4UPVA

Low x-ray dose structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
262
Chain Sequence
b'AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIFE-HYDROGENASE SMALL SUBUNIT
molecule tags Oxidoreductase
source organism Desulfovibrio fructosovorans
publication title Crystallographic studies of [NiFe]-hydrogenase mutants: towards consensus structures for the elusive unready oxidized states.
pubmed doi rcsb
total genus 81
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4upvA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4upvA02
1YRQA 4UQLA 1UBTS 5ADUS 5A4FS 1E3DA 1WULS 4UE2A 4UPVA 5JSYA 1YQ9A 4UEQA 4URHA 4KO3S 1UBRS 4UEWA 4KO2S 3ZE6A 1UBHS 4GD3Q 1WUKS 4KL8S 3RGWS 4UCQA 2WPNA 4KO1S 4UCWA 3AYZB 4UCXA 4UD2A 5JT1A 1WUHS 1WUJS 4OMFG 1H2AS 3ZE9A 3AYXB 4IUBS 4U9IS 4KN9S 1CC1S 4U9HS 2FRVA 3H3XA 4UQPA 3USES 3ZE7A 3ZEAA 1UBUS 1UBJS 4IUDS 3MYRA 4UE3S 5A4MS 4CI0B 1H2RS 1UBMS 1UBOS 1YQWA 4IUCS 5D51S 5A4IS 1UBLS 3CURA 3USCS 3CUSA 3UQYS 4KO4S 4UD6A 5JSKA 4C3OB 1FRFS 1FRVA 5JSHA 1WUIS 3ZE8A 5JRDS 1UBKS 4UPEA 4UE6A 4TTTS 5JSUA
chains in the Genus database with same CATH superfamily
4N7BA 1T8TA 4YASA 4A91A 2FPMA 4J4TA 2CXTA 4ZFNA 3BF8A 4FDUA 2FETA 5CBPA 1R8QA 2MSDB 2ODAA 4P6VF 1G4UR 3MWLA 3LZDA 2FPSA 2QAGC 1DJPA 5T6BA 2P69A 3PL1A 1E92A 4Y2GA 3QE4A 4ZA2A 4JLJA 1E1QA 3WNQA 2EW1A 4ZK2A 3AEKA 1DKUA 1E6EA 1OXBB 2CBGA 3DCIA 3C85A 4R9NA 4REQA 5DWVA 4X94A 1N6HA 1P72A 5ER9A 1ILWA 1V95A 3ONDA 1GZ3A 1X80B 5TX7A 1Z0UA 4YV1A 2AW5A 5TDHA 5F78A 5CFOA 5JDIA 3S2SA 3LE8A 2ATXA 2CYCA 2NV6A 3IE0A 4UHEA 4YMHA 1XX6A 1D7OA 1TD9A 3UWDA 3HB5X 4LJ9A 2WSYB 5D85A 2FVYA 3BD9A 3N2NA 3L8EA 3T3DA 5B1EA 1AH2A 4AKIA 3ISTA 1AZLA 2AV6A 1VHWA 1VKJA 4XWYA 3UYKA 1TGVA 4KAXA 1ATZA 2DVMA 3JWEA 4G36A 4NFYA 1ANKA 1OILA 4J7CA 3P9SA 4Y7DA 5FD8A 3ZTTA 3PI6A 4DNQA 2OFPA 2Y2VA 1OE0A 3AF3A 1GKKA 3V6LA 4C6RA 4NU6A 2JVIA 3DHEA 4DJ5X 1TUGA 1U0OC 5DHSA 1H22A 4MQ4A 1CT9A 3OJXA 1W44A 3FOFC 1JIUA 4LEIA 5E95A 3W1EA 2HQ1A 1Z62A 5KPDA 4BMYA 2WUFA 4DS3A 3WXMA 3O26A 4QGFA 3QKUA 3OOYA 4XW2A 4EG0A 2FP4A 3R9XA 3CH6A 2ONKA 4JB3A 1SVOA 3K20A 1EB8A 5AKJA 3EYAA 3UHOA 5KKNB 3ZTWA 1R6AA 1E9BA 1UDRA 2F4NA 2Q6TA 4DCCA 2IVZA 4S05A 3K8YA 4L73A 2WD8A 3ASUA 3A9TA 3R5HA 3MCTA 2GNOA 3OY2A 4Q3BA 4QIHA 1E5VA 1CQWA 1XCGB 3CV3A 1LGYA 3NCHA 4GBED 1U1IA 2YHSA 4B46A 2X2FA 4ZMBA 4B79A 3AVQA 3ZBUA 1VLVA 3V8MA 3QFHA 2Y1OA 1KFCB 1W94A 1XF1A 2AW3A 1DFHA 1GZVA 1XC7A 2DC1A 4R1UA 4R54A 1N9GB 3WIOA 2C1XA 2GF2A 1U7WA 3F6EX 3PEVA 2YVLA 4LOKA 4DUPA 2W4MA 2OSVA 5FX2A 2CV2A 4DMHA 4K1LA 3VO8A 4RENA 4MW2A 3E8XA 4E14A 4EPTA 1L7EA 1U0LA 2QPAA 3DBOB 3DMTA 4ZU1X 3RJ5A 5BVGA 5BN4B 4KR7A 3FYUA 2CLMB 3UOGA 4GM1A 4I3HA 1X7XA 4C3VA 4DLWA 1XKQA 4OH1A 2H1OA 2C03A 1BEZA 1ZD4A 2C4TA 4ON9A 2WPNA 1C9YA 3OKAA 2E6UX 1C30B 1P31A 1WU8A 1RDFA 1BROA 2H2FA 2ZK7A 3EE6A 4OJKA 1Z4JA 4D0LB 3B7GA 4HGYA 3USES 5AUNB 5CA1B 2QW8A 2WNIA 4A8JC 3KU4A 3QUCA 5HKLA 1NW8A 1QJCA 1P2BA 1LDEA 1PT8A 1TMKA 4FWBA 4B7UA 1WJGA 3ZV3A 1ZU4A 2Z3VA 1SRRA 2JJYA 4N0DA 3EH2A 3R3JA 4MULA 1HL3A 4PLHA 4UBMA 1ISMA 1M1NA 2BYTA 1FIUA 4LMAA 2PUGA 5GJBA 3CLRC 4MRNA 2XNHA 2VF2A 1RFGE 3MT0A 1KO4A 1T2EA 4GQAA 3CUWA 1H9CA 3GRUA 1GZ5A 1S01A 1M74A 1TZBA 1E2NA 2QJWA 1K66A 3E9ZA 1I30A 4M99A 1P4AA 5UKDA 1WMEA 1OD6A 4NK4A 2NNLD 3N2KB 1GR0A 5B1DA 4HSGA 4FMDF 3PUZA 4QUDA 4US2R 1UMBA 1CR4A 1NW5A 1P9WA 3DZFA 3SQMA 4KITB 4OHYA 4IH1A 3P9NA 1QS0B 1RRKA 4M4SA 2FJUA 2Z3ZA 3HP4A 1CDZA 4QULA 1K7YA 2YXDA 3RRZA 2EZUA 5A3SA 4ZEMA 4EJMA 1OI4A 1KDRA 3D4NA 1H0RA 2G5PA 1LSOA 3ZE8A 2OP1A 4J0IA 3LUHA 4MS4A 3H05A 3FBTA 2ZP1A 4HUQB 4LRXA 2B1JA 3OM0A 4E5PA 2CBXA 5PGMA 4B2PA 1UZNA 2DWQA 2XJ4A 3UK2A 4G26A 5F4BA 2CNOA 4O2BA 1MAVA 4N3NA 1YASA 1N1GA 3ZV5A 1HDRA 2N1MA 4MA5A 2C3PA 4LRWA 4OV6B 3K8ZA 1P3DA 4LHSA 1RE0A 2Y93A 4MUAA 5K0LA 1I2CA 4BU1A 4G89A 2VAWA 4FUTA 5DGTA 3OZIA 3UV3A 5ALNA 3F9RA 3RJZA 3ZWYA 2W2MA 3HR7A 2VBIA 2P6RA 3V2UA 3CF4A 2FSSA 3WQBA 5I5GA 3DKKA 5DCLA 3FNHA 1K6JA 2AGVA 5DRTA 4YIHA 2WJ6A 3G0GA 1BXRA 3VR3D 3VZBA 2X0RA 1VJRA 1W36B 1WE2A 4GUDA 4TYMA 2H4ZA 2QD5A 4RQUA 1CETA 1GSAA 2QRPA 4KQXA 3GROA 1T2NA 2Z8XA 1I51A 3BXPA 1UK6A 2Q1XA 4IS2A 4PGAA 1AKWA 1PZMA 3VZPA 2DUWA 3GFVA 4EFKA 4NBNA 1AZSC 1ZH6A 2ZB2A 2ZBPA 1XP8A 3R6WA 2PS3A 4R41A 3GRCA 2VJBA 2E2WA 3QFCA 1KO5A 5FPYA 1RPZA 4MUBA 3WZMA 3SYNA 4BZPA 4DNPA 1L1EA 3GI1A 1Q1GA 1XQXA 4Z0PA 3OAAA 3D0QA 1QTQA 4KYIB 3H9BA 5EN4A 1RHRA 3JRWA 5AXCA 3JASB 4CJXA 2I80A 5T4EA 1Q7TA 4NZMA 1CJCA 1UBEA 4WKGA 4D42A 1TB4A 2QYSA 1Z5NA 1QG6A 3DT8A 4NDAA 1RPTA 3H5IA 2OA0A 2YVUA 1IZ9A 4FBMA 2P2LA 3CLKA 4GQBA 3U2QA 4OVKA 4YRKA 3MHTA 3GLSA 1GEGA 3IPXA 4KNYA 3DB1A 2ID4A 1QIGA 2FQQA 4Q3OA 3RRYA 3W3ZB 3AW8A 2OC9A 3P9PA 4MQMA 4UATA 1CQIB 2D0IA 4GI3A 2WTNA 3RKUA 4QNNA 2J07A 2O14A 3A6FA 4I9GA 2PZMA 4LC0A 4MYSA 5BUZA 1K8XB 2XPCA 5L40A 2I4RA 2O8DB 3PUHA 4GQIA 2V3CC 3A27A 1PL7A 3T06B 2ZYDA 2DCMA 1F48A 1QO0A 3MGKA 3PFHA 5LMZA 4OJQA 5DM0A 3O38A 4EEKA 2JLRA 2FK7A 2Y1DA 3I39X 4OLJA 1AQNA 1Q3TA 3I01A 1KYXA 2MR5A 2QT9A 4ER5A 4DEVA 2JASA 4JUIA 5AICA 1STOA 4JYAB 1J8VA 1XTKA 3ZC3A 4TQGA 1UODA 1LX7A 