4UQCA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.30 a resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 140
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqcA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqcA02
4MNJA 2XIIA 3OLEA 2J7HA 2J7DA 4C7DA 3PZNA 5DEZA 2D24A 2XVPA 4AD4A 5A6AA 2F7PA 2QMJA 2CHOA 1VFOA 4FNSA 3DDFA 1KFWA 1VJZA 4TX6A 4MNMA 3A22A 2OYKA 3T0DA 2DIEA 2V3EA 1UR9A 3J7HA 1UWTA 1HXJA 1HKKA 3VD4A 1J9YA 1AVAA 4JFUA 1C8XA 3A4AA 1B31A 3M46A 4TTGA 3VIJA 1NM9A 1UR2A 1BSIA 2XPKA 4QCEA 1C8QA 1MW0A 2X09A 4PTMA 1UUQA 1NWUA 1MQPA 4GO9A 2WC3A 4YHGA 5I5RA 4B9ZA 5HPOA 3W28A 1HF6A 1BF2A 3DX4A 1XYZA 1IT0A 4J3TA 1GQJA 5I77A 4M24A 4U3CA 1JZ7A 2XHYA 2VVNA 3MV11 2CCRA 3T0BA 3BCDA 3OGSA 5AYIA 3O9NA 1QPKA 2VCBA 1W9BM 3EJPA 1R87A 5LA0A 4P7QA 3AMKA 2FE0A 4NZCA 4U2ZA 2BV9A 5EFFA 2CNCA 4HP5A 1GOIA 3IANA 2EACA 5A6MA 1NWTA 2NT0A 4GI8A 3WENA 4P7LA 1UH2A 1H2JA 2WMIA 2PB1A 2DEPA 5JIWA 1JYWA 3GDBA 2DH2A 5E6YA 3W82A 2VVSA 2EXOA 3VD7A 4B16A 3MMWA 1R7OA 4J3WA 4WSKA 1PIFA 3HG4A 1W1TA 4UCFA 3LRLA 3WDRA 4JKMA 4AMCA 1GNXA 1BTCA 1KTCA 3EDFA 3RJYA 4ZXOA 1HTYA 1E6SM 1JF6A 2ZUWA 4OOUA 2J7GA 2XVGA 1GZJA 5JBFA 4IISA 3A6OA 3SUUA 1JG9A 2VRJA 3RIKA 4A3HA 1OGBA 1LJYA 4PSPA 2FH8A 1CWYA 4URIA 2OWXA 1WZMA 1W9DM 3GXMA 3DDGA 3NDYA 2GUYA 1M53A 3L4WA 1FOBA 5JBDA 3A5VA 3FHQA 4J3UA 4OBRA 4HTYA 1VBRA 4FLSA 3AMGA 3CGTA 4NZFA 3W25A 3WD4A 1E3ZA 3ZR6A 3VU2A 1W9PA 5AYBA 3K8MA 1V3JA 4ACYA 1EGZA 1TCMA 1V3IA 2XVLA 2VMFA 3TTOA 5HNNA 4NZJA 2Y24A 2WBKA 1DWJM 3OGRA 4W8AA 3AIBA 3PTKA 4QAWA 1QNSA 4D6HA 4AZ5A 5KZ6A 2V3DA 3AZSA 4AD0A 1UR8A 3VO0A 1UH4A 4RE3A 3CV5A 3VDAA 2X2HA 7TAAA 2HVMA 2OLHA 5ECUA 1HT6A 1XSIA 3CBWA 1JD9A 4TVDA 4NRSA 2UY2A 3OGVA 2A3HA 2VC9A 4KGLA 3LMYA 1MVYA 5DF0A 2YLLA 2V3GA 1KCKA 1EDQA 4PBGA 3GNOA 1K9EA 1QNPA 5IXEA 1V0NA 1E6PA 4W85A 3WDQA 2PBOA 1JZ5A 1JZ6A 4W8BA 1W32A 4MB5A 3PZVA 2ZUSA 2IXVA 4Z2IA 2BY2A 2CERA 4HA3A 4U33A 1JXJA 1E6RA 3GXPA 1E0WA 3MMUA 3BSHA 4AZ7A 4H04A 5ABEA 1V6UA 1UH3A 1B3VA 3D3AA 1J0HA 2D3NA 3UEQA 1H4PA 3ARSA 1XH0A 3PZUA 1FP8A 5DMYA 2WANA 4TXEA 5LA1A 3B9DA 1K6AA 2DT1A 1TVPA 2CXGA 4W7UA 3PZQA 3ZJKA 2EPLX 1DP0A 3VGFA 3L2LA 1ZBVA 2PC8A 3AOFA 3MV01 3EMQA 3IGUA 4MB1A 3WF3A 1L0PA 2ALWA 2GFTA 4CD4A 1BPLB 5A6KA 5ABFB 4J7RA 2FHBA 1H41A 3II1A 3WSUA 4UFMA 1LLOA 4R27A 3WQ5A 3WNLA 1OGGA 4DO6A 4AWEA 3BLPX 3S2CA 1FA2A 2J75A 5D8WA 1JYVA 1TE1A 2YFOA 4LYPA 5DFAA 1BVZA 1JYNA 3ZQ9A 3WUBA 3CPUA 3RPMA 3N18A 1N82A 3THCA 1M01A 1V6YA 2FH6A 4WSJA 1OM0A 1QI3A 2XN2A 3EDEA 1CBGA 1F4HA 1VIWA 5HOSA 2WVVA 2ZX5A 4U3AA 5CQ1A 1BLIA 1QNOA 4ZENA 1ISXA 2DSUA 2EQDA 4X9YA 3B9EA 1MW2A 1GOQA 3VGBA 3ZT5A 1Z32X 4NRRA 5A8NA 1US2A 1HJXA 2WHJA 1E70M 5A6JA 3WFLA 4P8XA 4J27A 3CHEA 4PEEA 4CCEA 2QF8A 1H5VA 1LL6A 2EPOA 1UHVA 3RM4A 1V02A 4HA4A 1JNDA 3N13A 2XSBA 4GXPA 5IHSA 4AIEA 3T2PA 5CLTA 1J12A 3KL5A 2E9LA 3DX1A 5I24A 1CXLA 1V02E 1X6LA 3BLKA 4LPCA 3ZJ7A 3NSXA 1ISYA 3EDJA 4A3YA 4MJ2A 1WAWA 2EPKX 1G9HA 4KRUA 1OT2A 4CU8A 4MTVA 4CD6A 3VM7A 4QLKA 1EXPA 2YA2A 2Q8XA 4JFWA 1KQZA 2XG9A 1UWRA 4NXSA 4FNUA 4H8UA 2CBJA 1KQYA 3CUFA 3UG5A 2G3JA 1LF1A 5A69A 1HJWA 3WDPP 5DT5A 1PAMA 2GK1A 1TFVA 4HOWA 3DYOA 2G8ZA 1PZ3A 3WH8A 1PZ2A 3BSGA 1H3GA 1CGVA 2ZOXA 5IDIA 3AS0A 4GZEA 1FH7A 1K9DA 1M04A 2WW5A 4JAWA 1RP9A 2XFFA 1BG4A 1WO2A 3TTSA 3K1DA 4PTVA 3M6DA 4AIOA 2ZWZA 1EHAA 1BHGA 3ARYA 2D73A 3IJ9A 3IAPA 4ZXLA 4JL1A 1XH2A 4AXNA 4CKQA 3MKKA 2BVYA 1FP9A 3BVXA 1FH9A 2VX7A 4PUDA 1E73M 1I1XA 2F7RA 4GIAA 1R8LA 1V08A 1CGTA 1CXEA 4RL3A 3QR3A 4MADA 1ECEA 3VTRA 3FAWA 2YJQA 5GQBA 1AQ0A 1Q6GA 3VIPA 4D6CA 4TVUA 2HISA 5E09A 1KGWA 4Z2GA 1J11A 1XCWA 2J74A 1W3KA 4DWSA 3L4VA 1JD7A 2XWEA 2DT0A 2TAAA 4JFTA 5A8MA 1QI5A 1PIGA 4L4PA 3U7VA 1CXHA 4BF7A 4AMXA 3ARRA 1E5NA 3HMCA 5EBAA 2VZUA 3A4WA 3VGGA 2XM2A 3VINA 1LG1A 4D6EA 2IXUA 3FY1A 2A3AA 1HJSA 2FGZA 4OBSA 5M17A 3VSTA 3MUZ1 4AEFA 3KLKA 4QLJA 4QCFA 3PN8A 4OIFA 4KWUA 5F7UA 2IUZA 3ZT7A 2W67A 4A4AA 5JBEA 4H41A 4WKFA 3BUIA 5CJ5A 3W37A 3SUVA 3WF2A 1RPKA 3ARUA 3RMEA 1OIFA 3NDZA 1FFQA 3KE0A 2O92A 1OB0A 3SUTA 3WN6A 1JAKA 3EYPA 2OSYA 1HKMA 2WVUA 3CHDA 1XHGA 3BC9A 2D0HA 4BQ3A 1DWIM 5BCAA 2WK2A 2X8RA 3KZSA 1TR1A 4ATLA 3HZ3A 3VIGA 1AQMA 4W7WA 5A2BA 4LYRA 3ZSSA 2PWGA 2CETA 4X0NA 5ABGA 5AC5A 4D1JA 3WUEA 1PJ9A 2IGTA 3RM9A 4CD5A 1GOKA 5D4YA 2AOSA 2W4XA 3OLIA 5A2CA 4XV0A 5CPQA 3T08A 2BXZA 2XSAA 3TOPA 3VM5A 2O9TA 3DC0A 1OSEA 4AZGA 3WNOA 4EKJA 3CZNA 4HZ7A 4WIWA 1JZ4A 3OBAA 3VUPA 2D22A 4DM1A 1WZKA 1E9LA 4J28A 4PMDA 2EPNA 2YIHA 1WP6A 3WMSA 3BAXA 3K8KA 4W7VA 4MAVA 3WEOA 1OWQA 2CPUA 1QI0A 3BUBA 1MYRA 2YOCA 1J0IA 3S5YA 8CGTA 5JIPA 1DWHM 2VTFA 2ZICA 1I75A 2OWWA 3MANA 2JEPA 1CXIA 1Q6FA 1UG6A 3JUGA 2ZWYA 5GNXA 1TUXA 3AS3A 5FCZA 3MUIA 3NJ3A 1WZLA 3W6LA 3WBAA 5DO8A 4LX4A 3ARQA 1MQRA 2YA0A 3WD1A 4C7FA 3RDKA 2FDMA 1UOKA 4HU0A 2VCCA 3FXYA 1E56A 4WJXA 2CHNA 2EAEA 1CZ1A 4Z2JA 4MPKA 2XWDA 2NSXA 4HOXA 1HP4A 3TV8A 2VJXA 2OSXA 1UD5A 5I0DA 2Y2WA 3VGHA 3S5ZA 1LWJA 3BVUA 1UASA 5CGMA 1NP2A 2WMKA 3F5KA 1LG2A 3N17A 2CBVA 2OW7A 4PMVA 1NOWA 1E4NA 1BG9A 4F79A 2ZX7A 2FYVA 3OA5A 1G01A 1JNEA 3SCTA 