4UPVA

Low x-ray dose structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIFE-HYDROGENASE SMALL SUBUNIT
publication title Crystallographic studies of [NiFe]-hydrogenase mutants: towards consensus structures for the elusive unready oxidized states.
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
total genus 81
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4upvA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4upvA02
3ZE7A 4U9HS 1UBRS 4U9IS 4UQLA 5JRDS 5JSYA 3USES 3ZEAA 5D51S 4KO4S 3H3XA 4UEWA 4IUBS 4GD3Q 3ZE9A 5ADUS 3AYZB 1UBHS 4UCXA 1WUKS 1YRQA 3MYRA 3ZE8A 3RGWS 5JSHA 4IUCS 5JSKA 3ZE6A 1FRFS 4UE6A 4UE2A 1WULS 2WPNA 5JSUA 1UBTS 1WUHS 1WUJS 3CURA 1UBJS 4C3OB 5JT1A 4TTTS 1UBOS 4OMFG 4CI0B 4UE3S 4UCQA 4KO3S 4KL8S 4URHA 1UBUS 4UPVA 5A4MS 4IUDS 4UD2A 4KO2S 5A4FS 3USCS 4UCWA 3AYXB 1UBMS 1WUIS 1H2RS 4KN9S 5A4IS 1H2AS 3CUSA 1UBLS 1UBKS 4KO1S 2FRVA 4UPEA 4UQPA 1YQWA 3UQYS 1E3DA 1FRVA 4UEQA 1CC1S 4UD6A 1YQ9A
chains in the Genus database with same CATH superfamily
1NMZA 1CDZA 1EKXA 4WJKB 3BE6A 1FP6A 4B33A 3ELUA 3LW7A 4DA0A 3R0IA 5SYAA 4H7PA 4QDUA 1SBIA 3AUAA 3MIZA 3PR1A 3CJQA 2F59A 2O3TA 3KV3O 2CCGA 3E23A 5I4BA 2B83A 4KFRA 4KXNA 5F2OA 3HR7A 3HJCA 4KYUA 3EQ7A 4CL2A 5M04A 4N18A 4PYJA 4DMGA 5EJ7A 4EMTA 2OO7A 2PX5A 3CCBA 3EQZA 4ZRNA 3T3IA 1ZICA 5CH8A 3AT1A 3OFKA 1C3XA 2A1UB 4L6AA 5FFFA 3QIVA 3S0JA 1K7YA 4GQAA 5C34B 3GLKA 4GUDA 3T3PB 5DSZA 3BWBA 5EMMA 5F35A 1C0LA 5HHTA 2ZIGA 4EQZA 4B4WA 3GZNB 3EIHA 3G5TA 2JCSA 3QLTA 5AW6A 1JAHA 2JHPA 3D2BA 5AK5A 3TW4A 4X61A 4UM8B 2BFBA 3NGLA 3IT3A 2Q7XA 2YCLA 4MWDA 3GAAA 4Q3AA 3VOTA 1KBOA 3M4NA 1DLIA 5FR1A 4R98A 4BVLA 3ZD8A 1SQGA 1VCNA 5ALSA 1UK8A 2VP6A 4JROA 3R44A 2CL0X 2XVZA 1NUUA 2ZBRA 3A1FA 2VPIA 1TYCA 4XWAA 1HBJA 4JIMA 1WMDA 1X1CA 2FPUA 1QG0A 3GLHB 3LFUA 5EVCA 2Q4RA 1XLVA 3OKPA 3O4RA 2G8LA 4BMZA 1E2QA 3KLBA 1DVRA 3NXKA 5D3KA 1GNSA 1AB6A 1YQXA 4JVOA 1ABEA 1PZFA 1EE9A 3OZCA 3IPCA 1BGXT 2IF2A 5JYDA 1B42A 1XCOA 5I7SA 4LNHA 4M53A 1B0PA 1L5LA 1OXVA 2N1MA 3GNTA 1PEAA 3LKZA 3EZ9A 2QPLA 2Z98A 2NPIA 3CRW1 1X9GA 2HSJA 3S4YA 1JLLA 1XP8A 1PF7E 2HT6A 3ANTA 4WAUA 2NAFA 1WU8A 1ADBA 1ORIA 2PJRA 2OGZA 1Q19A 2DSNA 1XVTA 2WW8A 3AJ9A 3ELYA 4JASB 1S1MA 3WNDA 3N8GA 4NOKA 3B7GA 3KR1A 1Z0FA 5A4MS 3THXB 4D1YA 3HKBA 4Y9UA 1JGTA 1RMQA 3DMDA 2IELA 2P9YA 5B2FA 5ALGA 4IJMA 1GLGA 5B55A 2B4TO 1Q1GA 2I87A 2PT7A 3OWOA 3R0XA 1U2GC 4WOPA 3EUFA 4GX2A 5KTPA 1KJJA 3IKLA 1KWGA 4US1R 3NEJA 2WR8A 2BISA 1Q5PA 1GO2A 4RH0A 2E4ZA 2DFTA 4H27A 2PU5A 4OHFA 4DRXB 4EECA 3GG9A 5KOIA 1DXOA 2D0IA 1T1JA 2G1UA 4NBSA 4JLOA 2PYZA 2AUNA 2O0MA 3L8DA 1W2WB 5DCUA 1ZU4A 5KNBH 2XE8A 1NU8A 3C41J 4IH9A 2AQIA 2C77A 2C4NA 2OCXA 2H57A 1DFGA 3L4KA 5EJ4A 1CK4A 3FYUA 5EJ2A 4GMDA 1DDGA 2IIQA 4ND5A 4YEDA 1SD5A 2X5XA 3ONNA 1FFAA 3TGLA 2C4KA 1LF5A 4UQPA 4ERXA 3E1KA 1YKSA 1ZVJA 3R3ZA 4DQVA 2QTVB 4TMTA 3T3MB 2ZDQA 3WI7A 1QLHA 4KSCA 1Z0DA 2AUMA 4RD6A 1LX7A 5DYNA 3CLTC 4O2AF 4OM8A 2WIKA 1J2JA 1TTHA 4JL8A 4MUXA 5DX8A 4C7MA 1TYEB 1GA1A 3QU7A 4NHOA 2DWPA 1FQKA 4FW8A 1FP1D 3I6BA 4YLGA 5E7IA 1NHGA 5M5BA 2P5YA 3LO5A 4Q02A 5K3CA 1LCIA 2IY8A 3JW8A 1CERA 4OFXA 2PSHA 2HWXA 2OYCA 1N6KA 2Z9DA 3FSJX 3DL0A 2ZS7A 3NHUA 4B7AA 3N9IA 1HDEA 1V11B 4F11A 2H4WA 1M72A 2PRYA 2BVNA 3RVMA 1LZKA 1VBNA 4M9SA 3OQOA 5GPBA 4NBWA 3HL4A 2H9YA 2PX8A 5DXAA 2H4YA 3QOXA 1VPEA 1ACJA 4NVRA 3H17A 1F12A 3E35A 4TS1A 2Q5EA 4HZUA 4WZAA 3KTFA 4DIMA 1O57A 3MMSA 1XZEA 4EUSA 4F84A 1YCDA 2XHEA 3RYCA 5ELXA 5MF6A 1JE1A 1SJ9A 3QJYA 1AU9A 7ABPA 3WNCA 1QJCA 1F2DA 4X1IA 4Q4JB 3MT8A 1JFFB 2FDXA 1R0KA 3MQ2A 2SECE 2WVJA 3L8FA 1QV7A 3L4BA 2ZXEA 2HLDD 3GLIE 3L43A 4OJTA 2GBLC 5JFGA 3WLRA 2JLZA 3CLUD 2HU8A 5FLKA 3VOSA 3T1NA 5DHSA 2PUFA 3C7TA 3T0GA 4RMIA 4YGXB 5K09A 4QPNA 1FVHA 1YO6A 1MO4A 2VTKA 3BC1A 4ZAYA 3K1AA 4C20A 2VSQA 2ZBVA 3M6IA 1JIIA 1SUIA 1F7VA 1S3SA 3JXEA 4EGCB 5GONB 1RWPA 1VIDA 1GTMA 1N9ZA 5HOEA 1MJFA 2P68A 3HY6A 5JVDB 4OAOA 4AG6A 3GNQA 3W77A 3B3JA 4H7JA 5FB3A 4KPUB 4DDTA 3BJEA 3P4YA 5DGHA 4AZ3A 2WTBA 1ZEJA 2OFWA 3MD0A 1BRMA 2PBZA 2AJCA 4HDMA 5CNMA 1E6MA 3DLPX 4JHLA 1V5EA 4KFTA 3O2SB 1ZX1A 2YOHA 1SPXA 1U1CA 4QPDA 1S2LA 3DV0A 3NNNA 1BU5A 4FMBB 4ROTA 4G5RA 5A7FA 4KMSA 1A76A 1HURA 1UKZA 4MGKR 1Z4MA 5DV9A 1W88A 4C03A 1TCBA 5EWJB 4ACAA 1UL1X 1NP3A 3AHCA 1R4AA 3HC7A 2PGOA 3KJNA 3FLBA 1WU7A 1Q1NA 3IJEB 3P4XA 4NNJA 4AMUA 4ESOA 1ESCA 4ML3A 1GL3A 1MQ8B 4XGKA 1HE5A 1QC5B 3Q3HA 5CFLA 1VE9A 1TLFA 2OAGA 3LA6A 3NH9A 4IH4A 1EFDN 2Q49A 1UMCA 4R0NA 5AJZA 4NU0A 1T0HB 2WUDA 3FFXA 2VF5X 3MZ0A 1F5NA 5EIOA 3TE7A 1ZC3A 5KYWA 2MOKA 4RHYA 3ZE6A 1CX9B 3I61A 4G8CA 4DR1B 3BHIA 1A8PA 5LXTB 4HI0E 3ZWBA 4RGBA 1J25A 4OXIA 4BYGA 1XHFA 5EPOA 4L7VA 1G7SA 1KETA 1ZRHA 2HPVA 4Y2QA 1L9XA 3IP6A 5JYCA 1W6RA 4YRAA 3P2MA 2H3EA 1V35A 4IDHA 4OXKA 4OB8A 1OAKA 3GLFA 4UNIA 3T3EA 1M0WA 2P79A 5HM6A 1TK2A 1J7JA 4ZU1X 4KXMA 5B7GA 4EVIA 2AN1A 1Q1AA 3STTA 4AIRA 1OI7A 4QDXA 3WGHA 1N9GB 1A88A 1I3CA 1D2AA 1J1IA 2W6PA 5BMOA 4F1JA 4Q9HA 1V16B 1E1YA 2PZKA 1XMIA 2R3SA 1C30B 3DMYA 4K3UA 4TMWA 2J0EA 3WBJA 1EBBA 1Z8HA 2B82A 3QBVA 4V0LA 4HVTA 5E4YA 2PQ2A 5LKAA 