4UQLA

High-resolution structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Studies of [Nife]-Hydrogenase Mutants: Towards Consensus Structures for the Elusive Unready Oxidized States.
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 83
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4uqlA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4uqlA02
4UPVA 5A4IS 5JSHA 4UCWA 4UQPA 4CI0B 4UPEA 4URHA 4UCQA 3ZEAA 1UBUS 1WULS 4IUDS 4UCXA 5JT1A 1UBMS 1WUJS 1H2RS 1WUIS 4UD2A 5ADUS 3USCS 1WUHS 4UEWA 1YQWA 1UBLS 5JSUA 3H3XA 1UBKS 3CURA 5A4MS 1CC1S 4U9HS 3ZE6A 1E3DA 4KO1S 4UE2A 4U9IS 4UE3S 2WPNA 5D51S 3AYZB 1YQ9A 5JRDS 1FRVA 3AYXB 3ZE8A 1UBTS 5JSKA 1UBJS 4UE6A 3RGWS 2FRVA 4KO3S 3ZE7A 4KO2S 5JSYA 3USES 3UQYS 1FRFS 3ZE9A 1UBRS 4UQLA 5A4FS 1UBOS 4IUCS 1H2AS 1WUKS 1YRQA 4KN9S 4TTTS 4GD3Q 3MYRA 4C3OB 4UEQA 4UD6A 4KL8S 4OMFG 3CUSA 4KO4S 4IUBS 1UBHS
chains in the Genus database with same CATH superfamily
1ZLXA 3LQRA 4XIFA 4MTCA 5FOWA 3W6NA 5BVGA 2H9YA 1I4OA 1P77A 1XVIA 2J3KA 2OYSA 3I76A 1B6TA 5LUBA 2DEUA 4BO4A 4CG2A 5ALDA 3GCWA 4QJBA 3CUUA 3KQLA 1N6HA 3H3XA 1J8FA 5AW9A 1D4AA 3CN9A 2VPIA 5JQGB 2H1CA 1XHFA 3UG6A 5LC1A 3BF7A 4I6JA 4MQ6A 4QPPA 4F6RB 4CM6A 3FZYA 2QM0A 1P4SA 1FTQA 1T0JB 3A0RB 2X5NA 1ONNA 4ZC1A 1GZVA 1JE0A 3RV4A 2AV6A 2BLNA 2G0AA 4GXRA 3KJIA 3HI4A 2M6SA 5K51A 1KI6B 4BKOA 5JJCA 1Z6TA 2X9NA 4MAMA 2NU8A 3EY9A 1WQ4A 1J8DA 4AW9A 2OHHA 5HIMA 4FLMA 5G53C 4DA8A 4UOEA 1JIKA 1KO5A 4TSFA 3LLVA 1HDOA 1KQOA 2PX4A 1U6JA 3QI7A 4CV3A 5BN4A 2QLFA 3HUUA 3I58A 2W6ID 4H3HB 5BNTA 2BTOA 5A9SA 1IN5A 3G9XA 4IM7A 3JQEA 3UT6A 3WLRA 1WZNA 1QAMA 4IGIA 1MC8A 2QRJA 2HSZA 1ST2A 4F7DA 4RO0A 2OK7A 4GSYA 3HL4A 1NDHA 1TQ8A 3FJYA 3PNQA 2QTVB 1ETUA 4S05A 5GADl 4MYDA 1NJ5A 1BCRB 4EG3A 2ZDHA 1BS1A 1O8BA 1YR2A 1Y5LA 2GZHA 2ZJYA 1EFUA 1XMVA 5BNZA 5JRJA 2VJMB 3FVQA 2E4YA 5JD4A 4N41A 3QKTA 2X0DA 1NMSA 4D46A 1A1SA 2WWRA 4OB8A 1A69A 4XJVA 1NBIA 2G1PA 3LK6A 2IHUA 4QODA 4RD1A 4GGOA 3F98A 4TUYB 1AMUA 1WRBA 3BUSA 3AHDA 4A15A 1L4BA 5CDTA 3GJQA 2G72A 3JARB 3GGCA 1SCJA 4RD3A 5FWYA 3MLAA 3PFKA 1F8XA 3A0UA 