4CU6A 2J8GA 1CDGA 3LPPA 2ZE0A 5CGTA 2VR4A 1QBAA 1JIBA 4BZYA 3KLLA 2DT2A 2E3ZA 2BS9A 2O9PA 1H49A 2Y8VA 3CMJA 3M07A 3DECA 3SUSA 3UERA 1NP0A 2X0HA 3VD9A 1VEPA 4N42A 3HG5A 4V2XA 2ESCA 2W62A 3WQ6A 3DYMA 1EO5A 3WY1A 1FHLA 3FN9A 3EJSA 3AQUA 2XYLA 5A2AA 1FH8A 4JFSA 1G1YA 1HL8A 2Y8KA 4X0VA 4P8WA 2YLAA 1OD8A 4AC1X 1NQ6A 1CNVA 3PBGA 3WMBA 4Y7EA 1QX1A 4D72A 1FHDA 4YPJA 2XUCA 5EFDA 2WSPA 4NI3A 1G5AA 2D2OA 3D4YA 2V5CA 3NYDA 2DH3A 4FNPA 3WF1A 1GQKA 2AAAA 1XD1A 1VF8A 3UESA 2DSWA 1OGSA 3B9AA 4NSBA 6TAAA 3VD3A 2F61A 1SYTA 4CCCA 2WKLA 4GO8A 2X2JA 4L4OA 2JIWA 4J3SA 3WL0A 3W24A 4PMRA 1R34A 5E1QA 4E2OA 2A3EA 4GPNA 4UFIA 1E6NA 3VMOA 3BXWA 5BWFA 3CIVA 1UZ1A 4ZFMA 3VIKA 3QHMA 2G3NA 3K46A 2J79A 1AQHA 3AIQA 2CBIA 5M5DA 1QHPA 1KR0A 2G3IA 3ALFA 5CXPA 1V6WA 4D71A 2DGAA 4DWSD 5BXTA 4GKLA 5BROA 1OT1A 1SR0A 3PTMA 2QV4A 2W92A 4D6GA 3WDHA 3WY3A 3K4AA 2PF0A 4U5KA 3PZOA 1V0KA 1Q6CA 1J0YA 3BVWA 3EMCA 4JFVA 1U2YA 3EJRA 3TONA 1XSJA 1CTNA 1DWFM 2YL6A 2GDVA 4F66A 4PMXA 1JGIA 1E6ZA 4WKAA 2J7BA 4XZWA 2CYGA 5EB8A 2CIPA 3PZMA 3WIJA 1ZJBA 4YHEA 2VOTA 4PN2A 4CVUA 1GQLA 3L4TA 4W93A 5ABFA 4TX8A 3AHYA 3BUPA 3D4ZA 4MNKA 1UZ4A 3BAKA 4CVWA 4UOQA 1PBGA 4KMQA 4GQQA 3BMVA 1CECA 1UD6A 2ZUVA 1SMDA 2VNCA 4E8CA 3OLGA 3PTQA 2ZXQA 1J10A 5JUVA 1W3LA 4JCMA 2GDUA 1W9XA 2J25A 3CZGA 2G41A 5CSUA 1GCYA 5E6ZA 3PZGA 6A3HA 3PZ9A 3VDCA 5BXRA 1E43A 1C3FA 3VX1A 2BFGA 3IAQA 4BQ5A 5I78A 3G6LA 2XN1A 3GTNA 3HJEA 3U7BA 1ODZA 4PMZA 5FOOA 2Z1SA 5E9AA 3NIYA 1B0IA 1JYXA 1JDAA 1R75A 3GH7A 3LXBA 1VJSA 2GJRA 1GW1A 3N15A 4RE2A 2BVDA 5CLWA 2PWEA 5AC4A 5A1AA 2X1IA 1BGAA 5I3DA 2VZOA 1NOUA 3POCA 5M03A 5A3HA 4DUXA 3WDJA 3A21A 3AYSA 1PS3A 3L4ZA 4PCSA 4HMEA 1CXFA 2Y4SA 3AIVA 3VKKA 3GH5A 1GUVA 1E6XM 5D9NA 1FFRA 5I6SA 5CPSA 4M8UA 3W4RA 4AYGA 4N0RA 5A6BA 1JAEA 4P7RA 2J4GA 2WC7A 3U57A 1BYDA 4W86A 1IV8A 3WD3A 2XFYA 2GJPA 3ARVA 1H0GA 4WK9A 5A8QA 4HPGA 3DX0A 1UD8A 2WHMA 3TA9A 4AZ6A 4TOQA 5HDRA 3WL1A 1W91A 3CTTA 5C8BB 3ZSTA 1C92A 2OYMA 1W2VA 3DYPA 3HG2A 5I23A 1QBBA 1MW1A 2BHUA 4MAZA 4JZ5A 1KBKA 1B30A 4BCEA 1SZNA 2X05A 2C7FA 1RD6A 1WKYA 1B2YA 1TA3B 1TQTA 3E1F1 3RILA 4QLLA 3VNZA 2FHFA 2UY4A 4FLOA 2WLZA 2BY0A 3VVGA 1XV8A 3W6MA 2QMKA 1QWNA 4MB3A 4CN1A 4FNQA 2XGIA 3QOMA 1IZKA 1EOMA 5GPRA 4DUWA 3AFBA 5I2UA 2VX6A 3WH6A 1J0JA 3AS2A 3WF4A 3WY2A 2V3FA 2JALA 4PYSA 4YN5A 1CIUA 3LPFA 2VI0A 1QOXA 2BY1A 3WH9A 3AHXA 3I3BA 1CGUA 2WWCA 2WWDA 3G6MA 4OZOA 3SCQA 1VAHA 2WYSA 1R47A 3SCSA 1R86A 1G0CA 1TG7A 3B8SA 2J7CA 2QPSA 3NSMA 4OGZA 1KR1A 3GZAA 3CUGA 4B3LA 2CKRA 3AROA 3LXCA 4FNRA 3OG2A 4UTFA 4UQAA 2WMHA 1MQQA 1W1PA 2WCAA 4Q22A 1B9ZA 1TVNA 1V3LA 2WSKA 2YBTA 1VENA 1BQCA 4IUGA 3VIHA 3CH9A 1HVXA 3FW6A 5FL0A 5D9MA 5BRQA 3AMLA 2MANA 3ZIZA 4AZHA 3CUIA 2WCSA 5TD4A 3GBEA 3ZOAA 2Y5EA 2RGLA 4TUFA 5D9PA 1M7XA 1PX8A 4AD1A 2XGBA 2BHZA 3EDDA 3GXFA 4HMCA 4JHZA 3LPOA 2JF6A 1ISWA 1A47A 4UR9A 2VQUA 3VDBA 1UD4A 3AIRA 4W87A 4M1RA 3MI6A 1EO7A 2WAGA 4D6JA 1VEMA 1ZS2A 1WDPA 1EHNA 3WKZA 4DO5A 3HG3A 1E40A 1OCQA 4EE9A 4B9YA 3ZJ6A 3ZO9A 1XC6A 2VT0A 4TTUA 1EH9A 5A6LA 1QHOA 2WZIA 7A3HA 3LRMA 1MXGA 4AY1A 3VDHA 3AZTA 3RM8A 1WPCA 5C71A 1GORA 2X0YA 3N04A 2YKKA 1JDDA 1LL7A 2D3LA 1V3MA 4R5EA 1MW3A 2VZSA 3WBEA 4H8VA 3AI0A 4OOZA 1TQSA 2OWCA 3MMDA 1EA9C 2VURA 4E8DA 3WEZA 4CGTA 2BXYA 1WDRA 4CU7A 3CMGA 1JZ2A 4AD2A 2FHCA 1ZB5A 2J7FA 3BAIA 2ZUNA 4CUCA 3D50A 4HZ6A 3H54A 4NXKA 3S6TA 1CGWA 1B3XA 1H1NA 2WMJA 3T2QA 1BYCA 4P7NA 4JL2A 3O2LA 3VSUA 5A6SA 4HA1A 2ZXAA 3WQ4A 3VNYA 2ZX9A 2QPUA 4AMWA 1K9TA 5FKYA 2NW0A 4XZBA 4PMQA 3OZPA 1UR1A 1HNYA 1C91A 3KL0A 4NX0A 4K68A 2F2HA 2DIJA 5FD0A 4PSRA 1QW9A 1UYQA 2GJXB 4BS0A 2EJ1A 1KXTA 1ZJAA 4OKDA 3U5UA 3OZOA 3I3DA 3AHVA 2W91A 4JHOA 3LXAA 1UQYA 1XCXA 2YL8A 4MNLA 1KWKA 4UQDA 3RCNA 2WVSA 2DSKA 1DTUA 3DX2A 3UR8A 1O6IA 4LGXA 1QI2A 1GPFA 3THDA 3DHPA 5CSYA 3F4VA 1D7FA 3AISA 5KEZA 1GQIA 3W0KA 1Q4NX 4PRWA 4IPNB 4PMOA 2F7OA 1UKTA 2VZTA 3WNPA 2PWHA 2E0PA 4H7VA 1V0LA 3T2OA 5A6BD 1XD0A 5M3WA 2J7EA 2DSVA 2X2IA 3D51A 5A8PA 5HXMA 4AW7A 3VIFA 5A8OA 1H11A 1ITXA 1TZ7A 2WXDM 2D1ZA 3CHCA 1ITCA 6CGTA 3WELA 2EABA 3QGVA 1EIBA 3HN3A 1ESWA 3A24A 1O7AA 2GSJA 1HIZA 3BUDA 3AS1A 4U31A 1YHTA 1OIMA 4AZIA 1J01A 2AMGA 4P8VA 3AXXA 2XVNA 5HBFA 1JZ3A 2CKSA 3SCRA 1DWGM 2XTKA 1VB9A 2VO5A 3MUAA 7CGTA 1HJVA 3AXHA 1E4IA 5E0FA 4IM4A 1BAGA 5D8ZA 3WUFA 1B3YA 3BVVA 3N1AA 2CITA 3FHAA 3PZIA 1L8NA 3BCFA 4HZ8A 1KXVA 2VX5A 9CGTA 4JKKA 2YL5A 1KWGA 2QLYA 4ZE4A 1JZ8A 1C8YA 4F8XA 3GBDA 2A3BA 2J8FA 1O7DC 2BNJA 2EO7A 2WCGA 3DX3A 1ISVA 4FLRA 2E8ZA 2YA1A 1QVBA 2C0HA 1P6WA 4DM2A 1BVNP 2YDSA 1YQ2A 1B90A 1VFMA 3WDIA 5I79A 3OLDA 3WUGA 3QOKA 4S3JA 3ARZA 1JI1A 1R46A 3AIUA 4MDPA 4XUYA 1V6VA 1JI2A 1KB3A 1ZL1A 2ZXDA 3MS8A 1Q6DA 4WKHA 2BHYA 2C8NA 3L2MA 2DQXA 1WCGA 3CC1A 5AY7A 4AIUA 1W1VA 1MWOA 4U2YA 3OIHA 1RP8A 3F5LA 4B3KA 3SCUA 2ZX6A 3WF0A 2OYLA 3ZT6A 2VR5A 5ABHA 2XN0A 4C7GA 3VX0A 4BA0A 4GI6A 2PI6A 1TQWA 1UD3A 2WPGA 1E71M 2UY5A 4QP0A 3GM8A 5FL1A 2PWFA 4JIEA 3GXTA 1GOOA 3BVTA 2OSWA 2WMFA 2XFRA 3VILA 3T0AA 2WVTA 5HPCA 1UKPA 1KTBA 5IFTA 3WNKA 1WDQA 2JEQA 1GJWA 4HOZA 2EADA 5E0CA 2A3CA 4PTWA 2WMGA 4AYSA 