2QL6A 2Q4EA 3A2NA 4ARBA 4EX7A 1BG6A 4KPEC 1C9JA 4JGGA 4JZYA 4MWZA 5F7XA 5B30A 3H11B 3QQPA 2E4YA 2H3HA 5GTDA 1W76A 1XQ6A 1QORA 1FTSA 2QZPA 4U6SA 4FGKA 1DBVO 2YV4A 4XE5A 2Z58A 1S2IA 1ZK3A 2WE7A 1MJNA 1TUGA 2GI4A 4AIIA 4EUEA 4MMZB 1K5GA 5TR9A 5GM1A 1KPGA 4HGOA 5KO2A 2O1EA 2QW0X 3L92A 3JYNA 3IQFA 2XHZA 4P4LA 1XMXA 4IEIA 4W5RA 5KTNA 5CAEA 5FLXA 5DBFA 1PK9A 3MW8A 1X1QA 2J67A 4TZ6A 4CN8A 4C3VA 1JAIA 1IBKB 1UOEA 4UBNA 4JR0A 2QY9A 4TWAA 1U9ZA 1YMQA 4C5BA 1QO9A 4UZSA 3S99A 5EWMB 5CJ2A 2JZOA 4HUQA 1B2LA 4QUBA 2RGRA 1K63A 1P1BA 1XJWA 2ZSFA 1K89A 2BFDB 5GIOE 5AVWA 4GR5A 4Q4CA 2Y71A 3HQ4O 3E0QA 3RC7A 1CNEA 2H7XA 1G8PA 3ZDCA 4BE7B 3BRCA 3CR3C 4F56A 2P35A 4KBFA 3U3MA 1ZOOA 1X1EA 4TV9F 5EC8A 4RK0A 1RKVA 3OLCX 4OH7A 1W73A 5A9TA 1I4LD 5HKBA 2WU0A 3CKYA 1CP2A 5ABPA 1Y6GA 2PH7A 4X24A 3DB1A 3LVQE 3OZRA 1BXZA 1L1EA 2B2CA 5T67A 3ICCA 3W5DA 1U0BB 2IXEA 5A2QA 3CF6R 4RCYA 1JAZA 4IIVA 4ALNA 5BUQA 1SWWA 1USKA 1PT6A 4V0OA 5DYYA 2B4AA 2KYRA 2NADA 4K0RA 3OOWA 4GFDA 2M98A 2X9GA 3H05A 4J7AA 2XOKA 4K9MA 2X7JA 3WK4A 3DUFA 4C7OB 4QPCA 1JALA 2KWIA 5IT0A 2D5BA 1JDSA 3R7FA 4DG9A 1JB1A 3PUJA 3GA5A 1V7PC 3KDAA 4ROSA 4RYLA 1K8XB 3H18A 2MSDB 1G3IA 1RWOA 3H16A 3K92A 5IANA 2JLBA 3LAWA 1A1VA 1C1DA 1WEHA 4MHTA 5THQA 3SR4A 5A06A 4Y8VA 2J3QA 5HRCA 4HDCA 3LMKA 4DAOA 2FPKA 3SK0A 3QH4A 3SJCA 1DI0A 2X5NA 2FRVA 3Q8KA 4LYAA 3JY6A 2Q5JA 2EW8A 4UPEA 2R25B 1OAOC 2WD7B 3DTYA 3SQNA 3G2OA 2NYUA 5AKGA 3Q0IA 1SQFA 1GCIA 2PWYA 4UHKA 2BFMA 1G7CA 2D74A 3DYIA 2UZ3A 1ZGCA 2BTOA 3TCXB 3ZE2B 4DR7B 2XB2A 1G9TA 1I3MA 2BEWA 3DR5A 5D87A 5L3QA 1CU1A 4JJGA 5C1PA 1IY1A 1MXFA 2HRZA 4JVLA 4REMA 1IJEA 1J20A 2KHZA 3I4LA 1DC7A 3LCMA 4YLYA 5KNCH 1FXSA 2WIJA 4Z8YA 1Z06A 1QQ7A 2WF8A 3FGZA 5BYAA 1EGVB 2P3SA 3OQVA 4H7HA 1XZCA 1XMPA 2W2NA 1YQUA 8ATCA 3A4NA 1BXGB 2EG5A 5F12A 1GTZA 2G36A 5I7RA 5JSZB 1SMKA 2P4EA 4PG8A 2PUJA 1U7WA 2RHBA 4DLUA 4MAAA 5F78A 3IBTA 3I05A 2GD1O 2PYIA 1CS0A 1TADA 1WZEA 2B2NA 4GHWA 1R2QA 5L3ZA 4UEWA 5LCXA 4HR7A 1CS4C 1IHPA 5AKXA 1QXSA 5DHQA 3LX4A 1JLMA 4IUYA 3TZQA 3BGSA 3UOGA 4BMDA 3V4FA 3MWYW 4HFJA 1U4OA 3PFKA 1TCVA 4YAIA 4FGLA 2FW9A 3HKDA 1LGYA 4TV8F 3IPAA 1E3JA 2RHOA 1KAEA 2RH8A 3UGJA 1RYHA 2Z2JA 4RPGA 1SB8A 1T4CB 3OZAA 4D9CA 4OQYA 5C5CA 2VJMB 1XQVA 1FTQA 3IO3A 1JIKA 1DO8A 2XMDA 1HYHA 1M5UA 1XVVA 3NP7A 3RYIA 3TZ6A 1CJSA 2BGIA 1YGPA 1I80A 4KGZA 2IHVA 1FSFA 3HJAA 5EMNA 5F76A 4ODIA 3EC7A 4Y2GA 1PV4A 5JJLA 2XB6A 3D6HA 3R0ZA 3WYDA 4E5UA 2CV1A 3AEKB 4KN8A 4MRSA 1FP4A 3ETEA 3MBKA 4R9NA 3N1UA 3A05A 3V9AA 3EWSA 1T6BY 5EXPA 1Z56C 1JKMA 1QTIA 2I2XB 3OM8A 4IJQA 4UNQA 3VYTB 4RW0A 4JDUA 3B5JA 2P75A 2VJKA 3R3JA 4MV0A 3HACA 1QG6A 2O8EA 1DCMA 4XAQA 2M32A 1YZTA 2I6TA 1FL9A 1PJSA 5I7OA 1P4GA 4NAHA 2V4UA 2B9EA 4MPJA 2WB2A 3OZSA 2H4JA 1RHKA 1SUCA 3N76A 5SYMA 3EUWA 3NYQA 4FR2A 4B8YA 1PJ4A 4X1OA 3DKVA 4IP0A 4WCFB 5MHTA 2DBZA 3F9CA 5A4FS 1K2VN 1BE8A 1F06A 1K2WA 1YF3A 1JDTA 3NANA 4DA9A 2C31A 4Q9JA 3VSCA 3NLLA 4YCSA 1TU3A 1FFYA 3F6EX 3OT4A 3R5KA 2EIHA 1T1GA 3H2IA 4I3FA 2YIVX 1U1FA 1VMDA 4MSUA 4O5AA 3A6DA 4KX5A 4QTUB 1F4VA 4TKZA 4RESA 4D57A 1SXJB 2RH9B 2NXWA 3DNMA 1MEEA 5JQGB 1QYVA 4A4DA 2C7QA 1ZM2A 4OK3A 4E30A 1Q91A 2G9UA 4OK6A 2L0XA 4B6QA 4D8WA 3FI0A 1MKYA 4LYDA 1DNPA 1WSAA 1B8PA 1KQNA 3BMQA 2VC2B 1XU4A 1JV2B 3D0KA 3P9NA 4L3VA 2C4WA 4NWIA 4OY3A 5LZ7A 4F60A 1Z0IA 1KNQA 3THWA 1O6BA 1P3Y1 1RPTA 3URMA 5BN4A 5JXHA 4K6MA 2P9JA 2ZUSA 5JV5A 2PAFA 4Q1VA 5K8JB 1F0PA 5C5DA 3FYUC 1NC1A 3N2GB 5HTKA 4WESA 2IOHA 4BNJA 3V32A 4V0QA 3U60B 3VR6D 1VCOA 1ZD2P 3JVEA 3N2IA 3Q7IA 4TUYA 3UGQA 2W4MA 4LVUA 3BILA 5BPHA 1NV8A 3WKCA 2JASA 2NPFA 1YQ9A 3E27A 3ZQJA 4A26A 1EDEA 5CTJA 3I0ZA 1ZO8A 4NZMA 1FUIA 4Q93A 1Q16A 3QXXA 3BPSA 1KZ1A 2YZKA 3DWGA 1GFZA 2WV9A 3FUCA 3PNOA 4BN5A 2E5WA 3JALA 4BB9A 3VYWA 5LD2B 2XE7A 1MX9A 3MT9A 2YZNA 5T64A 3I9JA 2OP0A 3KEOA 1P2FA 1OV4A 1X7ZB 1T2UA 2F4NA 3B9RA 1U7ZA 2DKFA 2TSYB 2P6MA 1A9YA 1Y7IA 2VUUA 3ABOB 3MGAA 5FYDA 1ZR4A 4GD3Q 3F4LA 3ACBA 3Q7EA 4G6ZA 2HZ7A 3T94A 3UWDA 1U0HC 4ESEA 5HF6A 3X2SA 4OKIA 3SZUA 3V8MA 4BQOA 3UKOA 2REQB 2LIVA 2FVXA 5IDYA 4RO0A 3VV3A 3HCCA 4RDHA 4B9EA 1UBEA 1C29B 4RWEA 3T7DA 5CBPB 3DWIA 3THYB 2IYVA 4RD2A 3A3KA 4UPDA 5DI3A 1M8FA 1JLSA 1YL5A 4R2IA 4RHCA 3WB9A 1DMSA 1XVIA 4YTEA 4MUBA 4CHGA 4IQGA 4DQLA 2QUZA 4U02A 1UJCA 4MKHA 4NIMA 4AU1A 4UW9A 3LUBA 1RCFA 4MP8A 5B1SA 1R27A 4ENWA 3EA0A 1E8MA 2ZJYA 3MUOA 4KYVA 4UAJA 3N6VA 1P1KA 3CSSA 2AFIA 2QRPA 2F17A 3L4BC 4JBWA 2F2TA 3C3CA 4B45A 2C2OA 3OJFA 3MB5A 1P0IA 1GT6A 2QKYA 2IHJA 3FW1A 3IA2A 4IQ8A 1ZVMA 2ZULA 1J2UA 3MTEA 4FYKA 4GBED 2ZUCA 4A82A 4BBAA 1ONSA 1UDCA 4Z4CA 4INJA 2PX4A 3NHBA 4M22A 3QMWA 3W34A 3FDZB 4YBRA 4YALA 4RTSA 1G5TA 1F60A 2QTNA 4FFLA 4HTAA 4C4RA 3G6WA 1ZIOA 4Y2PA 1T6YA 2AG8A 1A50B 4M1KA 2PBRA 1RVV1 2G4VA 3RSZA 3UH1A 3O3OB 4L4ZA 4XVQA 3RS0A 4DJDC 5K0SA 5I7EA 4MGZR 5A0TA 3QEOA 3VKFA 4JOSA 4C0LA 3RUPA 4E21A 4Z2AA 1DV2A 4YREA 3U44B 2VQEB 1LEHA 1N6IA 3O73A 4PBTA 2Y66A 1C3OA 1MH9A 4TS3A 1P31A 4ZRMA 3SOZA 3TTWA 1FLDA 1PG2A 3TAXA 3UJDA 4A0SA 2BI4A 1JIQA 1YNSA 2H7VA 2N9UA 3AY7A 3OFJA 2ZSJA 1L8OA 2OBYA 4NE7A 5E6SA 2W48A 4ZQHA 