1KO7A 4RVSA 1X8LA 3KFXA 4QAQA 4X7RA 4A5SA 1O2DA 2FWMX 2I0FA 2ZATA 4PN7A 1EIZA 3I9MA 2W6ZA 3CISA 4CGYA 5JNLA 3IUPA 2IYLD 1DKNA 3O7MA 1E66A 4LKOA 3WYGA 4WBNA 4F4HA 4MP8A 2X0EA 3WYBA 1IVSA 4MYDA 1D1SA 2W6JA 1R8XA 2FQWA 3PTLA 3K0CA 1DXOA 4A0SA 1IBLB 3LT4A 2OGUA 4X45A 4BKRA 4DM3A 4CLOA 2FB9A 1KP3A 3R3YA 1CUEA 4TTQA 3DFMA 2YL2A 1G66A 3ANSA 4KVAA 4AG3A 3R76A 2Q1YA 5K6AC 3RODA 1GG8A 4YCDA 1Y34E 1EVLA 2IEDA 3PUYA 4PAMA 4R2LA 4W6ZA 5K0TA 1Y7HA 4LJSA 2NUPA 2FV8A 1ZY2A 3QQ5A 3TOCA 2AJ8A 2PZKA 1U2GC 2QZJA 4UDYX 3VNSA 1OXMA 5B6JA 2GESA 2GSWA 3VKWA 2PTHA 4D6XA 4A1FA 5CXSA 4A36A 3BZUA 4UD2A 3KPUA 2H9AA 3T3MB 1MV8A 2VZEA 5EMNA 4NEQA 3TIVA 3TZQA 3TG8A 3OE7D 2X3UA 3RBZA 1MZPA 1XCOA 6REQB 3GBSA 3GLFA 1I6WA 1SWVA 3KTOA 4LJ8A 3FGPA 3VHLB 2PUTA 1GUBA 1F1JA 1BH6A 1DC5A 2QENA 4Z99A 5I9MA 7ABPA 3RTGA 1P74A 1JTFA 4PHCA 2Q7XA 5DTRA 3ST7A 2ZRBA 4RCVA 3TQHA 1E9CA 3U6BA 3RPEA 5DCUA 1F4LA 2YXNA 4M9QA 1ECCA 5E7IA 1GUZA 4C05A 2PNJA 3P26A 4Z1MD 2QTVA 1UPBA 5E9QA 1IN1A 4URHA 2FN4A 1R0RE 2X86A 1Y5NA 3VNAA 1Z22A 1N5JA 3DE6X 1XDUA 5G0VA 1AQJA 3A25A 3EWIA 2GVNA 1TCVA 1PHRA 3A4IA 1OBOA 4NMHA 4OMFG 2VJMA 5H02A 4D0NA 3AF6A 4HLNA 1G7TA 4YY3B 4LXIA 3T8YA 3ETDA 4BRSA 1Z7GA 2OXEA 1IC6A 1TQ2A 1YQQA 2JFQA 4Y1RB 2WZBA 3OIUA 1XTJA 1YR2A 2YHBA 3PQEA 4TXJA 4X1IB 5BVHB 1P7VA 2WJWA 3F90A 4UEOA 1MF7A 2C5FA 3USZA 1I5OA 2P7HA 4CDGA 1RJEA 4JJAA 1RHQA 2Y1LA 1DUVG 4LY6A 4LY9A 5DEOA 4AKTA 2C7RA 3AKYA 1HT3A 2IF2A 1V26A 2IU6A 2P2NA 3JQAA 3Q3EA 2GHQA 4LY0A 5BQXA 5CFMA 3GNQA 4POAA 3SP1A 4Y2RA 5FUWA 3OHSX 4BDTA 1YK1A 2O1WA 3BFXA 5EHXA 4H17A 1RSZA 3SYTA 1M0WA 1AKNA 1EQ2A 1SMKA 2IOHA 2QTGA 2JJ1A 3WK6A 3H4IA 3FMPB 1KXZA 4X54A 2DECA 4IUBS 4PZLA 3FVWA 3WFZA 3D2CA 4BEJA 3RASA 5J5VA 4KRYA 1R3UA 4WXEA 4R1OA 4RH1A 2QTWB 4ADSG 3ZBQA 4CG0A 3WQHA 1IFXA 4ZU6X 2V9ZA 2IXBA 3F98A 4LXYA 5AVOA 2FR0A 1TVKA 5JMPA 1I4EB 3RIHA 1CB0A 1BGVA 1FYVA 1Z4PX 4OREX 1JHZA 1P6QA 1T26A 5DW3A 3LBYA 2VK4A 1UPUA 1T0BA 1XT6A 4D8YA 4PGMA 2A1UB 2VJLA 3NBFA 4G2NA 4RZUA 4X41A 3WB0A 3CU5A 3PUKA 4R69A 4EK9A 1CPYA 1VE3A 2XQFA 4E3WA 3E1SA 3I28A 3ISVA 5FNVA 3QPDA 1U3UA 1PR2A 3D8UA 3MTIA 3GP5A 5H0IA 4CMCA 1P1RA 4FZVA 1FP2A 1GQFA 4Q7QA 5DGIA 4ZCMA 2F4VB 4CM9A 5AVYA 3E5HA 3R44A 3IPAA 3R3VA 1INLA 1E4YA 3GJ4A 1EWKA 4H1WA 1W1IA 3F97A 2SICE 4K2AA 5AVJA 3NO4A 4NH0A 3FPLA 1NMZA 3R5XA 2IYXA 4N03A 3VU1A 4QT4A 4MQEA 4ZVLA 3FW1A 3BXHA 5IDXA 3BDVA 2NPFA 7REQB 3CLSC 5TR9A 1MVOA 4E08A 4G67A 5HCIA 2G04A 4H6PA 1JU4A 3UC9A 3G59A 3KEFA 5TVKA 3VKVA 2EWVA 1J2YA 2D5BA 3LUDA 3VVBA 4NTZA 3HXQA 3P2IA 2H4JA 4OK5A 4HNGA 1CQIA 3VFDA 3KL4A 3KSRA 2D1TA 1FTWA 2BKUA 5AM0A 3E2IA 3FHCB 3RUIA 3TBHA 1Z36A 3NT4A 4ZO6A 3KD3A 2GXQA 2NWQA 2ZQ5A 3A3OA 1C81A 3DFIA 3SLGA 3UJ3X 2AOUB 2RHJA 4P86A 3WRWA 3QXJA 4LOAA 1II0A 4LNUA 5KVSA 1XWFA 3W3AA 2NUTA 3KHUA 2V97A 1CZNA 1XZDA 4YV7A 5K01A 2R6ZA 1C7IA 4X8HA 4WWHA 5JVDA 4XWGA 3EVBA 1U90A 2A92A 2PWPA 4YPOA 2YOHA 3VBCA 1NIJA 5FJIA 5DNYB 2XE8A 3KVRA 1XAGA 2EG5A 3DUFA 3JWHA 1JP7A 3C6ZA 3LWZA 4X3OA 3ROZA 5FEMA 5J5AA 4EJ2A 1KEKA 2VJKA 3TX6A 1WZ2A 1FOEB 4MJLA 5EXXA 4DLVA 5AK3A 3F7TA 1Y5IA 4CIBA 4XR9A 5SYNA 2OUIA 1OAOC 5EHIA 4FFPA 2L42A 4WK0B 5C7IO 2YHIB 4II2A 4TS3A 4BWGA 1USWA 1OFTA 3OCUA 3FTEA 2DAPA 4D6YA 1IQUA 3HDHA 4NEGA 3DZDA 1KS9A 3AJDA 1WDMA 2EKPA 4LDNA 1XDWA 1GIAA 1ZNYA 3BXEA 5HOQA 4PLTA 3WIBA 3B6JA 4GGMX 4IJMA 2P2GA 3OIFA 2GEJA 2QVXX 4IKPA 5LBIA 4ANFA 3QA9A 4M0FA 3NOOA 4M36A 3T34A 1Z73A 4ZTUB 3DMDA 2WHPB 3L3BA 5BSRA 4FT2A 1PUIA 2WUWE 4X66B 5DLEA 3ESYA 2HIAA 4U5QA 3UAYA 4FFBA 1V3TA 2CXXA 2YVQA 3O1IC 1ABFA 1UC9A 5EYPA 3ZX5A 3E4CA 1DPFA 1J2TA 3QWIA 3WKEA 1TT5B 2YCLA 3L4JA 1Z28A 3L0OA 3D5TA 3S5UA 4MVCA 5FBKA 3B9PA 4JJGA 4P58A 1JAIA 4DTIA 1V9CA 2G25A 4WGGA 4D02A 3FGZA 1E62A 1ODLA 5A71A 3KKLA 1DC6A 1FP4B 1UL1X 4AY2A 1NFFA 2W0SA 2W6OA 1YB6A 3LQ1A 2NADA 1ZJJA 4IV8A 3SSMA 2H2AA 2XJ9A 2WMOB 3IQFA 4NDZA 1KDVA 4OAQA 2ZQZA 4EGQA 1CYEA 4Q48A 1DBWA 1RHJA 1VGQA 4WACA 2B69A 3TBKA 4B85A 1GLVA 2ES4A 2R4TA 2ZRMA 4AKSA 3CRRA 4LCBA 1ISGA 1GYQA 2X3FA 4DCSA 5I45A 5K0JA 2HT1A 4GXNA 3O8DA 1DGQA 4ISBA 1P1IA 3Q15C 3C39A 1SOUA 3UMVA 4JQOA 1CDEA 1JQAA 1CFJA 1SU7A 2Q3HA 1RQGA 1NVMB 1L7VC 3FDJA 4AD8A 3B8EA 5CUQA 4F9EA 2X5NA 5FA8A 2O59A 2CWWA 4RQBA 1D8AA 2HMTA 4QEZA 1EPUA 4YMWA 3PLNA 4WADA 3KKQA 2DRIA 2JC3A 2YRWA 1UP4A 2C2WA 2P6NA 3KQMA 4D4LA 3TI9A 3KSBC 1T2AA 1PJ4A 3L0CA 3FIUA 4OM7A 2VSQA 5JCJA 4YPVA 1L3CA 5MFZA 3CG0A 2PUFA 1GUAA 4FC7A 2D1FA 5BSWA 4PCUA 1H4VB 4ZHQF 2AJLI 1LRLA 1DAMA 1YE5A 2ECPA 2EKLA 3A4VA 4FYKA 4L5AA 1CZOA 2HI0A 1ZIPA 1XBTA 1JSXA 4J16A 4PYQA 3TLEA 2AEEA 2OWDA 3GH3A 3NAZA 16PKA 4M83A 3QVTA 1M0TA 3G8AA 1L7QA 2CLEB 2PYZA 3H6KA 2B8TA 3WY9A 3VAZA 1JV2B 3FYCA 2M32A 1ZKMA 1K97A 1T1IA 2DR3A 3FPSA 3PHHA 4X9XA 4LF8B 3HC7A 1FVXA 1XRRA 3WSWA 5DWQA 1IH8A 5LLDA 3ENZA 4OSPA 3MLEA 4ZO8A 3TAHA 3OO0A 4Q93A 4AROA 4ZV4A 3VYWA 3ZWOA 1QVWA 1GCOA 5BNFA 2FPPA 1EXMA 2JJMA 1A8PA 2RB4A 4P81A 3ZXSA 4BJ1A 3OQMA 2VT7A 3E9MA 4G5SA 3R3UA 5KDDA 1Z8DA 4L4YA 2BMWA 3H9JA 2OV3A 1N7IA 3LL7A 5DEIA 2JIDA 2ZYSA 4Y9UA 2RGYA 4EW2A 2UYQA 3JVUA 3PQ4A 3RQIA 2CF6A 1L8AA 3ICCA 1I6MA 2I34A 5DHQA 