4UPVA

Low x-ray dose structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIFE-HYDROGENASE SMALL SUBUNIT
publication title Crystallographic studies of [NiFe]-hydrogenase mutants: towards consensus structures for the elusive unready oxidized states.
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
total genus 81
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4upvA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4upvA02
3ZEAA 1H2AS 2FRVA 1H2RS 3AYXB 4KO1S 5JRDS 1UBOS 3CURA 1WUJS 5JSYA 1FRFS 1UBLS 4IUDS 1UBHS 1WULS 4TTTS 5ADUS 4UEQA 1UBUS 4UD6A 4KN9S 4UQLA 4UE3S 4UCXA 5D51S 1FRVA 1E3DA 4U9HS 4UCWA 5A4MS 4KO4S 5A4FS 4UPVA 1WUHS 4UD2A 4UPEA 1YQWA 4C3OB 4CI0B 4UE6A 4KO2S 3MYRA 1UBRS 4UEWA 4GD3Q 1CC1S 3USES 3RGWS 3ZE9A 4U9IS 4UE2A 4UQPA 4IUCS 2WPNA 3ZE6A 5JT1A 4KO3S 3AYZB 4URHA 3ZE7A 3ZE8A 5A4IS 5JSUA 5JSHA 1WUIS 4IUBS 3UQYS 1UBMS 1UBJS 5JSKA 4KL8S 3CUSA 1WUKS 1YQ9A 3H3XA 1UBKS 4OMFG 1YRQA 1UBTS 4UCQA 3USCS
chains in the Genus database with same CATH superfamily
1JEYA 2HK9A 1TIKA 3LCCA 4OHXA 3VPXA 1PGNA 1JSRA 2R7NA 4H35A 3NBYC 2G63A 2AE2A 2FW7A 3ESYA 4PC2A 1ZQ1A 5FNVB 4DMHA 5MGBA 3BMCB 1NV8A 2ZUEA 3MWDB 3IA7A 2OP1A 4HNHA 4DCOA 4EF5A 4YXWA 2UVDA 2OGZA 6PFKA 4RNDB 1LI7A 4A2WA 2WUVA 3D8BA 3GY0A 5EJ5A 5KWEA 3RIGA 1CZNA 3KWJA 1X0VA 1G4HA 1N2ZA 2JD0A 2P27A 2PV7A 1OTXA 3UK1A 5ICSA 3IODA 1AJEA 3CLHA 2A9FA 3ZGOA 1G2OA 2ODPA 3IILA 3O21A 4OMDA 4JP2A 4IJMA 5EP3A 3VDMA 3WB9A 4UBMA 2FMKA 4DUZB 2FEPA 2OZLA 2P0EA 3LY9A 4INZA 5GZ3A 1OU0A 2NV6A 4K7JA 2Y2UA 3B9BA 4RY0A 2G5CA 1AUVA 5EZQA 3X2EA 1ZL0A 1RPZA 1JQLB 3H9UA 1RXSA 5KNBD 3AEYA 4BE9A 4BQRA 1BJTA 4E5UA 1GGHA 3IB3A 4TXHA 1QS0B 1P7VA 1KVSA 4JP5A 1R8QA 1HT2E 1H6DA 1OJ7A 3BXGA 3E3LA 2QG4A 4ZD6A 2UXDB 1G21A 3HJBA 3RQSA 5J23A 5T64A 1YUMA 3Q72A 4GL4A 4BFSA 2IXFA 4PYOA 3VH1A 2TYSB 4CEJB 5K3EA 5IUJC 4G4IA 1NVXQ 2I87A 3J7TA 5CX1B 4KPUB 4HB0A 4B4VA 5AOBA 2H1HA 2XWQA 1EAYA 1GV1A 1LLFA 2XGJA 1SH7A 1Y37A 2ZYDA 3ZE9A 2FG5A 4LZLA 3RM3A 3P71T 3R3HA 4BQFA 2BM0A 5LP6C 2ONCA 1CY1A 1MB2A 3HBLA 5EIBC 4Z1MD 1XP8A 2FEMA 2G07A 2V7QD 4LBYA 4X92A 3ZWAA 3E7WA 3ZY2A 4UU8A 1MO5A 2M98A 2FSPA 2GSWA 3D6TB 3FFBA 3L7IA 4RGVA 5AHXA 1F6DA 3WLRA 1TEHA 5G0TA 3V1LA 4ZJZA 3WAJA 1E2BA 5IKEA 4OG2A 3REFA 5TS2A 3T5BA 4JEHA 2G70A 2ECPA 2J8ZA 4JD5A 1Y6FA 3RS9A 1SXJD 5FLKA 2HV8A 2G6TA 3I9LA 3Q0EA 2DJ5A 4JOBA 4AO8A 4F11A 1QO9A 1VYTA 2Z08A 3B9PA 4DREA 2NX2A 5DCYA 2VAPA 1ORIA 5FAKA 3UICA 3G2NA 2ZJ4A 3ZE7A 1YA4A 5MN6A 2R6AA 1SXPA 3WB1A 1F7VA 1OYWA 3CCFA 3VTKA 4BJ1A 3R9XB 2ZJ3A 1W8IA 1YZFA 5A0FA 2XH8A 3UAVA 5F9FA 1XZQA 3EYAA 3SOPA 2IH4A 1YDMA 2AFVA 1YZNA 4JLAA 2XVMA 2WYHA 2WJ6A 4ESVA 2YKGA 2JH8A 1N5RA 1NNUA 2QRQA 2TS1A 3RUAA 3MGCA 4JJ6A 3ELWA 3FBGA 1TFRA 5DLEA 5A0TA 2GYWA 4J1TC 1PR9A 2RK3A 1UANA 1F48A 3OX3A 2Q6TA 3RFXA 3TQRA 4MV9A 3WLJA 5AIBA 1BROA 1CXZA 2H5IA 4XDHA 1Y7IA 1N1GA 1U28A 3WGOA 2P40A 3DHYA 3QMWA 3C3DA 1JRLA 2AFIA 3PEUA 1L9XA 1Q0HA 2AXEA 4WK2B 1OXXK 1JKMA 3AFIA 2FEOA 4OFXA 1GTRA 1XB2A 3H2ZA 2QA5A 4WBNF 4N7RA 1Y6ZA 4TMVA 2HAEA 3K0EA 4GM0A 1ZSNA 1QYVA 1DUVG 1MPTA 2FN8A 2R2GA 1OILA 1E2NA 4UOQA 1RABA 4WW0A 4WNAA 4DT1A 4QUJA 1G9TA 1CY0A 3A2NA 2DPXA 5LKAA 2JCBA 4EW1A 3KOYA 4C3ZA 3SU8A 3LRPA 1AA6A 3BIWA 1S2LA 3H3JA 3A9SA 1HYHA 1UKZA 4S3MA 4U4AA 1X1EA 3K09C 1UBHS 5K0NA 4F6RB 1GL7A 2ANBA 3PQ6A 2Q8PA 2C2YA 5CYOA 3WSVA 2QZJA 4D46A 3PCRB 3ZWNA 1JA0A 1PZGA 3OH8A 3QWBA 4K9QA 2Y27A 4GP7A 3NHSA 2AJLI 3HCBA 1BN6A 2XF8A 1EZ4A 3CS3A 4HDMB 4R0MA 3L0IB 1ADYA 2XKBA 1XPRA 3HTXA 1DT3A 3ZI4A 5ALFA 3TLJA 1UWVA 3D6VA 5LMNB 1XZJA 1QCZA 3MGKA 2AOWA 2ID4A 2YV2A 2ZT7A 5LQNA 1UWLA 3EEYA 3OBBA 1NR5A 2AYYA 3EIUA 3QLUC 1NVEA 3WJ1A 1PTJC 2B5OA 1L4HA 2X9VA 4ICIA 4JT2A 2XQFA 1CR1A 1Z45A 4PINA 4QTXA 1G20B 4EVSA 1RMTA 2GDZA 2QMEA 3L84A 3D1VA 2WZCA 3WLLA 4YT4A 1F2DA 5HRCA 2IODA 3IJ5A 4E2XA 4NKRA 2CXXA 4DV0B 3VC1A 3FTEA 4DR4B 4MCIA 3BZUA 4MHTA 4LYJA 1ZK3A 4R2LA 5J1TB 4BVLA 4DPKA 2YCBA 3LYAA 5FEMA 4OHZA 1W1UA 5DYGA 4BMDA 1E32A 4QXAA 1UZUA 2Q3MA 3WXBA 1Y4SA 1J7KA 1H94A 4XLTA 3TIIA 3KQKA 2HNKA 3MVEA 5AI9A 3WWOA 1FVFA 1H22A 2F17A 2KQUA 4MA4A 2HCFA 4LRYA 3INYA 2VDWA 3BA6A 3G8YA 2P7HA 2GM9A 2QRZA 4DW8A 1NQWA 2Z1NA 3LU1A 2CL6X 3DE4X 3OLWA 4L5BA 1L8XA 1C8KA 5EZ6B 1XAIA 4ZAYA 3TFQA 3PJFA 3VR3A 2MYTA 1MQSA 5CVDA 3C3BA 4Z0HO 1Q2XA 1G64A 1DXYA 2R86A 3KQSA 3D6JA 1TI7A 1R27A 3MNFA 3UMRA 3NI2A 1CNEA 1SCBA 4MW4A 1L5QA 4BQPA 1KU0A 4QARA 4BQIA 2FOLA 1Z7YA 1RPAA 5FLXA 3D1LA 1H8EA 1L5SA 4I9NA 2VZ9A 4OQMA 4AJHA 3TZBA 4ABYA 1Y3DE 2Z6VA 1JLLB 3K1AB 4R1MA 2JGMA 5CJ2A 1CY4A 1KR5A 3IKMB 3DE5X 3JQFC 1JEDA 4LKOA 3SAJA 4CCYB 2CE7A 1KNXA 3SKVA 4MKFA 1QPGA 3ES9A 3LQQA 4S2EA 4KQFA 5FV4A 1ZG3A 2VJOA 3FLMA 3KOMA 3L8GA 3GRVA 4Q9JA 1RQGA 2F2TA 1X87A 4Q21A 4OH1A 1GTMA 1HDIA 1X38A 5LZ4A 1X0XA 2JK1A 1XNQB 3FE2A 4Y7CA 1XI2A 3RHSA 2NU9A 1GZ5A 3L01A 1EVYA 3ZE2B 1HYGA 2BFEA 5CDHA 1JDNA 2HU5A 4E32A 1ONOA 1RWKA 1W0KD 5GZ6A 1BU8A 3T7IA 4U6SA 4I8IA 1IY2A 1L7VC 3PPXA 3QZUA 3DOEA 1IB0A 1H8HA 1V6SA 2QM3A 1Y5MA 4GI3A 1U2EA 4Y98A 3IOMA 2AR7A 4HNVA 4YMUA 1DPGA 1EFKA 2A1TS 5KNCH 3ZLJA 3PWTA 3D0KA 