2YBDA 4L02A 1GVNB 3MTAA 3VDMA 4K6KA 4OTZA 1JSZA 2C57A 4CTNA 1LI5A 5AVJA 1NURA 1G20B 4GXNA 3FVQA 2CFSA 4DJJA 3L8HA 1JQBA 3OH8A 3I5XA 3GVHA 1Q83A 1ORTA 2E89A 1E2HA 1Z0UA 1J8VA 3H1BA 3ZDXB 3AETA 2CC2A 2G17A 4TTRA 3K0CA 4GKBA 1BWRA 4E1VA 1P4SA 3IALA 1KQ3A 2C9BA 1AZTA 2IVZA 6LDHA 4AS1A 1A7JA 2PE5A 3O84A 1U7XA 1LBSA 4M0DA 2UXCB 1JLRA 4M1ZA 4JC5A 1M6YA 4WFKA 2GZMA 4TZ0A 2G7MC 3U09A 1L5MA 3OU2A 3HRKA 4UU1A 2DMRA 1T8RA 5A03A 4B7UA 1CW2B 2F62A 2ZRAA 3F2VA 3VH3A 4ETNA 4UQOA 3TECE 2O8BA 2R68A 5A3JA 2Y1OA 2PQMA 3A6KA 1ZD5A 1JKXA 5ALLA 1YR3A 4HXGA 5ES4B 4JVSB 3C6BA 2Y4OA 1FTGA 5L3VA 1R4MB 3ICOA 4IHJB 4JI5B 1C14A 3O95A 3RW9A 1LPNA 3C1TA 2FWJA 3DE7X 5EFOA 1YRHA 2W8ZA 3BG5A 3RLFA 4DZRA 3JPYA 3OM1A 3C3AA 4YRNA 5K3OA 3ABZA 4EGJA 1VJTA 2EC5A 4DDWA 1QBGA 3LTNC 3KC2A 1QP4A 1JG3A 5F1PA 2I1WA 4RTKA 3ZJVA 5ES3A 4FFBB 4A2CA 3DMTA 1DUSA 3E82A 3H3JA 5CXQA 1GGHA 4OIFA 2ZJ2A 2V7QA 2VYND 2CLOB 5KVCA 2OA0A 2WZBA 2AFVA 2ARKA 4BX3A 4D97A 4UNRA 4D9EA 4Z4EA 3SC3A 4XXHA 2HYIC 1UBNA 1R1DA 2HX1A 3K05A 4G67A 4TKUA 3UHOA 1VSVA 1DC6A 5D5HA 1NJSA 1NRXA 5CDSA 3ZDQA 1K3TA 2GPTA 3HHPA 3PEFA 1WB9A 2JRLA 4LDPA 4Y2UA 2Z5GA 4AO6A 3WADA 2IUFA 4PG4A 2WYIA 3HBNA 3P9XA 4XDYA 4AFNA 4E2FA 3EPJA 3UV3A 1HTBA 1ODCA 1NG9A 2XUHA 4PF1A 4AWBA 5FWYB 1SR8A 3WXMA 4DVJA 1UJMA 3S2SA 1UBOS 4A0GA 2H5EA 4YQYA 3Q1KA 4LHSA 4X45A 3TQTA 1R6AA 2EJVA 1DKPA 2RGCA 3GEGA 4GE0A 5FUBA 4M9XA 3NC0C 2Q7DA 1TAGA 2CDRA 3COYA 1Q0SA 2QTRA 5D3QA 2F8LA 4ZTBA 2IX3A 4CJXA 1E5XA 3OPVA 3P0HA 2QPTA 1JHVA 5HIKA 2QN1A 1XMJA 1HXHA 3CX6A 5HJ5A 1G0OA 2BF7A 4G1MB 4Y6PA 1O2DA 1ZNYA 4ZO4A 4K9KA 1YJQA 1QK3A 4WLVA 3ZH9B 1V5IA 2J46A 4ER7A 5JWRA 3MTJA 2LV8A 4M87A 3H83A 2YYAA 5BT9A 5IEBA 5IUKC 2P2NA 1GG9A 4QDOA 5HNKA 3E3LA 1EDZA 2F55A 2HQSA 3ADBA 4WADA 2RE8A 2QI9F 2J7PA 3SQMA 4ZI2A 4JAVC 3TEMA 1JDNA 2J5KA 1D2GA 4JQCA 1PD0A 2QV0A 5H16A 4BXOB 2IXAA 2JJ8A 3A2MA 3TRJA 4IJ5A 5ITWA 2XJ9A 4BXOA 3DG9A 4L9RA 4DM7A 3DZHA 3SYRA 2W6MA 1E3LA 2HIMA 4FIDA 4RY9A 4A91A 4B84A 3SDZA 5F3RA 4XRRA 2C4VA 2EJCA 1P72A 4MVJH 1YRBA 2VXYA 4BBPA 2J3KA 2CFOA 3VSDA 2QRVB 3FUUA 1E6CA 1ZZGA 3UXHA 4KNVA 3AX6A 3KUDA 3EBLA 1J06A 3DDHA 2C3OA 1RE1A 1LDYA 2RBKA 4LYYA 5C5IA 1I7SB 2OAP1 3VJMA 4FKBA 1SUDA 2I6XA 3IUBA 1W19A 3PI7A 1IIRA 4IDPA 5EIEA 4ONEA 1TT7A 3T52A 3M6UA 3CEJA 1QAQA 1CF2O 2HMTA 3V7FA 2ZSDA 2ZRKA 4ALMA 5LDDC 5G1NA 3LHFA 2NUTA 1UWCA 1R8SA 2ON6A 2CNNA 4I50B 1V8FA 3BMNB 3GJ3A 2GETA 3P9IA 3VRHA 2OCAA 5LL6P 3ZVKA 1VJ5A 1Y9AA 1UXJA 2DYKA 3DOFA 2FN8A 3UMRA 2Q2NA 3GRYA 1PGPA 3AUTA 4RLQA 5D2CA 5L51A 3FFTA 3IL2A 4AROA 2H08A 1VGVA 3MFQA 2R2AA 3LHKA 5LYJA 1V1MA 5D86A 5T6BA 3VR5D 2IOFK 2ZRLA 3NYRA 3SJZA 4DEXA 2O8NA 4OJKA 5AOCA 2WQ6A 3M6AA 4GWKA 1V5WA 3ACCA 3KLNA 4J07A 3OM9A 1AT1A 4PQRA 4ABTA 1W52X 2FJ0A 1OZHA 3VU1A 5BV7A 4RDXA 2W9XA 4GT1A 4HBZA 5AQ1A 1ZL2A 4DC1A 3DDSA 3EQ8A 5H8WA 4BZPA 2GBGA 1T9KA 3O8NA 2ZYDA 2Q3HA 3B9BA 4IKEA 3OQPA 3EVEA 4Q66C 1RVDA 2ZPUA 3G17A 3PKZA 1OYVA 4WW0A 5KPJA 2F8SA 3FN4A 4BWFB 1QTQA 4U7GA 2X5OA 2D1QA 4BLTA 2GCGA 1QE3A 3UAYA 4YUWA 1J9GA 2IS4A 4OI2A 1GCOA 2P5SA 1DWOA 2YC4C 4DV6B 3VI4B 1CY2A 1OIXA 2HLDA 3ZGOA 2O2HA 3O8QA 1BMFA 3G5AA 1E58A 1XF1A 3FLMA 3MN1A 1X9IA 5FTLA 1U3FA 3AEQB 1ORDA 1Q0HA 2FSSA 2PKEA 1VPWA 3TTXA 1M76A 2NU7A 1TLTA 3IQXA 2C5SA 4E1BA 2YJZA 4P83A 4AQYB 1HG1A 3LWDA 2B7CA 1LDMA 4KLZA 3WYGA 4GH5A 3X2FA 4JELA 1H6BA 4II2A 4GP9A 3H2GA 1VIMA 4GIBA 4YRLA 3THOA 1TCAA 5C8ZA 3OPYA 3RAEC 1R8XA 2DY0A 4V2UA 5DE3A 2V7BA 3PQ4A 1V9CA 2NNLD 1Z5ZA 1O9HA 2FZCA 4I08A 5TRTA 5B37A 1IJFA 3F3MA 1R0WA 2FWPA 2A78A 4V24A 3ORSA 2C4MA 1VCHA 4QIHA 5LN1A 2IBMA 4K81B 3UPDA 5HVNA 3USZA 1UPBA 5HFJA 2VXCA 4Z7QB 4NXMB 2FMKA 1GU7A 1WSDA 1RM3A 3PS9A 4K0KB 4H6XA 2ZFUA 3SQLA 1OVGA 3QKTA 2PS9A 4RZSA 2PKRA 1QLJA 4QM7A 1AMOA 2UZ0A 2AMYA 4XVCA 3WJ7A 2O3QA 1HO3A 1QCZA 2JJYA 2WUVA 3C3KA 4QVKA 1YASA 2G83A 2COKA 3F5MA 1ZIYA 3O7WA 4KRGA 2MHCA 3FDFA 2ZOSA 4GQIA 2BHSA 2UUCB 1ORRA 1JA0A 1R0LA 2P4HX 1EVIA 2W22A 2HLNA 2VHUA 3I76A 4OLFA 2FOLA 3NIDB 1EWKA 5HX7A 2W6OA 5DMXA 4XPZA 5EJEA 2QVZX 3DS8A 2Q5HA 5ECDA 2CSUA 4AF7A 3QSYA 1YBAA 5ALUA 3T5TA 3ROZA 2CLEB 2O0JA 5IJ0B 1V8DA 5JHGB 3M9XA 1QF7A 4H1TA 1Y0BA 2NAPA 1NC3A 3GJ6A 4H6WA 3WB1A 4CM5A 2DPMA 3D6NB 2NQ2C 1XJQA 1JXAA 1XXHB 3CGGA 3TVYA 1EZ1A 3ZHSA 1EP2B 1WHTB 1RXCA 1UKBA 2M9MA 4O2RA 4UUOA 4YPFA 3CVXA 2ZRHA 5T6MA 1UIMA 1E0JA 1EWRA 3AB7A 1V4BA 4IDEA 3GK3A 3IEVA 1O95D 3AINA 4NPAA 4O1HA 3T5BA 1X7YB 3T9BA 2XT9A 4FS3A 3FYTA 3G8DA 5HGJA 5AXAA 1KF0A 2WAYA 3Q8MA 2O0KA 2I29A 2EGHA 3O74A 4O29A 4R3NA 4D8VA 2Q6IA 4P93A 2XTZA 1ZY2A 2JCYA 1XX6A 4WZBE 5F1YA 3IELA 4RVGA 3RTGA 4HUTA 2JI7A 2JAQA 4X6UA 3MOIA 3W5UA 3IXLA 4WVFA 2VJBA 4B6EA 1ZESA 2FEXA 4P53A 3IPYA 3AR5A 5FI0B 1BKSB 1HQKA 2J4CA 4Y1EA 3RWOA 3DT6A 3I30X 4N7MA 1GV0A 1RIIA 1H2BA 4H1VA 1N1EA 4RVDA 3D7NA 3LY8A 4EO4A 2XKKA 3Q0EA 1NJ6A 3FNGA 3GP3A 1R4NB 4YT4A 1NXTA 5J1SB 3ANYB 5CFRA 1KVTA 3RROA 4O1MA 4J3NA 1DUIA 5C3UA 2KBEA 3LF1A 4YVFA 2IL1A 4AP9A 1H9CA 1A9ZA 3LE8A 3B1WA 3FWKA 3TLCA 5DB4A 1W4CA 3B1XA 1BHO1 3I6MA 4BEVA 4CM8B 1RAIA 1T5DX 3PNVA 1P8AA 1NBOA 1P0QA 4HUJA 4ZQFA 1M10A 5DOZA 2J4DA 