5KS2A 2I2CA 2PYDA 4FHZA 4TZTA 1O54A 3QLVC 2QIOA 1RAAA 2JI8A 1SUEA 4PO9A 2VPTA 5E6RB 2VZLA 3V97A 4HWTA 4LBWA 2B36A 5T57A 3AQIA 4FGUA 3TFOA 3TF5A 4L5YA 4HLUA 3SQDA 5AESA 1UKEA 4FXOA 5FUMA 4HQLA 1TFRA 3SZ3A 4DLPA 2FW9A 5HBGA 2CD7A 1OSNA 5J4YA 2OD2A 4YMVA 3HJHA 3DO6A 4JGIA 3FHLA 1LI5A 4TT8A 4HBGA 4ZT7A 3RSFA 4AMBA 5CXQA 3KQKA 1CYDA 1K0UA 1OLUA 1H4TA 3INTA 4Q24A 1M6YA 1SG0A 3GLKA 4MYUA 5TARA 3R8CA 1JAYA 1SQFA 2I22A 3KUXA 1ZUHA 4XM1A 4MW9A 2W83A 5JI2E 3W1VA 3JQBA 2JLYA 1Z35A 2G28A 4ND5A 4JLWA 4BLQA 4XWWA 3QZUA 4XQ9A 3QVWA 3BXOA 3EXHA 2PKYX 1B0ZA 3TINA 2R00A 1VCMA 1NKSA 3KUKA 3RFVA 1KC1A 2RE8A 3B13B 4OQLA 4TM8A 1PLJA 3TCNA 1QP0A 1Z15A 2W90A 5U4XA 3O90A 5HZMA 2RBGA 2HA5A 3GFBA 1P91A 3O93A 5C5EA 3LKBA 2PANA 1H2XA 2R6AA 1JEQB 3FZGA 4NOMA 1YR6A 1QFSA 1U8FO 5AW4A 5J2TB 1U7UA 4U1RA 3MTDA 3UWMA 3DF9A 4QG3A 1FTYA 2DGDA 2NU6A 3D3KA 4NYJQ 3VU9A 4OQQA 3DZBA 1G0NA 3Q3JB 2H1SA 3C41J 5HCUA 4ZEVA 4BHTA 2BDTA 4M0MA 1KJQA 2VDJA 3V33A 1E8DA 3OIGA 5THKA 1XWIA 4RGBA 1J56A 2A6PA 5EP3A 3F1LA 3KAKA 5F2NA 4A5OA 4PNHA 5L7TA 3R7WA 1KR5A 4MMXB 3THYB 1QYCA 4R9VA 1EAYA 3WC4A 3TKYA 4F97A 4E03A 1JDTA 1M8GA 1TO2E 1VL5A 1USVA 2OO3A 2ZUDA 3AUFA 3GAFA 1PR5A 5CIQA 1HNWB 5DTJA 2DKOA 3CRMA 2CXSA 2IY9A 2P6OA 3WV5A 4B8YA 3HYNA 2OCPA 4ND6A 4ZOLA 4UQOA 4ZVMA 3ESZA 3NT2A 1REQA 3OZCA 1IDOA 3GLHE 3OEHD 5TGZA 4F7WA 4DR6B 1Z2CA 3LHDA 1HDCA 2XKAA 1NVVQ 1TM7E 4MWDA 4MP3A 2ZFUA 1M3SA 5K8VA 2JGAA 3T61A 4MCJA 1ECPA 2AYYA 2WQZA 4FQ7A 3PUIA 4YRRA 3DV2A 3H1EA 2HU8A 3EEOA 3MFYA 4JDUA 2HK9A 4KIJA 3NYRA 4ZALA 3AOGA 1CTQA 3MSCA 1H0SA 1OFHA 4PRYA 3L1VA 5C5CA 1G8SA 3G13A 4W5NA 3MINA 1PV2A 3L5KA 4UUQA 1S2NA 1E5XA 1EFRD 4M76B 4LPKA 1UM9B 3PX3A 1GQ2A 4OU4A 3MXOA 1QMPA 2ZUFA 1Y1RA 3PWZA 1YGYA 2J33A 3PHCA 4NS1A 4LY3A 4MQ5A 4X3CA 3CIFA 5IM4A 1DFGA 3TTTA 3PDJA 4X20B 3R0IA 2GJ8A 1I80A 1Q7EA 4DCMA 2QS9A 3P20A 2EERA 5AKHA 1UKYA 1XJWA 2NZYA 3L7DA 2X9QA 2ACEA 2CUNA 5K3BA 1U80A 1JPVA 2WHEA 1XJ5A 4ZMRA 2GTHA 4Y6OA 3ZZMA 3PVSA 2ZM5A 4YQFA 4FEEA 3OIVA 4KP7A 2XBMA 2QD4A 3ILYA 4WLVA 2DB3A 3G2NA 3QLEA 1UXHA 3DOHA 2HPHA 2JGLA 4D45A 4UREA 4MLZA 2N3ZA 5FUXA 1T10A 4IDNA 1BXZA 5CLQA 5F76A 5TNXA 1L5GB 2O8FB 5T6MA 4CCYA 5KVQA 3KYDB 4GBGA 3RC8A 5SZKB 5HKKA 4AUMA 3ZJVA 1C4WA 1A1SA 1K9VF 1ZJ4A 2C1ZA 3EIEA 3V6MA 2ERYA 3EEFA 2PZ8A 3WADA 1K63A 1NJGA 1UDXA 2P1DA 2ZRCA 3Q7EA 4QRIA 5B6PA 3BE5A 1QDUA 3IQDB 4D4GA 2JGJA 3W90A 3LV8A 4G09A 4IO0A 5DNEA 4ZGGA 3GA7A 4JI7B 1IRIA 2HNAA 2KBFA 3PR2B 3C0KA 4B3XA 4OHUA 2HYIC 2E1RA 1XU4A 2DYKA 5JYBA 4D44A 2GKGA 1AG9A 1ABBA 1RKVA 3D1JA 3IDAA 5B2EA 4ZMSA 3ZBTA 5JD4A 2P6MA 3AP1A 4KE7A 4WFJA 2WDZA 3DOCA 3P9CA 3ZYZA 5FDFA 1KI9A 4OXNA 1IN6A 3IPCA 4JK3A 3RRMA 1BHSA 4H7PA 1DZ3A 3EF0A 4R6XA 3H7AA 3GU3A 4WZBE 3CX3A 4LHWA 5DLDA 5A9TA 2XOKD 4YUAA 3HO6A 2BEJA 3GEPA 1NYQA 4I19A 2PH3A 5C9ZA 2X8JA 3PKZA 3FUXA 4MR7B 3W34A 3ZCVA 3B7PA 1EHIA 1O95D 2O3QA 2VNHA 4LECA 1IY9A 1DCTA 3ER6A 5FBZA 1QANA 2HJGA 2PO5A 2SNIE 2EJTA 1SULA 5HRUA 1MO6A 2BZGA 3MGGA 2BE7A 4RDXA 3JD0A 4D99A 2P11A 1LPPA 1JKXA 1H1TA 3KP1A 3Q0EA 2WWGA 3FHOA 4MB2A 4NG5A 4ZCSA 1NC3A 4Y2VA 4U39A 4HEQA 1C4XA 2WM3A 2WR8A 1W4CA 4IMPA 3JD2A 1Q0UA 5DGHA 3KKKA 3QPVA 2IZ0A 4XYBA 4I8IA 4R83A 1ZPDA 3PI7A 3OQVA 3AKCA 1DCMA 2E89A 4G1VA 4QGBA 4KQHA 5GJVC 5A5DA 4RVCA 1TOAA 3AESA 3CPEA 3ELUA 5G4KA 1W5SA 4D9NA 4MQ6A 1Y4ZA 2ZR0A 4B9AA 2Q6KA 4B6FA 4GLLA 1NDUA 4YP7A 5F23A 3PWTA 1LNSA 1ZZGA 3REFA 3WL8A 4B3IA 3IE1A 4Z49A 3Q8KA 4QVKA 5EVCA 5I7WA 5JV5A 1TO1E 4MI3A 2CT8A 1U11A 2PUJA 2C2XA 4RPIA 3BGIA 4XWKA 4GL4A 4QJIA 4KR3A 4YRBA 3EG5A 2BBTA 1EK6A 2OPBA 4HC4A 2AUMA 1CUXA 4Q1AA 1RRGA 3K5HA 4CR8A 4KXXA 4ZQCB 4BNNA 1W7AA 1ORWA 2I54A 1T3ZA 3G2IA 4MKZA 2VP5A 1DJMA 2AEMA 5C53B 1C80A 2GZAA 3GD5A 4PYMA 1HNNA 2Y0CA 1JIIA 1NUPA 2BGMA 221PA 1G21A 4GF5A 3N2GA 4P33A 2QN2A 2H65A 4FFOA 4R7GA 3V8EA 1JHPA 3FHJA 3U6KA 4ARCA 3RGGA 4G5OA 3OH8A 3D6NB 1MQ8B 3M6VA 2O23A 1P1KA 1RADA 1Q6ZA 1N2CA 4UPVA 3JARA 4QLOA 2PH1A 1JH9A 4GWLA 1A0OA 3UWOA 4IQFA 3I3SR 1JWAB 1E6CA 1X8KA 5AJYA 4BFSA 3ETJA 4LCJA 5JPIA 1CHDA 1DTWB 2CKMA 3SKXA 4E31A 1QVVA 1CFZA 2REOA 4RTQA 1NV9A 1H94A 3NHPA 4TKZA 5JWHA 3RS3A 3SOPA 1I7QB 1NMSA 1QGZA 1FDWA 1Z0AA 2I76A 3ZKWA 4C6TA 4ZZ0A 5KPJA 4JKIA 3VAAA 4Q9JA 3LRPA 5AD1A 2AD1A 1KIMA 2QN6A 3G82C 3TTXA 1GO2A 4GXQA 3M6UA 1ILEA 5LP6F 3L84A 1RAIA 3IO3A 3Q41A 3QTTA 1WHTA 5CAEA 3GUYA 5GJCA 5JNUA 2HCRA 1Y3CE 4JUDX 2CDAA 3DDSA 4K9RA 1WUYA 2GD1O 1GU0A 4QLBA 2AEFA 1WMFA 3N53A 1DI0A 3M83A 1PFVA 1Z4KA 2IUSA 1DWPA 2CXPA 2IGTA 2WE7A 3CNQS 5HP4A 3QU2A 4MMZB 5SZIA 3K1AB 5TQ2B 4CV0A 3Q8LA 1DQPA 2A4MA 2G0NA 2GZHA 1RLIA 2Q9AA 2ZYRA 5HF6A 1QX4A 2XGGA 4ZYTA 4G6ZA 1NOJA 1Y8CA 4D9MA 4WKOA 1OT3A 4EZEA 4E09A 4C7KA 3EPKA 1VYUA 3WX0A 1E4EB 3HVUA 3KK0A 1Z08A 4YAIA 2WSSA 3KUDA 3AINA 4BRWA 1BMFD 4PWYA 2GEBA 4MNTA 4XOIA 1NPDA 3ZIAD 1K3FA 1E98A 2HMYB 2YWJA 1JG3A 1L7NA 3F5MA 3F4BA 3NBKA 3L7NA 1MXHA 2XECA 4JU9A 4ZT4A 2ORED 3DL2A 1XLWA 1YDMA 3QYAA 2QE6A 3OFJA 3N5KA 2YFKA 2P91A 5BW6B 5K09A 5FYDA 1NPYA 2XHEA 3OE1A 4X8MA 2PV7A 1CEXA 4LJ7A 3QVUA 4OL9A 5LLSA 2IITA 4F3KA 2P5SA 4OYHA 2RGBA 3HP1A 5BT8A 5ICEA 4H1VA 3GN2A 1RQPA 