1PFUA 2UYGA 1G0NA 2AOUB 1K4MA 2WBLC 3PFIA 3S1LA 2OYRA 4AURA 3M2TA 3NBFA 2FWRA 4LJ8A 4ND5A 1JI0A 4FFDA 4P31A 3RBAA 3LA8A 2W6QA 3RRBA 2VKQA 1NLFA 4GPBA 5JVDB 1GD1O 4X45A 3HFGA 1N6IA 3DLHA 2EERA 1S2GA 3EN0A 3EIFA 1DQNA 4P1ZA 5D6NA 2NG1A 4L78A 5FUVA 3CNNA 2Q3CA 3OOYA 2PKXA 4CMAA 3P9RA 1B41A 3MCUA 1MX5A 4NENB 4ZOAA 5DHPA 5D85A 5L3QB 2CV1A 1S2DA 3EHEA 4G1VA 3BD6A 1K2VN 1EESA 3QIAA 2V4MA 2OE2A 1H4VB 2O2DA 4HEA6 5CNJA 2X22A 2H1VA 2O1XA 3PFGA 3IILA 2Y1GA 2XWJI 1E3TA 3ZI0A 3K6SB 3GT4A 1MQ8B 3ANLA 1L7EA 1LQ2A 3O38A 1ABFA 1KC1A 3D8UA 3IGFA 1ZINA 3LKDA 3WV4A 5I5EA 1E6MA 1N9ZA 2IYSA 2C3PA 5DKFA 3ZZMA 3Q88A 4RKWA 8LDHA 2H2IA 1J56A 1H42A 2BP7A 2FR0A 3DVAB 4TTQA 2E7ZA 4A0RA 4BO2A 1V4VA 4X7RA 2FETA 2AFHA 2X2FA 4FHGA 1BXGB 2HF9A 2WI8A 3COPA 3FUWA 4BGIA 1VL0A 4AMBA 2HH9A 2FDCA 4U2FA 1N7IA 2Q5HA 4LRTB 4CF3A 3SIPA 4D0NA 4H18A 1L5WA 2HCFA 3D02A 3HB0A 7GPBA 3LT1A 4WERA 1KFEB 1XDBA 5C8VA 1ZRHA 2CWWA 2FCRA 3AIOA 2WB2A 4PLCA 5IG2A 4JMLA 3DOHA 4ZVQA 2EJCA 4GFDA 4B7CA 2KW5A 4QU0A 5I4BA 1HL3A 1RHQA 2HXYA 4OATA 4ZJPA 1PFGA 1PIWA 3ZHTA 3F2IA 1UZUA 2OAGA 3V55A 2XE4A 1V8FA 4LK3A 3HACA 1T3SA 2C04A 2HJHA 3GEIA 3JX9A 2OENG 1KBZA 2D8MA 2H57A 2WFMA 2YVLA 4FFOA 2ZRFA 5EXEA 1LW7A 4FMCB 1K0UA 1YS1X 3GA7A 3RIHA 4RTQA 3NIBA 4UOQA 2Z09A 2NSDA 3AM5A 3TPCA 1HFEL 4C6HA 1Y3BE 2CLFB 1NHGA 1CLUA 1QFZA 3FNBA 1MO3A 4QG7A 1JVSA 4JMPA 3KX2A 1UXIA 3D4BA 3GGOA 4WBSA 1NI5A 3AI2A 2C7PA 2XDWA 1NVMB 3Q85A 1C4KA 2X3UA 2WQ6A 1IQUA 1HC7A 1W19A 1M6VB 2X14A 5ICMA 2CKDA 2Q5FA 1LTKA 3HLTA 2FG5A 1LLUA 4DIBA 3MFYA 4I5IA 5A0VA 3ZCVA 3M6IA 1DRKA 1FX1A 1P1IA 3K0FA 2Q9AA 3N58A 4I36A 4ABYA 1PK8A 4JB3A 1JU9A 1KI1A 3BHNA 1OSNA 1Q14A 5DNWA 1QYVA 1YJXA 3KTDA 1JXMA 1GGJA 3B85A 2SNIE 2HJWA 3LV8A 4B48A 4RQBA 1MT3A 5JR3A 1OVMA 1OVGA 1TUGA 4WBNB 3ORFA 3H6GA 2YNMA 4DV4B 2GBLA 1EK1A 4I3GA 4DMCA 3G2QA 1F5NA 1BX1A 3MOSA 1HG0A 1N4DA 1ZOLA 4BVLA 2NUAB 1CUXA 2C4TA 3LM8A 1L1EA 3PC8C 1Z8DA 4G8CA 4ND2A 3I9NA 3HKCA 2WJ3A 2X9VA 4JELA 1M8KA 3E58A 4I5FA 4F6RA 2GM3A 2RBGA 1U4NA 2UXDB 3HLKA 1VJCA 1SBNE 3ELWA 4KOEC 5BPHA 5CLIA 5CX4A 3ZHCA 3AEUA 3CWZA 5KC9A 3NBMA 