3T4EA 2X4IA 5H9WA 1NVKA 1W87A 2R66A 3PNLA 5MN6A 4TMZA 1NVAA 1T91A 4Y1RA 4LJRA 3L1VA 3OVMA 4J6EA 2FG5A 4XVHA 2RHDA 1GPKA 3S2GA 5IKXA 3U5ZB 5JTUA 3B2EA 4CKYA 1EJ6A 1I7NA 1WLSA 1Z07A 2FSGA 3Q6NA 4LBZA 4KXYA 2Z2KA 3ZLUA 5ILGA 4HH0A 3AERA 2PXXA 1H22A 1HT3A 2VH5R 4O2AA 5TPZD 8OHMA 4Y6SA 2WFAA 3I9MA 5DH9A 3EZNA 3T0FA 5FX2A 4D25A 1XNJA 1BH2A 3FVVA 1VMIA 3KTDA 4IIJF 1Y3HA 4N5IX 3KQLA 2ZITA 3JWIA 2W90A 4J90A 1ONPA 1X74A 4HDAA 5TEWA 3ZXYA 1L8XA 1P2BA 3DFKA 3IBSA 2XA1A 4H7DA 4J29A 4KIJA 4UXIA 2ZUBA 2DLDA 3EPHA 3I73A 4ALJA 1QIDA 2DXIA 3HFGA 1YTUA 1IEVA 5KI6A 1RWBA 3OHPA 2BFFB 5IJ9A 1GCUA 1ZUHA 1WBDA 3C3XA 3MCWA 4MRPA 1XPUA 2YJ6A 4FZJA 1OYOA 1XNGA 2VDJA 3AEUA 3QEAZ 1T13A 3CLSC 1RWXA 2C1EA 3K0CC 3LU1A 4NAVA 4PYKA 1IH8A 1A9TA 3AJDA 3AM5A 3I9LA 5AW9A 2NU8A 4DCJA 4CEIB 3ME5A 2MSKA 3SQDA 4F6RB 2I99A 2HL6A 4FB4A 2B7BA 4C29A 4W1RA 4XH9B 3EIXA 2H1OA 2HPZA 1UK9A 2G5CA 3GNSA 4F8JA 3HS3A 3BD8A 4FI3F 3DZGA 1PKXA 3FB4A 2V65A 4KDEA 5KB3A 3PDIB 3JAKA 3RG8A 2DOKA 2Q3MA 2QLTA 3EXAA 3JQ9A 4YLEA 4BQQA 2XD9A 1JH9A 2B4YA 5BY2A 3W9SA 4FP9A 1DU4A 3GDHA 4D0RA 2YZMA 1YRLA 2AB0A 2E7ZA 2H6EA 3DM5A 4KH0A 1XL0A 1U1DA 4A0FA 2IYEA 2XYVA 3AVPA 4DE5A 1ZPDA 2IBSA 3ZDBA 3CCCA 3TG2A 3NC1C 4O8CA 5HZHA 2OYSA 3DBHB 4GRIA 3S55A 4ZYXA 1P2GA 3WRWA 5JJKA 3Q6MA 3U7GA 1X13A 2I7XA 1PWZA 3H0KA 1A8IA 1YB4A 4CU2A 4EGQA 1BJTA 2GUGA 2W6IA 3B9QA 4TLMB 2ZXUA 1DS6A 1GM5A 3MLBA 5BUZA 4LV8B 5KNDD 4YNBA 3DMTC 3L6UA 5HF5A 2CUZA 1ZNXA 1WXIA 2COUA 1MB4A 3PPVA 4X00A 1TMOA 1PRYA 1YL6A 3A9UA 3P9KA 1UZMA 3PQFA 4H7FA 3LVFO 2I2DA 1KP3A 2BMAA 4JJ4A 5I45A 2OHOA 5FUVA 4AMYA 2QRGA 2HMSA 2VAWA 2BFNA 3HKEB 3G5MA 1ODJA 2IYZA 4DPMA 1CR2A 3PQEA 3HWWA 1WL8A 3D6FA 3IEXA 1ZH0A 3F5SA 3WQBA 1DWQA 2FK8A 3KEQA 4OU4A 5KQRA 4IIDA 4OB7A 2YBEA 1M6HA 4REOA 3HBAA 5FWXB 1L8LA 4TWIA 4FWIB 4CUKA 1NUQA 5DM1A 5LIRA 5K3BA 5JT1A 4LCEA 1QIMA 3A9SA 4O4HF 2OCIA 3AC0A 3SZ3A 5BN5A 5AVQA 4Q4LA 4E07A 5FJIA 3BA6A 2RHRA 2R1TA 1II9A 3WMFA 4K9PA 3KO8A 1EQUA 5ITVA 4Y1FA 3V4PB 1W1UA 2EFHB 3ROEA 2I2AA 1SUEA 3EISA 5AH0A 1FSPA 1ECJA 5F5XA 4I9FA 1JHDA 4XSVA 3L05A 3I0MA 4MROA 4M55A 3I8XA 4DT1A 1GWNA 2FG6C 2RHGB 2HJVA 4P7KA 1DJQA 1HUQA 2DPXA 2W70A 3RAJA 3Q7TA 1OC2A 2QM3A 4FN5A 3SSOA 2OY0A 4OVKA 1CUBA 5CB4B 4B6GA 3CUEF 1MVNA 2Q3EA 4HHEA 1KDTA 2A1TR 5LKRA 1BCRA 1CG6A 1Y7TA 2AXNA 3PC6A 1QVZA 2HA0A 3M5PA 2QJTA 2C5LA 2HSGA 3MHTA 2EX4A 1VP3A 1E1CB 1Q0RA 4MX8A 3NG1A 4BY9E 2ZVDA 4U8HA 2OPHA 4A8HA 2ZDHA 3CQ9A 3VPBA 4BPBA 1PJ3A 2NUAA 2AYXA 2C4TA 2V3VA 3A1TA 5MGNA 3W90A 4L8GA 4WFQA 2PY6A 4PZLA 2O5VA 3O1HB 2F8MA 3NIGB 2X6TA 2J09A 4BO7A 2H4ZA 4BUJA 3ECAA 1DXQA 5JATA 1HFJA 3VR6A 1LRLA 4MYTA 5LVAA 4G0OA 4YHHB 3IP8A 2P9TA 1NW7A 5EZSA 2VEDA 3NETA 1PWEA 1L5ZA 4LTNA 4H0NA 3HKCB 1Y4AE 3K1JA 2BCEA 1ISRA 4J91A 3TD6A 2PTGA 1UWLA 5BW6B 3X44A 1N6LA 2WJGA 1AZLA 3OU7A 3AP1A 5FTMA 3M3PA 4Y2HA 1EIWA 1DOAA 5LZ5A 1JB9A 4P8RA 1OYYA 1RRPA 1GG2A 3VX3A 1RLTA 2FPIB 1T5HX 2VUIB 2P67A 3AF3A 4ZIRA 5K0FA 3S1SA 3RNLA 5CCBA 4LK2A 2ECKA 1KFBB 1XTUA 2BUBA 3NCTA 3EG5A 4Y6QA 5CTAA 1GRVA 1OFIA 5THKA 2X0EA 1QHXA 4TMYA 2WTXA 1MX5A 4YP5A 4BJ3A 5J4HA 3I5YA 1C7RA 4BVBA 2W42A 2IEBA 3T4UA 4ZZ3A 4X93A 5A2GA 2O05A 3ANLA 1A27A 1JF8A 1N6OA 1P1JA 3FCYA 4ND1A 1GNTA 4PX2A 4TV9A 3BTSA 4X84A 3H5LA 2PNFA 3KTOA 3FRHA 1EK1A 3PUZA 1GTG1 4B80A 2GEVA 4L1KA 2I5PO 3V8VA 2CLCX 3OJWA 4EF4A 4HQ6A 3SSNA 2YYYA 3PSHA 3Q41A 3ZDFA 5A6SA 3REQA 1QH8A 2Q6TA 3QE3A 4Z54A 4BHTA 1SBHA 5T8KA 4PYLA 1GNVA 1YC5A 4V0SA 2Z5LA 4BMCA 3W3ZB 3V1TC 4BGVA 3ER8A 5TNXA 4YY3B 3E5MA 4F4CA 3ZY3A 3K6SB 3ZHVA 1UEXC 3SR3A 3B5IA 1B6SA 3J81k 2O2IA 1CUAA 1PGQA 5BV0A 1DIRA 3F8SA 1WCYA 1DCTA 4HGRA 5HK9A 2RGYA 1QQ5A 4E4YA 3O03A 5CITA 1DRVA 3DW1X 2JANA 3OSZA 3IQDB 4FQ7A 3F78A 3QJ5A 4M8IA 2CK3A 1Z68A 5HIJA 2J9FB 1KQPA 3DMNA 4OSPA 4ND8A 4PLCA 1OASA 2G63A 5JH7F 3D0QA 2NWQA 4K9QA 4NG4A 4KV9A 4WXPA 4MV9A 2BYTA 1D4OA 1I4WA 1JZQA 1VDMA 1I51A 4EJ6A 2LRHA 3LT4A 5FBQB 3LYAA 4XARA 3TRFA 1TC2A 5K0JA 1UKCA 5IKMA 3PPWA 4MH0R 4I3HA 3QOYA 4LRTB 5C32A 4I3GA 3TLZA 2FZWA 3HPQA 4KQMA 2DB3A 1PK7A 4G41A 4B3IA 2X1HA 3UT5B 1XEAA 4Z4GA 5JI2E 1G55A 2A3RA 3IUPA 4WDRA 3HJNA 1TK9A 4DBLC 2AJBA 2PKYX 3T95A 5CT4A 5G3YA 5BR1A 4FHCA 5IX8A 3ENKA 3WK6A 1JXMA 5EY5B 4BFUA 4KDFA 3A1EA 1GLNA 2B1JA 4C76A 4N0PA 4EEXA 1Z6YA 5BQFA 1XYVA 3FYDA 5TMEA 4CM7A 2JG3A 2DTDA 4XASA 1CJUC 1I14A 3OI7A 3P2OA 4RXMA 3P27A 1OTYA 2CVPA 4KE8A 3NBMA 4FFRA 4EYKA 5E1OA 3WLAA 4G2NA 3STYA 5IDWA 3P20A 3TQRA 4YRBA 2ADFA 4M88A 2X4LA 5AW5A 1U11A 3W2HA 4AVYA 4RA6B 2VRWA 4TV8A 4EUFA 1IOLA 1P9OA 5AP9A 4C4XA 4YPVA 3PXGA 1CSEE 3IUQA 4UMVA 1PE0A 5ALMA 5F7JA 3DMFA 1U2QA 2YOFA 1UXGA 2EJTA 3EZYA 2JPDA 2JFXA 3KVVA 4TWBA 4Y2TA 3TFWA 3AJAA 5E8RA 2RAFA 4BBZA 5AJVB 3GRCA 3IAS1 4EOGA 1BW9A 5CURA 2A5FA 3O0TA 4A5SA 3K20A 1DKNA 1V6AA 3WYAA 2I4LA 1E69A 3SXUB 2C1ZA 2J7KA 2MSNA 1U28A 1U9CA 2VLIA 2WIGA 3EN0A 5JCPA 4M8NE 2YS7A 3PCXA 4PC6A 5COAA 3B7PA 3UMYA 1PT7A 5KVVA 4PFKA 1ISFA 1WPXA 2GXSA 4JYPA 4GZLA 3TZCA 1CV2A 1IY0A 4OMCA 4PSUA 1UBHS 1VJ1A 1KI3A 5JSQA 2KE5A 3DHYA 1LDNA 2A4KA 2CVOA 3OO0A 2E49A 2R8PA 5D3MA 3RHSA 5EN4A 2J6CA 2KB0A 2W5UA 