3GXIA 1ISZA 4ML4A 1C90A 4CD7A 2YFNA 4D6IA 1E0VA 4W88A 4D6DA 3VIMA 1UQZA 1GONA 3OB8A 1NOFA 1QNRA 2RGMA 2XM1A 2D0GA 3F5JA 1S46A 2EPMX 3VMPA 1W9VA 4LQ1A 3EJUA 3M7SA 3PZTA 4AZCB 2BVTA 1Y7VA 3BAWA 4UQEA 4LYQA 2WC4A 1E5JA 1EDTA 3WMCA 3D52A 4UOZA 3H55A 3L4YA 3AZRA 1X1NA 2J47A 1OD0A 1GHSA 4M56A 5FIPA 2EEXA 2WZHA 3CUHA 4ACZB 1GOMA 1ZBCA 3A4XA 3WEMA 1CYGA 4CCDA 2W61A 3WD2A 1DWAM 3CZSA 3SCOA 3MUY1 3SEPA 5IFPA 3K4DA 1E4MM 4KH2A 1HVQA 4H8HA 4UFKA 3T09A 3U5YA 1WNOA 5A95A 2DSZA 2F1AA 3ZM8A 1UKOA 1CEOA 1D2KA 3WH5A 2VL4A 1E55A 4M82A 5BXSA 1B3WA 1GOWA 3SURA 4F9DA 4AISA 3WNNA 3CLWA 4J3XA 5GNZA 1CGYA 3SCPA 1HWWA 4FLQA 3GH4A 3CUJA 1TQVA 1E72M 2UWFA 3AXIA 3BAYA 1VRXA 2YL9A 3AHZA 4UQ9A 1QHZA 4W5UA 1QI4A 1VEOA 3A23A 4UFLA 3PHAA 1CPUA 2XIBA 4Z2HA 5BRPA 1ZU8A 3N12A 4KRTA 1UWQA 3MSGA 4CN4A 1HL9A 1V3KA 1R85A 3APGA 3UG3A 4D6FA 2JFEX 2WHKA 4E4PA 1TA3A 2WHLA 3CHFA 3CO4A 3NUKA 2D0FA 5BXPA 1PX4A 1MFUA 3AYRA 5D9OA 2X2YA 2WMIB 3VOCA 4PCTA 1IZJA 5CG0A 1RH9A 1UWUA 5DT7A 2V38A 2F8QA 4PMYA 1U30A 2WKGA 1XYFA 3EMZA 4W8LA 1V3HA 1W3HA 4AEEA 1G94A 3O6AA 2FGLA 1XGZA 5EMYA 1K9FA 2VUYA 1EDGA 1JFXA 1HP5A 4LXFA 4GQRA 3W81A 3CZLA 1VFUA 2BY3A 3BH4A 1WDSA 5C70A 1CXKA 3I3EA 1WZAA 1UR4A 4DO4A 3IJ8A 2V5DA 1NH6A 2Z1KA 2ZUMA 3AHTA 3GXNA 3WQVA 1Q6EA 3ZR5A 4W5ZA 5BYWA 1T0OA 2DT3A 4P7OA 3VIOA 3ZMRA 1UD2A 4M81A 1QW8A 3W38A 1H09A 3FNDA 2G3MA 2QHAA 3ECQA 3VIIA 4UNIA 3SIMA 4AZBA 1HKIA 2VCAA 3TTQA 2DPEA 1NWSA 1UA7A 2J78A 1HJUA 4NF7A 3DHUA 3WFZA 4AD5A 4U5IA 1HKJA 2D23A 1GVIA 2NT1A 4Q7NA 5IHRA 1H0IA 2YDQA 1TMQA 3WQ8A 4DUVA 1DEDA 1E0XA 3MU7A 2E9BA 1JL8A 2B31A 1KXQA 1J0ZA 1J18A 3N9KA 3L4UA 1BYBA 1UKQA 4ATDA 5LYRA 1MFVA 2DDXA 2XJ7A 8A3HA 2PWDA 1QWUA 1J0KA 1UKSA 2OW6A 3BLBA 1KBBA 4H2CA 1W1YA 2O9RA 1GJUA 3UR7A 3SCNA 3W29A 4DWSC 1W9UA 4M29A 4EK7A 2J77A 4FNTA 1XRVA 3A3HA 3ARTA 4JKLA 1E15A 4UFJA 4S3KA 1ZBWA 5CPTA 3BAJA 1BFNA 4AD3A 1HJQA 4ZE5A 4M80A 1SFSA 4CN6A 2E8YA 1NARA 3TTYA 4UFHA 4XB3A 3WQWA 2O9OA 2WBGA 3UETA 1TQUA 1R7AA 3MSDA 3W26A 2GJXA 2CBUA 3WY4A 3NSNA 2ZX8A 3H53A 1US3A 1UR0A 1V03A 3KEHA 2GVYA 5A94A 2F1BA 4FK9A 1EOKA 1V6XA 1SMAA 3AMCA 1KXHA 2JF7A 4QDMA 3CZKA 4UQCA 4JCLA 3L4XA 1R33A 1A3HA 1E4LA 3TP4A 3VGEA 1W2PA 3GYCA 4UQBA 4HPHA 3VD5A 2WVVB 4ZEPA 1UWIA 4GI9A 4B15A 4IPLA 2F18A 3SCVA 1XSKA 1C7SA 1JXKA 4D1IA 1CENA 1EQCA 3CZJA 3WD0A 5LA2A 2VQTA 3VMNA 1V0MA 5E70A 1F4AA 2PBGA 4KGJA 2ZUUA 3VPLA 1KGUA 5CZKA 4ATWA 3RO8A 3ARPA 4EANA 1E3XA 3D5HA 4WLCA 2UY3A 1JDCA 1OINA 3ARWA 2F7QA 3AJ7A 2E9MA 4PTXA 4QFUA 4Z2LA 1GHRA 3GNPA 2CEQA 2EBNA 2VRQA 4TVCA 4MDOA 4CD8A 1KGXA 3AMDA 3MO4A 5GNYA 3LPGA 3GXDA 2CESA 4FF5A 1CLVA 2WNWA 1B3ZA 3CZEA 1QNQA 3EJQA 2E40A 1E6QM 1BGGA 4GZIA 1X6NA 3IJ7A 1BYAA 2XVKA 3ALGA 1GVYA 2GK1B 3GNRA 3AIWA 2WZEA 4UOJA 4PUEA 4W89A 1CLXA 2ZUTA 4OUEA 4BQ2A 3ARXA 1M03A 3N11A 4PMNA 1WB0A 1NWRA 1VFFA 3IK2A 1C93A 2JIEA 3BMWA 1LWHA 1E1FA 4GINA 1U33A 1PX3A 2D20A 4WF7A 1UA3A 4PMUA 1DHKA 2ZIDA 3VGDA 3BUQA 4P8UA 3SUWA 3LRKA 1HXKA 4V27A 1JFHA 4XX6A 1AMYA 2G4FA 4HMDA 2W66A 3WH7A 2WLYA 3ZJ8A 3EDKA 1XH1A 2W63A 1ODUA 1W3JA 3A47A 1HX0A 3EBVA 4UZUA 3VSVA 2E4TA 3NCOA 1OBAA 4RE4A 4Z2KA 2VRKA 1JF5A 3KL3A 3BGAA 3AIEA 4DWSB 1WE5A 4W84A 3EJTA 1EQPA 2JE8A 2WM0A 3CZ8A 1E1EA 1LL4A 3UG4A 3AICA 2J62A 4V28A 3W27A 3FAXA 1CGXA 3SCWA 1PPIA 2WB5A 2YBUA 1LQ0A 4EAMA 1UWSA 1D3CA 3RJXA 2VX4A 4MB4A 3QHOA 4FMVA 3POHA 2ZXBA 4BQ4A 1C7TA 4F9JA 1VBUA 2W5FA 4HU8A 3QHNA 3LX9A 3K8LA 4AZCA 1MXDA 4MJ4A 4GZJA 1PEZA 3KWXA 1ZBKA 3HU7A 1HN1A 4OJYA 4UZSA 2VZVA 4J3VA 1KCLA 1I1WA 4ACZA 3UCQA 3WNMA 1B1YA 2YDRA 3W53A
chains in the Genus database with same CATH superfamily
1P7TB 4MNJA 4XX1E 2DKUA 3E8VA 4AD4A 3VH8G 2CHOA 4PTDA 4R7OA 1IKFL 3EAUA 3GVWA 3S37X 1UUOA 2ARWA 3R7RA 3VH8B 2YMTA 1UB3A 2I24N 5CLZA 3I02A 4TTGA 2AKRA 2XPKA 1C8QA 3PJLA 3FJNA 3AG2B 4HIBA 2WQXA 1NWPA 1Q9WA 1MQPA 1ZLWK 1GTFA 4KJPD 3SKNA 5CEXB 1NCUA 4TPRL 4XT1C 1NMBL 5LQBH 3CK0H 5HUPA 3O9NA 2EDEA 3DCPA 3EJPA 4AVHA 1BKSA 3TF4A 2YC1A 4BH8B 4DERA 1ZV9A 3Q67A 2FO4A 2LVEA 4KFZC 4HHMA 5B3JE 4PJHA 1ZT4A 3QIWC 4H8WC 1R7OA 4KQ0A 1ONQA 1HGWA 2E77A 4BZ2H 2CHWA 2PR9A 4UB9A 2J7GA 3D9AH 2ZZ4A 4KUZH 3ANYA 4F58L 3EYUH 3T2LA 3CLFH 5JPMB 5E2WH 2Y25A 3DFOA 3UTPD 4IGNA 5I1JL 3BZ4B 2DW7A 2ZOUA 2Y1AA 5E94A 4IZGA 3CFQA 3FQXA 2DQFA 4IXXA 1LRQA 2MKLC 4AKQA 5L2KB 5SX4H 3D47A 1I9RH 4N0FA 1V3JA 3D0AA 2WAQA 1V3IA 3P5YA 4AQ8A 5HWJA 1ETZB 3QPEA 2AJYH 4H44C 5KZ6A 1HAUA 2FEEL 4L1BA 4F1ZA 2WM1A 3UYRH 4MZ8A 4Z1DA 2V5BA 3FPYA 4R85A 1SY6H 1LO0L 3CBWA 5ECJE 2OZTA 5I1LB 3P82A 4V11A 1SUXA 4IW4C 4G8FA 4S2SA 1JXJA 5BU9A 4ONFH 1Z9MA 1WFOA 5K2ZA 1OAXH 3QC5X 5AW3B 4KBXA 3CWGA 3LHVA 4C4KT 1OCNA 7FABH 3VFPA 5HVFB 2D3JA 4WUUD 1IR1A 3C6CA 5BRZE 3PGDB 3L2NA 4PWIA 1FNGB 5L8JB 4RRPG 3HC0A 4PH6A 4F40A 4JDBA 3BLPX 1OW0C 4LESA 1EZVX 2BPBA 3N18A 1AG0A 2FFCA 4PHXA 1GS8A 4LHQB 3MLYH 5I1DA 3UGEA 3EDEA 3MY9A 4P46A 2Y2YA 5GS2H 1DUYA 1RZQA 4CC1A 2EQDA 8FABA 3B9EA 2C13A 5E8EB 3S88H 3ZT5A 4NEHB 3V7AE 1L5GA 1VCAA 4P8XA 2YSWA 3O41B 5DWUH 4F9PA 1KDIA 1JRHH 4DN3L 3STCA 3B4UA 5DLLA 4Q4KA 3N13A 1XLEA 3FSUA 3KR3L 2XSBA 1J12A 