1CVLA 2FZGA 2ZCVA 3JQAD 1P61B 1VMIA 1QORA 3ENQA 3OKAA 4OUKX 5EJ6A 1S4MA 3KTOA 1CUYA 1XRLA 4NDNE 1D1QA 1SVSA 1J9ZA 2WKRA 1MABA 3IIIA 3QYPA 5E38A 3QOWA 5CX1A 4AP6A 1T9ZA 5JISA 5F2OA 4ZHQF 4HQ0A 3I72A 1AURA 3C7CB 3GDFA 4FOTA 4LI0A 5HMMA 4FYJA 4EKIA 4O0LA 2FQWA 4MV4A 1PW7A 3L04A 4CR8A 2BFBA 1I1OA 1CF4A 1ZVVA 4FWBA 5IKMA 5HQ3B 3KXIA 4C6SA 1MIOB 2Q3MA 4TMTA 3DBLB 3JU3A 3CVXA 3LPAA 1XK7A 4BFZA 5CA1A 2B4RO 1JEQA 3ZN2A 4YTEA 2V45A 4AMVA 4YMHA 2I4IA 3AHIA 1XVVA 2YS7A 1NY6A 4JGBA 1ZCJA 4JOBA 2XUKA 1U5AA 2Q6VA 4K9DA 3WQBA 3ESRA 3N0WA 5IVDA 4PX3A 2JG3A 1ZGAA 3WYNA 2VHCA 1Z36A 2HRQA 3AF3A 2FPSA 2Q8NA 2PGXA 1JSRA 5A2GA 4BVFA 1ORWA 4OKSA 5ELLA 3WDMA 4CF5A 1PQWA 4S0ZA 1PVDA 5DN6A 4ZXPA 4NL4H 1BKYA 3TZQA 4EKGA 1FFWA 2OXRA 1KRHA 3PD7A 3LWNA 3ZDZB 4Z0NA 4HD8A 2O7SA 3BBLA 3PA8A 1E62A 3IOYA 1H1LA 3QBDA 4PHHA 4P35A 3JTEA 5IK2A 2IODA 2CUTA 4CBVA 1M3SA 1E8MA 5JAHA 3VR1A 5EE3A 2E4VA 1KI9A 2G09A 4X7PA 2FE1A 5GMOA 3RANA 1RVV1 4Q9KA 3TQCA 3TLAA 2E0IA 1OY1A 2CBXA 3E1GA 3AYZB 3GXBA 1MW9X 2CVQA 3B5IA 1SWWA 2OECA 3PHCA 4J9VA 2PGLA 4FONA 5HP4A 1CWUA 3AVOA 4GBGA 4YI5A 1WXHA 2O9JA 4IDHA 4F6CA 1P9OA 3KALA 1QM5A 3GJTA 1RYBA 1OLUA 4ZT6A 4ZCTA 4IG4A 4DIUA 4EMBA 3AEXA 1ZCZA 3UK7A 1DEKA 1AIPA 3FCEA 2PS9A 2J3QA 4BLRA 5HK9A 3DYVA 3EZ7A 2ZJ0A 1B0AA 1T43A 3S55A 4HUQA 5ESDA 5C8XA 2VOJA 2CF5A 4Q5IA 2HFJA 3KHTA 4WESA 4EB3A 3R7FA 4RD4A 3NG1A 4CN9A 5LWQA 3H9BA 3ZJYA 1C3JA 3G2LA 3CINA 2Q4EA 3STHA 3CLVA 1A9TA 4WLFA 1INLA 3H86A 3NWOA 2QAIA 1JHDA 1ULZA 4YCNA 2WFLB 2BFWA 3EXHB 4RK6A 1EE1A 3DVQX 3IYLW 2CE2X 2I8LA 4RA9B 1T8YA 5B7NA 1JWBB 4B3XA 3R7SA 3OC0A 4P4GA 1G41A 5F3WB 4FLEA 3R2JA 4YCJA 4D6XA 2ZXFA 4XTCS 1KRWA 1Z5PA 2QZZA 4W5JA 3ZXSA 2W6MA 2GEDA 2G1KA 4EZIA 4V02A 2CGEA 4BPRA 4C7BA 3SJ7A 4AZTA 1N6NA 4A5SA 4KQGA 2IUFA 4KIGA 4MRMA 4MS3A 2TMYA 3FN4A 4II3A 2CB0A 3GLHB 5BN5A 1V3TA 1KK1A 2EIXA 4G0NA 2GD0A 4MV9A 4WFJA 3RCBA 1A9XA 3FDJA 2YNMD 4YQYA 4NV1A 4MUXA 1QNLA 2G4LA 2ZI4A 1J99A 3GP5A 2CNNA 3I4CA 4KSYA 2YV1A 2HA4A 2D62A 3ZV6A 3KZCA 4QJIA 3KYCA 5E9WA 2DFTA 2ZM6B 1X2EA 4J6EA 1E9EA 4FW9A 3UH0A 5CFQA 2W70A 2XDAA 2CD9A 