1M5RA 2QP4A 2H59A 3DOUA 2YFKA 1KMHB 2ZTUA 3AR7A 3HVKA 4O4JB 4G37A 3OTOB 3H75A 1VZ3A 4X3OA 3GR6A 1M1UA 4ZJUA 2CHVA 5CLJA 1CZKA 1AN0A 2FY8A 4Q3BA 4C6RA 3RU2A 1II0A 1IN5A 3MM4A 4ZA2A 4BMSA 1P18A 1XYYA 5CA1F 3HUUA 3U0VA 1KORA 2OOSA 1UBFA 3PT9A 5K6AA 2B8JA 4IDDA 3EF1A 1PEYA 2WICA 3AEYA 2DETA 2PM8A 3IURA 3M8KA 5IM4F 3HTXA 5M3BA 4X91A 4F5ZA 4YXWD 2FMUA 5E6RA 1VLHA 4QOEA 4CTKA 3UN1A 1GZVA 3FHCB 3N7TA 4DLTA 3NHAA 5LA6F 1U3WA 2B5WA 2WU8A 3KS9A 3KK0A 4HB3A 4BB0A 2HWYA 2Q4TA 1EHYA 3V2GA 4B85A 1M1XB 1T0UA 1Y1QA 4DV4B 1MRNA 1ZK0A 1Y8CA 3VYUB 1AA9A 2OLKA 3F7NA 1W93A 1DIHA 3PE6A 1Q44A 2PLNA 3IQHX 4R71A 1N2CE 3GFFA 3L1JA 3V34A 3PA6A 5TQJA 2J87A 4D99A 1JQLB 4EZIA 2FGKA 3F7OA 3SXPA 3KB8A 3DXFA 4MQ6A 5J4KA 1EBUA 2HCFA 2X76A 1NLMA 2B8NA 3KKLA 4FOOA 1AUPA 4NL4H 4X1YB 2PRIA 2XD4A 5FEMA 4XUGB 3RV4A 5GQSA 2J6IA 5HW0A 4B2LA 1T3LA 4ZQGA 1ZQ1A 5AQEA 2JGFA 3IV7A 4X85A 3S6JA 3PQ8A 2VJCA 1WP4A 3WL6A 1JXQA 4E5MA 1KAOA 3W5IA 3RYHA 1CYEA 4D96A 4B3XA 2ANBA 4EPTA 2HYDA 4YO8A 2C84A 3D31A 1A9XA 3AIIA 2QTCA 1OUMA 2IZOA 1G2PA 1K75A 3QPBA 3FDJA 4IV0A 4PHHA 3VMFA 1GZSA 2MWMA 4MW5A 3G02A 2D1RA 1QM5A 3WQSB 4XRGA 3EPRA 2JAHA 1I24A 4YDSA 1BMTA 3N8DA 3RPEA 5MFPA 1P2TA 4DIKA 3TLBA 4QXRA 3GV0A 1E77A 1E3DA 3DULA 3RVSA 5JXGA 3RS3A 3KJXA 4L08A 2GF2A 3DUWA 1QZUA 2VF2A 3T06B 1TZKA 3KHSA 4LJLA 4NJOA 5ERGB 2L42A 3RIYA 5MN5A 3LPLA 5HILA 1I2DA 5EXTA 1TU4A 4ARAA 4A8JB 4LFAB 1K7EB 3STXA 2NO4A 1GU1A 1OX6A 1K6XA 3DOIA 4Z0TA 3WLMA 1EA7A 3ABQB 2OK7A 1XFDA 4F45A 1YNOA 3ZHCA 3ZZMA 2ETXA 2GB4A 5I3CA 1Z6TA 2BDEA 2OSBA 3IP7A 3M70A 5AKZA 3T8YA 3ESYA 3ADPA 3JQ9C 4Z3KA 3A6FA 4TS9A 1HGXA 3ZJ5A 4GL2A 2XNDD 5B58T 3AXSA 3OUTA 3ER9A 1E2GA 2PU7A 3ETHA 4JY7A 1P33A 4B31A 3NUZA 1JZTA 2GEJA 4NMXB 2A9FA 3GEDA 1LTKA 4I9NA 2UVQA 5CLLA 4YO7A 1JTFA 2FN9A 1E2EA 1DPFA 1KY2A 1WUKS 2OGWA 3I28A 3L7CA 4N12A 1ICEA 1W85B 3AI1A 4PC7A 5FBLB 5LSAA 1IXZA 4PLWA 1H1LB 3AVOA 1M2OA 3K30A 1ACLA 4ZCMA 5KTMA 3HU3A 3F6RA 3R4VA 2YL2A 3IR6A 5JDIA 4CKCB 2R1UA 3DMPA 2FF7A 1J0XO 1ECFA 1QH0A 3OFND 2VN8A 1SCUB 5DP1A 3RJ5A 2O07A 4RZHA 1NW4A 4ARIA 5B53A 2FPPB 2GHQA 5E7JA 3MWEB 3VO1A 4IGAA 3UMVA 2I71A 1DPGA 2FFAA 1YT5A 2IDJA 3MBIA 4B6JA 1GZHB 1UK6A 2JFZA 5A9SA 3K2EA 1CY8A 5AVKA 2AZMA 2ZQ5A 1H3EA 4RH3A 4LKRA 4RD1A 5IYZA 3OO1A 2JCXA 1XL1A 2HK6A 2O0HA 1SBQA 4IZ6A 5JZ9A 1WDLA 4U2CA 1VE5A 2RHTA 1KIFA 5ERXA 1Z7WA 2BGWA 1CTQA 1R0SA 1TE2A 5KOJA 1LH0A 2XNSA 1KC1A 4NDNE 1W9HA 2H9IA 3TI9A 1QNFA 1U5BA 1CJTC 2EZTA 2YHIA 3MLAA 1TM4E 3QX7A 2OZPA 3D7LA 3P9QA 4MRMA 4QT0A 4KO2S 2VDUE 4CKWB 1WBBA 1Q7RA 4B79A 1GNQA 1WPGA 1HZJA 2ZWPA 3ZD9A 3SJBA 3F8TA 1E9DA 2YRWA 2IIBA 2C2KA 3L7OA 3ONVA 4MVJM 4K28A 1H23A 3VPDA 1L5HA 4JH0A 5BT8A 1XC7A 1E0DA 1P9NA 3OPXA 3U4IA 1DBSA 1YQTA 3GVCA 1X38A 3ZLVA 3N39C 1ODSA 1LV8A 2BM8A 4TTJA 3TSYA 1E7MA 1UUFA 5ICFA 3P5SA 1JSRA 3BTUA 2WLTA 3MPUA 4HPXB 4MGEA 3AI3A 4ZEMA 3HZRA 2Q1TA 4JEMA 4X8OA 2JBAB 3H4TA 1M1YB 1HDXA 4ZKDA 5K3DA 4LSWA 3T5AA 1IN4A 4D74A 1E7YA 2PZ8A 2JFVA 4I81A 1E3EA 1ZHOA 1QH1B 5DX1A 1UPFA 1GZ4A 1CETA 3PEVA 3EEOA 5ENVA 1O6CA 4LDRA 3TWOA 4GECA 4BU0A 1OAAA 3UNXA 1ZNQO 2HNAA 4ICIA 2H31A 1VPDA 2EAUA 4Q12A 1CHDA 2H2GA 2EFGA 1VYTA 3PX2A 4FHDA 4Q7LA 5I4CA 3QELB 3SPXA 4RD0A 1LTHR 2IIVA 4MI6A 2PT5A 1H65A 4XCQA 2C5GA 5IAAA 2EX0A 1TECE 3KAJA 4DUGD 2AZXA 2QY6A 3BK1A 4QFMA 2HB6A 3A0UA 3AIMA 1Y8RA 4NS4A 5D6NA 2HAEA 2W6JD 2Z8ZA 3A58B 3DD1A 3GRKA 4HDNB 5ERYA 3SCZA 5M29A 2FA9A 1UDBA 1UPCA 4D80A 1CVIA 3EMKA 4V3CA 3FKSD 1F7UA 1KMNA 2IJGX 3FWHA 3EGVA 3FVRA 4BECA 2F90A 3A2LA 1T43A 1G59A 1QU2A 2WQZA 4PZCA 2KM1A 1ZD4A 1RIFA 3R6DA 2PL9A 3NZEA 2V3WA 2BSAA 1L1RA 1SKBA 1SVWA 2YX1A 2AXQA 3GUUA 2NYVA 1O95A 3QF4B 4GOLD 4LEIA 1CUIA 5E4JA 3TLMA 2XSZD 4FE4A 3PRJA 3Q8LA 3U4HA 1W581 1U9YA 3EGDA 4GF5A 3IEMA 2AOUA 1HPLA 4P5EA 3VZSA 3JVDA 1U0TA 3RI3A 4PYRA 4X63A 4KXXA 3WYFA 5CMLA 2FUKA 3QEMB 1MPTA 2FP3A 2A0XA 4BIIA 3MJRA 4PYOA 4KHPB 3U49A 4LBYA 3QU5A 5LPNA 4UNSA 1ZCJA 3ZCRA 5CVCA 4MO9A 2I2CA 5JXWA 4COOA 2Q2OA 4NSNA 1WULS 2VDOB 3FETA 2RHWA 1PBTA 2IXGA 3IAUA 1S8NA 3KT0A 4O4LF 2JI9A 2JAPA 5DIZA 2ZRBA 4GNKA 1ZD1A 4GVLA 2B7LA 4JXJA 3HRHA 2PS3A 5L3SB 1IQRA 3JQEA 2C2XA 1FUEA 1KK3A 3ECCA 1EZ4A 1V95A 1WXQA 3BEOA 1AGRA 5T8KC 2RKBA 3D8HA 1HRDA 2XH8A 4I6GA 4R2JA 5ELMA 3O8DA 4PYIA 4TLBA 4WJLA 5DN6D 2ZZMA 4QYMA 3BOSA 1GILA 2JLCA 5LJLA 2VHXA 3PSAA 4RIEA 4CM4B 1KEWA 2X8JB 3R23A 4BNUA 1TOAA 2R4TA 1QYXA 3EF0A 5G0TA 1H1TA 2OQ2A 4MA4A 1V3QE 1ND6A 1J7KA 1J70A 3CLVA 2GSWA 3BSWA 1LJ8A 1XE3A 3GVIA 1GDDA 1E98A 3IEIA 3IDOA 3GLVA 3B6JA 4D9MA 3ITKA 5G0WA 3T7RA 3KL2A 1KR5A 1PNQA 2HRCA 1LTQA 4OBEA 5EKXA 4CCYA 5FI5A 4IDOA 3B38A 1J9EA 3E8MA 5JECA 1SM4A 5BN3A 5G41A 4TT8A 2IW1A 4OQPA 1L4HA 2XKBA 5DGTA 5KSPA 3K16A 2QN3A 1THZA 3PGMA 4EYQA 4GUAA 1I1HA 2ATCA 5LNK1 3GELA 1U2RA 2A35A 1KXZA 1BRTA 1Y3DE 3LT1A 3PKJA 4XFKA 4Z1MA 2J0QA 3CLRD 1S02A 1LPMA 2NO6A 3C3BA 4D9NA 2VDWB 2ZAMA 5CA0F 2RGNA 4W6ZA 1J56A 5BV8A 3JZAA 4M0CA 5I51A 4ER3A 3H2JA 4XM0A 1A8SA 2ZRFA 4GDFA 2ZIUB 2G5PA 3L7JA 3OT1A 2PK3A 4R2LA 2O3JA 2Z2IA 3BWYA 4L74A 4Y9TA 3OEHD 2J32A 2O3SA 1C8BA 3KVOA 4LGVA 4OQZA 1GN9A 4YH1A 4DC0A 