2R0ZH 1UC4A 4KVCH 4MNQA 3NEEA 1BEYH 2LQRA 3QNZA 3EOLA 1ZAJA 4PJGB 3SI9A 5CN2A 4NXSA 1V51A 1HJWA 3UOAB 1N19A 3CXOA 5IKCB 5C7XL 1D5MB 5GRVK 2GVEA 3U36B 3OWEA 3PGFL 3PF2A 2QKIA 4XAWH 4I5XA 4K6AA 1Z89A 3O16A 1L6XA 1BG4A 5CP3A 3H7UA 4DKDC 3C87A 1BHGA 3ARYA 4UT6L 2K6ZA 2A77H 4NVTA 5D1XA 3IGXA 1FH9A 2IGFL 5IQLA 2BWGA 4E9RA 3IV8A 3USZA 2O4QA 1VHPA 1KGWA 1AIFB 4UF7C 5EEYA 5IJKC 1HI6A 3ROOA 3BE1H 5FA4B 2PXYC 4KWSA 3RG1C 2RQ8A 5DDHB 1VBJA 3VINA 1NA8A 4CCZA 2J6EH 3VCNA 4HIQA 5AVWB 3S4SG 4A2DA 3AXLA 3KBMA 4F0LA 3SE9H 1VKXA 1ORQA 2GSIA 5GGTH 3ICJA 2X1TA 3W37A 5FCUL 3RMEA 4HGWB 1FFQA 3O9WA 2G2RA 3H7LA 1HHGB 3BCJA 5J12C 1TO3A 4HA0A 2ANUA 5EBWA 5ISZE 4FS9A 4UILL 3BSZH 4L9YA 3UA4A 1XGQB 2IGTA 1BBJB 3LKNA 4U0QB 3NH7H 1NUFA 2H45A 5BRBA 43C9B 3RX3A 4J23A 1RERA 2YPVA 3VM5A 5JMOC 2XSXA 1JZ4A 1P2CA 4PGEB 2VC6A 1Y6MR 4US5A 3BESR 3FO2A 1NIUA 1HS6A 2CPUA 5IV2B 4J1OA 4LT7A 4AGLA 3RX9A 4PR5A 3WKMH 1UCBH 5HHVL 3AS3A 5IM7B 2A85A 4N90D 4YZFE 2SEBB 4QO1B 1SGKA 4C7FA 1R3KB 2G9HB 3VGAB 2YCLB 3ABSA 4MWAD 3MGTB 2POTA 4DP4X 1GT8A 3B7RL 5BS0A 1RZKL 4X6CA 4AIXA 1NSJA 4Y2DA 4G83A 2HWZH 4JQ4A 4NT0A 1L7IL 4PG9B 3MLSL 2VD9A 2ITCB 1G01A 4O2CA 2VR4A 5G4OA 1PZUB 2DT2A 4M1CC 4GXVL 3HTWA 3VXTA 3L9RB 3MODL 6ENLA 1Q5MA 3HG5A 2KZKA 3P7YA 1UBPC 4JG5A 2CE6A 1CFNA 4NQDA 5DXXA 4GKSA 5T9BG 1A4JA 3MOAL 2GUOB 4F0KA 4JFQA 5CSRA 3S9YA 1G5AA 5F9OL 1JZEA 2TRSA 2AJXL 3EZJB 5FYKU 3QJOA 3VQ2C 3VE0B 3RTQC 1NLDL 1UBSA 4U1NB 3CC5B 5C07D 4C60A 3WL0A 3BICA 4C6EA 1R34A 3OHXA 1MCOL 3BXWA 4PJIB 4AK2A 3NO1A 4MA8L 1LE9A 1RK0B 1RY7B 3F05A 2EPHA 1KPVA 4AHQA 1YEDA 3N3MA 4LVHC 1S7WB 3NZ8B 5C0ND 4H83A 1TTRA 5C0QA 1FYTE 4DUOA 5D7SL 3KAOA 1CTNA 1NSNL 1Z3GL 2NY4B 3C2SA 2HUEA 2NQLA 1KJ2B 4JAMB 3N34A 1ZJBA 2NY6D 3V0GA 3REQB 4NGHH 5I6NA 4DH2A 3ML8A 2HDJA 3QUXC 2BS8A 4ZSTA 3GKAA 2ZUVA 3UZEC 4PRHE 1WG3A 2ZXQA 5HDQH 4KKCD 3KHQA 3QC0A 4BEIA 1ADWA 2NMSA 2ZJSH 3PC0A 1Q72L 1HDMA 1ND0B 5CJNA 4RMUA 1V79A 2ACQA 2XN1A 3GTNA 5DHVH 1DDHB 3BWUC 2Z1SA 1A3RL 4YDNA 1H5YA 4AWJC 1VJSA 2EE0A 4XNUH 3IDMA 2CG9X 5T3XE 4L4VB 1IBZA 2X3CA 2YGPA 4IMKA 4H20H 3UWYA 5ALCH 4DI8A 4P7RA 1PLGH 5CINL 3DNKA 1BYDA 4PV9B 1H19A 4PUKA 1BF5A 4AZ6A 4PGCA 2Y5JA 2PLCA 5EBLB 2GL5A 2ATKA 3EOTH 3MLVH 5GGVL 1E42A 2NY2B 2VSMB 1DQQA 3HCVB 2Y62A 1AZRA 1HL2A 2W0FA 4ZX6A 1B2YA 1QR1A 4HUXA 1NF0A 3VNZA 4B7IA 2PCPA 3DESA 4HWZA 4LPWA 4WWKA 1CLYH 1G9MH 3WIIH 2VEMA 4L8CA 1PEWA 5D2YA 5J1AA 4PY8J 4HISA 4N9CA 2D7PA 4R8WL 2EVGA 3VKAA 1ZHKA 1JGMA 4UTIA 1R1CA 2X6AA 2NUWA 2VDPH 2BP0B 2NNRA 2OYPA 5CR1A 1DLFH 2LHAA 1BYNA 3VI3A 2FJKA 5K59E 1MWAA 1WFNA 2BZCA 4HCGA 4ABQA 3M0IA 4OD3H 2E46A 3H2CA 2RJHA 5EO1A 1UFUA 1YECH 3F58L 2BSCA 4X9BA 1GC1L 4I0PA 5TD4A 3QRGH 5G5DB 3EH5B 4XMLH 4LAMA 5AW9B 4GSXA 2VB5A 2CH8A 1KBGH 3VXGA 1JXFA 1J5HA 4XKYA 3GRBA 3VD2A 3RWHB 1EHNA 1BWKA 3KVLA 5HI4D 3HG3A 4E9QA 2ICEC 3BVNA 2F19H 1GPOH 1QW7A 4JR5A 4JDTH 1PTZA 3PJTA 3QXAB 1M42A 4DAGL 1MW3A 2QADC 2O4MA 5DSCA 2RHEA 1NEZG 4ENZA 2F6KA 3CBRA 1NEZB 3WLJA 4YYCA 1TKWB 4L3EE 4MZ2A 1J1OL 1IILE 2XISA 4L3FA 1W1ZA 3R8BB 5IVXE 3UWUA 3S34H 2NR6C 5DHXB 1W8NA 4Z1AA 3D85A 2MEJB 1G0DA 4ZFOL 2ENSA 3GFUA 3I3DA 4XMKH 1F3RB 2YL8A 2MH4A 2DSKA 1DTUA 3HUJA 5F7EL 4PS3A 5EZOL 3HMXH 2J6WA 4OB5L 5KEZA 1VERA 4UDTB 3ZE1E 4NQCA 1N2VA 2GAZB 2H2PC 2AANA 2E0PA 4DP0X 3P2BA 4YC2C 3D51A 1IU1A 4ICXA 4F1SA 4JOMA 2X88A 5CPLA 4NUJA 1N59B 3WELA 3TH2T 2BTMA 3GSQB 3A24A 1HZKA 3QA3B 3SDCB 4K5NA 3ABOA 3PNWB 1GWJA 5FF6B 1PDZA 3AXXA 1BQSA 7CGTA 4PWKA 4S3CA 3LNIA 5AN7A 1GC1C 3OJDB 1M1BA 1DBKH 4GUIA 1MPAL 1HCVA 3M0KA 4PGJA 5MENE 4Q4SA 3RIFF 4YS1A 2HTLC 3GINA 3P4MA 2P7TA 3WG6A 1MCJA 3HOGA 3FU3A 2EUZA 4KCWA 2VXVH 1CFBA 3PU7A 3VXNB 2C9AA 4K9EL 4LCVA 4S3JA 3ARZA 3BKCL 2YRBA 4XUYA 2YMXH 1JI2A 1C5BH 1AXSB 5FFOA 2Y36H 2EG8A 4XAZA 4ONVA 2UWEB 4ODHH 1W1VA 4K3EH 3CYVA 1LZOA 2QL1A 3CHQA 1RJLB 1AQFA 2MOVA 3VX0A 2Q3XA 4A55A 3MRHB 4HBKA 5LWYH 3VXQA 4FYSA 2J73A 5IFTA 1ZHBA 4IHOB 3SPVB 2GIYA 2BBFA 5HGAA 3ZTCC 3U46B 4BDVA 5C2BL 4ZX4A 3O2DA 2FQGA 5FFLA 3E0LA 3LRGA 4H7ZA 4MZYA 3NPZB 2Z2BA 3HE6A 5I82A 4XWGL 1WFTA 4Q6IA 3EF7A 3PWUA 4P4RA 3QWQB 3PTDA 4U1IA 1FVEB 4RAUA 4M56A 3GBNH 2D4FA 4QRBA 4LL9A 3CZFA 1NC2A 2YPKA 2NUPA 3ZVVA 2VGFA 4CCDA 4W9DC 1B4EA 3S2LA 3QLDA 1RI8A 1P7HL 4LANA 1E4MM 2JI1A 1IBYA 3U9UA 5FPIA 4XPTH 3ZM8A 3I02B 1EV2E 5DJ6A 3P30H 1B3WA 4L1WA 2AKRB 4Z42C 4AISA 2ACUA 2G5WA 1Q9WB 2ZT9C 3SKNB 3N6QA 3QDJE 1MEIA 2G4JA 1LQAA 1SOXA 2IPTL 3DV6B 4XO9A 1ES0A 4WDXA 5C0BE 3HTLX 4JJ5A 3NIDB 2VW7A 5BXPA 4K9EC 4XPFL 2EDMA 2X2YA 2FO4B 4URKA 3B2VL 1U8JA 3R13A 2FECL 4PJHB 1ZT4B 1XBRA 1ONQB 3WJYA 5JOEA 3SHSA 2B7PA 5KETA 2CZEA 1QU4A 3RK8A 3RN6A 4P99A 4DF2A 2KPNA 5TDPA 5I1AA 3GHPA 4IRZL 3S0PA 4AGPA 4MHHI 2HLFC 1SNRA 3SAZA 2GT9A 1ZLVH 3IJ8A 4OAWA 4GMSL 4Z7NE 5F1UA 4ES9A 3UAEA 1TIMA 3R0KA 2NSQA 4HCRA 5E94B 2YD8A 3NL3A 3GQFA 3FQXB 2DQFB 1TV7A 4PCPA 4KY2A 1RJQA 2P10A 5G4HC 4N0FB 2OK0H 1QPPA 2CLKA 4KXBA 3HPAA 1H09A 3BTNA 4AZBA 2ITEA 5BV7H 2F9BT 2C16A 3K6FA 2ZKWA 3GWJA 4JFZL 4RFOL 5ES4B 1ID2A 1K02A 4RISH 2NOYA 2ZZ2A 5ENLA 3BIKA 1YEGL 4OTKA 4V1YA 5ESQA 4PJ7B 3TPUA 