3OFNA 4RVCA 4NU8X 1G42A 3QPCA 3WFJA 4AJOA 1KXJA 4KO1S 3W5AA 3R5TA 1YS7A 2HSZA 3C3KA 1XTRA 5L7TA 2GEFA 3HMQA 1VHQA 4LX8A 1N6OA 2E21A 4TRNA 4TS3A 4JQCA 1MNQA 2G04A 5BN4A 3BG5A 1D7OA 1DUSA 1Z17A 5HUHA 2VTBA 5MHTA 1TC1A 3MT8A 1EVKA 3VPFA 4ZKDA 2I99A 2CL7X 1N8KA 4MWEA 2VYCA 1RQ2A 1DZ3A 2XEXA 5HYVA 3RSSA 5K3BA 2IKSA 2QTCA 4BBJA 3TH5A 1FNSA 2F3SA 1T0BA 1A8IA 2C2GA 1OBHA 3E9MA 2OAEA 4TSRA 3GLTA 2J9ZB 1ZPDA 2NN3C 5C8DA 2Y1KA 4PZDA 4KIFA 1CS0B 2QD3A 1Y0BA 3QNWA 4RCZA 5I6DA 2CCKA 3V1NA 1L8OA 3SVTA 1SVUA 2VT3A 1T4MA 4YIHA 1YVEI 2GESA 1WUHS 2GF2A 3EEBA 2ZWVA 3IUNA 4QG7A 3SR3A 4Z7JA 4OLFA 5A6SA 2HHJA 4KB5A 2JGDB 3AV3A 3KZNA 2IEDA 3GLUA 5L40A 4BN0A 1H5NA 2WUGA 3Q9UA 3AEUA 4IIXA 2Q4TA 4QM6A 4K81B 1CUWA 5WRFA 3OTIA 1OLUA 2UUCB 1OA0A 1EHIA 4MUNA 1K86A 2HWYA 3PFHA 4XUDA 3ZWBA 1SOAA 3EH2A 4D8TA 3HKEB 3TSZA 3W8RA 1P9RA 4B87A 4CN9A 5B7NA 2Z2KA 3RBXA 4CQLA 1XZKA 3IEMA 5JQGA 4I1PA 3FSGA 2ERYA 3QV1A 1UJCA 1AZWA 5EEGA 3RODA 1O9BA 4MEBA 3A1UA 4H4DA 1ZO8A 1R9JA 4HDNA 4NCKA 1JDJA 3PX3A 4IMPA 7REQB 1O97C 5CBKA 1ATIA 4QAQA 4RK4A 4G85A 1UPXA 1ACLA 4XDYA 5D3MA 1ZUIA 5IN5A 4JXZA 1UKCA 1EHCA 4DIEA 2AF4C 4ZI5A 3AU9A 1G0OA 4MS1A 1J9ZA 4R1PA 4DM7A 4F2HA 5E38A 3ZGYA 1NP3A 2AW5A 2RHRA 3E3AA 3CCCA 3N75A 3LGAA 4I7EA 2EFEB 4RBNA 4XTRA 5DX8A 4E7OA 4UNNA 2HJGA 3LGSA 3TQSA 1HTWA 2HDWA 4HDRA 2WWHA 1FY2A 1YI0A 4KQJA 2JI4A 4IGIA 3SN6A 2RHTA 3TQHA 5KOHB 4E2ZA 4GKJB 1DRVA 3OUZA 1V3TA 4CMBA 1KOGA 2EVWX 2ZSAA 3H5NA 5FH9A 5H1YA 1PJQA 2JLSA 3K05A 2B4AA 1H1LB 3SOZA 1ANKA 2KE5A 2M9MA 5ALNA 1N0WA 4M60A 5JMPA 3V8EA 1NAHA 4GOMD 2XYGA 3UB2A 3UEOA 3OX2A 4C01A 1HUQA 4PVDA 1NQAO 3L7AA 2WNHA 1KO5A 3LHSA 4ARZB 1LPBB 3KT6A 3KZOA 3MJHA 4Q3LA 4W9RA 3O73A 5KPJA 1K63A 1MBZA 1W1WA 4GMDA 5I47A 4NU5A 4C3VA 3BREA 5HJ2A 5DGHA 3T95A 1KZ7B 3MTIA 3ZVLA 3L8MA 2FKNA 3ZBQA 1TDJA 3H2HA 1XVIA 2P90A 4B81A 2EBFX 5JC8A 3FFAA 5HDBB 4A8PA 3QUSA 3D3JA 1EBUA 4OHFA 4XQGA 3TQIA 1MH9A 1PT6A 4HEHA 3STHA 3CLTD 3H7IA 3PHLA 5H16A 3UUWA 3DTVA 2PMKA 3S1LA 4NK5A 3T7KA 5TQ0A 5GGYA 4YRNA 3KYJB 1KI9A 3E9QA 4HDCA 2VT6A 1U9YA 1TT5A 5H3CA 1QHYA 4TKLA 1K27A 4X7PA 1P4SA 2IDZA 4YJHA 2J3DA 2W5UA 1GKIA 2WKQA 4WZAE 4RHXA 3PWKA 5EJGA 4UBLA 4B3CA 4OI2A 2AEEA 2C1ZA 2UDPA 3UUEA 4BO0A 5D8DA 2EQ5A 2NUTB 1US8A 3BXOA 2YHBA 3ZKWB 3KR9A 4Y9SA 3LNCA 3L0SA 1V8BA 5KVAA 3DBOB 5HS6A 4QFBA 2W4MA 3HVKA 5F35A 2V0CA 4ZFNA 3G5TA 4B7UA 1ZOLA 1SG6A 4PU0A 3HI4A 4EBBA 1FP6A 1E2EA 1VRCA 2A5DA 4YXWD 2G7MC 3A58B 4L5JA 5H59A 3ENKA 4HDSA 4YCMA 3LECA 4R3WA 2WUWE 1WW2A 3FYCA 3NM6B 3OPXA 1ECGA 2ZBFA 4G0ZA 4Q15A 1N0UA 3EVCA 4IHQA 5J59A 1ZISA 4JBIA 3VHQA 3H9EO 4C7VA 5BWBA 5JFOA 3GP8A 3ED5A 3G9XA 4Y6LA 4BP1A 4ZJYA 4L07A 2EX4A 2G77B 4PLVA 3ROPA 4Z4GA 1PFUA 2O7NA 3FZNA 3JQ7A 1TYDE 3W5BA 1V6CA 2A67A 1UZMA 2ZYRA 1ZIXA 3JQAA 3QPAA 1KE1A 5JJBA 3D64A 3IOYA 1V1JA 2A59A 4JLOA 3SEAA 2R8RA 1USVA 2WWRA 1HEUA 4JJKA 3RSFA 4FGJA 4KXNA 1VI6A 1QH1B 3ENQA 1ZOIA 1D8TA 4MW1A 4ALLA 5JADA 1RPJA 4C6RA 2TMKA 4EO4A 1ETHA 2ACKA 1QK5A 2X5XA 1JR3D 1KOLA 3MWJA 2PX8A 4J1NA 3BH7A 2RD2A 3WRXC 1O8BA 5SY4A 4M8KA 3ET5A 1FF9A 4OX9Y 2A35A 1A50B 4YI5A 3R8XA 1BE8A 1BDJA 2QT1A 1JEQB 1M2JA 5LYJF 1Z3CA 2O8DB 4NQRA 1Z4JA 3D4NA 3MJVA 4TTSA 3ZQUA 3GVCA 2FWJA 3LX6A 4J3FA 4NR0A 4DB4A 3N0WA 4RAOA 2PCJA 2CJFA 5J63A 2QKYA 3RAPR 3N8KA 4Y2GA 1FFWA 2HRZA 4OI1A 5JJIA 2Q5IA 1NRWA 2DLCX 1P44A 1KF0A 2CHUA 5AK3A 3COYA 3F8SA 1E2UA 3FMPB 5HE8A 4EB6A 3C24A 4D3XA 4DF3A 1IBKB 1UH5A 1U9IA 2XMGA 4LV8B 4MWTA 1XA0A 1IZ7A 3H8VA 3KKOA 1GFZA 2IYTA 3ODGA 5FO1A 3Q98A 3TKAA 1AIPA 3F78A 2PPLA 3GN2A 3G7SA 1ORRA 2FRDC 1LPNA 4ECAA 2E4UA 4ER3A 1V7ZA 1X2EA 4K46A 1QVVA 5CD1A 4W8OA 5AJYA 4X3PA 5M3BA 3TR5A 2WG2A 4PBTA 2G5GX 1AV7A 3CW8X 3R75A 2WJWA 2C2MA 1BU5A 1M6YA 2QJOA 1DJMA 1SB9A 4FKMA 1IG0A 1P6XA 4JI6B 2O6HA 2WFMA 3I9KA 4KYUA 3T1TA 3CFYA 2XAAA 3KLNA 1L4GA 4OQZA 4CEHB 2ZIGA 1YRHA 3CR3C 3L5OA 3AL0C 1E1NA 4KHPB 4YRSA 3AI1A 4OUDA 1OGYA 4UVGA 4WJKB 1G55A 3I2IA 1JIXA 1EVIA 1EJ0A 4QO7A 2R79A 4JYBA 5BNIA 4I8DA 5IYZF 2OL4A 4MVJI 3TX2A 2F9FA 3OKPA 4WACA 3HN7A 4GKBA 5EEHA 3UV7A 4R68A 5ITZB 2OO3A 1PIWA 4JC8A 4HI0E 1Z0ZA 2VF7A 4V1CB 3DMGA 1U7XA 2V7UA 5JS7A 4U7PB 1QCDA 4BNMA 2B5WA 9MHTA 3VC2A 4G9GA 5KVCA 3DCYA 4IMIB 1L7RA 5IBPA 2QVBA 4GGPA 1CT9A 3PNKA 4P31A 4XJTA 3LWNA 1BGXT 4KFRA 2KSQA 5GPBA 5A4KA 4KAJA 1J8DA 1G8GA 2G7ZA 2J85A 3O2SB 4ER6A 1M8JA 4ZMRA 5L6MB 2EP7A 3KAKA 4U3JA 1LSUA 1WB6A 3QI7A 5FNVF 1IEXA 3HVJA 5G0WA 1Q12A 1D6SA 1EIZA 1MGOA 1QYIA 2HRBA 2JI7A 1HE5A 2QMUA 3MTAA 1E77A 9ABPA 4KV9A 1SXIA 4G56A 1NVTA 1ZX1A 4JLPA 4ILKA 1RXYA 2B98A 5JW6A 2CMHA 2BR4A 2BM9A 1QHNA 1ZNYA 2HHHB 1R6XA 3TLAA 1L4MA 3HA7A 3KE8A 4IGFA 1QRAA 2GB4A 2QE7A 3QBDA 3WQBA 1GZDA 5EJFA 1KAGA 3EVFA 3C7KA 4F84A 1DTWA 2EIXA 2VBIA 4UQPA 1M7HA 4INOA 2FLWA 2EKPA 2E4VA 3LO5A 4XXHA 5KJ1A 1VLLA 5LSAA 2D1FA 4QKQA 5T3YA 3FKSD 2FPKA 2RG1A 1N7IA 1OX6A 1LPOA 1IJBA 3GEDA 2O9JA 5A3JA 4W5OA 3EPLA 1J0DA 2IE8A 1YR7A 2JEYA 3CLRC 5EMMA 3DB2A 4X7RA 5JARA 4U7GA 2VVTA 4KO3S 4UW9A 5CVVA 3KZXA 2JI6A 2W48A 4JP1A 1SXJB 4AMGA 4YUWA 1BXZA 1C3EA 4B35A 1NTOA 1QFSA 4WAUA 1EX9A 2BGWA 1WOYA 3GJSA 4V1CI 