4YN3A 2HJWA 2QB5A 2HT1A 4JX9A 1T8YA 3CKMA 4IIGA 2WTAA 3O7MA 1RXWA 1QZXA 2XGSA 4URWR 1ZH8A 4EMBA 2R11A 1SCBA 2GESA 2ZRMA 5E9JA 1YZHA 4X71A 1PNRA 3CNHA 4DSNA 2PEYA 3L0BA 3QTLA 4EVQA 2VP9A 4ER6A 2PX0A 1E4OA 4YP1A 4PPGA 2HK9A 4YV7A 4Z3OA 2EWWA 1Q2XA 2NG1A 1SVIA 4Q82A 3H5VA 2OVBA 1IWOA 2HU5A 4H7KA 3LOPA 1KWKA 1NMQA 2YMPA 5JS2A 3R9WA 3IUNA 3WIUA 2DHCA 5M2QA 1ILEA 1U28C 2ECPA 4FGWA 4CIXA 3WGUA 3W7AA 3ZOZA 4BLOA 4BV3A 4AX8A 3GF4A 4RMGA 4TKVB 2XZTA 3CR8A 4OD0A 1QRRA 4EW3A 3F47A 1ENYA 1B14A 4XQEA 1NZFA 3JR3A 3JQGB 2NVBA 3ABRB 1B16A 5G0UA 1OX5A 1TPYA 2IP4A 5BVGB 2CDBA 1RC0A 1HFWA 2HDNB 5AWFC 3ZJYA 1CIPA 4HDSA 6Q21A 1QX4A 4M9QA 3S1AB 4PCVA 3TLXA 4FFPA 4EENA 2QE7D 3HABA 4IH1A 4S35A 3GDWA 4FX2A 4YASA 1M8KA 2VAXA 1Y7PA 2N0SA 2VBFA 2R6ZA 2EEZA 1A3CA 1XZKA 3AJ8A 3WY9A 1KVUA 1QUEA 3BN3A 3HYLA 3AR2A 4I14A 4YAFA 5AI5A 3MJEA 1Z39A 1CDOA 3I3SR 4D26A 1JSCA 3NVDA 4MW4A 2FZVA 3DO8A 4QRDA 1L4NA 3TKYA 1T2FA 2W8BB 2V6FA 2IDMA 3PUXA 5AICA 5FUWA 2W93A 2W2KB 4C2UA 3OQIB 1DP4A 4QTXA 4DNXA 2CXOA 5K6AC 1Z2DA 2YICA 5FBRB 4AYTA 1ORHA 4YMUA 1YAHA 4LOHA 3LL7A 2B4KA 3BD7A 4OHRA 2WJHA 3K7EA 3V4SA 4BDTA 1JUDA 1YS6A 2VXOA 3DVAB 1KGDA 2PEZA 3HWSA 4FFWA 5FTWA 4ZVOA 4EB6B 3I1FA 1LBQA 1X7WA 4XA8A 3WL5A 4N6NA 4KTVE 2FMHA 4ETMA 3QVMA 3TDNA 2GWHA 2IZ7A 1D3AA 1E60A 2P1ZA 3ZV7A 4URYR 4ZVNA 2C29D 2IYYA 3H5NA 4C3ZA 2LUOA 1ZJZA 4GZ5A 4O59O 2PVPA 4DIEA 2QEQA 5JR3A 5F5LA 4BNTA 2OBNA 4ZAWA 3BFVA 3C7KA 2W37A 1SVSA 2AOXA 5EHIA 2WHYA 5IC5A 4EL0A 4IWYA 3BD6A 5F1KA 2ETVA 1K4MA 1LK7A 3LXUX 5ARBA 2X1VA 1DX6A 3D2LA 4FYHA 1TVKB 2O2SA 1ZXXA 1SBZA 1E2BA 4HOYA 1Q92A 3I53A 2PWZA 4ZEOA 1XDDA 2QZJA 1K8RA 3P2JA 4B6OA 4JI4B 2OESA 2QX4A 2EHJA 5ENDA 1W1IA 3CUSA 3HYCA 3P0FA 4NJMB 4Q7KA 4HDKB 1IYZA 2BFEA 2HLPA 4JLPA 4P81A 4KQIA 1NMEA 3I72A 1JQ3A 3A9WA 3G79A 3P0RA 3QPCA 5FV4A 5EERA 3RIMA 4K5QA 5LQUA 1GLVA 2GN9A 1RI2A 2UYOA 3CEAA 2DFVA 4LDAA 3HWX1 4B09A 2AHOA 2A14A 1U99A 1RE0A 1SXJD 4YUZA 4G5HA 3HHEA 1NN0A 2J0UA 5E6UA 2IPMA 3Q72A 4YBZA 4UD6A 1Z36A 3U7QA 3ZW8A 2PQ0A 3FROA 2IXDA 4TXMA 4E7OA 3M5CA 4H7EA 2JFPA 4QEDA 1N4AA 4TSFD 1WCWA 3KT3A 2VG8A 1KH3A 4Q00A 1EJ2A 5HZMA 4IVPA 1SG0A 1M34A 2J0VA 1L5KA 4M60A 1IZZA 4GLBA 3LQQA 4OI1A 4MQFA 3NASA 3R5SA 1B6GA 2DBRA 3Q1LA 3LGXA 4MTLA 2PA3A 3JWGA 1RRFA 1MJGM 1SEPA 2AFHA 1XCGB 3NU1A 2I33A 4PC3A 1KYYA 1QRAA 4DLLA 4CLXA 2O6LA 4OHOA 5JZBA 1PYGA 1G66A 2ODAA 3ZV6A 1JEJA 2YY5A 1EX1A 3SFVA 5CB0A 2B25A 3GGOA 1MMFB 4PX3A 1IXSB 4CMCA 1BC5A 4L2IA 4ZOLA 1KL7A 1CRPA 1GUAA 2XLBA 3AZOA 4UAVA 5E38A 5LLSA 2V9PA 4LRUA 3TVDA 2GZDA 4XVUA 1CB7A 1LC0A 4BCBA 3RRJA 5FYQA 1S2DA 9ATCA 3L7NA 3NPAA 2HA4A 3U3JA 1RPAA 2XVYA 4H31A 4QATA 4Z53A 4TZTA 3LUPA 2IYRA 3UENA 4BQNA 1UMKA 4HH4A 4F86A 2D7CA 3T9AA 4A9AA 2F4VB 1EE1A 2PX3A 3GGPA 4IMJB 4L8YA 4BZQA 5JDIC 4MARA 1JSXA 1XMSA 4NZOA 4H1HA 2XXBA 3I04A 5G2OA 1U8AA 4MMXB 3T7EA 3LGSA 3AQIA 3ULKA 4F2GA 3GDOA 2P9ZA 3G2QA 2IYXA 4PICA 2DX7A 1EP3B 3D8SA 4IRXA 821PA 5TX7A 2I6UA 5LWHA 1DRUA 1RJFA 3OCCA 4TRNA 5EWLB 4RL6A 1U8ZA 1XHEA 3N8KA 3ZTTA 4RD3A 4RY2A 1FFEA 3OSUA 4TWRA 2C5AA 2F3UA 4K9SA 5JPDA 1J5EB 2GEDA 2PO7A 3DTVB 3FWYA 4NBUA 3PPYA 4US0R 1JEEA 1X39A 3CW2A 2OHXA 3FKQA 2IHKA 2V0CA 2W2LA 4YAOA 2Y77A 5AK3A 4QBGB 3RTDA 3MCZA 4JITA 1CUEA 1IG3A 1VE7A 1ZN9A 1UJ5A 3H2SA 5HJ2A 1UJ6A 2FMIA 5G40A 3MYYA 1L4YA 2IPAB 1Q7GA 5D00A 4E94A 1IM5A 4LHWA 4R1SA 3M83A 1GPLA 1ZN7A 1H1DA 1M7BA 2I1VB 3EEFA 4PRLA 4KXVA 4KPFC 5BOSA 5BR7A 4ENPA 2CSXA 4QD3A 1I3KA 3ZI7A 4RLSA 3SX0A 1WS6A 5E9WA 2A58A 3P2IA 1JAXA 1VFPA 3SBXA 4YJ2B 1YJ8A 3OLVA 2FLKA 4MCJA 3EFOA 3HUTA 1JKJB 3WGQA 2O4CA 4MKXA 4EI9A 1BN6A 3TLGA 2WUFA 3BWCA 3FE2A 3PC8A 1A9RA 1XQWA 2GZ3A 2B4RO 4NARA 5BWLA 4LHEA 2R751 1NRIA 3S8YA 1CRQA 2E4UA 4ZZ1A 2I2WA 1ZWLA 2DG2A 1M9NA 2DUMA 3RHZA 3MWFA 2FN4A 1ICIA 5K0BA 3BMCA 3LYHA 1QQAA 3K1ZA 1D2CA 1ZW6A 2D5CA 2MSCB 2QSZA 3KFXA 2GJ8A 3JQAA 2CWWA 4BVJA 3LC1O 2E6UX 2NT4A 1SOUA 1FIUA 4XKJA 4TQGA 3Q5DA 5TMBA 5TLSA 3VKGA 3PR3A 1W36B 5TPWA 4CR8A 1R0XA 1E6WA 2OCPA 1LLFA 3ISVA 4P82A 3QUCA 1TGVA 3V8RA 1WCXA 3W5SA 2VYQA 3WFJA 5I7VA 5EZYA 4EPVA 3MILA 1SKYB 3IAEA 5I4KA 2Z6UA 1ZBQA 2VDKB 4ZI7F 1MOZA 1WEKA 3PQ5A 1DQNA 1Y1LA 1DTWA 3DCJA 1TTTA 3I5AA 3R7BA 4Z9YA 2IY7A 2RDMA 3F6PA 5T3YA 1R0ZA 2WJ3A 4KNYA 2BEVB 3F5FA 2GXAA 1I36A 4IW3B 1RJGA 2X13A 4MS4B 2ZPAA 1BA2A 3HDYA 3KEFA 4IO0A 4J2TA 4URFA 2ZCJA 3PNPA 3L7BA 3KQMA 4Y0AA 2ZUTA 1TUIA 1XPOA 2VWGA 2VPZA 1EFCA 4G1VA 2VT2A 4PCLA 3P71T 2DWQA 4WNAB 5LQSA 1E3TA 3UCEA 1O95C 3HL0A 3V7UA 3T3OA 3OE7D 3SBOA 3D81A 3R7LA 5CDTA 2OENG 2IW3A 3AI2A 4CIDA 3A11A 3Q2OA 1NNI1 1KDZA 4TVSA 3L02A 4F4JA 1KI9A 3FSRA 3LP6A 1JR3D 1X0XA 4JB8A 3I8SA 2GCEA 5BWBA 3R76A 3QWFA 3BXPA 1J0AA 3D7RA 3D5QA 4L0DA 3Q3CA 3ADOA 1ISGA 2D2IA 4JYMA 1RBZA 5BUCA 2C61A 3AB3A 3IPRA 3PLRA 4BP3A 4EW1A 1DAOA 2Z1NA 1YUNA 3JRWA 2H00A 2TS1A 3IOEA 3N87A 4K6OA 4N3CA 3TR5A 5LP6F 1XCPA 3I62A 3MT0A 3NOOA 5CUQA 1DBIA 2OFFA 3SJ7A 1QB8A 2J8ZA 1G0NA 4L72A 2CXSA 2A1UA 1JFVA 2BMFA 2AVDA 3TUJC 4EO9A 2DKNA 1M75A 3PVZA 4C89A 2PMWB 2PRZA 5C0OE 4DM4A 1X15A 2PSJA 2H1VA 3EDMA 4X41A 3GZNA 4PR0A 1NUAA 2AHRA 1IBSA 1GSAA 