2VC2L 4F33A 3G24A 3E5BA 1F90L 4WZHA 3L4UA 1BYBA 1K7EA 4H2AA 4G8FB 2MNRA 5I3JA 2DYPD 2PWDA 4S2SB 1RU9L 1P5UA 1X4YA 2QQNH 4AF0B 2OOFA 3GUGA 5L2JB 3FFDA 5I1KL 1WGVA 4M1DL 2HLAA 5IQ7L 4KHTL 1PD1A 3DH7A 4ZFQA 4AGQA 3VFPB 2XI9A 1SVDA 1DQIA 5EMMA 4OFPA 2EUXA 1LO2H 4FFZH 2PDCA 3HC0B 1SZRA 1MI3A 3UPBA 2WUCH 4FK9A 4IX2A 3PULA 5IBTL 4PEKA 3E1ZA 1OP9A 1G4MA 3NCFB 4ECNA 2VXQH 5I1DB 4AG4H 4P46B 1DUYB 3GW0A 2E4FA 3PPEA 8FABB 1T7WA 3FQUA 3G5WA 2GSGA 1L5GB 2WQAA 1Q13A 4LUTA 3W7NA 1BA9A 5JPNC 4HUNB 2RACA 4X61A 4WLCA 2M26A 5IQOA 4TUUA 1XM3A 5L88H 3QWRA 1MJJB 4MNQB 4BFRA 3O3UN 3LPGA 1J48A 5T1LD 3O3DA 1A80A 4BE5A 1DVZA 1GSKA 1RK1A 3IUDA 2ZUTA 3OV6A 2R1LA 4MNHA 3KBSA 1VFFA 4UC5A 3N42B 1FGVH 3FA4A 2QKIB 5LQBL 3CK0L 4G9FD 5D1XB 3RFZC 4UNLA 4K23H 3EA1A 2I5QA 1HX0A 2ACRA 4GRSA 2X0UA 3VH8A 5JW3H 2YR1A 1NELA 2F5AH 2Q7NA 4O0ZA 4S1QH 4BZ2L 3MUJA 5CU9A 3WD5H 3D9AL 5DT1H 4KUZL 4EAMA 5FSDC 3EYUL 1EEZA 3TJHD 3AXLB 3CLFL 5KYUA 5E2WL 3PP3K 1ZIAA 3BW9A 1VKXB 1ORQB 2AAVA 1Q8JA 4N6EA 3LZ3A 1W8OA 4A6GA 1DXIA 1PEZA 1WFIA 4GIRA 4UTBH 3O9WB 1LDPH 2G2RB 1CYWA 4HIJA 4F5CE 1H6TA 4LL1A 1MFCH 1I9RL 1BAWA 4D0CA 4U3SA 5EBWB 1O95A 4BJHA 1EWHA 3WMLA 5BOEA 2HRHA 2XTJB 2J7DA 1T7XA 2MQ3A 2AJYL 4PYHA 3LKNB 1VJZA 3QCVH 1Q0EA 5KS9A 1XB8A 1SY6L 1QSFD 1YN6A 5JZ7D 1AVAA 4NQUA 3TLRA 4J4PD 2R15A 3Q48A 1WD9A 3I75B 3QNXA 3DXAA 1UUQA 3PB2A 1P2CB 1FCQA 3DHDA 5KWYC 1Q1JL 2CUAA 3FO2B 4ONFL 2BM3A 2XHYA 2CCRA 2OZNA 1XSOA 4HXBH 4PR5B 3CSGA 3BJLA 1OAXL 4PUUA 4PBXA 4XOEA 4OZ4A 4RW3A 4CQ9A 1H3UA 1NAKH 1O94A 1X5XA 4RNIA 4OSUL 3HG4A 5BS0B 1AACA 4UCFA 4X6CB 3TEUA 5D1QE 4XG1A 1MZYA 1J6OA 4EMZA 3DHJA 4YWSA 2QTVA 5FF2A 1H5BC 1DJGA 3GC5A 3JXAA 2Y8UA 5JBFA 4IISA 4O2CB 3MLYL 1ZGLP 3SY8A 4F4RA 5GXBB 3ZO0A 4MJID 1OM9A 4HUWA 1MRDH 1O5DT 3VXTB 3QG6A 2ODHA 4OFYD 3S88L 2WNQA 3NIFF 2GUYA 3KPQA 3CS2A 1CFNB 3DI1A 4NQDB 3A5VA 3FHQA 5DWUL 7PTDA 3BQUC 2ITFA 3NDYE 4GKSB 3AMGA 1JRHL 4Y5VC 4RDYA 2HROA 3ZR6A 4Y7MA 1C5DA 3PGDA 1EGZA 4JFQB 3STPA 4W9ZA 3AIBA 2E67A 2JJSC 4KVCL 3EPMA 1BEYL 3MKCA 1G5GA 4AWTA 3TO2A 4RRPA 1DBMH 3EKZA 3OHXB 1XSIA 2FYYA 5EY5A 3SQSA 4F3FA 1L4IA 3ZMEA 3QKEA 2XPYA 1P4BL 2V3GA 2JQXA 3N40P 4JM0A 2PBOA 4HSCX 1KPVB 2I9UA 1YEDB 4Z2IA 3O41A 3L9EA 4XAWL 5I0VA 2YMOA 2HKAA 4BFEA 1ASQA 4NKMA 1EK3A 2QVIA 2GTWA 2A77L 5DHDA 4TSBH 1W8GA 4B60A 1S5MA 3WEXA 1CFTB 5FI8A 1MCPH 1ZBVA 4MB1A 2GFTA 5KG9A 4QNEA 1FWAC 5F7KC 4FAAB 4DZ5A 1EZ2A 4AWEA 3NN8A 5E6SB 2OZ4H 1PLBA 3P0XA 3MP3A 5DFAA 1JYNA 3VWJA 1TF4A 4YFLF 3THCA 2CQVA 1P0SE 3U36A 1HDMB 5HQLA 4I9MA 2J6EL 4C54A 4NUQA 3M0LA 3NCYS 4H6EA 1P6CA 3QQ4A 5F3BA 4WEUD 4A2MA 5GGTL 2VFIA 3VGBA 4A22A 5FDYA 5IJCC 4UMCA 3CHEA 3UXAA 3H2WA 4M51A 2DQIH 3P3UA 4UM9A 5FO8B 3V0JA 3QDHA 3GSNH 1EAOA 3KL5A 5I24A 1F4WH 3GMNA 2VDIA 3BSZL 2EPKX 3P14A 4KNQA 2NQCA 4Q33A 2Q8XA 3NH7L 5DDHA 4J3OG 2QQLL 2WYHA 1P4UA 4PGCB 3I84A 1ILSA 1YNPA 2ATKB 3QDGE 1DQQB 1MJUH 4Y2LA 5KAQG 3S4SA 1H3GA 2W0FB 2X4SA 2GBTA 3MPGA 2I5IA 1QR1B 4A29A 4HUXB 2PCPB 4YCOA 1I45A 4HWZB 4WWKB 3D2UB 3C52A 3VYLA 3T40A 1FCUA 1D5XA 1LK2A 4L8CB 3WKML 5IBXC 1UCBL 2D2JA 1VFLA 5J1AB 2Q2LA 5EMKA 3P6LA 4F8LA 2YSSA 4HX1B 1XGRA 3C4UA 4R5VA 1ZHKB 4M03A 1GHFL 3EKCA 3MUUA 5C8JA 6FABH 1S78C 1NMCC 1LROA 2BVQA 4EUPH 1I3UA 4JNMA 4GIEA 4Z2GA 3S8FB 4HPJA 5CZRA 3VI3B 2ZZ3A 1MWAB 1CXHA 4IIZA 3J2PA 3WFCH 4NBZB 5EBAA 2X1RA 3NQAA 1LG1A 4FA8A 2OJ1A 2G3ZA 5EO1B 3T4CA 3NSJA 1ANUA 1A4CA 4I0PB 4XVOA 3RLUA 5IM7A 3P74A 3NDZA 4LAUA 4JRYA 1N4XH 2AXHA 4DXXA 4KPHH 4BCYA 1PNDA 2ICCA 4XKYB 3KBVA 1F18A 4MFHA 2R24A 2X8RA 3I9IA 4K36A 4JUTA 3ZSSA 3BVNB 1O7SA 4ZL1A 4CD5A 1AGBA 5K39A 2XSAA 3C56A 5DSCB 2A74A 4AZGA 1WISA 2NQ5A 4MA7H 2YR3A 4AMAA 3RGTA 4O1CA 1NCHA 5K9JL 1YUHA 2BGQA 5B39G 1S2EA 3CLMA 3TN6A 2BWIA 3D85B 2VLKD 4X4MA 1WAAE 4Q74A 5F0PB 3W6LA 5B3NA 3VE0A 1Z6KA 3W7QA 4GYKA 2MOGA 3V7PA 2QGDA 3KWTA 1G87A 3HUJB 4RCXA 4QSFA 1E56A 4FN0A 4U6YA 3MRNA 1G9NH 1YDPA 1X7TA 2NSXA 1UEYA 5ICYA 4O4WA 5HDQL 1AP2A 1AHWA 1ET7A 2PD5A 1FWIC 3SN6N 1MCBA 1XTLA 1BX2A 2WBJB 5I16A 2ZJSL 1NIFA 2ID5A 3L54A 4UMSA 3MA9H 1G4RA 1S7WA 3ISRA 3NZ8A 3KLLA 1JVNA 4EBQH 3REWA 5AYYA 4L65A 2DKSA 1VEPA 2DIAA 2ICWA 2ESCA 3N85H 3ERPA 4YR6A 1FH8A 5E5RB 1KBVA 3C5SB 4XNUL 1JGVH 1JPEA 4N2NA 1H50A 1CD9B 3NZRA 3REQA 2NLYA 4H20L 2C91A 2QCCA 3WIHA 4XWUA 8TIMA 5ALCL 1VF8A 1XIGA 1UEMA 1PLGL 3R06A 3P4MB 2P7TB 1VFAA 2JIWA 4WSHA 5IBLD 5E1QA 2K7QA 2A3EA 2IAMA 2JKRM 1ND0A 1W80A 2D9QB 3EOTL 3MLVL 1SVBA 3ZKND 3ZYZA 3DOIA 1V6WA 4PJXE 3G3DA 2DQTH 3PTMA 3QGAC 1PY4A 4B9PA 2Y89A 2Q9OA 3WDHA 4AIBA 4N9GB 3TCXA 2EXWC 1CLYL 1G9ML 3EMCA 2J1XA 5K1NA 3WIIL 1XFBA 4J8QA 1XVSA 4HIHA 4IIHA 1G6RA 5I28A 2WSYA 3I6EA 3VXQB 1DE6A 1MEWA 1LBMA 4J6RH 4XZWA 2CYGA 2DD8H 2HNEA 2VDPL 5HGAB 1Z69A 1DLFL 4W9GC 4BDVB 3BD5A 2BNQD 2CBTA 2GDUA 4LS0A 3PM6A 3HE6B 1CQKA 1LJMA 4LO9A 3CFIC 4Q6IB 3MV8A 4OD3L 2V2CA 3PWUB 4P4RB 4XCYA 4BQ5A 4PY8I 5I78A 4N6FA 4U1IB 1YECL 2EDNA 4RAUB 4UTLA 4ONOA 4XIAA 3CZFB 3GH7A 1NC2B 2YPKB 5EU6A 4X7EC 3I10A 2NUPB 4XMLL 3ZN6A 2BVDA 1T1YA 2CC0A 2X28A 4X9HA 5DGQA 4JS7A 4KWOA 1NOUA 3N2MA 1KBGL 5M03A 3C2EA 5LGHH 3L4ZA 4KFMA 