1E2KA 1TJ5A 2P1RA 3QU9A 3V2HA 3OQNA 2DF8A 4PSUA 1P75A 4EF5A 1KWGA 3COYA 1GGNA 1XU9A 4MRPA 2PSFA 1FNNA 4PSDA 4R2MA 4AAYA 3RNOA 1FLDA 3E7XA 3GRKA 4K9PA 1HKUA 1ADCA 1EVYA 3MRXA 5BSUA 3ZCSA 1AQ6A 1V16A 2HWYA 3GA5A 5E9AA 2GYYA 1E8MA 5AVRA 1L7PA 3RLIA 1PWXA 5JC1A 4GH5A 1XVTA 1WW8A 2GFHA 1W5FA 1BO6A 2QSZA 3DPIA 3L05A 2HIGA 3BL8A 5CM2Z 5AOAA 3LPMA 4GVLA 3R3WA 4KACA 1IPEA 5EMHA 1M5TA 1LK7A 2B1QA 3K71B 2BEVB 1UXJA 1RRCA 2CNWA 1H5NA 1B15A 1MN6A 2YYSA 4DRYA 5AW6A 2ZVPX 3C5EA 2J6CA 3FTQA 3TXXA 4DFDA 1GNQA 3LC1O 3OQ6A 3PA6A 4O2BF 1CZKA 1NR7A 1DMRA 1RABA 3AV0B 5EWJA 5TEVA 4NIMA 4FSHA 3SF8B 3HQ4O 4ZK6A 2GB4A 4OAPA 4QTZA 3ER8A 3O4HA 4N41A 4V0ME 1I3CA 4NV1A 2XMSA 1JFSA 3WGJA 2XT9A 1XNQB 3C48A 3LPDA 1Z2DA 2BSQA 1JMKC 3BRWA 3P71T 3O8CA 3MXTA 1LCIA 1IOLA 2B4QA 1JQDA 1DG1G 2AH5A 2OGWA 2R8RA 3IQEA 4H7FA 4DGSA 3NIWA 4ZJPA 3HVRA 4K03A 1VI5A 4KZPA 1MIHA 1EJ6A 2H54A 3AFHA 5LXTA 1FX1A 3HM9A 1H6AA 3TD9A 3EVGA 4PQEA 1BWQA 2A4KA 3DW1X 1KVSA 2GSDA 3Q4GA 3WWCA 2NO7A 1GA1A 4N4AA 3QIAA 1I4LD 1KJJA 1YBVA 5HG0A 4F93B 4QAJA 4HZUA 3KD2A 4KKXB 2WT4A 1U8YA 3C74A 4NCBA 5EXPA 2V4MA 1RWBA 1D8TA 2QG9A 4ZVUA 3SMQA 3ZS8A 2DY1A 4FHEA 4BKOA 1DOAA 2JAXA 1T2FA 1JLRA 1TAQA 4BEBA 4EGAA 1JSLA 1JHVA 5K51A 5KYWB 4IXMA 4L74A 1CY1A 1G5FA 2RAFA 2VDQB 3PXDA 4MUGA 2J67A 3RT7A 4A8PA 4CLOB 2AC4A 4M0KA 5D7BA 3FJ1A 4TLEA 3MOIA 4AJHA 3OOSA 1UM8A 1XEFA 2EP5A 2X76A 3TXYA 2JI4A 3EUWA 4GRAA 4KXUA 3ZLUA 2VVTA 4NV0A 2X7XA 2G1PA 3A4LA 1M6HA 1KBZA 4NJEB 1R27A 2V65A 1X80A 4UVIA 4MOWA 3WZ2A 2EZ4A 3TLBA 2D8MA 2OGSA 2Z4SA 5KNCH 3HCEA 3D4PA 4D9CA 4HNQA 1US8B 1JFRA 1DRKA 4OHBA 3ZXXA 3JV7A 1G6HA 2C2MA 3F3YA 1VKRA 2GK6A 5AKGA 3WWDA 2O06A 2YWCA 2WAAA 5JMWA 1U9IA 2ZKIA 2XCSB 5DV9A 4DQUA 5A02A 2XSZA 4ZOLF 3GCGA 3UENA 3EULA 1TTQB 2GNAA 1M2JA 1NXTA 4PCLA 3VPHA 4O4LB 1MPTA 4O3MA 1K8RA 2X7HA 4HATA 3VZSA 2WB2A 2KMLA 1KEWA 3ECSA 3NV9A 1YBFA 2ZE8A 3OEYA 4UE3S 2CXRA 3U4AA 1UMKA 5JRZA 3AP3A 3QMWA 2H4FA 2F1KA 2WU0A 4P2BA 3CRVA 5LUBA 1ZCFA 2KLBA 3MEQA 4C4YA 4HAUA 4DYVA 4HYTA 1J8YF 2EATA 4G0WA 2WKQA 1QFXA 5CYFA 4WXRA 4ZZ2A 3PNBA 4QX6A 4JI0B 4HWGA 1G55A 2EZTA 3DFFA 4URWR 2JFUA 4NXMB 1A9PA 5WRFA 1M33A 121PA 5BN1A 1GPJA 3BD7A 2PMFA 4ND7A 3EXAA 2O5VA 3TUJC 1KNXA 3W0LB 3C3MA 2A2ZA 1LF5A 5IJWA 1BRTA 1X9GA 2ZS7A 3GGPA 5BVHA 1CR0A 4V02A 2K7ZA 4K88A 5FLKA 3G79A 3Q8WA 1AQUA 4XX0B 4QXMA 5AOVA 5KTKA 3NM6B 3ON5A 4QNRA 1EIWA 4ZQIA 4L0CA 1QYIA 4CODB 2QGNA 2TMDA 5LQRA 3FYDA 2H7XA 3GL9A 2BSXA 5F2OA 4DSTA 1MORA 2B8JA 3U3ZA 2A57A 4EMTA 5EWLA 3ZJTA 4RKQA 3RVBA 1MU0A 3C5VA 4JGGA 3GLIA 2YWFA 1Y7PA 3UJ8A 2YJZA 2BC9A 3VPFA 2B98A 1UKBA 2HSGA 4NBRA 1O87A 4C5BA 1EFPB 2BN4A 1MGOA 4DKJA 4IIGA 1ID1A 4W1RA 2EFEB 3GPCA 3HCRA 1WZIA 1FMFA 7MHTA 1HE8B 1PFKA 4PHHA 3IC5A 4EITA 1M1YB 1B8PA 1GQRA 3BE4A 5JS8A 2EL9A 4LVOA 2XTNA 2NV2B 4IX9A 5F3RA 1EP1B 3MUFA 4JOBA 4NOLA 3D8TA 3S28A 1MB0A 2PL1A 3V7NA 4ZI2A 3PC8C 2JGDA 4FNGA 1B26A 3M70A 5BQFA 1WUIS 1KQFA 5JSUA 1Z6GA 3JAMA 3TW0A 1K7CA 4JASB 5F9MA 3LWNA 1V45E 2EX4A 3ONNA 3VSCA 4I4NA 1EDBA 3VQTA 5HXAA 3IQGX 1RM5A 2ANBA 3FOCA 1UM9A 3FSJX 3NETA 1UT6A 3LF2A 5D87A 2BGNA 1P1FA 3C4VA 1Y48E 3E27A 4JQSA 1VMEA 1X7ZA 4IHAA 3L7LA 2D7DA 4WFQA 3SDZA 3GFGA 4X63A 3ZNOA 4IDFA 4P5EA 3ER9A 2XMRA 4I1SA 4RKWA 3PEWA 1H8EA 3OSUA 1P0FA 4EG6A 3MCWA 4R2KA 1VC2A 3DKIA 1T6ZA 4IOKA 1P62B 1VLQA 2QRNA 1V5EA 3HKEA 4BATA 1Z06A 1MNQA 4TOIA 4QO7A 4MVXA 5JVDB 1E0AA 1UBFA 3M5CA 4JYMA 2ZIWB 5G02A 1UMDB 2A84A 4F2DA 3U1BA 4DABA 3KDPA 1GNTA 3PQ5A 1PVVA 2H85A 2QVGA 4IDDA 3R9IA 2EZ9A 5BSFA 3I5XA 3QEKA 3UTCA 1LSUA 1S4QA 5AMXA 3UKDA 2E18A 3PXXA 1Y6FA 1DEXA 5EXDA 1KF0A 4FKBA 4GZMA 2RK3A 3IHKA 4A4DA 4EO9A 1DBSA 1SCKA 3AM3A 3QOFA 1QCZA 2BEWB 5JRJA 3V7FA 4U2EA 1RNLA 3HEBA 1OXKB 4EHAA 3WS7A 3DAOA 1RI5A 2UZIR 4O4IF 2G17A 4DG8A 2C8VA 2YIDA 1NUHA 1WV0A 4TWBA 4B6RA 1GA6A 1NYRA 1JHYA 3BTOA 3IJPA 4I1IA 5H3CA 1OI2A 1XRJA 3RYFB 1JBKA 1KMMA 3X43A 1N33B 1S8NA 4HWKA 4KQJA 2QTMA 1QVRA 3KU1A 3U0BA 1V1RB 3ITDA 1K75A 3LY7A 2BTQA 2PMCA 1V2HE 4NBKA 2V03A 1OQAA 4RZXA 2ZUSA 4DGQA 2Q2VA 5I4CA 2HRCA 2QE7D 1J0AA 3GUCA 5REQB 2J0VA 1D0SA 4B82A 5FBWB 1EI9A 5BQPA 4AI6A 1QX3A 3C7AA 1J5XA 4WKNA 3M9LA 3SKVA 1T0PA 3OTOB 3DUFB 4DC9A 3LWDA 4B35A 1CJUC 2ECQA 2VH5R 1PQYA 2W5UA 2I6GA 4M22A 2E82A 3OT1A 4DCNA 2HF8A 5C5IA 1W88B 1RVV1 3EF1A 4OJMX 1BQ3A 5EUQB 3TD2A 2XVYA 3ZHBA 4AP5A 2AN1A 1JKIA 3G17A 5AQ1A 5LQCA 5FADA 4KIUA 2Y9PB 1PT6A 4LDPA 3KTDA 4AUKA 5BMOA 2WUEA 4H1UA 2WA2A 4N3AA 2W70A 2FMTA 4AK9A 3DVQX 2J6BA 2CLHB 3QUSA 4L0QA 1G9TA 1I32A 3NFRA 4CKCB 1NX6A 3RFTA 2CHEA 2HFKA 5KJFA 3LDHA 3QW2A 2HQRA 2I6XA 5JQWA 2GDJA 4LYEA 2NSYA 1VYHA 2YJGA 2PBFA 1NT2A 2KE5A 3KKOA 4RYDA 2WWFA 4CM8A 1XIVA 3OF5A 4HB3A 5COQA 3TZHA 1P29A 2W2VA 3PXAA 2ZUEA 2P68A 1DJOA 5K3CA 4C5AA 5DOVA 1H69A 4BFTA 4OMCA 4MINA 4TYPA 3VNUA 1HYQA 3LP6A 4FGWA 3FWNA 4NCHA 2VDLB 1SC1A 4IIJF 3BL6A 1DT3A 3RFCA 4F38A 1N57A 4UVEA 2LKDA 3DC2A 4BX8A 4RH0A 1J8MF 3KOYA 1MBZA 3C1AA 4PG5A 1HI9A 1RPJA 4WX2B 1XXHA 2I29A 4AMYA 1BE8A 2FEOA 3L9XA 4A2PA 2UZ0A 1JG4A 3ZI4A 5C8YF 1AQLA 4HVAA 4S1OA 4MKHA 4XX0A 1R12A 2LTAA 3C6YA 5DLYA 1FP1D 5I7OA 1LBTA 3V1NA 1XF9A 