3WAGA 4C29A 1M83A 4DUGA 1NXOA 3RSCA 1K8ZB 3OQOA 2KJQA 5FBQB 5JHGB 3OPYA 3VR3D 1YDFA 4MB6A 1XMOB 3R5HA 1JFFA 2QD2A 2DF8A 1M1YA 2GAIA 1IONA 4KE6A 4RMJA 4D3SA 2RGXA 3L4KA 2FZKA 7ADHA 1YBMA 3SG0A 2AN9A 4BKRA 1WEKA 2C9YA 1U8FO 4G2TA 5JBNA 5IT0A 1X94A 1S4QA 3L46A 1LKZA 4YR9A 4PPYA 4URZR 2IY8A 1O57A 3H1AA 2FQYA 3O94A 1NT2A 5G41A 1PX0A 1NIJA 3DXFA 2PR7A 1LPAB 3WB2A 1AUPA 4QGHA 4B0OA 2B2CA 4NHOA 1GA4A 1QLWA 3M0EA 4ZV7A 2QBYB 2Z4TA 4BCDA 2L0XA 3AIIA 4ZN6A 1BVUA 2AR9A 4KODA 3TTYA 4D9HA 3K0SA 4JT4A 1GPDG 4P7JA 4CDRA 4DNXA 3AR8A 4NV0A 1T1GA 1KA9H 3UT6A 4JMPA 4CQMA 3ZV4A 4E1VA 1ZI8A 3MQFA 3SI7A 3LL7A 2QUBA 3FUVA 2IS4A 3IUEA 3D2LA 1IPFA 3RS5A 3RUEA 3SIXA 1DAPA 1P8JA 2ZTHA 3KELA 3L1IA 3NVDA 4YO8A 2ZCVA 3W2HA 4U2EA 2WPDD 4BX3A 2HU2A 3OOHA 4OA8A 1BHSA 1P1JA 4NJOA 4U63A 4HMOA 5B53A 1OI2A 1VGQA 4K9RA 1PBNA 1UBUS 5I5EA 3GWGA 2VNHA 3UHOA 3V00A 3BMNB 1YBAA 5B55A 4GHWA 3TIGA 2ODTX 3OICA 3OFND 1F20A 1VPTA 2JGLA 1O8CA 4O4JA 4ZT6A 1T43A 1UEJA 2BI7A 3LXMA 3ZKAA 4RKEA 2J48A 4KN8A 4CL2A 3OIDA 1AUQA 3HPRA 4R7GA 1G63A 1BKSB 1G5TA 1TQ2A 3HA2A 1LDYA 2GN0A 3K9CA 3QG5A 4DYHA 4F8JA 3ER9A 1OH6A 1I4TD 4YQYA 2IIBA 2P3LA 2W70A 4OFWA 4XM2A 3RLIA 4YV2A 4YT2A 4C78A 4YGXB 3TEMA 3WKEA 5JMOA 1T0PA 2RKWA 1UPTA 3R0ZA 4B6GA 1JJFA 4FP9A 1FTSA 4KR9A 1RWXA 3WMRA 3ZS8A 3QNUA 4AQ7A 3GZJA 5K8VA 2YWCA 4J0CA 2IJGX 3DFIA 2X1MA 5LD2C 1IIRA 1GUAA 1MNAA 4GD3Q 2M1XA 1TU3A 5A05A 5JD6A 1S6YA 5JZMA 2JAOA 1ECJA 1F8FA 1LLCA 2BE9A 4NMWA 3WOVA 3F96A 4HTAA 3K6SA 1ZIDA 4UXHA 3WKAA 4JENA 4L75A 4YA6A 2QN9A 1XTIA 1YBFA 3NYWA 4GR9A 3KM0A 1P31A 3RAFC 1JAYA 3E7XA 4LFCB 1Z06A 2BP7A 1UT5A 4BNDA 1ZLYA 5JVDB 3PYLA 3VO2A 3DQQA 3UJAA 1OQAA 1GSAA 3II6X 2C54A 2QQGA 4M7PA 5EPOA 1WA5A 1EQUA 3MCTA 3GJ6A 4O08A 4ABTA 4AWAA 3LYLA 2EXXA 2CFIA 2OWEA 2IWRA 3RREA 5F21A 1LBTA 2QB5A 3DEAA 5I8PA 4WXPA 1M6VB 2C95A 4GKAA 3VR4D 2OV6A 3BJMA 3UANA 2O8CB 5FOUA 3FXAA 1GCGA 3FDIA 3UNXA 1LBEA 5IJWA 2FUKA 2PQ2A 4D41A 1UPFA 2QU8A 2UVPA 4RAQA 1Z8FA 1ZLXA 2XWSA 1JG2A 2C7BA 2AZ4A 3HJUA 1V1MB 3HJRA 4EGAA 2HPHA 1WHSB 5GM1A 2IU4A 4ZHSA 3T0FA 2ZBUA 4JIMA 4EB3A 3L4BC 2W83A 4HDOB 4RDCA 4JOQA 2JG3A 4YMWA 1WDKA 1S4MA 1QE0A 4WKGA 4PW0A 1PZMA 2EJWA 4FUQA 3KSUA 4Y0NA 5KVSA 2XF2A 1QC5A 2OCGA 4EJ6A 3VR5D 4PGAA 2JKVA 1DJPA 2V7VA 1U1CA 1X1BA 821PA 2I9KA 3PHJA 3E1KA 4QXRA 3HR8A 3ZTTA 1NN3A 3HM2A 2ZIEA 3LX5A 1HYEA 4HN9A 4HP8A 4KQEA 3HKCA 4HB3A 1CLEA 4FHCA 4XDZA 4BNJA 4ZGGA 2DR0A 1DCTA 2B69A 2VP2A 3IULA 4FONA 1JSXA 2RAVA 1YQ9A 5FFMA 1EGQA 2Z2IA 3DOFA 1EAMA 3HUDA 4NE7A 4PYIA 5DT9A 1VPLA 1MC4A 4KWCA 3V97A 3UKOA 1U7UA 1IOWA 4WOCA 3ZWPA 3NJ4A 4KO8A 4Q4JB 4BBAA 1BDHA 1QKKA 5ALPA 1HNZB 2OZPA 4P4SB 1JI0A 1SU6A 2I1VB 1GTJ1 1VIAA 1MQAA 1L7AA 1WUJS 3EXIA 2HXSA 2IH5A 3WWZA 4REQA 2F59A 3OO1A 1P19A 2VJMB 2AXNA 2YUIA 3L18A 2B6NA 1GYRA 3NTQA 2CMFA 4BLOA 3WGJA 5LBTA 3EGDA 5F3DA 2J0UA 5BVHB 2G9ZA 3LCRA 5E3HA 1SBYA 4KQ2A 1NLUA 4DA9A 3UGJA 1XD2A 3EFBA 1OFGA 1B0ZA 2VDLB 1YE8A 3VYVA 1TGVA 4Z3DA 1QZTA 2IHJA 3DTVD 4NX2A 1FRZA 1T1JA 2EC5A 1XQWA 2PMBA 2PUDA 2IHUA 2QEQA 4EG0A 4XR9A 1WPRA 3X1DA 2GHIA 2WYUA 3BD8A 3EQ9A 4HQLA 1AUXA 1XU4A 3QE2A 3ILSA 2J6IA 2ZIAA 1CJSA 3E9RA 4D9BA 4P3OA 2V7WA 3QENA 1TQHA 3PGMA 3CZ9A 1P72A 2X4LA 4HLDA 2XYRA 2ZVQX 3UW1A 5EXEA 3QUBA 4RD1A 2WFLA 1PW7A 3LUCA 3C8DA 4QQ8A 5TY0A 4GPZA 3RO7A 2CLEB 4P08A 1I0ZA 1T5IA 1GKUB 1SU7A 4B9EA 2F1RA 2HIAA 2C9OA 4LPSA 4XFDA 1JAHA 1UF9A 2PRJA 4E6PA 2DKOA 2FVXA 3LT5A 4Q3DA 1NNLA 3SFVA 1YS2X 1SC4A 4UDOA 5C0OE 4P0QB 3RC7A 4ARIA 3OQHA 1GZ4A 2ZI9A 3IHTA 3OZEA 1DCFA 4CODB 4QTYA 1KL7A 3W1EA 1CLUA 1JIVA 1FP7A 2FUG1 4GIBA 4NLLA 5GIOE 2FPLA 4OXKA 4BQOA 4CKCB 3T0GA 1UDBA 3FBWA 5HTOA 4MV3A 5BMVA 4Q3EA 2PTHA 2WTAA 4Y67A 2YV3A 4A4DA 3PTZA 3IPLA 4RK1A 3RSHA 1XF9A 2O57A 4GBJA 3WRYA 1Z7BA 1EMDA 2UYCA 1II8B 3PKJA 4I1IA 5G40A 1X1QA 4B7XA 4G8CA 3QEKA 1L4EA 4AO7A 4GQAA 4QOIA 1NZDA 1CJTC 2E9SA 5K8UA 5DM60 1EA7A 2R44A 3CJRA 3RRFA 4Q05A 4KIUA 1XFDA 2OAQ1 1CUEA 3C6MA 1PVDA 2E7ZA 1H2HA 1SHZA 1XNJA 4V24A 1YOBA 3EDOA 3IO5A 3TL2A 1IAQA 2P7IA 4X45A 4JT8A 3U2QA 3WLPA 2BEVA 3OCVA 3T54A 3RWBA 2O2IA 2ZT5A 1LW6E 2LXNA 1F9AA 2R7AA 4IIHA 4NQZA 4RFSB 5L3QA 3IQZA 2V8BA 1N1EA 4OJYA 1CP3A 2Z58A 2XQGA 2ZXFA 4HZUA 4WHMA 2QLNA 5DASA 1V7PC 4EL0A 3KSAC 2H51A 1M2FA 1E7YA 4Q7JB 4I4LA 4U7FA 4FOLA 3LIPA 3EFOA 2LGJA 1VLJA 1V8OA 3CBGA 4AMUA 2OFFA 3O4RA 5AI0A 3QW2A 4JLDA 3VVLA 2PWZA 1IUNA 4F5YA 1L6RA 1VCMA 2AUNA 4JI3B 2BWJA 5ARCA 2ON6A 4JVSB 1LFAA 4ATNA 1XFAA 3CJQA 1ITZA 3T7TA 3QJYA 5J1SB 3HM9A 1W88A 3CURA 3AL3A 4B44A 2GUGA 5HHTA 1ZMRA 3IVRA 521PA 1TA9A 4HNAA 4ZZ0A 3WYAA 3GCWA 1NXQA 5K0BA 3NDRA 4X60A 3H5LA 1CY6A 3ICWA 4I9UA 1UQRA 2J3LA 4K2HA 3LHDA 4DC1A 3AXSA 1IHOA 2ZIXB 3QKTA 1Z08A 2OBBA 4XYLA 1BYIA 4DWWA 3WX0A 1BHO1 1KJIA 4H6WA 4O4LB 4P6VF 3TZLA 1U2QA 3SHVA 4N5IX 2M6LA 1VCIA 4FEYA 1VCNA 3IB6A 4KR0A 2FY8A 3AVYA 1W8DA 2ZAOA 4WFJA 1G5QA 4J0DA 1JEAA 2GXUA 1GQOA 3IR6A 1T6BY 4QPCA 4DCPA 5HQ3B 1NPDA 2NGRA 2Z6UA 5FPQA 4C0HA 3NCHA 1RZVA 1KEEA 3Q15C 1M3SA 4ZRNA 2D0DA 4YJKA 5CAEA 3KSBC 1AMUA 2AKAB 3T6KA 1VE9A 3O03A 1U7PA 2BI4A 2WJYA 3I9V1 3MOSA 2JI9A 4HY3A 1OHHA 4IJ6A 