5BZWA 4L56A 2BP0A 3U9UB 3AB0B 1E6XM 4M7KH 4N0RA 3EXRA 4QG6A 1ZOXA 1DN2A 5DJ6B 5CGYD 5IZ7A 5A8QA 4N0UA 4HPGA 3KPMA 4JDTL 4NAQA 3ZSTA 4LALA 1W2VA 5LCVH 4MAZA 3QUKA 4P5RA 4HJUA 1OAKH 1ICTA 1ES0B 5T5NF 4EOWH 2IKJA 2HZHA 3UWVA 2P8PA 4JJ5B 5L6YH 3S34L 1KD0A 1QWNA 4ZO9A 2EIJB 5I02A 4DUWA 1U8JB 2FO1A 3CAFA 3WQCA 4XMKL 4WFHD 3U25A 2AQQA 1NFGA 3AHXA 3SB3A 1FNHA 3HMXL 3SO3B 3SBFA 2WZAA 3CQIA 5TDPB 5L2KD 3GS0A 4OGZA 4KK8C 4LEQA 1BCIA 3KYAA 4HNTA 1S5IH 3R1GH 3SSZA 2V5JA 5F71A 2GT9B 4RH4A 2WMHA 4OAWB 3UC2A 3WNIA 4G71B 1NEZA 3FCGA 2YEQA 4HLJA 1NGYB 3JYCA 4IUGA 3MV7B 2NY0C 4AZHA 2IKIA 3NJMA 2HJKB 4QY8B 3DX6A 3TWYA 4B0MM 1D7CA 3EWXA 5GISH 2CGYA 4HMCA 1KC5H 2NY1D 4UR9A 3MX0A 3BZ5A 1RZJC 2VDMH 1U8IA 4W87A 1YYLH 3BIKB 1JHKL 2BH0A 5ESQB 4CQDA 2EDTA 3TPUB 4DO5A 5F9JA 5C07E 1XC6A 3SYQA 1ZA3B 2PLMA 3VDHA 3AZTA 4ZQKA 1WPCA 1E27A 2D3LA 1P5UB 3FKKA 2FHCA 2B0MA 1C5BL 3FFDB 5HNUA 2Y36L 4PJIF 2NV1A 5DJ2A 5H6HA 1N10A 4A2FA 3Q6GL 2HLAB 1LMIA 4ODHL 4K3EL 1UGKA 3LRHA 5GSVB 2F9RA 3D39A 3D3VB 5EOQH 12E8H 5LGXA 3PY9A 5LWYL 3PE9A 5FR3A 4NJKA 3DX2A 4RMTA 3QM3A 3F4VA 3LBCA 4ZO6A 4B3EA 1PKQA 3LQLA 2Y6SD 4H8QA 1KJ2H 5HVHB 1V0LA 2Q6ZA 3PFMA 5DZNA 1XD0A 4R0LC 3FQUB 3NQEA 5F3HB 3LN9A 1FX6A 3QV6A 1ITCA 4LUTB 4B5EA 2FYMA 2QAPA 3GBNL 3TM6A 3AWEA 4AZIA 2X4UA 1QWHA 3UXDA 1QACA 1KNOA 2XVNA 5HBFA 4F7PA 1Q6OA 3NNTA 1Y18A 2HRLA 3PB0A 3O3DB 5AVUB 1RK5A 4ETQA 5DMNA 3APYA 4ADTA 4XPTL 3IRZA 1RK1B 4RDBA 4F8XA 4N1EA 1OHQA 3ZKXC 3GLEA 1ISVA 4FLRA 1QVBA 1P6WA 2GGEA 1XIBA 3BLLA 3WUGA 4B41A 1FVEA 1L3NA 2CFFA 1EHLL 1IGTB 4QRTA 3LCHA 4PWHA 3MHGA 1ZVHA 2EYTA 3ARDA 1YLVA 2X70A 4PBDA 3M5YA 3IRCA 4BFFA 4R6UA 5BQDA 3G1SA 1P7KA 4C7GA 1KEMH 4K9JA 5IWLC 1ORSA 2VABB 2LE9A 2E7MA 3QZ6A 3ONCA 3RLSA 3EBAA 3TT1H 5T33H 4JQ1A 1QHQA 5JXEA 2AV7A 4PJCF 1U2HA 4ZMLA 2AJZA 3HI1B 6XIAA 2WMGA 4ONGH 4XCEB 4RGMB 3O1NA 4XR8C 4A35A 4D6IA 1EEZB 3TKFA 2P0OA 5KYUB 1NOFA 3S8HA 3BW9B 1ERNA 1QZNA 1NIBA 3DV6A 5CEZD 4RNJA 3W3OA 1BQHA 3SQRA 1Z2KA 3OKKA 2WC4A 4P5TC 1E4WH 1XGTA 3JVFC 3D52A 3SGEH 4HIJB 1X1NA 3GR8A 4FGMA 5G1MA 2OK0L 4D0CB 2OQJA 3WEMA 3ZL4H 4U3SB 2NY3C 5IK3A 2QTEA 1P84J 2QUVA 5BV7L 3EYSH 3ILQD 5I3IA 4RISL 3KLDA 1BVOA 5KS9B 1YN6B 3VOHA 3ZRSA 1T1XA 1MDRA 1I1CA 3DJTA 1HO4A 5LBSA 3DJRA 5CCHE 3WOVA 3QNXB 3DXAB 2WB1A 4LLVA 4ZPVA 1E65A 4XBMA 2IDSA 3EJYC 5B1JC 4L6HA 2GJ6E 3E7JA 3P02A 4N2EA 5DA0B 4X7CC 1EFZA 4DXKA 4PVLA 4P61A 5DMIH 1KIRA 4OZ4B 1QSEE 1BWVA 4PRIE 1D5BA 1X7QB 1AG6A 4K8RH 1I60A 25C8H 1LO2L 4Q9BA 4PJ7A 2CO3A 5F7MC 4FFZL 3H9HA 4IMEA 3T6ZA 2WUCL 4KZEH 2FGLA 5IBUG 4OFVA 2AQSA 4KROB 4O15A 3PHSA 3LS4H 3U2CA 2EIZA 5G4MA 4AF0A 2NY5H 2YCJA 1ZNNA 3LBOA 5L2JA 1FBIL 4AG4L 4DO4A 4HUWB 2HRPH 2V5DA 5CFHA 1L9TA 3QG6B 3Q65A 3KPQB 2OZ0A 1FC1A 4C4KO 1C5DB 5F7NC 3RPTA 2CCVA 5EZLA 3IDUA 3D0CA 2OCJA 4BKLA 4NF7A 3TO2B 4KXZH 5TBOA 1KRMA 4N2OA 2FYYB 3C2AL 1F5WA 3LMJH 4F3FB 1K8XA 2R2BB 3FVDA 5CSZA 4MCMA 2B31A 2J9XA 1OX5A 4UTAH 2WXRA 2NY4D 2VEKA 4L1TA 1IBDA 1QPOA 3GDKA 1ED3A 1YEIH 2K9FB 6XIMA 4EK7A 4NKMB 4FNTA 4JKLA 2GTWB 3DTDA 1VDGA 4S3KA 2FZ9A 4G8AC 5IB3A 4G8TA 5LNVA 4KZCA 3TYDA 1MJJA 3WEXB 1N6VA 3WQWA 3ZHKA 2CU9A 3AAMA 4MXQC 2UWEF 1DFBH 3SRKA 5KG9B 2GJXA 2K45A 2WKOA 2I25N 3SOTA 3Q13A 2BG5A 3PL6A 4W9JC 2F5AL 4L4JA 1KEGH 3H3BC 5GJSH 1AJZA 3NN8B 2XX0A 2WQSA 4S1QL 3V0SA 4A8LA 3GC3A 1K5WA 3UTTE 3VWJB 5D7KE 1U8KA 1S2UA 4EF3A 2AQ1A 1TJXA 5DT1L 4L4VD 2VH5H 1H3VA 2CBQA 4HPHA 3QQ4B 1CYXA 4MYAA 4B15A 4IPLA 2VR2A 5F3BB 3SCVA 1L9OA 1XSKA 4MAYC 4QHNB 1AYRA 3WD0A 3UR5A 4UTBL 1LDPL 3QCTH 4UM9B 1MY5A 1MFCL 2VE6A 3USBA 1NIEA 1UWEH 2NY2D 3GMNB 1OCBA 1EB3A 3QULA 4DKAA 1BP3B 3QCVL 1T89A 3NO5A 1X7FA 2J43A 1HSAA 3N2TA 4KCTA 4OZGB 4D8ZA 2OS7A 4GP8B 4JO5A 2WZEA 1OY3B 1IT8A 3S4SB 1Z41A 3H9YA 2X4SB 3ZXAC 3IK2A 5HWNA 4CKVX 1E1FA 3MJMA 2X9YA 3NJXA 2CXKA 2Z65C 2J9YA 4KZDH 4RMVA 1D5XB 3FTXA 1LK2B 1FFOA 3A13A 3PVFA 2E56A 5HD8D 5J6SA 5H91A 2YSSB 4MZIA 1XH1A 1XGRB 4D8PB 4L9LA 2NV9A 5C8JB 4HJIA 5CJBA 4JD4A 1NAKL 4DVOA 4JUSA 3NIDF 2BVQB 3ISIX 1FJ1A 4OCSH 4D3CH 2DJMA 3I75A 1JGLH 4PJHF 2JE8A 1R3JA 4YL9A 2BW5A 3PDDA 3BP6A 3QH2A 1UWSA 1ZEAL 3BYTA 4X9SA 2WHVA 4FMVA 4NP9A 3GRIA 3DBXB 4IBYA 1MRDL 3ATBA 4ELMA 1ZBKA 4JRYB 3TW6A 3LHYA 2VZVA 4K0OA 1PG7L 3CB8A 4FG0A 4QAIA 2XIIA 3EGSA 1XUZA 4K8RD 3E80A 2AEWA 3OR7A 4AOFA 3OKLB 2KQNA 1AGBB 4H9TA 5K39B 3J7HA 2N56A 4P5SA 2A74B 4IQJA 1R2SA 4O12A 2BSBA 1KBWA 4POZC 3NVTA 1U8LA 1YUHB 4JREC 4W1TA 1SLXA 3SJVE 4L4TE 1J8RA 3T0BA 4IBZA 3CXFA 1SM3H 1QPKA 1PCWA 4XP9H 4G6CA 3ABZA 4P7QA 4KDWA 4TSBL 2FE0A 4U2ZA 5ICZA 1I7TB 4E9XA 2Y5QA 5DTFA 1MCPL 4FZEH 1ZLEA 2NPLX 3B7UX 4U6YB 1YDOA 3MRNB 1YDPB 2YD9A 3EH2A 1U8NA 1FF5A 3SDCD 3CSPA 2YBVA 2L3BA 4REQB 1V5JA 5ICYB 1AP2B 1AHWB 3H3KA 1BX2B 5I16B 1O6VA 2CO6A 3FFCA 2HTKC 4XH2A 3H2AA 5HQEA 3REWB 1TWSA 1NCTA 1TPC1 2ICWB 3UD6A 3VAEA 2TSAA 4BFKA 4Q6KA 4YR6B 1CFTA 3THQA 2DQIL 4DEPC 4EVNA 4UNTA 4I2XA 5IHBA 3LB6C 1F4WL 4D6HA 3R06B 3BH8A 5JH1A 4LU0A 4KK6C 5BQ7A 1VFAB 3E6HA 1BLNA 3EEGA 2OLHA 5F6IB 2IAMB 5DRNA 1DJXA 3L1OH 1RZKC 1F2XK 4TLSA 1OG0A 4RMWA 4XAYA 3S1UA 1MJUL 3LY0A 3WDQA 1JZ6A 