1SM4A 2B2CA 1ZRHA 3EF3A 1WCYA 5C7YA 1E0JA 1M2VA 1L1RA 1WXHA 4EECA 1II8B 3H1GA 4DMMA 2DFDA 3A6KA 2QM7A 1KMHA 4EHIA 4DSZA 2CLDX 3EUAA 3MJSA 1GTMA 4ZI5A 1IDN1 1UDCA 3VTKA 3KE8A 2HWXA 3R9KA 4CLHA 1TZCA 5AKKA 2I2BA 1P9LA 2JEOA 3ISJA 5A5VA 5B7PA 3THXA 1M1XB 1FEZA 4YP6A 3C3CA 3OPVA 3GJ8A 1HDGO 4NYMQ 4X6LA 1X8JA 3K5PA 2Q28A 3MD9A 3CCBA 4UHCA 3HJGA 2Z04A 3K1ZA 2R7KA 4YRLA 5EZYB 3RRNA 2IFTA 2DP4E 4IXWA 1TEHA 3HWWA 3WV4A 3N2YA 1YFJA 4X5OA 4FYMA 4MVJI 4TN1A 4YO7A 5HZGA 2Q2OA 4H31A 2A0UA 4M0CA 1TJPB 4WBSA 4IIXA 1JB9A 1XWWA 1VIAA 1PF7E 3GP8A 2EWMA 1EUQA 1BMFA 1AN0A 1N36B 5KDLA 3IO5A 3GA0A 2OZEA 3AEZA 5D3QA 1CP3A 2A3RA 2NACA 2DY0A 2IIVA 2GM5A 2XCUA 1ZD3A 2YFHA 4BVAA 5KWJA 3AJ8A 4B5LA 3VTAA 1ODSA 1E4EA 2FRXA 4G5FA 1IBKB 1JQJC 4B87A 1P77A 1T5HX 1NVKA 3TW8B 3UJ7A 4X92A 4N5NA 5E7JA 4G9GA 4AG5A 3SZUA 5FWYB 4EHJA 3IXMA 2O54A 5HRCA 4UQPA 1E0SA 3ZLJA 5F77A 3B3GA 3S2EA 4BNDB 1M0EA 2IZ5A 3FH0A 3Q7PA 4DLUA 2QGFA 4M7OA 4Q6WA 4QECA 4XD2A 4ZAWA 2V9CA 2O8CA 1AUXA 4UU1A 1MR3F 5CRIA 1F6WA 2FFHA 2X23A 4NMWA 2W2TA 3QF4B 3JZFA 2COKA 1Z0IA 3K5WA 3OLXA 1AQYA 2CDBA 4L8FA 4CUKA 3UQZA 2ZANA 2ZYUX 3FMOB 4TTTS 4G0QA 1L7XA 1C30A 2NZXA 4EA7A 1WCV1 2GZMA 1YQ9A 2JW5A 2PRKA 2IXEA 1OH7A 4B8WA 3TUZC 2GCIA 5DK4A 1Y9AA 4BEWA 1ODKA 4Y6PA 1JGTA 4AECA 1ZUNA 2NXJA 2ID8A 2Q6LA 4J3FA 3HADA 3E35A 4GKAA 3D43A 1DIGA 4Y2YA 1RXEA 3BJEA 3EZ6A 2RKOA 1UFVA 3M5PA 4JGBA 2YQZA 2I33A 4CL8A 1NI5A 2OYRA 3H9CA 5CJ2A 5HCNA 3SX2A 5ALEA 4HXYA 3DONA 5EHGA 1ES9A 1QGED 4QQNA 2W00A 4QXQA 3TVYA 2QQEA 3UAWA 4ZYXA 2C3MA 5AM2A 4CMEA 4OGGA 2BI4A 1HRDA 4R51A 1E7MA 1YKGA 5DNUA 3HYRA 4C07A 2BCJQ 1ZITA 2QQGA 1J2EA 1XCLA 2I4MA 2OQIA 3I73A 3TZ6A 2WAYA 4BGIA 1AO3A 1E3WB 1H42A 1W0KA 3GBVA 3GG2A 4FR5A 4UULA 4B84A 1TRHA 3O4GA 4O1HA 4TKVB 1THTA 4AS1A 1JVNA 5DMHA 3OLYA 4J4HA 1S2LA 5IABA 2DFPA 3CT6A 4HB2A 1OFVA 4JC5A 3HA5A 3P94A 2BEVA 4R9UC 3I0ZA 3AYXB 4GX0A 1AS0A 4DE5A 1H2BA 5D01A 1XD8A 2EXXA 2HM7A 2OV2A 2XKBA 4BRUA 3HK2A 1SUBA 3P5SA 4J0HA 4K0RA 1I10A 4HGNA 3UAGA 4KDEA 3ECAA 3AUUA 4L6AA 1PGNA 2VJCA 5LXTB 1JPJA 4P4UA 4CQNA 1PG2A 2GYVA 3HKBA 4IYJA 5EGSA 4EKEA 2G5GX 3GJXC 2N47A 2WVHA 4K2HA 4LQDA 2OXTA 3S1AB 4WEOA 2NT4A 3MWDA 1ZH8A 1P7ZA 2HJRA 2XGMA 5A5FA 5CXUA 1VSBA 1IBMB 4QPNA 1P1JA 4WKCA 4ARAA 1BCRB 1E79D 3OJEA 4BL5A 3C7CB 1RRPA 4F6CA 3KLBA 4HN9A 3LQ2A 3GT7A 1PSWA 3G7UA 1C0IA 4PPFA 4Q1EA 1O1YA 3HNOA 4Q9DA 2I6UA 2Y1WA 5DTEA 3ADCA 3GLGA 1ESDA 5DB4A 3V1KA 3AM5A 4ITVA 3UANA 3DL4A 2IHBA 3NFYA 1EUCA 2WBLC 4UKDA 1NR1A 5D2CA 3TVTA 5FORA 2C58A 2JHAA 2Y68A 3D6VA 4J0GA 1IM2A 4JHXA 2QTTA 1BDHA 1TKRA 4BMZA 5ARCA 4LOJA 4Q7MB 3BGVA 1D04A 3GG9A 4B6EA 3M5DA 1F8FA 4N01A 3ZNNA 4ER7A 2IH5A 3O95A 3PJEA 4NNPA 3Q7QA 1OYVA 1XTVA 5BRJA 4F3NA 1PK8A 4TQ9A 3LVRE 5IAKA 1S1MA 3ICWA 1CY2A 1WM1A 2OV6A 4ZCIA 1QLWA 3I12A 3U3XA 2GD6A 5KX5F 2H92A 1S3GA 1CS4C 4HFMA 5JXGA 4CN9A 1ORVA 3UB4A 4BQQA 3QKRA 4F71A 1WXDA 3P1JA 4KO4S 2IYEA 5LQNA 3I2JA 4YCJA 3J81k 4ALLA 3GFTA 3AESB 3EGEA 1A5ZA 3L9WA 1UPCA 1XHEA 1COWA 2ZWPA 4YWJA 1ARZA 2VDRB 3QNUA 3JQ8B 3IQHX 4JJ4A 4FOTA 5CVUA 4E2YA 1AA6A 1VCOA 3TFQA 2ZRDA 4F45A 2OCLA 3UK1A 1F8GA 4CFZA 1EFUA 2AFIA 3ZZNA 5DCWA 4MGIR 4AJ1A 2FX2A 4U9HS 3S2FA 4BQNA 1QNFA 1T36B 2L69A 3CEJA 2BISA 2PM8A 3B3AA 2FU5C 5IU6A 4EMUA 4KXYA 3O47A 2AFRA 4QYWA 3ZGNA 4FM9A 5DP2A 5ALXA 4CZ2A 1JZSA 3GJ3A 5JQGB 3DMHA 1E7QA 1R0YA 3O8OA 1YNSA 4B4WA 3GFQA 4QUAA 2PFKA 3Q6IA 3V1TC 3QE9Y 3MILA 2RGUA 1KL7A 2NU7A 3EQ6A 2VSOA 4PYKA 4ZVOA 1NT4A 1DAKA 4G5XA 3UMBA 3LXUX 3WGQA 1GCUA 2QP9X 1RACA 4DDVA 3FFAA 1EQAA 4JBIA 4BB0A 2W4QA 3PUWA 1LSSA 3IV7A 4L2IB 4AYXA 4DPMA 3TB6A 4TTIA 5A7FA 4YRAA 5L6MB 4RK6A 2PGNA 2VTVA 2DFTA 5DXAA 5BN5B 3G2PA 2ZI4A 3P9QA 5A4AA 5BMVB 1JA0A 2JI7A 2HA7A 4YT4A 1CVRA 1G21E 3D6MA 3HVIA 4KMRA 1CF4A 1DEHA 1XVIA 2C97A 2QX6A 3E9YA 3GRAA 2C4MA 3LYUA 4Q47A 3IEVA 4KXVA 1TMOA 3C3WA 3ZIDA 2Q5QA 3HV2A 1NVBA 4N12A 5FWXA 3BWXA 3LSTA 4GX2A 2GPBA 4NF2A 4KH0A 5J2UA 1JHXA 1HE3A 1SBQA 4QDXA 3S2GA 1AV7A 1WU7A 5K2OA 1HRKA 2PA3A 1B8UA 3S99A 4CKZA 5IXSA 3OPYI 1X7HA 4IQ4A 1L1FA 1P44A 5C8VA 5IXJA 5ALYA 5JWOA 2MSCB 4E46A 4F60A 4A73A 2W8BB 3DBHA 5DKFA 4CKYA 1X7WA 7YASA 1YOBA 2WTAA 5L4NA 3T12A 1IZ0A 2CE2X 1YCDA 1KU0A 4BASA 3MT9A 4PZUA 1ZU5A 5IANA 3E7PA 3HEAA 1P81A 3R0QA 4R68A 4I1VA 2X4DA 2QN3A 5C8YA 5ILQA 1HETA 1HKHA 4UXJA 4BQRA 2I2XB 3NBZC 5EUMA 2J3LA 3ZIUA 3WL3A 4F85A 1BE0A 2IP4A 1U6JA 4JYZA 4FCTA 4LHXA 4J03A 1XD2A 4BO0A 4Y7CA 1EE2A 1AKVA 1W76A 5I5EA 3W8FA 1E1KA 4HNSA 4Q15A 3EW7A 3UCFA 3GNTA 1Z5ZA 4MWZA 3G5TA 2WB4A 4JCCA 4WRRA 4I3GA 5B4VA 4PQRA 2JLUA 4CWAA 1EAMA 3K96A 5L7YA 4KHZA 2RI0A 3V8VA 1MQ9A 1KFKB 3ET4A 2GX6A 3MT7A 4D41A 3HBNA 1HFWA 2HHCA 1FNMA 10MHA 1P0PA 2WWTA 3CX7A 3MIZA 1U94A 2VQDA 3TB4A 4IMRA 4GZ5A 4Y2PA 4YS6A 3M1IA 1EUCB 1LBIA 1YRQA 3GFRA 2YJNA 4G0OA 5BSGA 1DMSA 2O19A 4KQFA 4N9WA 3IAAA 1DG9A 3JX9A 1BSVA 3BAFA 4KXQA 3N0XA 3KHTA 3GMSA 3STXA 2BHLA 4U8GA 2PAAA 2EKZA 3M6FA 2B6HA 2I67A 1JW9B 2XYVA 2Y1XA 4RD0A 4RJKA 5DRYA 4G0YA 2GVDC 2BHNA 2CFIA 1BS1A 3ETCA 1ACMA 4TVOA 5HFJA 2FZLA 1RCTE 4J29A 1BJRE 2G72A 3FR7A 1DT5A 3UAZA 1QBKC 4NCIA 4Y1FA 4QXPA 3UMGA 3L4KA 1RWWA 4YLGA 