4NECA 1EK2A 3RVSA 2PMDA 2TECE 3GLRA 3DLBA 1AZLA 5BSGA 3DW1X 1Q0ZA 1U6IA 3U13A 5BUZA 1PF7E 2HDOA 2J3EA 4QEKA 3HWX1 2O2DA 4U7TB 4PYKA 2ZJ1A 1XTKA 4YRBA 4UUNA 2PH7A 2LKDA 3GLHA 1I33A 1MO2A 3BM5A 2QGNA 1JVSA 1ABBA 2D8MA 2ZP1A 3AMVA 2XTJA 2M6SA 4ZU6X 4RHEA 3ANMA 4TYPA 3O8OB 3KR1A 1IZYA 2VTEA 1E9SA 3N7AA 4HXYA 3HYLA 3CH4B 3FDXA 4X63A 3H87A 1Z39A 1ZJJA 2V0NA 10MHA 2IS1A 2QE7D 3ULKA 3F5DA 4X1KB 3MYYA 1PN3A 1IBLB 3THXB 3DTYA 3IQXA 1V0JA 2Z43A 2GXSA 5JCZA 3NAQA 2PSHA 3P0JA 4RFLA 3KZCA 2OG1A 3NBQA 1KORA 4OI4A 2QD1A 3BMOA 3L7LA 1JWLA 1ZOPA 1F0YA 1LJUA 5I7HA 5IX8A 1QIMA 4WNIA 1MVLA 3OQPA 3SBEA 2QMZA 1QAOA 2NTJA 3A6DA 3QBJA 3UGKA 4RJLA 2FZ5A 4JQYA 3H9QA 4IFBA 4BUZA 1GQRA 2GERA 3NRCA 3L8FA 4EY8A 5K3CA 5BXQC 1D9ZA 1E4EB 2GILA 4QU9A 4QM7A 3KO8A 1K4YA 4MVJF 5F7OA 5TF0A 4AY6A 3A9CA 3AETA 2J07A 3MA0A 1NJGA 3IP7A 3MRXA 2BFPA 1PG2A 1SXGA 1GPLA 2ZJZA 4FHGA 5GAJA 4B4WA 3I8SA 2BFCA 4OQLA 3FLBA 5FPSA 2D06A 2YHIA 4RL6A 2W0SA 3IAS6 4UEKA 4D96A 3HACA 2BCEA 2PDAA 1K08A 3PWZA 4PAQA 3U37A 3WLKX 1NVVR 1WO8A 5EVCA 1X39A 5JYBA 3CLVA 4BO7A 1O6ZA 1UK6A 1GT6A 1KDRA 2D2EA 2GMWA 3C3YA 5GV8A 2PU5A 3DMRA 4Q1FA 1SWVA 5HUQA 2VHVA 4CG0A 2DJIA 4HBZA 4O2BB 1O6BA 4W5NA 4EECA 3IIIA 1M34A 4D3FA 3COZA 1OPRA 1I9CA 2BRUA 5ESWA 3ROMA 3KT8A 4RH3A 3RK4A 3F9IA 3GXBA 3W2EA 4CV3A 3QJGA 1NATA 4V0SA 2AQ8A 1L5HA 4YJFA 4HGRA 4F8EA 3JZDA 3N7TA 3VJKA 3H5WA 4BPBA 2MHCA 1V8PA 2FFHA 4H1VA 3AFOA 5FBKA 1Z62A 3LPAA 2MSWA 5DCLA 2FW6A 1TTQB 1ICIA 4LVUA 5JXGA 3DZHA 2EFJA 3EGXA 3KHUA 5THKA 4L51A 3E3OA 3I58A 1ODKA 4MR9A 1U0TA 2IU6A 4YRDA 5E6UB 5KCZA 3D59A 2VDPB 2WILA 5K8IA 4J49A 2DHRA 3EF3A 3ZHVA 4HDKA 4DDUA 2ZITA 1BWSA 4F4FA 1SQ0A 3ZJVA 2CJWB 4TTQA 1DKUA 1QZZA 4NCJA 2CB0A 5FR1A 4MVXA 4GOJA 1NC3A 5KNDA 4KLRA 3MBIA 4O2AA 5DSZA 3UMJA 3A3PA 1MFPA 2HSJA 1VSTA 3H18A 4GSLA 2VHQA 1JZQA 2FEXA 1XEXA 4H1TA 5A3SA 1ZCJA 3MEQA 2FPPB 4MR7A 1C4XA 1P1BA 4Y9RA 1UMCB 5SZHB 3TZ6A 3QVTA 3F74A 4EEZA 3CRW1 1JMVA 3DPSA 4IJVA 4Y2UA 4BNLA 1QP8A 4ZP1A 3IV6A 1K6MA 1WD7A 2WKRA 3DZJA 4EOGA 3OD1A 2IY9A 4YJ3B 3PC3A 1E4YA 2CXNA 2IE0A 2VK8A 2FMIA 4DY4A 1V9LA 2ZYHA 5A5DA 3M6IA 3RJTA 1ECPA 1DX4A 1A5TA 5L45A 3SHFA 5KQSA 1G18A 1T2DA 1UBNA 3DPIA 3QEOA 1R5OA 4OBXA 4CM7A 3N0TA 5DTJA 2EHDA 2H11A 4JAVC 1CZKA 4O3FA 2V3WA 3H11A 3QXJA 3F8WA 1V5FA 5TT1A 3F6RA 3I92A 2V5UA 4Z86A 1KI6B 4AQDA 4UM9D 3HNOA 5FBVB 4BNTA 2QRUA 4Q12A 3ST7A 2OFWA 5KYXA 4RTOA 2ZRAA 5LM3A 3N6VA 4CL0A 4C6HA 4EJ0A 2P0AA 4DLRA 4FHDA 2H18A 4KFTA 4FZJA 3IJPA 4U2DA 1W35A 1JNYA 4OFBA 5DKFA 1KMIY 1SGWA 4YDSA 5LKRA 2DFLA 3UWDA 1E9AA 5FTLA 2W2VA 4RVDA 1IPHA 1LLUA 1I6WA 1V47A 4XX0B 5DX0A 3C85A 3EA5A 3MN1A 3D7SA 5LQSA 3VI3B 2O8BB 4N9WA 4KOEC 4NJEA 4AKTA 3R24A 3LWBA 4JL8A 1K7XB 4HRAA 2DLDA 3K32A 3I9NA 2QAGA 3CRVA 4K9SA 4IIUA 4AY3A 1UJ4A 4CIYA 3NHRA 1I3NA 4TMTA 4TTAA 2I5PO 3REGA 4ZWNA 5BWLA 1PU2A 2P1ZA 4NEQA 5IBQA 5LL6P 1D2CA 1FVOA 1WEHA 2JGJA 4IAOA 2Z04A 2G8NA 5G4LA 1DEHA 4FFWA 4GKVA 5JAHA 6REQB 1KVTA 1U98A 2CVOA 3DV0B 1H2AS 4RANA 3T9CA 4U6QA 1RYDA 1FRQA 1W25A 3IIKA 3P8ZA 4QT4A 4ZZ3A 3U7QA 1PZHA 4Q37A 1E0JA 2LIVA 3ZV6A 1QORA 4QAJA 3VM6A 4JI8B 1WLSA 4HLQB 4IFIA 4JSYA 3DV9A 4ZVMA 5BNFA 3KQMA 3RJ9A 3TOXA 1L7EA 2C5BA 3GLGE 2CK3A 5EHGA 1AGPA 1J21A 3SWWA 1V11A 3FGOA 1E3IA 3OCYA 1EFLA 4OU4A 3UK6A 2PD6A 4CNQA 1E5LA 2I7TA 5TPZA 4TVBA 1F1BA 1YAHA 4RV5A 5C53B 3C3AA 4MV0A 3UQZA 2B0JA 2EJVA 1U8XX 3VI4B 1E92A 3FMIA 3PF8A 4ESHA 2BKVA 1E2MA 1O6CA 1Q0QA 3AUXA 1NM5C 3I45A 3LRXA 4NJMB 1SQGA 1J9EA 4XYGA 3W8DA 4DJTA 4YAGA 3W2IA 4N40A 1ODSA 2B7BA 2LBPA 2MINA 2GZ2A 2YYAA 4HF7A 4R0VA 2ZIFA 5FA6A 1OB2A 4ZVOA 2ZTLA 2ZYSA 2BBWA 3EDMA 4W7IA 2CLIB 2ASVA 1WE2A 1A71A 3ZDEA 3ZHXA 4NXMB 2Z30A 1FUUA 3KEQA 3ZPXA 4KMRA 5AFSA 1P3Y1 5KSOA 1Y3CE 1EESA 1IDN1 1T0HB 3AKEA 2H16A 5K0TA 2XZOA 1GUFA 3AQ4A 2X4GA 3O91A 1ODFA 1NQOA 5BWMA 5HGXA 4PIPA 1ZM3A 2ORWA 2I6FA 2RGDA 3M82A 3REQB 3RTEA 2ZSKA 2D5IA 2V74B 3OQBA 2IYPA 3GFRA 5FBWB 1HT0A 4KNVA 4D6YA 5LZ8A 1AF4A 2AOUA 1YHZA 1RQLA 3LA6A 5SYNA 4CIVA 1ISHA 3K0CC 4V38A 3IESA 2EX0A 2ZQZA 2ZBDA 3CSDA 4TV8B 1EM8A 1YWGO 1U3TA 3NJRA 4NARA 2X2PA 4WZAA 3ZXIA 4AX4A 2JCVA 1ID1A 4EFKA 5BN3B 5BV1A 2ZWIA 5B4UA 3WYCA 3E15A 3RG8A 1V16B 2WMYA 4I2NA 2DFPA 1A8PA 1PT7A 3Q5DA 2A7XA 2YX1A 3OOJA 3TW0A 2X3FA 2PRIA 1DFHA 1BVHA 1JQ3A 2YHSA 4DGSA 4Q1VA 3SEFA 4WUVA 2O23A 3TVTA 3ZLUA 1GARA 2BD0A 1P7YA 2IBMA 4XOUA 3W5VA 1SCAA 3WYEA 3ZJTA 3HHPA 4E4RA 1AS0A 1CKEA 3ASUA 3SE0A 1ZM4A 2GQ0A 2AMVA 2H7YA 4MIOA 1ZFNA 2ABWA 4N3AA 5E8RA 3W9YA 5JVDF 2WI8A 5EIAA 5AVYA 2VT7A 5DM1A 1IHPA 1PJRA 1XD9A 2FSVC 2ZJAA 1FLVA 5CFMA 3CT6A 3DEHA 1T9BA 1WDMA 4D82A 2FW0A 2WZBA 5IH3A 2XQVA 1VP3A 4P80A 4DBZA 1KSGA 1UP4A 3QX3A 4F38A 3FR7A 1WHTB 5GJVC 5JNRA 4TS9A 1QMGA 2DPMA 4LRSB 3UYLA 1W5SA 3LQ4A 3ONDA 4HUJA 4E5DA 3ZW7A 1RU3A 2Q2QA 1V1RB 3MS2A 5B36A 2O8EB 2Q4BA 1YZLA 5JDIA 2G9QA 1IXZA 2C99A 2ZJ6A 4EABA 1C4OA 1G6KA 1UEIA 4J43A 4J94A 4W8GA 4G1BA 4Z4FA 3GRAA 3ZHRA 4BP9A 3BOSA 3I3OA 3U7RA 1E6CA 3ZWCA 2B4TO 3ZCSA 3ZCVA 2I3GA 1ND6A 2D4AA 3VZSA 4BZPA 4B5LA 2AOVA 3E1SA 1FRFS 1Y5IA 3UW3A 5A04A 1LD3A 4L5CA 4QNMA 3BKWA 3O31A 2N9UA 3N2KA 1DS6A 