2CERA 2OQLA 2CJSA 3LERA 1ZQ5A 5FO8A 1OABA 1THCA 4H6RA 4Y8FA 5DEJA 5IY5B 2WANA 3FIGA 2L04A 3AABA 4E4FA 4HK6A 4HIHB 1G6RB 2BJMH 3T1GA 4IIFA 4XBSA 1TQXA 2ALWA 5DYOA 6FABL 5A6KA 2X2UA 1YX1A 3CHRA 3OF6A 3DRQA 4XNYH 1SYVB 3PBMA 1P7BA 3C6LA 5FLVA 4WI3A 1IGIL 3ZQ9A 5I74B 5IROC 3CH0A 3WFCL 3NRQA 3L16A 1OM0A 3MV8B 4XCYB 5EMJA 3D2UA 1U21A 1YYMH 5A7EA 5H8UA 2JMRA 5EU6B 4IKJA 1BXUA 2CHRA 1T1YB 3TYGL 3VFWA 4HX1A 1N4XL 2RDUA 4KPHL 1W5QA 4NN6C 5D7IE 5IHSA 4M6VA 5BZWB 1WHOA 3MLTA 3ZJ7A 3F7PC 2WXLA 1BJ1H 1QSFE 4N0UB 3KPMB 3UPRA 1KQZA 4GUOA 5E6RB 4EN2A 4N7QA 2OR9H 1J9RA 2WTOA 5I6XB 2G3JA 5A69A 1GZHC 3HOJA 3VXRB 4WR3A 4HBQA 2X4RA 3S2AA 2DYRB 1PY0A 2GK1A 1Z9PA 4MA7L 1RZGA 3QUKB 1Z48A 2JXMB 3DIPA 3U4FA 2YPVH 2Z31A 1ZIBA 3AS0A 5KJRH 5EOTB 1M6JA 2P8PB 4RWHA 2BSTB 2YHGA 3RXZA 4AM0Q 2ZWZA 3H8AA 2OFQA 2E59A 4ZXLA 1L9WA 5BOFA 4IF2A 2DQMA 3G9AB 1LQSR 1CGTA 4X7FC 3VDGA 1BEUA 3GG7A 3NQ7A 4PS7A 4YX2H 1G9NL 3OZYA 4QRFA 5D9SB 5DZ9A 4EI5C 3QZBA 3S36X 4DWSA 2OMZA 4M3HA 4INFA 4GQGA 3MA9L 1OTUC 4QR7A 3NJJA 4NRXA 3CVIH 2DLTA 4K55A 2R29L 5B39A 1NBZA 3UDWA 3O8XC 5CJ5A 3DX6B 3N85L 3W7KA 2PDWA 3OW1A 2OSYA 3MX0B 1U8IB 4R84A 1NPJA 2Z2UA 3ABMB 3NG3A 5JQIB 2OTWA 1VPOL 4W7WA 5F9JB 1PJ9A 1H7WA 2I5GA 5DMGD 1Z44A 1YNTF 2WBJA 4ZQKB 1E27B 4EIGB 1JPSH 1YIXA 2BCMA 3WNOA 1X5AA 5CBIA 3EUUA 2N1TE 2OMWA 5H4ZA 1KENL 4OFIA 5DJ2B 2OMYA 2IV8A 5EIVA 2DQTL 3ZE2F 3C5SA 1IC4H 3B8YA 1A6PA 1DWHM 3D39B 5F7DA 3ATDA 4JR9L 3MANA 1NOLA 4P46D 4PB4A 3GZOA 4WHDA 4G2AA 5D5MA 3WJMA 2IFGA 5AYZA 1XQ4A 2DD8L 4GX9A 5D1QC 2Z9TA 5AW6B 1PKQB 2OSXA 1JNHA 4KK9D 1UASA 4C90A 2WPBA 2VFGA 2QSQA 4F79A 4MNQD 1MSSA 4H9YA 2VLRB 3LPPA 4PU2A 3L3GA 3T8QA 4BZYA 4N9GA 1RLWA 3M07A 2AEOA 2VDKB 4YTSA 3B0XA 4V2XA 3QGKC 3MP5A 3WY1A 2X4UB 4HD5A 5MI0C 4HJSA 1KNOB 3IE9A 4F7PB 4X6DA 2V5KA 4AUBA 1OVZA 5LGHL 1Y18B 1SZFA 2ATAA 1TX0A 1GS7A 3NYDA 3D4YA 4ETQB 2Y1ZA 4M7KL 5L0QB 9PCYA 1MCWW 4OF7A 1GK8A 2VYRE 1RSFA 4G9DA 5D1XD 1L9PA 1UUMA 4PMRA 5K9DA 4GQBA 5ADOH 4TF4A 3THAA 3QDME 3LU2A 4Q0XL 1E0TA 5LCVL 4QRTB 5CXPA 2DM4A 2LV4A 2ISSA 2EYTB 1HCYA 1Q4WA 3ARDB 1OAKL 1EXGA 1OT1A 4KDTC 2X70B 4EOWL 5L6YL 1AIZA 3IN0A 3NL5A 1BQLH 1P7KB 2WCPA 4A7VA 1TPWA 1ORSB 4R7WA 1CCWB 3V4PH 1XRTA 5D6CB 4K15A 1T99A 2AV7B 2ED7A 3A4JA 5ABFA 4TSAH 3O9WD 2AJZB 1N18A 5DO2C 5FFGA 2V9DA 1H7OA 1CECA 4DEUA 1SMDA 1IAII 3AXMA 1BQHG 1F6KA 3MCLH 1S5IL 3R1GL 3HEIB 4E2BA 2XTJD 1BQHB 3MJ9A 3PZ9A 3OKKB 5FEBA 1A21A 4B90A 4PV8A 1UFGA 1XGTB 1W54A 3HJZA 4M5TA 2FZDA 3HJEA 2VCOA 1FWBC 1ODZA 3E0WA 3T2NH 1JCNA 2OQJB 2QGCA 3RVVC 4I3GA 1F3JA 4Y8DC 5IK3B 4J1UB 2PWEA 4N5EC 1L9RA 2NYYD 2VZOA 1LO5A 1FIEA 4ATTA 4S1RH 2VDML 2QHRH 1YYLL 1BZDA 4US5D 5D9NA 1JAEA 1T1XB 5BW7A 4W86A 1R9YA 4HN8A 4ONHA 4LLVB 4ZPVB 4NYLA 4NKOA 3GSWA 3GJFA 3TA9A 1NGYA 1UZGA 2C18A 3MV7A 2PODA 3IJIA 1VA9A 1EZVY 5CJ8A 1MW1A 5LXEA 2HJKA 4QY8A 5BS0D 3QORA 4Y2DD 4JFFA 4EF8A 1PZ5B 2UY4A 4FLOA 1KIRB 5C9XA 1AH3A 3K6NA 1D5BB 2A4AA 3NIFE 1OCZB 1PKNA 1F3TA 1ZTVA 5GPRA 5C5YA 5EOQL 12E8L 4RPPA 3EO0A 2R2HA 5KSAB 3H9HB 4GH1A 2RJGA 4QUOA 1ZA3A 1EGVA 4NQDD 4R9HA 3BKJH 2EIZB 3HUJF 1J9SA 4FG2A 4AHPA 1OSPH 2ZYRA 2I07A 5I8CA 2J5LC 3QPXH 2FIQA 5GSVA 4S0TD 4MA3A 4U4BA 5D9MA 2ZOOA 2X4OB 2OLSA 3D3VA 1R3YA 3KVPA 5EZLB 5LXGH 2A7NA 3NOEA 2BHZA 4PIBA 3LRSA 3GWQA 4BKLB 2OELA 1YPZE 1OP3K 2C9SA 4AXWA 4M1RA 4G5DA 2E6DA 4I18C 1I8JA 3QV7A 1E40A 4GVFA 3GSXA 5CSZB 1IL1B 2FPTA 1UJQA 4R3UA 5I76A 3M4HA 5F3HA 2Z0UA 4ZMTA 2OWCA 1ED3B 2YWZA 4JTFA 4AD2A 3FCSA 5KVDH 4LVEA 2HH0H 2IJ0C 4NX5A 3S96A 3HV8A 3LNFA 4GEIA 4JL2A 5IB3B 4AMWA 2NW0A 1SF5A 3R89A 2XACC 2IAAC 1NDTA 3CSYB 2VDLH 3P81A 3OZLA 4HSNA 2GJXB 3LB0A 1KEML 2OMVB 4BS0A 2VDHA 4O1AA 1HIMH 3PL6B 5D96C 1IXQA 3TT1L 1MRFH 3AYVA 5T33L 4M02A 4OQ1A 3C5ZA 1U8KB 4YIQA 3QI9C 2FSEB 1Q4NX 4PW3A 4ONGL 3FB5B 1IGTA 1XRSA 3AU6A 5HXMA 1H11A 1FQ0A 4NZ8A 4P9HH 3O2DH 1KLZA 1E4WL 4AX6A 4RX4A 2H9GB 3DARA 2PRLA 2VE6B 1HIZA 1GW9A 2R6OA 2VABA 4G8EA 1DJZA 3Q94A 4WK4B 1ACYH 1P6FA 3EYSL 3QULB 3HFMH 1E4IA 4LP5A 3UBXI 4QOKE 1L3WA 4NYYA 2YXOA 2XQBH 3R5EA 2IQTA 1HSAB 1N12A 3HI1A 1L7TH 2WJEA 4WWKD 4LP4A 4XCEA 4NO5A 2ISWA 2FQFA 4I4WA 2J8FA 1KCRH 2JIXA 1UW9A 1B90A 2VEFA 3BW2A 2Z6IA 3BPLC 1R46A 3AIUA 4DBUA 1EUUA 4MMZA 2Y88A 5DK3A 3WKNA 5DMJB 1FFOB 2A7PA 1K2DA 1TVDA 3T4AB 5LNSA 4FTVE 5DMIL 3QQ9D 4AE0A 4L9LB 1GQNA 2H3BA 3UYRL 5ABHA 2HAZA 4UDUA 4K8RL 4IIDA 1IIGA 25C8L 2CLRB 3CQKA 2CLLA 4D8LA 4XBJA 1FJ1B 4I0PD 4KZEL 1R3JB 5MF5A 4OJFH 2BIOA 3BP6B 2H6OA 4LCSA 2Q6WA 4JFDE 1Q0XH 3E96A 1K72A 3RVUD 1C90A 2YD1A 4GAGH 2F8XC 1BECA 2F53A 1D7BA 4I7UA 4HAGA 2HRPL 2D0GA 4GUHA 1OF8A 4ELMB 3HBQA 4B50A 5CD5D 1A7NH 7FABL 3GMOB 4LB4A 2F5BH 3RGHA 5D38A 1F2QA 2J47A 3RNQB 1X7QA 2CCLA 4MYXA 1IKNC 1WEJH 1OE3A 4M7TA 5K3VA 1BXAA 4HCRH 3EGSB 3WD2A 1ZSXA 1TWZA 4WKXA 4MJJA 3U6WA 3MHZA 4NT6B 3OR7B 3UROR 3Q2DA 4H8HA 4XO7A 3T09A 4FI7A 5AHLA 1TPFA 4JX5A 4ACPA 4ZPTB 1D2KA 3K6DA 3LMJL 3T77B 3LKSB 3D85D 1R17A 3KPNA 3ITCA 1K3UA 5E6IA 3CUJA 1U8LB 1YHPA 1AY1H 4WSGA 5HJLA 4UQ9A 2AW2A 3HIZA 3GG0A 1YY9D 5AYTA 5GS0H 4MPQA 1V3KA 1R85A 3KEDA 2R0ZL 4NQCD 4GYPC 2MRYA 5ICZB 