4TLDA 5DDIP 3W6NA 1NXSA 5BOSA 3WGIA 4EI8A 2HEGA 4WA8A 3L02A 3EY9A 4KR6A 2QUZA 2IUEA 4CMAA 1K86A 3QF7A 4BQIA 1L4FA 3DWIA 4KLAA 4RORA 5DASA 2WOOA 3BCUA 2JRCA 1JKJA 1U0FA 2JH3A 4UAJA 4MIEA 4G86A 4C2BA 1IUNA 3IHTA 4ZJUA 3OPXA 5BYKA 5A3QA 1IZYA 4IRXA 3UJAA 4GKBA 2CJYA 1PNRA 3PENA 3VNRA 3WLHA 3ZGXA 2Z5GA 4K6OA 5DNWA 2CLLB 2EU8A 2D8AA 4E6EA 2WE8A 5MGNA 1GPDG 4K9OA 4YRFA 1DJQA 4ZVRA 1XMOB 3AEXA 4MZXA 1UQUA 2M1ZA 3N05A 1A9XA 1FNSA 1IU9A 1SUAA 3IBYA 5IHXA 1QS0A 2Z8YM 3R77A 3V9AA 1CB7A 4I4IA 4C78A 3F2VA 3LC0A 2O3SA 2VXOA 1RC1A 1QZXA 3HMQA 3NI2A 4LJ5A 4X7MA 2P9HA 3ZZ1A 5LUAA 3UY4A 3D5EA 1VHTA 5JH7B 4HRAA 4BGEA 1R4ZA 1L9XA 3LRTA 2VZ8A 3DFKA 1MG0A 1TECE 2VHQA 3QUQA 2YMLA 4UZEA 3TO5A 1BVHA 1QK3A 2R25B 4J07A 1U04A 3KHSA 4FFRA 1N2HA 1WKVA 2QLTA 2ZSUA 4OXRA 1S7GA 4OP1A 3PNOA 2PGJA 4UUBA 2V0NA 1W4LA 5A1TA 3T95A 3CONA 2V7WA 2Q7DA 2WAXA 4JJEA 4I9NA 2PWAA 4LS3A 3RG8A 3UJBA 4HNTA 1T1RA 2O2XA 821PA 2I4OA 4HEA1 4Q03A 3JQFC 3AETA 1R0SA 4DMUB 4E2ZA 4E2FA 2BHSA 1RJDA 5DYTA 1EE9A 1RXCA 4DY6A 1IN4A 3DZKA 2MSLA 3GZJA 1E3DA 3KB8A 3QVMA 1R6VA 2Q5JA 1MB9A 3MFQA 4A1OA 1SGWA 3AP2A 3N58A 1Y8RA 3ZPXA 1AK9A 1E9AA 2VK2A 1XZBA 3VDRA 4CF7A 4UCQA 2I6FA 3Q7IA 2FW8A 2CC2A 3NASA 3OF3A 3COJA 1FTNA 1UIMA 1F6DA 1VDZA 5F33A 5ECWA 3WE7A 3NUQA 1UFRA 1PRYA 4LTNA 1TMYA 2NVUA 4PQGA 1SWWA 1E9VA 2J87A 2NTEA 5D6NA 1O9BA 1H2RS 1CE8B 3VR6D 5HYVA 2G4VA 2CB0A 1XMQB 1YS9A 2VTEA 1MIOA 2JHGA 3OTHA 1RCFA 4M9RA 3SXPA 4EENA 3LUKA 4Z7QB 1Q0HA 1W46A 2M6LA 4DCGA 2QNRA 4M1WA 4YCLA 2WJ3A 1RXWA 3MJEA 5ITSA 3EDQA 4H35A 1F7UA 3P0JA 4Y0NA 4PLGA 4YAFA 3I37X 4XJSA 3FF1A 2JCSA 5C4IA 3RYHB 1J24A 5LC1A 3GFSA 1Q20A 2W2LD 2DJIA 4ZOAA 3VVLA 1NXQA 2EW2A 3K72B 3KT3A 2J9YB 1ISRA 1QP7A 2RHTA 3IAM1 3WLEA 2IHKA 3AWIA 4JUCA 3RU7A 2VL7A 2RBKA 1ZCAA 3R4VA 4RA9A 2HU7A 3HACA 1J0XO 2YN4A 1DC4A 2C5BA 2F1OA 2XWSA 1Z4MA 1PEDA 2XODA 5BYBA 3KVVA 4AO6A 1A9SA 4F84A 5C35A 2PWZA 1L4KA 5B30A 5MN4A 3H17A 1CP2A 5BQ3A 4QSMA 2QXUA 3O3OB 5ICCA 3B5IA 2XNJA 2QRKA 1PJBA 3JRNA 1YUNA 4DDUA 4I55F 1JEYB 3TVDA 1DBRA 1SCDA 3Q0TA 1F2UB 1NQVA 3C7KA 3QENA 3L01A 1YI0A 2BMJA 2OORA 1Z29A 2AE2A 4EUKA 3GJ7A 2FF7A 3UK7A 2GF9A 2ISCA 1M1NB 2DWOA 2IOQA 2WZCA 3A2MA 3KJXA 3DO8A 3KRTA 4IJUA 5ITVA 4NONA 1VLHA 1UWLA 3UMJA 2ZJ1A 4GI2A 3ZU4A 3LGAA 1X2EA 1AM4D 3IESA 4HH1A 1H8HD 5CDYA 3KXKA 3THXB 2L0XA 3RUEA 5KX5B 4AWBA 1WSDA 2ZRPA 2ZU0C 1P73A 2COUA 1W6UA 2P75A 4IIFA 4NBLA 4IDOA 1Q50A 5B3AA 2H48A 2IZ6A 4E4TA 3B70A 4HDMA 1XO1A 4OA8A 4O3FA 4TT3A 3MN1A 3E6AA 4KWIA 1U2TA 4RACA 5EP1A 1ZYUA 1VKHA 2QTNA 2XNDA 1FFYA 3BQ9A 3WK8A 1HM5A 5HS6A 1MAAA 4JHLA 4HNVA 1SXQA 2JH9A 1NUQA 4IZ6A 5E8JA 2H7YA 2WZDA 4L4UA 1RI1A 4UCXA 2RDMA 5TPZD 3U16A 3ZWAA 1VRCA 1N34B 3TSZA 2LZ0A 3PC8A 2CHVA 1C9JA 5ALJA 3VJRA 3K0CC 4PGFA 2H3HA 3A11A 3TJMA 2EFYA 4URZR 1ZWLA 4A92A 5IVIA 3ACBA 1FUIA 5CEEA 1EA7A 2ZRAA 2D1RA 2SBTA 2ERCA 1FFSA 3PXEA 2FX3A 1IY1A 4I2NA 3D7LA 3CKMA 4B74A 4WOBA 4EI2A 5L6LB 4I8DA 4I3FA 2NN3C 3LQQA 5LJLA 5KYYA 1IATA 1C1XB 2BCGY 3FTDA 3NP7A 4GPBA 3EASA 3TW4A 3GJ0A 4DMRA 5LIRA 1A8QA 2AUNA 4O2RA 2OECA 3O6VA 2Y05A 3MB8A 3QLUC 4O4IB 4E32A 4ZTZB 5GTDA 3M6AA 2LCQA 4CI9A 4B8ZA 5DGXA 2M6RA 5AKLA 3NGXA 2XCOA 1PR6A 1A04A 1KY2A 2ZAMA 3IUBA 4TVKA 5F64A 1HNXB 3OPYB 5JBIA 3U80A 4KDCA 4IGEA 1B76A 3HKCB 4BNKA 4CM7A 5B7NA 5IHPA 2RARA 2X19A 5KC8A 3MHPA 4H7JA 1S02A 3GGCA 3KZNA 2WC1A 1XMIA 5BSKA 5CFNA 1WB9A 5JC8A 2PPLA 4G0VA 1JT2A 2JIZD 3KOXA 1EGQA 1M73E 1VHLA 3PQ3A 4EWLA 5L51A 3ZD7A 4JBXA 3Q3IA 2XE7A 4N9QA 1KYIA 1VG0B 2GT1A 1NI4B 2EBHX 4QWMA 4RMNA 3PDIB 1GYRA 3C43A 3JQGB 1USKA 2ZAIA 4KV7A 4RL4A 3NHKA 1YF3A 5CVJA 2YCBA 1F9AA 2JARA 4WCFA 2P2SA 3ORHA 4OH7A 3RNLA 4ZYVA 3LQFA 2NP7A 3O84A 2R3SA 4JVOA 2VTBA 1WWKA 1JLLA 1LRKA 3LZ6A 3TKAA 3IP3A 1FFAA 1WBJB 3S4YA 4LVUA 3UH1A 2MYTA 2V6GA 2E4WA 3BOSA 4PICA 1XL0A 3WLMA 2OLJA 4EPWA 1A8IA 3NHUA 2ATEA 2V54A 4HDNA 1TM4E 1V2GA 1HO3A 1ZRNA 2IU4A 4C0HA 1QOZA 1NJ5A 1IULA 1NY5A 4FPXA 3OWOA 2RI6A 1BXKA 1QZTA 2W2KA 3HLTA 4C7VA 3B1YA 2YICA 3LY5A 3ND7A 3FJYA 3H0KA 3H0CA 1PQWA 4GDMA 1GNRA 5JO9A 4Q4CA 1FSFA 4ACAA 4XUCA 2GFQA 4JQYA 3SR0A 4F3TA 4INAA 3IFSA 4MUMA 3PZRA 3W4IA 3GRYA 3L4BC 5COBA 5KSYA 5LKRA 1CZHA 2QMZA 4YRQA 3DH0A 13PKA 3TTYA 2QROA 1J4AA 1OBHA 1FPMA 3RIXA 4NCAA 3GEGA 3HCBA 1Q0SA 3LX4A 3BTVA 1RW4A 2XE6A 3K0FB 4UM9D 5FXMA 4H7HA 4ZYLA 5JIBA 3I2IA 1SELA 4M1SA 5T41A 3MCAA 4OI1A 3L0IB 4C87A 4PY2A 2A58A 4XGKA 4QZVA 3UJDA 1L5YA 2D5AA 3GVIA 3IOBA 3N8KA 3CURA 2W8BA 3CUSA 1N6IA 1XTBA 3DBHB 5B53A 5AXDA 4C3OB 1U8ZA 1N5RA 2OG1A 5LQSA 3RRXA 3PCRB 3QGMA 1NP3A 1Z0ZA 3W7BA 1M7GA 2GDZA 2NSHA 3BB4A 5EKDA 4F12A 1PGOA 3II6X 3LLVA 4PAQA 4WLEA 4MI9A 3NDRA 5C0OE 3V4OA 1KOGA 3TRDA 1XOIA 3ZWQA 4IDAA 4GRIA 4PX5A 1MW9X 3IDFA 3WB2A 2NMVA 2HD4A 4KUHA 1Y33E 4YFVA 3TX2A 1EXVA 5JJBA 5CW1A 5BQOA 1LPOA 4WNAA 1W96A 2DTDA 4GI5A 1CNFA 2HMUA 1U5CA 3NHWA 4KZKA 3C6XA 3SY8A 4AJOA 4DSAA 1NMYA 3K73O 4REMA 5EG5A 4ARSA 1TCCA 1XAJA 3KJZA 1MO3A 4MR8B 1EK2A 3NH9A 3X2SA 1ODIA 1TU4A 2QLBA 1NASA 2RK4A 2EBFX 2P40A 1E7SA 3HE3A 1Z17A 4DJFC 2OCKA 1XDGA 2QJFA 2R9VA 1U1DA 3X1DA 3VX4A 4GOMD 1GNVA 4L9SA 4HX9A 4ASUD 1JEOA 3RBAA 