1A3CA 3GHHA 3EPRA 4F6LA 3EIQA 1HFKA 4E09A 3EC7A 1LPSA 4I1RA 3B9QA 2G4VA 3ISTA 2CNLA 4D0NA 4F6CA 1CUXA 2ADMA 3RS3A 5CX4A 3KLBA 1HA3A 5KOIA 2GHRA 4US2R 3KBBA 2VQSA 2YS6A 5CRIA 1H4SA 2GK3A 3O38A 1E2LA 1DB3A 5I51A 1CUSA 4Q66C 4H17A 5KKAA 4F1JA 1SMKA 2IIPA 2ONKA 3LUFA 3BJEA 2P6MA 4FFBB 4J7UA 3VSBA 5I3ZA 5JAMA 2H7CA 3QYFA 4YCJA 2DBQA 5LQRA 2GJ8A 4LYFA 3RU3A 2DBRA 2OFOA 4EX6A 3JQBC 3ZVKA 2O2HA 4PE5B 2ZSJA 2MU1A 1Q1EA 4CT5A 2NO1A 2P5SA 3OZVA 2Q1TA 2WJ3A 1R4NA 3PVCA 3V4SA 4P86A 3FOEC 2LRHA 2P2YA 2ZRFA 2IX3A 4W9NC 5JJ5A 1Z5PA 1WOMA 3NALA 2X0JA 2XIJA 3PRKE 4OM7A 5J2UA 1HLPA 3GRCA 5TF4A 2A58A 2IXDA 1RAFA 2DAPA 2Q3JA 2Y77A 2HL6A 2J9FB 3BEOA 3BDVA 3CRQA 3G59A 4X20B 3ZK8A 5CK4A 2ZM5A 3O90A 4PVCA 5TPWB 3HWWA 4XJVA 2WWTA 4HWTA 1XZFA 3UMBA 3ZWKA 4EITA 3HK2A 2Q0QA 3VOSA 4EK9A 3K16A 5I9TA 1FDOA 3NHBA 1AH2A 1JV2B 1OHHD 2XOKA 4FFVA 1C2TA 1W19A 3KD2A 3JAKA 1GSOA 3DAGA 3LQRA 5BQ3A 5JJLA 3DVQX 3P9SA 4MROA 4TLCA 3ESRA 5H4GA 2BGTA 2P35A 2ZT8A 4N5MA 1NBMA 3OEHA 4BBZA 3DZGA 2WD7A 1NJ2A 1ST3A 1ZH6A 3NLLA 4LI3X 3I9JA 3AESB 1ULAA 2NZ8A 1W5AA 2WUDA 4NCXA 4X3CA 2VJPA 3VPGA 4BQQA 2DSTA 1A82A 2YDXA 2PZAA 4XVHA 1E2HA 3RK1A 1BJRE 1BEEA 5EKTA 2HRCA 3SZUA 3DP9A 3GIDA 4A8JA 4ZYWA 1B8OA 1HEYA 3JVDA 5IJ9B 2A1UA 4ID9A 2JGIA 5E9JA 4LWZA 2ZJ2A 1YFZA 2BW0A 4ONEA 4EJSA 1V4NA 2I80A 3V8VA 3EDYA 4YUVA 3HFSA 1Z4MA 2P3SA 1A96A 2EFDB 3GNSA 3I5UA 3QLJA 1DTSA 1JEOA 3L5KA 1XDGA 3T94A 3UJ8A 3AR5A 1XRLA 5EKSA 3AEZA 2NXJA 4EHJA 1HDRA 5D7BA 1XAHA 4AULA 5JZ9A 4ARSA 2B99A 3HSKA 1MCZA 1DJOA 1HMYA 1R0ZA 3D8NA 1EG2A 3IE0A 4EHLA 4UUBA 1I5OA 5A7HA 3M4YA 3NIBA 4NF2A 4F1KA 4Z4EA 2R97A 1P9WA 3STWA 4QU0A 2BAGA 3IQHX 4K9KA 1T26A 4ZTBA 4OSPA 1JG6A 3TBFA 3MJ4A 1NU8A 2ILVA 3JQ9C 3AUTA 1RPNA 1XG5A 3L7OA 4LXYA 4IWNA 3CVOA 2D5LA 4ZEVA 5KX5A 3IE1A 2V45A 3O1IC 2R47A 4OQ4A 1WULS 5EHNA 4B46A 1BMQA 1WSAA 2HJHA 2OWDA 3AOGA 3R3UA 2VXYA 1SBCA 1I3KA 1VCOA 4II3A 1S2OA 1U04A 1QIIA 2PZJA 2WKPA 2XE7A 2XGGA 5DYIA 2X2OA 2R7KA 4F12A 1E2KA 1RLTA 1FDIA 4D80A 4F46A 2FPOA 3H2YA 4QDOA 1LV7A 4O8ZA 4TKVB 3LM8A 1BCSB 3CUVA 2QX6A 3JQ8A 1KO8A 3PNLA 4WKNA 5L8VA 1H3EA 1W30A 1CG6A 4YAIA 3DT9A 5DTEA 2X1LA 5ARDA 3KE9A 2R9VA 4C0SA 4F72A 4Y9DA 2X9GA 2ZS9A 4FFSA 1YFLA 2ZI6A 5FUXA 4I46A 2VUSA 1KVUA 4Z4QA 3MWGA 1MC1A 3JD0A 2YFHA 4X7MA 3R6GA 2C8KA 4MUYA 3WLFA 2QPAA 4HS9A 4C22A 1VDZA 2WDZA 4LJKA 1E79D 2C58A 2WB4A 4B7CA 2VNKA 3B9RA 3K4HA 4IG4A 4LWQA 5E8JA 2X6QA 2L17A 5HFAA 2W2OA 4CIDA 1H66A 4O4LF 1N9GB 4I6JA 4S1TA 4WOJA 4C43A 4EYEA 2JZOA 4ZU1X 3SZGA 4F4UA 5EIEA 4WCFB 4EKNB 2FTKE 1FYEA 4MKRA 4B3TB 3KYCB 1HRDA 3DR5A 2FMXA 2IYYA 3G8DA 4L6AA 4V0OA 1FDSA 2BM8A 2WF9A 1DNPA 5AVKA 3C6QA 1Q3TA 4OJMX 5KNDD 3QKRB 4G1CA 1L6IA 3TGPA 4HSEA 4DTIA 4K26A 2PU7A 1WNFA 3IOBA 3VA7A 4OSOA 3IP5A 1I7LA 4P3XA 3T5DA 3V7FA 4A6DA 5A3VA 4XLLA 2P67A 1EX6A 3QLVA 2QJTA 4A73A 5EPEA 3T7AA 1TM5E 1FP4A 4HYEA 3KSDO 5AJVB 2HTEA 3L7CA 3IUJA 5EC8A 2QUJA 3IP6A 5IVKA 4U2GA 3A06A 1K98A 3O8NA 1UL1X 4JB8A 1PK7A 1LRJA 1Q84A 4WZ6A 5H7XA 1HDXA 2JH9A 2X6TA 2XB4A 3G8AA 3WWEA 2E48A 2HQRA 4J0EA 1QAQA 3UWPA 4B2YA 1QJ4A 1EVJA 2P6UA 3OU2A 4QRDA 1FEZA 3MBOA 5TGTA 1KGSA 1ATZA 1U1IA 2W2KB 3SCZA 4BLWA 3AG6A 4CKEB 4D4IA 2VZ8A 4BY9E 1XP5A 2R7MA 4GO1A 4PNZA 4YK7A 1XPJA 5DX1A 2Z4RA 4BTLA 1H9BA 3LOUA 2X2FA 1AC5A 2H57A 4LY0A 3QLTA 1IFXA 4PCVA 5I8ZA 3CHYA 1B4DA 3FYHA 1M72A 1IEVA 2DQYA 5JSKA 3U0VA 4ERXA 2A0XA 1PG5A 4C2AA 2Y4OA 3VJLA 2H1IA 3SX2A 3AGPA 4YUXA 3P9KA 5B37A 3SDBA 1I2CA 2E5FA 2YWGA 1Q7EA 4P7BA 3T7DA 3QXGA 1Z4IA 4FTWA 1F14A 5AVXA 3RAEC 1RZRA 2ZZMA 1G8JA 3UXHA 5F33A 3LW7A 4MX8A 2E87A 1VBMA 3A4IA 5A5FA 3S5UA 1DAHA 2PJUA 4KWTA 3DAFA 3GT0A 4LGCA 1TK2A 2A3RA 4HVCA 3EWAA 4J1SA 3L6EA 3AT1A 2GVDC 1E5QA 5HKLA 2H52A 3IGFA 4JJGA 1H0KA 3AUAA 3O84A 2IYNA 5J4VA 4I19A 4JVNA 2AG6A 4REOA 4DEYA 3L7DA 3DM5A 1JZTA 4KAAA 1MT0A 4BP8A 1P4JA 3ZGNA 2R2AA 3KWLA 4LXXA 1KY4A 4BZWA 4G4SO 2ES4A 4Z9YA 5JAUA 2ZRIA 3PD1A 2F3PA 3HEBA 1N7GA 3K73O 2X8BA 1GG5A 2PXHA 2ZTUA 2WNSA 1E2QA 3D7MA 4INJA 1BOFA 1H3NA 4UBNA 1C4WA 5AW8A 5I7EA 3KYDA 2Y0BA 3OZSA 4N5HX 3P32A 3RS0A 4C7MA 3H05A 1HLDA 2HW8A 4U1RA 2JFWA 5A4MS 3PA6A 3UCXA 2I2XB 5BYBA 3QGMA 2BBOA 2QW0X 3DOHA 4L7QA 3T9EA 1WCIB 2CK3D 2I3AA 4EG1A 5EFZA 3AR6A 5JUWA 1JR6A 3GUYA 4O2BF 5K3FA 5CDGA 4DNPA 1EHYA 3V46A 4A3SA 2OSBA 2RC6A 2WTEA 3KDPA 1PJ4A 4M0EA 5TPZD 2PJRA 1JW9B 4MINA 1AKVA 4R2XA 2OKCA 2QGFA 4PFQA 2DWPA 1R0KA 1CEEA 2IHNA 1UP6A 1DO8A 2OD7A 2PHZA 2PYIA 3S8EA 1OE0A 1DEAA 3NWJA 1NZFA 3EZNA 1CUCA 3RDPA 5A0VA 2X3YA 5EUBA 1UJ5A 4DQKA 4M1QA 1QG2A 2G5TA 4TMYA 2AVDA 2F1JA 4Y2PA 2BZ0A 4AJ4A 2B4RO 3E2MA 3LT0A 1V2GA 5TMEA 1ENPA 2Z8XA 4DRXA 2RGBA 1KEPA 1KZYC 4BFTA 4NYIR 1M2EA 2FYTA 3RANA 4UHCA 3RR2A 4D99A 3KEGA 1TIPA 5IXJA 5AVQA 4HXFB 1UJ6A 4J2OA 1PJ8A 3ZZTA 1SD2A 4PC6A 4LQ4A 4FWTA 5LA6B 2IUYA 5JJCA 3P0FA 2NVOA 5B7PA 1LS6A 4QPPA 3BWYA 2IXAA 3FUUA 4GC5A 3S55A 3TSYA 3KQLA 1BWPA 4UAGA 1Y3IA 4RO0A 2QN2A 1SPBS 2RIRA 4W7SA 3AHHA 2HM7A 4BLQA 5JYEA 2PJZA 3R40A 1AD2A 1V96A 1VZ2A 3LAWA 2CV0A 3UJHA 4CM1A 1HOTA 2RJNA 1P8AA 2BEJA 1PR2A 2QMHA 1M8KA 3EQ2A 3JR7A 5EWLA 4EI2A 1LGYA 1TM4E 2R66A 3R3SA 