3IIVA 4JDEB 5CLXA 5DTFB 5EOCH 3HI5H 2A9AA 4L4LA 3MJGX 2ZYFA 5CG0A 4MWAC 3FHEA 1U8NB 2R2BA 3PFQA 4W4QA 1KEGL 5GJSL 1KV5A 3MA7A 1KTNA 4BFJA 1O9WA 2DB8A 3EWWA 3JWNG 2WSQA 4E4UA 2CO6B 1M41A 4ZYKA 3FFCB 5LNRA 3ESNA 1CXKA 2VH5L 1FWWA 4XH2B 1CI1A 1OPOA 2V82A 3NOIA 3LZPA 4JPWH 2XIOA 4K39A 4ZS6D 1H7XA 3QCTL 4ZB0A 4EVNB 1I82A 4N6RA 5C97A 4I2XB 4TVSa 4AG0A 1UWEL 3IDJA 1BZ8A 4HK0A 3PHQB 3BH8B 1UUNA 2J78A 3BE1L 5BQ7B 3S47A 3R10A 3NTYA 3E6HB 1BLNB 3BJ91 3R43A 2DJXA 1TMQA 5IFJA 4X8JA 1S7SA 5DRNB 1KSRA 3SPHA 4DUVA 5IJVB 3SE9L 2C3VA 5C0DA 4ATDA 3W1ZA 2K4AA 2DDXA 4QHNA 4MOZA 3MVTA 2Y22A 3D6NA 4NRZA 3BISA 1AE6H 5EGRA 1K8DA 4KZDL 1ZBWA 4AGNA 1M2OA 2OCZA 4M80A 1SFSA 4CN6A 3CO8A 4BZ1H 7TIMA 4R7JA 3HE6D 4K8EA 3KTCA 5DYOB 2VFHA 5HGHA 3GPSA 4OZGA 2POZA 2E6YA 4Q4EA 3T8XA 4OVVA 5AECA 3DRQB 2F1BA 4OCSL 2B5IC 4I9WD 1NC2D 1JGLL 1EOKA 3C6LB 2XA8H 4KKCC 2W0UA 4I3RH 3VGEA 1W2PA 4XMUA 2JK2A 1NEYA 4CBPA 4DP6X 3CZJA 4PJBB 4PMJA 3VFWB 4D8PA 4JN1H 4EANA 4TU1A 3MLZH 2IKGA 2GABA 3AJ7A 4PCNA 2FAUA 4Z2LA 5FO7B 3MLTB 2ZG3A 2QCDA 4TVCA 4P3DA 3AMDA 3BUYA 4IFOA 3HBPA 2HWZL 5DCBA 3EJQA 3UPRB 3B0PA 4X2PA 4NC0B 5E0KA 5AKRA 3QZPA 3MVSA 2QDEA 1MCHA 2X4RB 1NBVH 3UTPE 2QSVA 1W6LA 1PNCA 2GK1B 3DBXA 3COOA 1RZGB 3LH2H 1R2RA 2E09A 2A9BA 2Z31B 1PX3A 4OF0A 2DY2A 5I6MA 3C60B 3SGJC 3VGDA 4QG9A 2CLMA 4XP9L 3NJIA 4LF3A 4WNQB 3CHVA 4WVXA 2CKNA 4FZEL 1XG3A 4FX5A 3OKLA 5HDBB 2OTDA 1J96A 2V37A 5U4NA 5F9DC 2ASHA 2ON3A 4DWSB 1K4DA 2OMZB 3KHOA 1ZANH 5GIRA 4IMGA 3S1WA 1MFEH 1J87A 2E28A 3SCWA 4NRXB 4LW7A 4RJEA 4BQ4A 5B39B 1NBZB 5JH2A 3SGDI 4B5WA 3BDBA 3AY4C 3B2MA 5H8MA 4ZI8A 4JGJA 3DTXA 1I7TA 3DU0A 2DORA 1H15A 5EU9A 4WUUE 5GS0D 5AG8A 5DRIA 1D6VH 2DZAA 4MHBA 4NGHL 2OTWB 4Y9GA 3CMOH 4REQA 4U1GC 1XR2A 4LU5H 1T2XA 1KBPA 3NWRA 5HI4C 1A5SA 3BLDA 4FB7A 4XMXA 3A22A 5CKAA 4CQ8A 3U0PA 3L1OL 3FTUA 3W2NA 2XPZA 4PRRA 2OMWB 2IPJA 4WQ6A 2OMYB 4B9ZA 3W28A 5DWPA 3TBBA 5JQ6H 2CU0A 4G70B 2JKJA 2VSCA 4M24A 4IUOA 5DFVD 5F89B 5F7DB 3ZZ1A 3VE9A 2QCNA 1GYVA 1XBZA 2BV9A 4OR1A 2BJML 1GOIA 5D5MB 1KTLA 3APDA 3SYAA 3WJMB 3WAKA 1O1ZA 3R19A 3DSNA 5AVTB 4HPYH 1J1PH 2VVSA 3MMWA 3PFRA 1PIFA 3MO1A 3TASA 3AUOA 3GU9A 1QCWA 4XNYL 1EXBA 1JNHB 4PJGF 3INUH 4F8QA 4RSVA 4RNHA 3QWRD 3V6BR 4LVFA 3MJ8B 2VAAA 4H4NA 2O5XH 3L3GB 4MQSB 1AW5A 3RIKA 4LCCA 5CAHA 1INEH 1D3GA 1YYML 4UOW1 2JBMA 1M1XA 1CWYA 3CV6A 4RXGA 2DZEA 4ZQMA 3L4WA 5JBDA 4EOUA 4X6DB 5IUCA 5HYFA 4KWVA 1W9PA 3TEWA 2Y24A 1FDLH 2XQYG 4YHYB 4QAWA 3ENEA 1SYVA 4AZ5A 3ABXA 1M4KA 2C6QA 1QVOB 4G9DB 5DMMA 4OLZH 4OV6F 3CV5A 4TM9A 2J1YA 3JV0A 4P5KA 2OR9L 4UT7H 4CQAA 3FU9A 1JPKA 4KC3B 4PJCE 1JERA 3T9PA 1V77A 3QRGL 1S9YA 3SE4C 1M9HA 1EGMA 3M0ZA 3GDRA 3TMQA 2YPVL 5KJRL 3MMUA 1H6EA 3DMMA 3D3AA 3GAYA 4NPKA 5TQ0H 3NA9H 3PZUA 1FWJC 5FOJA 2LLNA 3IIXA 3C5XA 3QBTB 1BF6A 4HHAA 2F19L 3BQ6A 1GPOL 5ABFB 1L0YA 3L67A 1KYAA 4YX2L 3TZNA 1T5KA 1TTCA 5CEZH 3QV8A 3RNDA 3WSUA 3VXRA 1LLOA 4AB4A 2IH8A 3MYJA 1OGGA 3N6YA 4I88A 3ES7A 2J75A 3RR4A 1BVZA 2WNNA 2JXMA 1E4KC 2GBVA 2NRDA 1S3KH 4HJ1A 5J6HA 2NXIA 4WSJA 5EOTA 4PV8B 2BSTA 1SSDA 1VIWA 3IBOA 3P62A 4U3AA 3CVIL 1FQ9C 4ZENA 3BQ5A 1AQKH 4ZW7A 2N59A 1Z32X 2Z7UA 4N90E 1TDQA 1QNZH 1ID5I 1JNJA 1F3JB 2WHJA 3DXAD 4J27A 3P2VA 4MWAE 1ZCRA 1LO5B 5FEWA 1VR6A 1HU8A 1JNDA 1G9MC 4LAKA 1B4TA 1KTKE 3T2PA 2BNRA 1RZ8A 3UZJA 5D9SA 2FT7A 2NZIA 3PSVA 2ZFAA 3BPNC 2DY3A 3H4HA 3AXKA 1GKRA 3VM7A 4FJYA 4ONHB 2X3BA 4NYLB 1Z9NA 4NKOB 3LQZA 3GSWB 3GJFB 2CBJA 3WDPP 1JPSL 1JPST 2DFAA 4HK7A 1TQBC 2IC2A 1EXUA 3L4CA 3UYOD 4KXCA 3WH8A 1CDBA 4A8IA 1VZGA 1G7IA 3QORB 4JFFB 1FH7A 1K9DA 1ICPA 5IEKA 4KROD 1VFHA 2Y6ZA 3IDIA 2W59A 1DQMH 4GYBA 1EHAA 3FUJA 1KB5B 1DBKL 4DZAA 3MKKA 2BVYA 3UR2A 4AX3A 3B0UX 3EO0B 1E73M 2R2HB 1NCAH 3LQAH 5KBMA 4CBZA 1SJHA 1LD9A 1RHFA 4LEOA 3E9TA 4PD4K 3W0WA 2VXVL 2YQBA 1XCWA 4S0SD 2VXUH 3X17A 5GZOA 3W56A 5I8EA 2YMXL 1CICA 2ABAA 3A4WA 2BSSA 3W9EA 1R6VA 2I07B 5I0XA 2QJHA 3FY1A 5I8CB 1HJSA 2I26N 4LSBA 1NDZA 1W0YT 3KYNA 3N9SA 4MA3B 4OIFA 8XIAA 3ZT7A 5JBEA 2OKOA 2CLOA 3JUYA 1RPKA 2LR4A 3OQEA 3GTTA 3LRSB 4OLXH 4JHAH 2GG1A 3L5LA 3P3RA 4BQ3A 4PJ8C 4AXWB 2R2CA 3WUZA 3D69A 4JZJC 4WO4C 2D3VA 3GSXB 4X0NA 3WUEA 1PMYA 2CRMA 3FPXA 2HX9A 5EEWA 4QF1A 2N7AA 5I76B 5ADOL 4MJZA 5A2CA 2VLRA 4NBYB 3H0TB 3WXVH 3LHTA 3FCSB 5HAOA 3EZ4A 1WZKA 4NO0A 1E9LA 3ZPDA 4NZTH 3S96B 5AZUA 4IJ3C 2IH3A 3P0YH 5IGXH 3VWJD 3UMNA 1BQLL 1QNVA 4NUWA 3BIAX 1GKEA 3U48A 1UG6A 2PETA 1LUCA 4LX4A 3NYKA 3V4PL 3P30L 5D55A 2FDMA 1JGDA 4TSAL 3X1BA 3C5ZB 3KPRA 4YIQB 2XWDA 2ZZUT 4UM9D 4U28A 4B9CA 3ZTJG 5FF7A 1LWJA 4GH3A 3MCLL 4HQQH 1A1MB 5GVJA 3U1QA 1KGYE 2LVCA 3O6KH 4GY7A 1F61A 2ZX7A 3TJEH 3CMFA 4DO7A 3IPFA 1GRWA 3XISA 3G1DA 3T2NL 4G8EB 2M8XA 4HFUH 4XMVA 5D6CA 5CZTA 3VTMA 1E2ZA 2E74C 2QHRL 3NQGA 1DCEA 1F11A 4AJ0A 2R69A 5CU5A 1SVCP 5DI8A 3NZ1A 2HNHA 1G43A 3QNYA 3VD3A 4NO5B 4MDJB 4NAMA 3V5CA 4I4WB 5CSBA 2JIXB 5ACMA 1YNLH 2C1PA 3I2CH 3CTLA 3UCRA 3WLKX 3CIVA 3U9PH 1QTYT 3TNNB 2WIMA 3EYQD 1QHPA 1TNNA 4MMZB 4IL2A 4D71A 1LE5A 1JUFA 4UMAA 4NPYA 4J1UA 5FGRA 1K2DB 4WCYH 5KZCB 4F7MA 1K8ZA 4UDUB 4LH8A 3P93A 3W85A 4AQZA 1JCMP