4K3UA 4DDMA 3LUBA 3A3KA 1K5PA 1C0LA 3JQCA 4UNSA 3LBAA 3G85A 2P6UA 1G8HA 3CB2A 1AX9A 2P3SA 1ULBA 4E5NA 4DLBA 1NJ6A 1HE4A 1HG0A 5G40A 1CQJA 4HG2A 5HILA 3SS9X 3GGOA 1F4PA 2WNSA 2VKQA 1C2TA 2ILVA 3RHTA 3UWSA 3FKQA 1XNRB 4P93A 3KQVA 4ZQFA 2CVOA 5CVTA 2G9UA 1OB2A 1TU3A 4JWTA 2D59A 3D8SA 4LYFA 3ZWWA 2JGMA 5A3RA 1ZAKA 5DHUA 4Z4EA 1QRRA 1EBUA 1XKLA 2HLPA 1SH7A 1YQGA 2I7CA 4OQXA 5J5CA 1R4AA 5CDFE 2I2WA 1NVWQ 5IJ0B 2WWRA 4F5DA 3OCXA 3P96A 5DTQA 4W5OA 3CLRD 4COOA 3W77A 3BIJA 4ENWA 5KYUA 1PL6A 4U0KA 3SC4A 2JGEA 2VPQA 1SHZA 4MWCA 1C3LA 3EAQA 2HMWA 1BJTA 1JKJB 2VWQA 3PFGA 1KZHA 2Q1TA 5IUNC 5LZ7A 4PX9A 2X1VA 4KAFA 4TV8F 2H4HA 4AZ3B 4XQCA 3T9FA 4CVNA 5EJ4A 2F8TA 2F3SA 4RWZA 4OGLA 4FYJA 5FCDA 2CF5A 2VO1A 3FRJA 1H93A 3JQGA 1Z4LA 5ENDA 5ALHA 2JCXA 3JQ9A 4FYPA 4TYWA 2QL5A 1EFLA 3P52A 3QHQA 4HUTA 1G2IA 3L6CA 2PIAA 3I72A 4EZBA 3DM9B 2O8EA 5I7SA 2DEUA 2Q3FA 3QXXA 2OSBA 2ABWA 4M49A 3G0HA 3IUYA 2PGLA 4FNAA 4FYHA 4OBWA 2F9LA 1P2VA 1I4OA 4B6JA 1AHNA 2ZSFA 1TC1A 2DPLA 4QFDA 4NARA 2TECE 1TLFA 1ECBA 2VYCA 3TD6A 2DBRA 1IIBA 4N5DA 2GMWA 3UHJA 1O6GA 5KYTA 1IHYA 8GPBA 3EXEA 3MBKA 4R2IA 5AW2A 9MHTA 4J0QA 2XWJI 4OLFA 2VYNA 1FQWA 3ZCUA 4F5ZA 1L4UA 4RY9A 4M0PA 2IHYA 2ESRA 1WXGA 4HAIA 2IWHA 1CUBA 4J0JA 3UM9A 4DV6B 3KVNA 4U00A 2K87A 3VPCA 3B9RA 4D3FA 1O4VA 4GAEA 1OYOA 5KYYB 3MQ2A 3B51X 3LDAA 1TI7A 2FRDC 2JVJA 1OIVA 4XUDA 2Z4RA 3NONA 1HF3A 4GOLD 1ZGHA 2HBYA 3KZXA 3R9WA 4P2GA 2CNLA 2RKBA 3HU1A 1SVMA 3L41A 3KNZA 3OQOA 1Q84A 4JLBA 4B34A 4V0OA 1DAOA 3LBHA 2YUTA 4FOSA 4LE0A 3UBMA 3RAFC 2H1LA 3FPFA 1SA0A 1EQUA 2Z6VA 3A7EA 3DM5A 3R6TA 3T0FA 3V1MA 1B14A 4GE0A 3RUFA 3RYCA 3D1VA 1VKNA 2JVKA 1HX7A 2A9VA 3PE6A 3E61A 1VSUA 3GARA 2PKQP 1PJ2A 2G40A 1TQ6A 1WA5A 3KTFA 3PR1A 3W06A 5B57C 3NBYC 2CVZA 1OGYA 3FCSB 4Q18A 3WL4A 5G0UA 4TKVA 2W6IA 2CV1A 4V0LA 2ZTVA 3T9CA 3A28A 4HN2A 3I30X 1R0WA 5K0BA 4MRRA 3GCDA 1X7ZB 1J5PA 3WWPA 3T0GA 3PF9A 3CRNA 2Q62A 3G7NA 4HYYA 4RHUA 5F2EA 2AK3A 2BFPA 4YRPA 2O8CB 2XKJE 4IWNA 4YDQA 3RUCA 3BXXA 4OLAA 2EJBA 2WYUA 4E1BA 1BYUA 4ZDWA 4N7RA 3RVDA 1Q1AA 4FONA 3WWEA 2HAEA 5IWAB 1B43A 5EZQA 1JU3A 2QUBA 3QV2A 4RE6A 4EVSA 4DJJA 5JISA 1FDIA 2JAQA 4G5RA 4L16A 3NMUF 1I7LA 5IJXA 1TA4A 2W2NA 4GFDA 1ZNWA 2ID7A 3A6DA 5DWDA 1JWBB 3BWVA 4JL8A 2K2WA 4LA4A 1MDBA 2VF8A 5IT5A 3ZWNA 3Q9SA 2NUPB 1B8OA 3D8NA 1B6TA 1PJ8A 3JD4A 3MLBA 4XA8A 3ZXYA 2FW6A 1C3VA 1KQOA 1O5IA 1X7GA 1E1RD 2PMWB 2RHDA 2RGNC 3LECA 4UHHA 5CYGA 1ECFA 2G0AA 4V1CB 5TRTA 1J1ZA 3AM4A 2IV3A 4Y30A 4P7BA 1F1BA 3F8SA 4FINA 5IXYA 3QOXA 4IRMA 4D43A 1CUZA 4KX3A 5KYNA 2IA5A 4RK1A 1NRXA 4MR8A 1MABA 3EWNA 3BKWA 3WQQA 3S2UA 3U7EB 4OYLA 1T3SA 1WHSB 1YFLA 3OUUA 3EARA 4IY1A 4GRDA 2QKYA 2V5VA 2VDWB 5B1IA 1H5UA 5EWMB 1WLYA 4KMOA 4DNFA 4YRSA 3QE3A 3U56A 3TM4A 1OX4A 3MMNA 2CFOA 4FWTA 2EDAA 1U4SA 4DARA 2IEIA 2HYDA 3JVIA 3DDZX 4MYHA 4RHCA 5EAIA 1AGXA 4AJKA 2IVFA 2OESA 3KJNA 3CA8A 2VNKA 4FQ5A 1ENZA 3PF8A 4H4EA 2FPPB 4HLCA 1GGJA 5E0OA 3M3DA 1QFYA 1GG9A 5GAJA 4CIYA 3ZQUA 1DPGA 1Y98A 2WFZA 3AXTA 5G3ZA 2QLJA 5AW8A 4UU0A 3M4ZA 4A0QA 5IG2A 2NVWA 4IH4A 4Y0VA 2J59A 3LUAA 1Y7TA 3HJRA 4TTJA 3TK1A 3BKXA 2CZQA 3HUUA 5TY0A 1KEZA 1U3VA 1I8TA 2NO6A 1L7AA 2WT8A 4FOLA 3WOHA 1XZIA 3UKJA 5A4KA 3L7MA 3QVGA 4LXGA 3CZ9A 1YRBA 3VXKA 4FK8A 2NQ8A 2HQOA 3GV0A 2D2XA 3ABRB 5DMXA 2C9MA 2ZVQX 2NT3A 5K9ZA 4UVDA 2R7AA 1A5SB 2MWMA 3HRHA 3JQAD 2R8XA 3LBFA 5EMMA 2FFQA 1SB8A 1SOAA 3GJQA 2JLAA 3C3AA 4MGZR 3B36A 3BZBA 5LYJA 1F51E 3N8IA 2ECOA 1OV4A 3CPSA 1GPKA 3L49A 4JQCA 2PXHA 2WIAA 4UBLA 1QWSA 4IIEA 4WW0A 4CW7A 2I66A 4M37A 2P77A 5LZ4A 3H3FA 3SM3A 1AXEA 4R0NA 4GL2A 3D64A 5EJMA 1UBGA 3ID6C 4IHJF 1QPBA 4LC1A 3AZOA 3EXFB 2BMVA 3DVAA 4ARVA 3LUJA 2QBYB 4EUEA 4YHBA 3FPGA 1MC1A 5IW8A 3U61B 4W7HA 2X42A 2CLOB 3A6ZA 4MMYB 1E6MA 3A6JA 1QHGA 3EBLA 2DULA 4BP3A 2IEAA 3P5BA 4EY5A 1H2AS 1NI4A 1YCHA 3P9KA 4J4BA 4ZKEA 3QYFA 1Z0DA 2FH5B 1WHSA 2CXQA 3V4PB 5I8ZA 1D6MA 4ND2A 3WNBA 2PSSA 3I23A 1I2ZA 2ZS8A 3IT2A 1RZRA 1Z7BA 2HEIA 4IMJB 4BO1A 2ZJFA 4JT2A 4MRVA 4A27A 5DN9A 1Y8QB 2GD2A 2B8NA 2OFOA 4HDKA 4EHHA 2Q5OA 2V6MA 3N2IA 4GU5A 5IWCA 2ORVA 1EUZA 1TQDA 1U5BA 2QTCA 4RESA 3TWOA 2WWXA 2ZDHA 2GO1A 2ZRKA 3DULA 5EEHA 4QVIA 4FWIB 4BUZA 3ZBPA 3MGBA 1IONA 5CXXA 1UEJA 3L4EA 1RS0A 3CRQA 3KPWA 3AF0A 3O92A 3RUDA 1CZUA 3GDOA 5D84A 3AUTA 4ZZ1A 1OYYA 1LLQA 3IJRA 5KYKA 2ORYA 2BELA 4OGFA 1SAYA 4FMBB 4U7JA 2AFIE 2ZRJA 5LLTA 4DZTA 1HA3A 1RI3A 3WRXC 4E11A 1JA1A 3PG5A 1UAGA 2QVCA 2VK8A 4R7TA 4UVGA 1XNGA 5KNDH 2JGNA 1FRNA 1WEKA 2P8JA 2C7OA 1C8LA 4I50A 5ALMA 4MHOA 2CNBA 3ZDFA 1MJGA 2Y8EA 5SZHB 3MS4A 1KU6A 2PH7A 2ZULA 4KMMA 4NICA 1GVNB 1WXXA 5BN3B 3GLTA 1Q92A 1J7KA 4D25A 3HUFA 1U0GA 4L8VA 3OECA 2YQ5A 1HE2A 1U9YA 5LYJB 1ZVVA 4CV3A 3D02A 2VNAA 2ZB8A 3RK1A 1X1EA 3C6KA 4NYIQ 4P84A 1RE1A 2OXIA 1JEDA 2ZSHA 1QIFA 3URMA 3PGLA 2RHLA 1MA3A 3CUEF 3R20A 3ADDA 1IXYA 3CRW1 5DISB 5AM4A 4EUNA 1U7PA 1RWQA 4IJQA 2WG0A 2NAFA 2QN9A 7AT1A 2I1QA 1KAMA 2YIVX 3KQPA 3REQA 1L6IA 4B3FX 2FPIA 3A04A 3NPMA 3L8GA 1MABB 4FDVA 4GC9A 4QODA 4UNIA 1OPRA 2YWXA 3O0TA 4TLAA 1DINA 4X84A 3S68A 2VBCA 4LZZA 3R9XB 2BKXA 4IHJA 4LSMA 4U2CA 3A58B 1RT9A 3B78A 4CV2A 