1ZS9A 1RWNA 2QVGA 1C7EA 4B83A 3ZY6A 4C7OB 4L5YA 1TMKA 5GMOA 2GNOA 4YJ3F 2F4VB 3LOQA 2PS9A 1H6BA 4XQ9A 3VHLB 5ED0A 3C0KA 4ESOA 2CNWA 2HYIC 4MCAA 5GP1A 1N0IA 4QT0A 3MIIA 5GONA 5CK5A 4M9RA 1JH9A 1T24A 4YVFA 3PQ7A 3F47A 1YB7A 4G4JA 2PR2A 2GM5A 3U6KA 1JL3A 1W48A 2VOJA 4KV7A 5EINA 3LYUA 4WK6A 2G76A 3MC1A 4ZI2A 5F3RA 3FSEA 4X8OA 1SKMA 3S2ZA 3RBAA 2XGMA 4MKXA 2Y0EA 4G0OA 4AUEA 2CKMA 2VWGA 2P9HA 2IOFA 1VPEA 2V03A 1JU4A 1RM5A 2C2BA 5GVSA 4A1FA 4XPIA 3U80A 2HRQA 1WWKA 1Z2DA 4KDEA 2AI1A 5LB4A 1XDWA 1CJKC 1N4AA 2WTBA 1KYYA 1Q17A 2DULA 2NTYC 4ROTA 5IAGA 1U81A 3JARA 5JZOA 1JPVA 1K3TA 3UZUA 1U8EA 1SZCA 1UMDA 2IGBA 3F5QA 1RXCA 3FNHA 3DQZA 2W6IA 3I05A 4JYCA 3KJFA 4WLFA 2YIJA 4QULA 1ORVA 3I42A 3CNBA 1JECA 3W0LB 3QFTA 3PNMA 4TVSA 4HR7A 1GEEA 1SULA 1HEIA 4BMPB 4DUPA 1AK9A 1R64A 2Z3VA 2ZCUA 2B4YA 3H17A 3KAQA 4K1XA 2ZKIA 5DK4A 4AURA 2W98A 4AZ3B 1TD1A 1XWFA 4S12A 1CJBA 4ZI3A 2NW6A 4ETWA 2QL9A 2QTVA 2ACEA 1QRUA 4L76A 3K92A 5BP7A 3IYLW 5BY2A 3OC0A 2XCQA 3SJZA 3HXTA 4DOMA 5EHZA 3IUQA 1MXFA 4J75A 4L8LA 2Q7XA 5FOVA 2CV1A 3H1BA 1T8YA 4IDAA 5DMXA 1O9HA 2CVHA 3A11A 3LX8A 4CM9D 2MYNA 2J7KA 1LBQA 4Y0AA 4CDGA 3OWXA 1NUAA 1M0TA 5LB2A 2EW8A 2Q4DA 4BO3A 1L5NA 2BGKA 3VNUA 3GPIA 3MMSA 3RYCB 2VJDA 2FJ0A 1EVZA 1UMBA 1RCFA 4P81A 1MHTA 1YU9A 4NE2A 2R1TB 4X1IA 3ZWVA 1R00A 3GFVA 4DMUB 2BTEA 1KFEB 3EARA 4OX9B 2J08A 1KIFA 3L1HA 4RJJA 4Q3NA 1JTEA 5B6JA 3V8BA 1PJAA 2MIIA 4LXIA 5KMGB 3IBCA 3CLUD 3ZCTA 3VDRA 4U9UA 2C57A 2PD3A 2R8PA 3QFFA 5CB0A 4W9MC 4HWKA 4XCXA 4YAUA 3HJAA 4NBUA 3EXEA 2VNSA 3B7GA 2YICA 2FN3A 3R7WA 3LH5A 4PNHA 1NF3A 1ZIOA 1AB5A 1T9DA 1J99A 1DRWA 3F6SA 3GC6A 1AQ6A 3G68A 2ARKA 3PFNA 4FZVA 1GGVA 1G3RA 5JCJA 1ECLA 3Q40A 3CF2A 3PFKA 3GG2A 4PX3A 3ZV3A 3Q3IA 2C4TA 5BSFA 5IF3A 4OA5A 3I4CA 1UZAA 1JYEA 5KWVA 4BNNA 1QP0A 4X54A 1YGYA 4GZLA 1XIVA 4K6HA 4RMGA 1GNTA 1UBMS 1ZVMA 2MSCB 1J39A 2YNMC 1ZJ6A 3L82B 4IDGA 4R01A 1YDWA 2WSLA 2Q0XA 4TV8F 3CXRA 3MWEA 5U1PA 1FFAA 4GMXA 1A8QA 2YY5A 4BDTA 5EJ2A 4L72A 2R87A 1OX4A 4ARBA 4MRMA 4MGHA 4XVUA 3R5XA 1G6OA 2BUCA 2QRJA 1ZU5A 2RBKA 5DULA 4YP7A 4AZVA 4CV2A 1I30A 2HEIA 1MO6A 3TRIA 3UFXB 4BNKA 3R3VA 1PGQA 3M3HA 1E1CB 1SQSA 4FN5A 4BZQA 2ISCA 1Q74A 1C2YA 4IGKA 3GGGA 3E84A 3K09A 1G8PA 1UM9B 1E69A 1ZGCA 2Q62A 1Q0TA 3C39A 2J5XA 3GROA 1XTJA 2W42A 3U3RA 4LQLA 4HEJA 3VSCA 1QBKC 2VL7A 1YBVA 1LSJA 1NPYA 2NTVA 4D44A 2QIPA 2BH9A 2JLBA 3L77A 4D6XA 2EQBA 1WBBA 3L6DA 4GYWA 2WU3A 4B17A 3DCIA 5C7IO 2C4VA 2JFPA 2MMCA 2Z09A 4GLLA 4A27A 1OLOA 5JXWA 3RRYA 5D1NA 2XD4A 1FTQA 3EVBA 3QLUA 1PTJA 3ZNQA 4E5MA 1U8UA 1P2FA 4M4SA 1Z15A 4U7WA 1Q83A 4MP3A 4WSOA 3G82C 3HRHA 3JALA 1A27A 5SZIA 3IERA 4YRFA 4RVOA 4D5GA 5LWHA 2XE4A 1V5GA 3FPGA 3G2KA 1RC1A 1Z2EA 1U6JA 2HV9A 1JLHA 2XYPA 1DMSA 1GV0A 3O4HA 4GR4A 3T8YA 4DLPA 5MN4A 4Z7QB 5DU2A 1O95C 3EXHA 2DR3A 1V26A 4OYHA 5CB6A 5J3JA 4ED9A 1QNLA 1LK5A 3A2LA 3IHKA 4J16C 3T52A 4AQYB 1EUDA 3O26A 1MXHA 5AW9A 4YPVA 3HZRA 4QOEA 1KIAA 2JFXA 1G20E 3UK2A 4Y0VA 1R6VA 4CMAA 1M6EX 4M9CA 4EG8A 1YRYE 2JAWA 4L9AA 4P5PA 1X7GA 2GEDA 5EYPB 2GBLC 1G8SA 2VUTA 2W6CX 2YHUA 4BUCA 2ZRJA 4IZIA 4PONA 2ZRCA 2CMGA 3NAZA 2H1FA 3OQIA 4IS3A 4PO3X 2JC3A 1B0AA 2JDIA 4N18A 2P9EA 3SLGA 1EKXA 1YC5A 3R44A 1C8LA 4MW9A 4LS3A 1E1QD 1WCV1 3PDIB 1P5HA 4ANFA 4FUTA 2PEZA 1BWQA 1V5IA 1OH8A 1AO3A 1M1ZA 3AHGA 1SHKA 3KQWA 2NM0A 4NZPA 4JL5A 3CVUA 2JHCA 1I24A 2NAPA 3EISA 4PGMA 3UOGA 3ZIAA 3H86A 5HP4A 3JVUA 3ZU5A 1CEYA 2VNIA 5LZ7A 2VF8A 3S0JA 3U17A 1TT7A 3V34A 2V1XA 4N3NA 1H3FA 4BNGA 3W3AA 4IDOA 4TZKA 1E6WA 3JQFA 3CXUA 4W63A 4UZSA 5CCBA 1OLSA 4HLUC 1FDWA 2EWVA 2QTHA 1PJZA 1DIGA 1SUPA 5AXCA 2NU7B 3ACCA 2JAQA 4S2UA 4E3ZA 3TVYA 3OECA 1DC7A 3T06B 3VO8A 3WC4A 4QFDA 2E85A 4KRYA 5TQJA 5B7GA 1LH0A 2AF3C 5G4KA 2P8JA 3IQWA 2BBSA 4NPCA 2VP6A 2X8WA 2IFTA 1CDDA 2OXRA 1W85B 4LKRA 5K6AC 5DNVA 4RV9A 5BSHA 5JNTA 1MT3A 4N47A 1KBOA 4MTLA 1P5JA 1JILA 3UMMA 5JDCC 3TLGB 5IVPA 4FLFA 3A0UA 4I6EA 5ICEA 1UBFA 1B3RA 2QUAA 4I4TB 4X7BA 1ZMOA 2OV8A 3I6QA 3W5SA 3RYIB 5AK4A 4GPD1 4QU8A 5A7FA 4PR3A 4YQZA 1JUDA 1FS4A 1KMHB 4GM1A 3LF1A 1J8MF 2BCJQ 4LSWA 3W5DA 4V02A 1KZHA 1WUTA 1QDUA 1JQ5A 4DCCA 4E1BA 3AEQA 4IDEA 1VLVA 1DQYA 1Q14A 3FHJA 4P7GA 1HL3A 3CINA 3UIEA 3DOJA 1RC0A 1DIRA 2NUPA 4F92B 4J1QA 2N42A 2V58A 4R2HA 3WBJA 2ZE5A 1B2RA 3ZY4A 1O94C 2ZIWB 3VJRA 3IIEA 4EFLA 1YNSA 3FNIA 2BVNA 1FP1D 2N3ZA 1BXGA 2VNAA 3GJTA 3IEXA 2JARA 4IDHA 4YYZA 3C74A 3HYSA 3F1KA 3RT9A 2CW5A 3S1AA 1Q7GA 3CRMA 5K01A 2Z2ZA 4KBGA 5F1YA 1J97A 2IPAB 4FDUA 3ZI7A 3ZDQA 5AW3A 1RZRD 1WBDA 2QPTA 1GNQA 3B2EA 2F3TA 4IHKA 1XL1A 4JEIA 3QHAA 2CBGA 4FYKA 4J0JA 1XMXA 2QNBA 3ID6C 4LXTA 4PYRA 2ZIUB 4RLQA 1XK7A 4B3XA 3PUYA 3BB3A 4XYBA 4QUBA 1SVLA 5JZSA 1KC3A 5DBFA 4IINA 4EO7A 1GXSB 1LTHR 2J9GA 3CLSD 3ND8A 4JOCA 3EE6A 5F9MA 3D8UA 3KFXA 3L8DA 4P8RA 3ZCRA 1BE6A 4BB6A 3ZGZA 3PUJA 1QANA 1KK3A 3GDHA 2NUAB 3IXQA 4HYTA 1YIOA 4XGRA 1G7CA 4WLUA 5E7IA 1GIAA 1R7RA 2J5RA 1R37A 3S27A 4ZPJA 1J8VA 1WF6A 1QFJA 1U0JA 4FE7A 4ZEMA 5AHWA 5KNCD 2G36A 2ODWA 4RDHA 5D5QA 3BK7A 1P75A 1WV1A 5B30A 1MJ5A 3I0ZA 4GW3A 3OCZA 5F78A 1EU1A 4UVIA 2QE6A 5IHXA 1DCKA 3PTLA 4P3NA 