2WMNB 4TWJA 3RS4A 3EQ2A 3SGLA 4JLMA 4PC1A 3FI9A 4X60A 3H9CA 3TDMA 2EP8A 1V2HE 4R9SA 4DR5B 4FZ3A 4WA8A 3FMGA 2RGAA 3PFNA 4PZZA 4UU8A 1I7DA 5JD4A 2FQWA 2OOKA 2QSYA 5C31A 3EXG2 3NS7A 3GLHA 4F3RA 1BX3A 4MINA 3AY6A 4IGKA 4ZVMA 1E62A 1W8IA 3AZPA 4JUFA 3V6MA 4F4UA 3JSAA 4BGDA 5K8IA 4I5GA 1W4AA 1X1DA 4JMLA 1ETUA 3A28A 2VDVE 2VYCA 4EA6A 4L07A 3ZWAA 4PWZA 3FMPB 2FZKA 2ALJA 1UFKA 4NCKA 1HOTA 1NJ1A 1H2AS 1CUWA 1GHTA 2Z8YM 4QOHA 4B73A 5B3KA 3FHOA 3BBPA 3GRVA 3KXKA 2FX3A 5FNVB 4R1LA 1P0MA 3RVDA 5HRUA 3IE1A 1Z2OX 1MCZA 3JD2A 2JB9A 1FFGA 1SKUA 4FFVA 1F4PA 4UEKA 3ZWPA 4LYEA 1T15A 1Z12A 2GYUA 2LNDA 4JODA 2RGNC 3AU8A 4QARA 2GR9A 3NQ41 1DKUA 1N9KA 3ZHYA 4AAYA 1N92A 3R3YA 1E6LA 2ZIZA 3RVQA 5K7SA 2AKEA 1HFEL 1T4MA 4AZTA 1MC1A 4K6HA 5DRYA 3ZCTA 2BBSA 2I1LA 2Z3ZA 1QK4A 1BGVA 1WCV1 4UVHA 4Q9IA 3GGSA 5JAMA 4TYMA 1OH7A 4CUJA 2GPWA 4H18A 1A9QA 2GHTA 2XCUA 3VHXB 4DRXA 4EHIA 1WTCA 5C4GB 4CFSA 5F52A 4Z4FA 3D8BA 3SICE 3LG2A 3W2FA 4JKIA 4B6SA 3O2QB 4JP3A 4Q9NA 1RNLA 4Q4HB 2OCKA 2FMFA 5AKHA 1NVVQ 1W0KA 3TJZA 1Z8DA 3EA5A 2Q6VA 4C0SA 4JD5A 3PGXA 3UW1A 4DRYA 1EEXB 2Z6AA 4BUZA 4LG1A 3BFKA 5K8CA 1PLJA 4W6QA 3GLIA 2BEUA 3QRWA 3MMNA 4QSHA 2PXHA 3S70A 1IXKA 2HRBA 4D9IA 2XUOA 1FFXB 1WAMA 2XYGA 5AUNB 2XNDA 5IRCD 2PZBA 1L4FA 1U3CA 3H4IA 1S2MA 4FQ8A 4HEHA 3H1TA 4IKOA 3VNSA 4RLFA 3ZK8A 3V1UA 4FXPA 3ZE8A 5JNSA 2DWUA 1B4DA 3MFYA 4E5SA 1SZDA 3DGFC 1P0FA 4Q6WA 4ZHQB 2QXTA 1AXGA 3E5HA 3O26A 3E8XA 5ETJA 2RGUA 2WAAA 3FBGA 4KQ6A 1U02A 4M1WA 2EDAA 2Y0DA 1VG9B 3DAGA 4KXWA 4OP2A 2IT1A 4BJ1A 3VVLA 3CEPB 2PT9A 3CXRA 3M5DA 5IF9A 2AFIE 3X1KA 4OLBA 5GOZA 2ONJA 4PHGA 2CNDA 1KS9A 421PA 2I6GA 3FF1A 1TB4A 1FMLA 4GM0A 1D6SA 3QPAA 5SY4A 5TIIA 3H8SA 2BBTA 3ZVNA 3QVJA 1BVHA 3K8YA 4HX5A 2Q9UA 2ZQYA 1ST3A 1YFLA 3ASZA 4E31A 4UHHA 1NBIA 1KI4A 3AJEA 1ECCA 1XHLA 2XRMA 2UXDB 3DV9A 3EZGA 4B5KA 2Q1SA 4Q1AA 4C22A 3U13A 2JCGA 3PUIA 1Z2CA 2C5HA 3QU4A 4DADA 4DHWA 3KU4A 3CNBA 5KQGA 2NO1A 2P0YA 1O77A 1SU8A 4Q4JA 5JLJA 4B0PA 3LZDA 1MO3A 3OY7A 1JFFA 1O54A 1NKVA 2V6BA 1NFRA 2R1ZA 4RFSB 4FIZA 3DA8A 3SNKA 5EEHA 5KNBD 4EJ2A 4DYDA 4IBOA 2AN4A 5LMNB 1SKMA 1C1YA 4JSYA 1QGZA 3Q3VA 3QK7A 4KRFA 2QYTA 1KIAA 3IJPA 3V4OA 2ONCA 4CPDA 1S4MA 1ZJYA 2ZT6A 4MLPA 4QUKA 1ZM4A 2A5YB 1DAMA 2HY7A 3WRVA 2EHDA 1KBQA 3MINB 2J3DA 3K0FA 5GONA 4B34A 3I2FA 3KKKA 1D1TA 1E7QA 2ZR7A 4X9XA 4OEHA 1H8HD 3V7YA 2Q1YA 1WWKA 5KU1A 1ZGJA 1VSBA 1BE1A 2DECA 3ESCA 4KPUA 1Z37A 1I0LA 1UMDB 3EXEB 5LZ2A 2DFLA 2QZZA 4MQBA 3EPPA 3KYCB 2G09A 2IITA 1YAJA 2WKPA 4YCMA 2O1XA 3KHKA 3CHYA 5EP3A 4BNMA 3WO1A 4ENTA 1E2MA 4M0FA 3MUEA 3K96A 1PS8A 4FPXA 4YECA 4M0KA 1P2SA 2JDIA 5EJ9A 1EE2A 2DQZA 2WBLC 1T2NA 3PFIA 1E0SA 2B4QA 2CDCA 4EJ0A 5EWJA 2G04A 2WUGA 4ZO8A 4DUGA 3DW3X 3KUKA 1JPVA 2XITA 4EKIA 1G8YA 3O93A 2X40A 3RH0A 2BSXA 2F6RA 2W6JA 3USES 4FKMA 2OUIA 3H9JA 5FULA 5G02A 4LC1A 4B1FA 4D3DA 5CA1A 2RAPA 1QC5A 4YFVA 2QD3A 3VJLA 5AW4A 2OZLB 4CN9A 5FWNA 5EJFA 4PLHA 4KITB 3U3XA 2PLWA 1N36B 1U04A 5CBKA 4M86A 4WECA 5GIPE 4W1SA 5B5SA 3LXXA 5LXTA 4OL0A 3ZU2A 5EMKA 4GMXA 4FC7A 5LA6A 2JZNA 2XSZA 1G7RA 5I8ZA 2JGNA 1CY7A 2O8CB 1S01A 1AK1A 2I62A 3KJEA 4U2GA 5IAKA 4YUAA 1NF8A 3CH7A 4JJFA 3B36A 3IHKA 3RQIA 3EXFB 3QVVA 4N8DA 1UZNA 3C39A 1W25A 1EGQA 4AS2A 2WSSD 3A6ZA 1GZ7A 1CUCA 3E81A 3EIFA 2XCLA 3GI1A 3KQTA 4KN5A 4TSKA 5E0OA 1NNEA 1QFJA 3EVGA 5FRDA 3ZU3A 2WM2A 3IEPA 1FYVA 1Q7BA 5JALA 5K3FB 3X1JA 1EUCA 2Z9CA 3GDFA 3EIUA 1OPXA 2FPMA 3UH0A 1JFLA 4LXGA 3WK5A 2P2CA 4NBLA 2VO1A 1NVVR 3AP2A 1A2QA 4W8OA 2G06A 5ESRA 1HE2A 3H11A 2V1XA 3GPBA 1TA9A 2IEAA 2O2JA 2DC1A 3WMEA 1SY7A 4O6VA 2AD5A 2UVPA 1ATZA 3KD3A 1FFDA 3HA5A 3FNFA 2GRUA 3MTIA 3N70A 4MYHA 3NONA 4NU8X 3CN7A 1GL9B 4ZYWA 5HWSA 2ZIAA 1M7HA 1JHQA 5EXSA 1P8JA 4XQ0A 4HY3A 1XZMA 4GWLA 2FPLA 1W75A 1F6WA 2LPMA 3CRVA 3Q2IA 3D3WB 4G0ZA 3CXUA 4TYQA 1U0SY 3W5AA 3RIXA 3BWVA 4GE3A 1K0UA 1KARA 2HF8A 2N3ZA 2Z08A 5EE5B 3TQCA 4LS3A 1I2ZA 5DX0A 3WLNA 2QE6A 3G0HA 2BRUA 4Q4AB 3WNQA 4ESHA 2FX5A 3ETJA 2HLHA 3QPDA 4CTOA 3EHEA 5EWMA 2E48A 1ZK1A 4UTVA 1PT8A 1C50A 1B93A 2C0CA 3NP9A 4HN4B 3AR3A 1GAQA 5A6VA 4NDAA 2CXUA 4AURA 2IIPA 3RBAA 1XDBA 2B3DA 4MGHA 4OQNA 3PC8C 2Q45A 1O0CA 4JI7B 4I1SA 4A16A 5IABA 3OLQA 4BRSA 1NF9A 5INTA 4WKOA 3DFZA 3IOBA 4O4IF 1KKUA 2F3TA 3WIOA 3R20A 2QUAA 3ADDA 2OXFA 3GJYA 1VPTA 2H2HA 3UUEA 4YUXA 1ZUNB 3RV3A 4YV1A 3LL4A 2VRCD 1HOXA 1B1CA 1PL6A 3ZGLA 2REXB 2XZDA 1QG4A 2WWVD 3V1MA 4P4SB 4P3YA 2AMJA 4I55F 4INZA 3L1HA 1NJ8A 1OLSB 3RYTC 5I48A 3CPEA 2L82A 3LDFA 1VI5A 2OHIA 3FGPA 3IULA 4J7XA 5EEGA 1SH7A 2LE0A 5K2MA 3PDWA 4C7VA 4Q34A 1V48A 4GXTA 2DHEA 3OU6A 2P7HA 1WF3A 1M6VA 4OG2A 1Y7LA 4BO3A 3T34A 1KMCA 3VJKA 3W8FA 1NNLA 4YWJA 1WDMA 2C07A 5LOVF 2VK1A 4JVMA 4Q15A 4RVCA 3TG8A 1ISPA 4HYQA 2XUJA 3FDIA 2IYFA 3PXBA 4D5EA 3ZOKA 1MDBA 5GP1A 4J1QA 1HR0B 2X3FA 3C14C 4EEKA 1IY9A 1WJGA 1NVUQ 3L4EA 3UF0A 4GC9A 1J39A 4AM8A 1AKUA 3UC9A 1OMOA 2ORYA 3O1JC 4EG6A 1B15A 2QT0A 1GTRA 1FJ2A 5BSTA 4ZAZA 4TSRA 5J5CA 3KZCA 5IP5A 2OYRA 1PX0A 2PZLA 3GT3A 1BDBA 3H86A 5JSZA 1FX0B 1SCDA 3VXKA 5EAIA 4B3RB 1U0LA 1XN1A 2HHLA 1AV6A 1IU9A 4UM9B 4IS2A 1F3LA 2LWIA 4P31A 3LFTA 4JJKA 