1C0KA 1UBHS 3FPAA 4Z3DA 1B2LA 1A82A 2FMXA 4HAYA 4IFBA 4RHEA 6CHYA 2TMKA 3PL5A 5LA6A 5EP2A 5LSAA 1XLVA 4Z9BA 3RLFA 1F14A 1EJ0A 1EG2A 4O33A 3W9YA 2QUJA 4K7JA 3GEHA 4BVKA 3OEWA 5TLSA 5TS3A 3BXFA 4JJ8A 4MPJA 4YJGB 1K7EB 2V6JA 2WJAA 3JRXA 5FBLB 1NG1A 3FOZA 1B0PA 1Z4OA 3CN7A 3AKEA 2CMDA 3WBFA 1XZEA 5K6RA 5CFZA 3CEHA 2FFAA 1YJCA 5EWMA 2ZB7A 3TMAA 2C0PA 2OE2A 4G07A 1PQPA 2OL4A 3R3SA 4WVLA 5IP5A 4K6MA 1DKPA 5FYQA 2HU5A 4MV8A 1W85A 1Z6ZA 2OK7A 2VA8A 2Y1EA 3FVQA 4HGQA 1NKTA 3ZH2A 1G5PA 3V4FA 3ICOA 4CETA 3GDHA 3VR4D 2OV1A 1Y9EA 1DNPA 3PBKA 3WDKA 2BFCB 2GN6A 1OWNA 1MJ5A 2XR1A 2EYUA 4NZYA 3ZX4A 5BPFA 1MVLA 4RK5A 1NW9B 4LX0A 1AHPA 4JI4B 1BXRB 1BX0A 2P5YA 4JYPA 4B0PA 3T9DA 5JCZA 5IMBA 1SKUA 4JR2A 3TRIA 4C7XA 1LPAB 3PITA 4RFLA 1J9EA 4I1UA 3RBXA 2X9GA 4Z9AA 3UCXA 3WP0A 3L1UA 5EYPB 2PQ6A 5I4KA 1YZFA 3UWKA 4D8TA 3BJRA 1AVTA 2MOKA 3R0ZA 1EZZA 5BSEA 1PR0A 1Q5PA 4UQLA 2CFTA 3U09A 1GU7A 1RIFA 1WLSA 4ZQEA 4HNRA 3S6JA 3CKLA 3PB3A 4ARBA 2ZI3A 1HUQA 2XAAA 2D5IA 3D7KA 3HUTA 3PJDA 2P9BA 3E9QA 4NC9A 5KTMA 2VXBA 2JCYA 4IBOA 2HZBA 4A8TA 1YR8A 3HDGA 3DEKA 2PSJA 4EGCB 4RM3A 1WCXA 1IRXA 3NTLA 3H65A 4MCIA 3KV1A 4PFQA 4YRJA 5KVVA 3LZCA 3EPRA 4N82A 2JIOA 2H63A 4E3ZA 1VBMA 1AN9A 4DA7A 5HGXA 3K4HA 1R5OA 5I48A 1BWPA 1XTZA 3ZHXA 2P41A 2PJDA 2ZU6A 4QU5A 2GCGA 1FL9A 2G8LA 5CFPA 1PJLA 4TLCA 3LY9A 3RABA 4I08A 5JG7A 5BUSA 3L0PA 1WAMA 1MIOB 2JD2A 2I3BA 2HW8A 1JYEA 2IOYA 5BPHA 5LN1A 3ROFA 2PRYA 1PK9A 1Y9DA 1J0EA 2GZ2A 1E69A 1CJBA 1QFJA 1QVZA 2A5JA 3AJAA 3PEFA 2AN9A 5CVDA 3VSBA 4IIBA 2FW1A 4IGFA 2HO4A 2O2SA 4TUYB 5IJZA 4EARA 3EODA 2I9KA 3AHCA 1C9NA 1S1CA 2RHGB 3A1WA 4BFWA 5J47A 1NG9A 4XLZA 4E51A 4QG7A 3UCEA 1HFEL 3ZVLA 1ZOSA 3CCCA 1HOTA 2NAPA 2FMHA 4MXDA 1HDYA 3PFWO 3P2MA 1TUBA 5J2TF 2O7RA 5BNTA 2BGRA 1KZ1A 2FPRA 2FN3A 3WLTA 5LP6A 3OOWA 3A3NA 4DB2A 2VDNB 1ZD2P 1QHIA 3Q6MA 4RIHA 5FTJA 1WR8A 3GXBA 4Y6GB 3ME5A 1J0CA 4QRDA 3PC4A 4TTVA 4XD7A 5JAHA 3AR6A 3TSYA 4XVCA 1NJ2A 4NE2A 3AHIA 5T7BA 1MRZA 4QVGA 3SAJA 1O9HA 1QHFA 4EAQA 1BOOA 4UTVA 2BOVA 2V7PA 4GM4A 2Q8QA 5TE9A 5KTSA 5LFAA 1I9GA 3PP8A 2VJYA 4WH0A 4YB8A 3DW3X 1K5GA 5JSQA 3OT4A 4FP9A 3M2TA 2PT5A 3A06A 1AGPA 2VDVE 4Z4IA 4JY7A 1N4AA 2B34A 2NYVA 2CJWA 2EX0A 3ZHCA 4ZZIA 2FG6C 1E1NA 4O8CA 2HV8A 3R3HA 4BU0A 1YI1A 3K0BA 2ACVA 3THWA 4GX5A 4XPZA 5DFAA 1KEEA 4OGWA 1GPH1 2FG7C 5EXEA 2IELA 4TTAA 4OKIA 1B41A 4HXGA 5HF9A 3V1UA 4EO4A 1UT5A 4BBPA 1WXFA 4FHGA 1S96A 1Z75A 2J0UA 3RU2A 1EU1A 5BW8A 2VR1A 3ROPA 1MT3A 1PD0A 5F35A 3K0AB 4EA9A 4IG9A 3KC2A 1HPLA 4UPDA 4KLNA 3VBEA 5G1OA 1V7ZA 1DAEA 3C70A 4IAOA 4KQEA 3WYDA 4JKYA 2QRVB 3KZCA 2XVXA 1ADJA 2OAEA 4ZV7A 3S8MA 2ODNA 1UMCB 4E1AA 6ABPA 1E89A 1RXSA 1D9ZA 1M1ZA 2KB0A 2E1PA 4D4IA 1PLKA 1I2AA 1VG1A 3NBQA 3DWGA 2Z08A 4CLEA 2R7MA 1ZISA 5ALKA 4JI8B 1XPUA 4GSKA 3AZPA 1ZK4A 1O89A 4M9CA 4UDXX 1RYZA 1UKCA 1QP4A 1KR2A 4CKCA 5K3AA 2GBLC 1H65A 2QTBA 1TQHA 4JLSA 3H5OA 5KYUB 2C42A 3B3FA 1XYVA 3ZU5A 1NQWA 2UUBB 2C59A 2C29D 3QE2A 3IVGA 4PSVA 3RADC 2RGRA 3BIWA 3ANNA 3QRWA 4BC1A 4E70A 2JAPA 4W99A 1WCIA 4L4RA 1RRVA 4B6SA 4QHYA 2VATA 2ZAOA 3R1IA 3QU7A 3OZAA 3A1DA 2FX5A 4KSYA 5AP9A 5ESRA 3MJTA 1KK3A 1CR1A 4CHTA 3CH4B 5IKEA 3EZ7A 1A97A 2P6PA 2DFLA 2Y0BA 2Z1DA 3AK4A 3ANXA 5FR1A 5FOWA 3WGTA 4V03A 4IP0A 2AXNA 1WRBA 1ACJA 2R2AA 3EGXA 5LZ5A 3ABQB 1KRXA 4LI3X 1N78A 1ZN8A 2BGIA 3S44A 4CIXA 3KLNA 3V3KA 5IM5A 2FSFA 1L4YA 1UXGA 2C94A 3KPJA 5EE0A 4BVJA 5A1JA 4DDTA 4TUYF 3OBBA 1YQXA 2BTOA 2R1VB 2YXBA 3ZY2A 3IR7A 3HJCA 4O4IA 4CQJA 4EGFA 5EZ5A 1ZC3A 3SR4A 4P4LA 4MVJE 4A3SA 3TLMA 3WYEA 2Y6UA 3DE3X 2RAVA 2BJHA 2VNJA 2ECFA 3CLUD 1D7AA 2ILTA 2RD2A 3HVKA 5INTA 1GL6A 1S9HA 4PLWA 2O7VA 1U63A 5DOZA 4KTVE 4J43A 1AUQA 2WAOA 5J4LA 5HTKA 3ZLTA 2QR3A 4MH0R 1R4NA 2GD0A 4HLQB 2ZT6A 2B4YA 4GPAA 2D1QA 4CRWB 1KK2A 2GLTA 1MJGM 1OJLA 4N3BA 1MV5A 1UJ2A 2R0QC 3KQNA 3UXMA 1KJ9A 2NZ2A 2RHBA 3T1OA 5LQAA 3CRZA 2V6BA 3UFBA 1RBZA 4U2BA 1JSZA 3MCVA 4S2EA 1RBYA 3U7FB 2WVJA 3EAGA 2ODPA 1IWPB 5IKOA 1HORA 4JZKA 1M8PA 1OC2A 1SUIA 4L76A 1XZAA 1JE1A 1Z2AA 5AK6A 1N2CE 1L5HA 1QPZA 1NSYA 1JFFB 2AG0A 2VPPA 5THXA 3RUPA 3GMTA 3WGHA 4TV9A 2AHOA 1G7CA 2I8LA 2TMGA 3MWEA 4GPIB 4II3A 4DIDA 5LQUA 3U7HB 5C1BA 3H5NA 4GYYA 3MGCA 3QEMA 3MJDA 1PEYA 2QA5A 4RD4A 1A2OA 5F52A 1JQ3A 4NMXB 2R60A 2ZWVA 1K2WA 1VZ2A 3PDCA 1NU6A 1VJ5A 1XHLA 4PS1A 1I1OA 3AFOA 4RQAA 5MFPA 3RC1A 1YU6A 1NTRA 2RGCA 3DOOA 5E4FA 2VT6A 1CHNA 3U3KA 4MWGA 5IASA 4LJAA 4JLVA 2PS9A 2ZXFA 5F4ZA 3DBLA 4EHBA 1S2OA 1F9EA 3K8OE 5IT4A 4G63A 2CXHA 3JQ6A 4CKXA 5K0EA 1NLZA 3DAGA 2VYVA 1VJDA 1XPOA 1ONOA 3KDAA 3LJKA 1FSZA 2Q5LA 5C8DA 5ERYA 3MA0A 4M86A 3WMFA 1EDZA 5AVWA 4H18A 1F60A 2WJHA 4CHGA 1BMDA 1PDVA 5ESXA 3CTMA 2B4RO 1VIVA 2WYIA 3FCAA 2DT8A 2ZAYA 2ZYIA 4UUOA 4J90A 4BMCA 6Q21A 1IB6A 2OVFA 3OESA 5CH3A 4TVSA 2DBZA 3EQ2A 2FUKA 3OLQA 5C37A 3MMSA 3RTBA 5H68A 5A4IS 4F8EA 5B1HA 3VMFA 1QJ4A 2NOAA 3ABZA 4IOJA 2ZUCA 2R4QA 4ZAZA 4L3WA 5FI5A 3E9DA 3K4QA 5EHZA 4UM8B 2VCHA 3OA2A 5J40A 3Q11A 3P2EA 2XDWA 2OB2A 4QXOA 2J9ZB 2ZT5A 2J0QA 5EL0A 1PFUA 4LX8A 3I6MA 3U4HA 2PLRA 2WHQA 3IIKA 3ZDAA 4HAZA 2A9PA 3THOA 5FBRB 2B82A 5DHPA 2F2TA 3HV0A 3F9CA 4LYDA