5AO9A 5BW5A 3JAWA 3JSXA 1VLQA 1RI2A 4FJ0A 1LWNA 4CFZA 1LJ8A 1FUKA 3MK31 1SBNE 1UOEA 4KXFB 3ZY3A 3CC8A 3WMFA 4PNEA 4A7PA 5KUTA 3V2GA 2OUIA 5A3RA 3VH3A 2I7DA 1ULUA 2HH9A 4FNMA 2YMMA 3GZNA 1NRIA 2D3TA 1WETA 2OGSA 3DO5A 5CXUA 1EUYA 2AN5A 4Z2AA 4QZVA 2QVZX 1G59A 3PLAE 1Z2NX 1OI4A 5AJWA 1OKKA 3B2NA 3I73A 3Q6MA 5EGSA 2HQSA 5JD3A 3CUUA 1MB3A 3OZ7A 2GN8A 5EP4A 4AJ1A 3KX2A 3PDJA 4GXQA 4M1SA 4YEDA 3UBMA 4CETA 4EWLA 2J5QA 4I50B 1EINA 2F55A 3V9PA 1H42A 3KAPA 6YASA 3BRQA 4HTFB 3NEYA 5KWSA 3ZV7A 2HWUA 3KSRA 4E0BA 1DC3A 2YXNA 1QRRA 3ZTYA 2BGGA 3I0MA 4WFQA 2XRFA 1W5TA 2RJ3A 3LBNA 4HWSA 4R9SA 2ZULA 1C30A 1JAXA 4FGKA 4WY8A 4GOND 1LB1B 3RASA 3SS8A 4ASUA 2GVNA 3GRPA 3OOSA 4KWHA 1KK2A 4Y2TA 1HTBA 4POOA 1XEWY 1AGNA 5CJPA 4P38A 4BATA 3AVUA 1NKVA 3P19A 2FFJA 4F9EA 1EVQA 3WMEA 2O2CA 3FNGA 3Q11A 2JLUA 4FEGA 3HXPA 1EP1B 2HCTA 4AMBA 3K20A 2Z3WA 1GA1A 4W82A 3Q7QA 1KEZA 2P5TB 2RJOA 2QVLA 4NC9A 3RJZA 2A78A 5HM6A 3PVZA 3VU8A 4OMUA 3CSSA 3PKZA 2J59A 2RGNC 5EAIA 1PYOA 2Q2VA 4OQEA 5DCUA 2J3KA 3GX1A 3LDGA 4XM0A 2AD1A 1E2FA 4YFYA 3IJEB 3J81k 5K09A 2ENUA 3R6TA 4DCMA 4KQMA 1J4AA 2FPUA 3A9RA 3MJRA 3WL7A 4E5PA 2W6NA 1U31A 2NSHA 1XELA 2J6HA 1WMDA 3IJRA 3JATA 3P5SA 3QKSA 3TIFA 3UWKA 1RJGA 1NURA 2FEAA 1OIXA 1D6NA 2JGAA 2R62A 2W00A 1R6TA 1SBTA 2GYUA 2LWIA 4K0KB 4FYMA 5FX2A 3LE8A 2VQFB 4ON9A 2HA2A 3PC8C 1N1DA 4WBNA 2DG2A 2P9CA 2XNKA 1DKOA 4LJAA 4GP9A 1IUOA 2F00A 2G5PA 2VQDA 3IPYA 3FOBA 2PUAA 2Q4OA 3EMDA 2PANA 4OV6B 3W7AA 1I0LA 2LW7A 2CZQA 4BJ5A 1GU0A 3BBLA 3D3NA 2XXAB 1OGJA 3T5AA 5BR7A 1T3ZA 4P53A 4QLBA 3H5TA 3ONNA 4LF4B 1D2AA 2VLBA 1RDFA 2C1EA 1W76A 2JD2A 2PXCA 5FWYA 2WJPA 4O59O 1V5WA 3KOWA 4ZOLB 2GZRA 4G4GA 4IWXA 4C14A 1GUZA 3ORHA 4X97A 1DC6A 4ITUA 2GBGA 5AHKA 5NLLA 2WYWA 4QIHA 1DZIA 3C6BA 1LDNA 3M6MD 4QELA 2E6UX 3QFRA 4TYYA 4X85A 3TKYA 2WICA 2HSEA 2QVCA 3FUWA 4BFXA 4JDUA 1TJNA 2QX8A 2ZE6A 4FU0A 4G0XA 4GM4A 4HAOA 4LNHA 4YI3A 1BC5A 5EPUA 3G1TA 3AM5A 3ESAA 2ZT6A 4URFA 2OUKA 5K6TA 4E03A 1ZJ4A 4HX9A 4TM7A 2N1MA 1GU7A 5AXAA 2H1OA 4A0RA 2HO5A 3ZTWA 1AF7A 4Q4CA 5GY7A 3FIJA 1NONA 4LMRA 4KE8A 5BNZA 3DMTA 1L5RA 4K05A 3TRHA 2GPWA 1TQDA 2W2TA 4L9RA 4X71A 3TDMA 1DXHA 1QFXA 2GFIA 1P62B 1BVYF 5AM4A 1BQEA 1QH0A 2V6BA 1FYVA 2OKGA 3RSOA 5BN1A 1RI5A 1ABEA 1EXWA 2Y1CA 3A05A 2W2NA 3OQMA 1GDTA 3CKLA 3EB9A 4JYZA 4X65B 1YRAA 1T1EA 1E3JA 1Z2CA 2CXSA 4TVOA 3QE9Y 4EO9A 3NORA 2QTMA 1Z4QA 3ORRA 4RK7A 1TYBE 1K68A 1XMPA 2JFYA 1OI7A 5ILOA 2Y1WA 1K1EA 1E9RA 2B4KA 3S2YA 1T36B 2OYRA 5GWXA 4HN2A 3TBHA 4GMHA 4WESB 1TLFA 1ESNA 1R0WA 5LNK6 4H3KB 4KDCA 3RS8A 4BFVA 1UXHA 2DRIA 4JUIA 5LA6F 2ODAA 2VZ0A 4DA0A 1G0NA 5BUCA 1EUQA 3FFXA 1VLMA 1JIQA 1Y1PA 3ANNA 1JHQA 3W2FA 3K9GA 1JPNA 5JCJD 1Y6GA 1BMTA 1SU4A 2VDUE 1EXMA 4EZEA 4N12A 1WY7A 3EVTA 4MOWA 1NKTA 3CQ9A 2CVZA 2VJQA 5EI5A 3B1FA 3W6OA 3HVRA 1CZLA 3J7AC 2J6CA 4LECA 3VDXA 4ZT2A 5EJ7A 1OV4A 3IT0A 1Z0DA 2QHXA 4GUAA 5TS3A 4M2LA 2I7XA 3NT5A 3UT5B 1O77A 2GOYA 3EW9A 1WU8A 3HKDB 4LX0A 3NB0A 4KK4A 1M6WA 3MXTA 4M46A 2GPYA 1CF4A 1ZGGA 3G0BA 3U3DA 1N2JA 1NLMA 5KZMB 1YUNA 4WVLA 3WRWA 3I8OA 4YRZA 1K0UA 4UUAA 3AR4A 1REQA 3DWEX 3DYVA 2FJUA 3MAAC 4UD6A 3PYMA 1JQJC 2CL5A 2BZ1A 3KJGA 5DGIA 1YVDA 2IEIA 3GU3A 4Q4AB 2AJCA 2J3QA 5B1YA 1IXYA 1VJRA 4JI0B 4JLKA 4RKWA 3DZKA 1RRGA 4UBKA 3FCCA 4HQRA 4ZT5A 4FGUA 1Z74A 2NADA 3ASVA 2DFKB 2GCIA 4EY4A 2DQKA 1H0HA 1MG5A 2ZUSA 4QFMA 2R11A 3UMFA 2ASEA 2Z2YA 3BRCA 2BFWA 3IELA 1WY5A 4ZU3A 1J2UA 3VZRA 5I7RA 1QCCA 1N5IA 1UIMA 2OP0A 3KJIA 3C3WA 3L49A 3I2FA 3FMVA 3L6CA 5A9TA 2RGEA 2NVUB 5EJ4A 2YWRA 3P4XA 1W73A 4H3HB 1RLJA 4TYMA 4R71A 3FLEA 1HYQA 4FCTA 2YW9A 3PQCA 1E1MA 4M36A 4E7PA 1D6MA 1EBBA 1GN9A 1RXUA 1CCWA 3KOUA 1EX1A 3ZHTA 5LN1A 1IXKA 5A03A 4ERNA 2OBNA 5KTPA 1B00A 5K0GA 2E6KA 3TYXA 4HEA1 2BFNA 2HU8A 4POAA 3E70C 1X15A 3DXYA 3I2GA 1U9JA 3CIOA 5EZSA 5J9FA 4F8YA 1ZY2A 3BFPA 3M2TA 3OAAA 4OGLA 4AKGA 4L9SA 3TW8A 1G7RA 3K4QA 4MWBA 2VZLA 4C03A 1AS3A 1P18A 2P2LA 4ZEWA 5K03A 4AYWA 3AL2A 4NEGA 4WZBB 4YRTA 2C3PA 1CZOA 3NMUF 1XMVA 1U11A 5BYKA 1P2BA 4N8SA 4CM5A 2JDID 2QAIA 1JT2A 1RWQA 2YZ2A 3HS3A 3BDAA 1FU4A 2NUBA 1YR2A 3HB5X 4B6PA 1SXJE 4N6OA 2BMJA 2VEOA 2Z9DA 3FIUA 1QCYA 1I7SB 1OB5A 3ECCA 2K5UA 2IYVA 1IRIA 5L3SA 1M10A 5LLDA 3ITEA 5KOJA 2UXCB 2GKOA 3LQKA 5CLGA 2VSQA 1Q91A 1Z7GA 4P5EA 2V4UA 4N1AA 4ALKA 4CM3A 4Q34A 3HDQA 3Q9LA 4TLEA 1EGHA 4KNWA 3Q9NA 4J0FA 4NTZA 4RVSA 3W3AD 2Z5LA 1G98A 2XUQA 3GCZA 1IBMB 2C0CA 2R1UA 2ZXEA 7MDHA 1GPNA 3KQNA 3IVGA 2QTAA 1R8SA 1RXIA 5D00A 4MRAA 4K9OA 1VTKA 1SBHA 1WR8A 5TQ2A 4F5DA 2X1HA 5GGXA 1DO0A 2I6TA 2RGCA 2WSSA 3HLTA 3JSAA 5ALLA 3FD8A 1C0EA 1L5KA 4ALIA 2Z83A 5D3ZA 4YLEA 4V0LA 3EGOA 2ZJFA 4AP9A 4B7AA 3GFFA 5HWSA 2V55B 2VWPA 2OGUA 1X7WA 3GD5A 3QFHA 1UQTA 1P0FA 2D0IA 3VR2D 2P78A 5IT5A 3LBYA 3VHRA 3ETGA 2ZU6A 3RFCA 2C3YA 4DANA 1OJLA 1PSDA 4NP6A 5FD8A 1Y7LA 2HPAA 1L2TA 3GD7A 4WCFC 3SS9X 3BRWD 2C4WA 3PFIA 4PIVA 5I5GA 1XUOA 1Z4LA 3OZFA 3LUGA 3QI2A 3QOFA 4QECA 4WN9A 1WZNA 2O1EA 1KI8A 3DBRB 3OZWA 2C5EA 3PSHA 1X74A 1GNPA 3O9VA 1OIVA 4GSKA 4IIJB 4QBGB 5AKEA 3UA3A 2O0JA 4JSTA 3DLAA 2Y71A 4OGWA 4H0CA 3RC8A 1U2SA 2C1XA 3HSSA 5LYYA 