4KR9A 5BWCA 1WXEA 1B3RA 3BMOA 4RGYA 1BXGA 4HWKA 1U2EA 1LK5A 5IDVA 1RS0A 1B23P 2Z4TA 1D8TA 3UMGA 1EUDA 3KE8A 4RETA 1RXYA 4HRAA 4P34A 1KSGA 2HH9A 2QU8A 1KO1A 1EFRD 2PMFA 1FW6A 1E1QA 4WOKA 3BBLA 2GEBA 4EHBA 4IRUB 5C5EA 1ONBA 1RQ7A 5IAJA 2BH9A 5DW3A 5JNVA 1U1IA 3L3BA 2OZEA 3OJ0A 3R6TA 2Z43A 1UP7A 4NHEA 4ZCRA 1XCMA 2QMHA 1P1HA 1I7LA 5EUQB 1UZUA 3ECSA 3AR4A 4U00A 1PV2A 3TW8B 3W04A 3NJ4A 2HFJA 1GAEO 4RKYA 3NT2A 4CETA 4P38A 1QP7A 2VJMA 1OLXB 3PIIA 4QNRA 4LVOA 1N78A 4P2BA 2IYLD 4YT2A 3BGVA 3K31A 1SG9A 4L4SA 1HDIA 3U3DA 5KX5B 1DXHA 3IEUA 3LYLA 1DMRA 2VP5A 1GD1O 3GHYA 1M0SA 1WKVA 1GTJ1 3AEKA 4AMZA 1OBOA 1W0JA 1W96A 2AF4C 2CJXA 2D3WA 5KDLA 3SSMA 4ZJPA 1G5FA 4I1OA 4UVEA 5EZQA 3UFXB 3UGKA 4XIIA 2ORVA 1ZJWA 3PF9A 3I01M 5B58C 1OZGA 3BHMA 4R83A 4L0QA 2LD4A 1YA6A 5DWQA 5CDGA 5L7WA 2MSEB 1DTEA 4LQCA 5JNTA 2JH3A 3NIFB 5IFLA 3GLTA 3C74A 4JA2A 3AV0B 3SLKA 4WTOA 3A8TA 2PWPA 5HJEA 1M2FA 3P2EA 4ND7A 1C0KA 4GZ3A 1OTXA 3UATA 2A5DA 3DZFA 2B20A 1QNLA 4WCFA 4R40A 5KNCD 2ISQA 4R8SA 4AKIA 3T41A 2PDAA 4UHBA 3AKDA 1XDZA 4MJ7A 5FBZA 3SKYA 1Q84A 2QP9X 2C99A 3I6IA 4WLFA 4A10A 1UKYA 1FK8A 3DBVO 3EHDA 3PNQA 4MRRA 2OD7A 3T15A 2DEUA 1L7MA 1NVWQ 2JLRA 3OQ6A 4QO8A 5DBGA 1SXJA 2QL7A 1AUVA 4QLOA 2BR3A 4BMPB 5JQGA 2EP5A 1TO6A 4GX0A 4QYWA 3LTEA 3LXMA 1IONA 5J5AA 1C9NA 4MWGA 4OP1A 3X3HA 3I58A 1V8OA 4OQ4A 4ZEXA 1SO8A 5IULC 1LPOA 2IS1A 3EG9A 4GLOA 3OX3A 4UVIA 3H2BA 2JRCA 2WMYA 3QENA 2OT3B 3GZTB 5IJXA 3TDKA 1EUYA 5HEKA 2FG7C 5C8YF 1GQFA 1YTLA 2DBYA 2GTHA 3N2GA 3A32A 3O21A 1G2OA 2PKXA 2J0SA 4PEVA 1ZM9A 1T5SA 1IZ9A 1ZVQA 3H97A 4RA9B 3RLIA 3ZGNA 4XVRA 1WV1A 2OM6A 4LWQA 3I2IA 2EDCA 5CXSA 3K9BA 1BX0A 5AHKA 3ZYCA 3LRPA 3B2QA 4JK3A 2HPAA 2NO0A 1FMCA 2ZM6B 4PO9A 2ZAOA 1OD6A 3FKJA 2X0JA 2PNJA 2EF0A 4XSHA 1UWKA 3JQ7B 1JPNA 2JCVA 4IO1A 4BFSA 4EQ6B 5CPBA 3RC2A 2QN2A 3QY0A 1N57A 2B21A 1HYEA 2DRIA 2J9ZB 3OF5A 3ZK9A 2QGZA 3W0LB 4F6CA 5EE1A 3R3VA 4ZEWA 1UQRA 3PHJA 1NQOA 1SVLA 3OIFA 1G9XA 4IOJA 4UREA 4N6OA 2D2FA 2XMBA 3CY6A 3ZCSA 4B4KA 1KI2A 3I9FA 1Q1EA 2C3UA 2G1KA 1H4VB 1JQJC 3R7AA 4BTLA 4DCMA 3NWBA 3I1JA 3OMXA 4X94A 4FW9A 3R7WB 1VA4A 5IZ4A 4F38A 1IPEA 2C58A 2XA2A 2ZIXB 1DCKA 2IHZA 3B20A 2WT9A 2XDWA 4MW6A 1Q12A 4LTMA 2WJPA 1YOVB 5CBPA 3THYA 5H3CA 4NZNA 3FNRA 2JK1A 3CH4B 2HIAA 3DFFA 1A98A 4HEJA 4CLOA 4PXYA 2CEKA 2D0DA 3A1VA 3FFBA 4K9NA 2OXTA 4BKUA 2PKQO 1DAIA 3VFDA 1EWVA 1GZUA 1YB5A 5KYTA 5C1BA 2WP8J 2SCUB 4HNQA 1N6HA 1EPUA 3N2LA 1WTAA 2BY4A 2XE4A 3NXSA 3HB4X 5GV7A 1VJ0A 4EW2A 2GJ9A 3HP1A 3WX0A 2XE6A 1J2YA 3QITA 4GM4A 3GGCA 3BD9A 4UBLA 3ZZTA 5K4GA 4PTYA 5IKOA 5P8WA 4GL4A 1Y8QB 5TF4A 2RFLA 4K9LA 4CGYA 1J2EA 2D5AA 2ZT7A 3W7BA 3N2NA 1O3YA 2OCYC 3WLKX 5PGMA 1K68A 1N3YA 1TLLA 4EFLA 3QBTA 3RIGA 3TZBA 2JFYA 3PPXA 3F0TA 2YWEA 1TZCA 1W46A 3OZFA 4CLRB 2J30A 4DXHA 5H5JA 2RH5A 2GBFA 2IEZA 5A04A 1JWLA 5CD1A 5J2UB 4OIMA 2BGJA 3GYGA 3KPYA 5A7GA 4XB6B 4UEQA 1FS4A 3CRNA 2Q50A 1KFKB 2QGNA 2FPGB 1HTWA 3HBLA 4V02A 4WEQA 4DVGA 1RXUA 2NSHA 3JQPA 1JKIA 3A3NA 5DBEX 3AVYA 4X6XA 1EUQA 4BKRA 4BWYA 4TOIA 4EPWA 1U5CA 2FEOA 5FBWB 1J8DA 1IRXA 5C7IO 1P5HA 5JC8A 3DO6A 1BROA 2EZ9A 4RVUA 3IMGA 5A5EA 2QVYX 3AHEA 4MRVA 2RIRA 1K5DA 3SU8A 3ZCXA 4ES6A 4G0UA 4R2MA 4RIHA 4H6VA 1BWPA 3OC0A 5CM9C 2IUUA 3NUQA 1G20A 3JQ6A 4U39A 4BKMA 4DSOA 3OT5A 1NASA 3DP9A 2EZ8A 3JATA 4N0MA 4EKYA 3H8VA 4R8KA 3PGJA 2BMVA 2DH5A 3TRDA 4F2PA 1OE0A 1A2BA 3UB2A 4JLDA 4QPZA 4HEA6 5LQKA 2GKGA 4J9UE 5DHTA 3DAOA 5H70A 2YQZA 1KJQA 3AG5A 2FJUA 2FSHA 5IT9A 3AYZB 3ITDA 2VI5A 1UFQA 3PA8A 5EYPB 3SHOA 5KJ6A 3HJFA 4DV0B 2H1WA 3PG5A 1W5AA 4NCJA 3RF7A 3TNFA 1LQTA 3UY4A 3MWDA 3WWOA 1P3DA 5HMMA 4KXQA 3W06A 4N8EA 3UAOA 1H4QA 1P7WA 3BXEA 5JAHA 5FPTA 3VR3D 3GMTA 4OGGA 3BFJA 1E7WA 4G8DA 5LQDA 5C7OO 5F73A 2PPLA 1RWVA 1WMEA 1E2IA 2GXQA 4NXNB 4BNIA 4QEZA 3AFHA 5D8DA 2WMOB 1VL5A 1AXEA 1E2NA 1JR3A 2PS1A 4XZ3A 1PSZA 1BEEA 2FWRA 3DMHA 2VYVD 3D8NA 3HB9A 4JU9A 1VG8A 5NLLA 4GZ6A 1DG3A 4U0JA 1R4MA 2QYSA 1YH3A 4IHJA 1B7GO 4M1SA 1KDVA 5K0EA 4YRJA 1BA3A 5F3WB 2ZVQX 4IIYA 2J4FA 3GUVA 3H2HA 3SEAA 3PLAE 1G4UR 5B3LA 3FPKA 2J59A 4GBGA 4QQKA 1DQYA 2ICAA 4OX9B 3W2IA 3G7NA 3LIIA 5IC4A 2D4HA 3G5LA 4FFBA 4QQ8A 3AHHA 4E2XA 2XCSB 2AQKA 3FUVA 4A23A 2D1YA 5EQDA 4CMBA 3DXZA 5LZ9A 2UUBB 3WBKA 3QVGA 4OLAA 3FZQA 3OIWA 3WGLA 5C35A 1L7EA 5C9ZA 1BEUB 3GEIA 1QX3A 1DIAA 1HRKA 2V7VA 2W11A 3K9WA 3LCJA 4HLCA 4I4TB 3QWHA 4MKZA 2Q28A 4OUDB 1TIPA 4JLWA 1E4YA 2HQBA 4M2LA 3EY9A 3QVWA 2C0PA 4RVNA 1LF0A 2A9VA 3CUVA 3QV2A 3WWPA 5HUHA 1XA0A 3T7IA 3DONA 1PBNA 1OX4B 2V5AA 3DNPA 2R4UA 2EL7A 1P5JA 2YWFA 3AWIA 6NULA 2IUSA 2FGJA 2VS1A 1Z33A 3QTTA 2A9QA 4YR7A 1DG1G 2BRUC 3L0PA 5FWYA 5JS1A 1DDIA 2QHXA 3HCWA 3FLAA 1S9HA 3EGIA 2CCJA 1C2YA 4CIWA 3TQOA 2WVAA 1DT5A 4YRSA 3CUWA 1A82A 2NZVG 3DC7A 3GZJA 1D4AA 3QG5A 4MLCA 3VZRA 3FYCA 4B44A 4E1AA 4JUBA 2Y93A 2QROA 1E3WB 1W35A 2VTDA 3TD9A 4NBNA 4N49A 2XNCA 1YSCA 1DKOA 1B1AA 1M8JA 1O89A 2F43B 1CY1A 1AQ6A 2BHTA 4IYJA 4M99A 2LDXA 4KWHA 3K09A 3G7SA 4E5YA 3CLRC 3NAMA 4C08A 1F0YA 4L5IA 2J6HA 5ADWA 2GRJA 5DWVA 3I2HA 3PXDA 2FOIA 4JB2A 4MW1A 4EK9A 3GG2A 1QFSA 1YL7A 1RU3A 1ZVKA 2IX9A 1G8AA