3BIOA 2VPXA 3T3OA 1QIKA 2ZRMA 3OIYA 4D9CA 4DXAA 3EZXA 1JHOA 1SUCA 2YXLA 5BRNA 5AW1A 4U9HS 4E4TA 3M8KA 3IBTA 4B2PA 4EHBA 1VE7A 1OVMA 3H0EA 3A6KA 2DY1A 4JCCA 2PXAA 3K8YA 3IR7A 4AVYA 3AUSA 1WPGA 2ZR7A 3BWXA 1HG0A 3GL9A 5AMXA 3T61A 1KJ9A 3KBOA 1ZWKA 1WCXA 5BN5B 4Z49A 2HT1A 4QDXA 3PFWO 4DMGA 4HNRA 4IDBA 1L4FA 1Z68A 4MP8A 2VP5A 5J2TB 2NO9A 3WYFA 2AEJA 1WG8A 1DU4A 1Q7BA 1HFWA 1FW8A 4ENSA 4OYYA 5FEUA 4ETNA 5J5VA 2YWJA 4CF6A 1EA5A 3I52A 1Z28A 1MAAA 4KUHA 5JANA 1QMPA 2B92A 2VHZA 2JIOA 4QSMA 1JXQA 4ZOBA 1UDAA 1SA0B 4JBXA 1L0BA 2A9VA 4LDAA 3RFTA 1LVUA 1G41A 3BMQB 3KTDA 4QJ4A 2XHZA 3TMKA 4BTEA 4W7HA 4CI9A 3P5BA 3B6EA 3KKPA 3S8MA 4B6EA 1NVDA 3QH4A 1EGAA 4P3YA 221PA 1LF0A 3IAAA 1RKXA 3ZQ6A 4DM3A 1MHPA 3VZDA 4G86A 3L4BA 3NHJA 1AX9A 4XARA 1O97D 2QLMA 1P2DA 3AB8A 3KUXA 3M9XA 4GG1A 3UGTA 4J9UE 2FX3A 1E9BA 1ZD2P 1HL7A 2Q9CA 3EOAI 1ZD9A 4TLMB 2IEAA 2ZSIA 3DJFA 4FBGA 3ELBA 1DDGA 2WWGA 1C3OB 5LJIA 4P93A 1A5SB 4QYWA 1UIRA 3Q1KA 2QP9X 4ARAA 5C1BA 4NFLA 4X64B 2W6PA 3LQFA 4CDNA 4IUBS 5B3JC 4LF5B 4YRCA 5E3JA 3KJNA 1YAJA 3NUQA 2PNJA 1KQOA 4H7IA 1IZ9A 2JH3A 2ZATA 3CCBA 4ME6A 2EIHA 3EJ6A 1JLMA 5EUCA 3LRTA 3V6MA 4G97A 4IZ6A 3U56A 1Z22A 4J6EA 3AUKA 2P3OA 3ND5A 3MQ2A 4L6CA 5JO0A 4HGZA 5ICMA 3IMEA 2VQ3A 3FTNA 5LYJA 1OKKD 2D59A 2H4YA 2YJNA 3CKKA 3HP7A 4XTCS 3FTDA 5DHTA 3SQMA 1B8VA 2Q3FA 3SQNA 4DE5A 3ZJUA 1I5RA 4DBVO 1VPWA 2J3HA 5HXAA 5HPYB 3KT3A 2XT0A 3EBPA 4IEEA 2EFHB 2XCSB 2PGXA 3OLYA 2NO5A 2WF6A 1Z83A 4HQFA 5CBPB 1NVGA 5EVJA 3R7FA 2RSLA 3E5HA 1DQPA 4CLRA 3ETJA 4ASUD 2OFPA 5LDHA 2ID7A 2OMEA 3AKCA 4N3CA 1FFYA 3A4LA 1F06A 2IZ0A 1SCUA 1G2IA 3AW8A 1MIOB 3L7KA 1N3YA 3GGJA 3B13B 1MX3A 2XGSA 2DMRA 4NZYA 1YZQA 4I4TF 5AW6A 4CKBB 5KTTA 1AKNA 2JEOA 2QTTA 4A23A 3GAMA 4EVIA 1XZCA 4AW9A 4RZXA 2VPIA 1LWOA 4EI8A 5G02A 5JCOC 2F8LA 1B2LA 1AT1A 5M5BA 4B3IA 2DWQA 3LQ2A 2ZYTX 4ZOEA 1X42A 1ADCA 3ISVA 3OFJA 3E0XA 2ZYIA 3ZDXB 2G80A 4QX6A 5BMOA 3AH8A 1KC1A 5ENDA 5SY9A 3WK5A 4HYYA 1QONA 2F1OA 2XUKA 1PBTA 4BCBA 1KJYA 3I0NA 1ONNA 3EIOA 3K0BA 3TN7A 1RYBA 4DLVA 5IYZA 2GEJA 2VDJA 3R6LA 4IIYA 4EJMA 3AUJB 2B3TA 4ZTUB 4X95A 1RM0A 1ZNQO 2VS1A 1T4CB 3QWAA 1X1DA 4OKIA 2O5CA 2DP4E 2WT4A 2V7TA 4I9HA 4N5NA 2G72A 2Z9BA 2V54A 3AX6A 2FPXA 1EJ6A 4NE9A 3UMVA 1EVLA 4D4JA 1MJGM 2UYYA 3A4NA 2NSJA 1G3IA 3A1VA 3JQDA 1YQDA 4MRPA 1KQFA 4NYJQ 3RKRA 4EZBA 1DIHA 2YDYA 3KLOA 1GTL1 5FNVA 3ZE6A 1K7EB 1YI8A 3BMCA 2G67A 3TZKA 4BLUA 1ZJYA 3AJ8A 2C5GA 2P8SA 1KKUA 4CW7A 2J1LA 4UU1A 1PAUA 2QRVB 3SBXA 4JKOA 1DBVO 2VUIB 3I5MA 4YY3B 4NBNA 4EY5A 1UXKA 3DLIA 2JGEA 5AUPB 4B3MB 4DV1B 2PQ0A 3AVTA 1ZZGA 3F7OA 2XY4A 3TLYA 2YVLA 4MLPA 4D2IA 3EDCA 2WU8A 1E0SA 2L42A 4DCSA 4B6OA 3WGLA 4Z3OA 4TTJA 3IBYA 5FYQA 3OTOB 1EFHA 3BJRA 3H2KA 3BBPA 2Q6KA 1QHSA 2OCLA 5BRJA 4YCLA 2ZR9A 3ZHQA 2MSNA 5LDDC 1QS0A 3ZDRA 1KZ6A 3D43A 4LJ8A 1MOSA 1CUZA 1T1SA 2EBUA 2YV5A 3G2OA 3V55A 4KTTE 2XMPA 4CG1A 2ZRDA 4GBED 2VAMA 3DC7A 4QBTA 4TMZA 3SS7X 3VOBA 4CEJA 2YJ4A 2PWBA 1GVHA 3QLEA 5CX1A 3HZHA 3C3XA 4KPUA 4LY3A 4JZYA 3R3ZA 2N47A 4DMKA 2NAFA 1VYHA 2HPZA 3HY6A 3QVXA 3A37A 1ZD1A 3NHPA 2WBLC 4JJZA 4WNYA 4EPVA 3GMIA 2UUAB 2FF7A 3BHNA 3PC7A 3DO8A 4TLBA 4ES6A 4K40A 1G66A 3EZFA 1WW8A 3E23A 4W1SA 3U9TA 3ZZMA 1D09A 1FRNA 2WMNB 3TE6A 4I50F 3QW4B 3EAFA 4GPIB 3ZHSA 3FZYA 5ITVA 3ER8A 2ZI5A 2R6ZA 3U1BA 2I1LA 4J76A 4KVZA 5K3AA 3BCHA 5DFAA 1HNNA 5KYUB 1BIFA 3PE4A 1QHHB 2ZBGA 2ZYGA 3W79A 3WGYA 2BZGA 3U40A 4UNRA 1Z5NA 4BKOA 5BT8A 1U7DA 3BEDA 2VO1A 3DE1X 4XIJA 1CBUA 3JU3A 4K6GA 3TSOA 1E98A 3GRYA 2I2CA 3LUDA 5LQDA 1Q0PA 5AK5A 3DC2A 3ZW8A 1L5LA 1S01A 3I1FA 4IO1A 5JLAA 2RHOA 3K1YA 4OYLA 3R9XA 2H9AA 1F4PA 1N25A 3SZRA 4B74A 3RC1A 4RIGA 2RGAA 3K53A 1ZD4A 2RBEA 5IVDA 4K0RA 1DC5A 2EP5A 2VK2A 4R41A 1MKYA 3IV9A 3PFGA 5CLLA 4ZA2A 1PFWA 3CMMA 3NIGB 2HD4A 5CGZA 1SKYE 2JKYA 4PRKA 4QPNA 2V4MA 3K15A 3OFKA 3LS2A 4DJJA 3NWBA 4UATA 1JWAB 1O6GA 1SFRA 1D4ZA 2QDXA 3TZEA 4H16A 3OOWA 3AR7A 3E5NA 4KXUA 4MEAA 4CF3A 1YJQA 3TAUA 4KR2A 2W71A 2Y8EA 2JJ1A 1QX4A 4V2IA 3U9SA 5IULC 3C45A 2FZGA 3R3YA 1P4GA 3CZRA 3CYFA 3PKIA 2XYHA 3ORSA 3BFXA 1V7CA 3C70A 2BFAA 4D45A 5HDQA 5FUVA 1NUTA 1CJCA 5LP1A 2GD0A 3UG6A 1GDDA 1U2TA 2EJBA 1N36B 1XNHA 4TXNA 4F6RA 1RVDA 2KMLA 5LP6B 2VRBA 1SVSA 2GARA 1TLTA 4UAVA 1Z4KA 4ZOLF 4D9MA 2IYEA 4MULA 5C31A 4F5WA 1V71A 4GWGA 1JR3E 2PPVA 4RQTA 1BEUB 3Q3JB 1EH5A 3OU6A 4L2IB 4HDMA 1TMGE 1PVOA 2GGSA 2IYRA 2WOJA 3CLRD 1CQWA 5I9BA 4CIWA 3RADC 3IV7A 3OEED 2RGRA 2I4LA 5EA2A 4RTQA 5JSQA 1CJUC 2HB6A 4C2UA 1GEGA 4GGOA 4M0PA 3U1VA 4QJBA 2XUIA 5KSPA 2OO5C 1U4NA 3N9IA 2G9NA 4BEBA 4M1MA 1AU9A 4UARA 1V6AA 4CLEA 5K7SA 2H4WA 1DT5A 2O5EA 2GZMA 2PO5A 4J29A 4CEIB 1G20A 1FUEA 2VKTA 2XNCA 3GAAA 1E3SA 3PEFA 4G5FA 4NY1A 4YYEA 4CPDA 4D56A 2I2BA 2ZUDA 4U00A 1TZKA 3HWSA 1SUBA 5ECWA 3LFTA 1WZUA 1AY0A 2HHLA 3LLCA 3V4FA 2E37A 5AR1A 2V6MA 5C46F 4R2MA 3TXXA 1UBKS 3ZCQA 1T6YA 5TQVA 1W1IA 2H31A 3EWNA 3FPCA 1OTHA 1AQNA 4NABA 2D00A 1A4UA 1GQYA 3A32A 4IRXA 3OZIA 4A5SA 2IL1A 1YL6A 1U02A 1I5EA 3MF4A 2R1ZA 4JSRA 3ZEAA 1CHNA 3TJMA 1ZOSA 3GDFA 4ZQIA 1O96B 1K5DA 5DTQA 2PRYA 3D7RA 1PJ2A 2ZB8A 3GH1A 1JGTA 3HYCA 1A8HA 4IZHA