5JS6A 2ZRGA 5AIAA 3IVCA 1HTTA 1TM5E 2GCGA 3MRSA 2IOQA 4MW2A 4Q4HB 4XTRA 3SC2A 2Z95A 2ET6A 2VYCA 3PLRA 5JWRA 2D7DA 1NVAA 1Z28A 4J29A 4ETIA 1NLMA 2BBSA 1PZXA 2GH1A 3CRRA 1GTRA 3WKDA 2QRGA 1XZMA 2PKQO 1WDKA 2XHEA 2QMOA 2YCBA 2HEGA 3H2BA 1ZOIA 1LPMA 4IP0A 3I0MA 4UCQA 4LYDA 2QG6A 4BLUA 2Y71A 4TS1A 1Y8QA 5DLQC 1IXYA 3GJ8A 3GIWA 1RLTA 4BB5A 2C8LA 2HIHA 1UANA 2Y05A 4RXUA 1Q0RA 4JBXA 5AW8A 3FHLA 1FS5A 5TV2A 5F3RA 3G5TA 4HC4A 5A05A 4I4LA 4DARA 4U7TB 3R5TA 5D7NA 2OXTA 3DE5X 3VUEA 3DMFA 3OD5A 3KZXA 5LOVB 3DOFA 4M88A 2QOEA 1CJUC 2BGTA 2Q1WA 3VDNB 2FW0A 2OFFA 5AHRA 1XX6A 4G36A 5JI3E 1M6HA 5BUQA 2Q29A 3BRSA 1U90A 5IM4A 2Z2JA 1Q0ZA 3QBJA 4KMOA 3ZHZA 1U8XX 2C97A 3RI3A 1FYWA 1QS0B 2ZVQX 2F17A 5HIAA 3U56A 4O2RA 3A4IA 4GLBA 4QEKA 2PKYX 3OEWA 3FMFA 1V5IA 3SHOA 4DQ0A 4EF6A 2CFTA 3X44A 4QBTA 3ZPXA 3IKMB 5IXSA 3GBVA 7REQB 4G4IA 2HSDA 1LPPA 4DCGA 4INOA 4JBLA 2WD9A 2FPUA 4Z5XA 4W8OA 5BSKA 1P8JA 2ORVA 2WUVA 1J09A 1YOVA 3C6YA 2D6FA 1BA2A 1ZW1A 3CKKA 1K5GA 4YDHB 5KQSA 1PLJA 3JYNA 5ER6A 1G2IA 1T8TA 4YHHB 3AB8A 1YZTA 2Z04A 1LBQA 3RJMA 2ZROA 3NM6B 4AC9A 4BX3A 4DA9A 1QPZA 2AJDA 4D9NA 3R6TA 2W22A 1T1RA 4KCGA 4BQOA 3ZS9A 3WAJA 5GIPE 2VPYA 4XDGA 1YS7A 1K06A 3I32A 1Q74A 2ZSDA 4H1UA 4LV6A 1RWNA 4Z0HO 5FF9A 3RJTA 3JCZA 3E23A 1QQAA 4WFQA 2DFDA 1K5HA 3A1CA 4IIHA 3V3TA 4NPAA 4HUTA 1IK6A 3B7GA 3QFSA 2G1UA 3TD9A 4JJZA 5AOBA 1JJFA 3KCQA 5CH5A 1UKEA 4M7OA 1P2UA 2AG6A 4DKJA 1WU7A 3F1LA 4FNOA 4A1FA 2FZLA 1VIAA 3D2CA 3Q1KA 1W4CA 5HKLA 3SC6A 2AFRA 3U6KA 2P9QA 1GUAA 5T6MA 4NOMA 4DIOA 1J06A 3O2JA 1WABA 2QR5A 2C9BA 1O5OA 5B6IA 2BGIA 3PJGA 3QX8A 4JOCA 4NCNA 1R5BA 2XKBA 4B34A 1M1YB 4IHAA 2AEEA 1GSHA 4QLBA 1YDGA 2HSWA 3MEQA 5CA1B 3M70A 5ADVA 1AQLA 2BH9A 4P3YA 1NZFA 1GITA 5EKXA 2QE7A 1MB0A 3AZOA 1U4OA 1BKDR 1NMZA 3QRWA 1B4DA 1XNGA 2BFCA 3PKJA 2GA8A 4NKRA 2BD0A 4B6JA 5AFSA 5JXWA 2VSXA 4BU1A 1J8MF 3MIZA 4DKXA 3WGUA 1Z2PX 1W36C 3CZMA 4GNRA 1P6QA 3KB6A 4QYIA 2CLEB 4A0SA 3KYBA 4BQPA 3H6HA 4QU5A 3VHRA 2QT0A 2WIKA 1YRQA 1ZAYA 3JQPA 4TMVA 1GZ6A 2GPSA 3EG9B 1GRCA 3LCUA 3MGCA 3UAVA 3VR3A 1SPBS 3IMFA 4RZ3A 1E58A 1X80B 2FPIB 2QUAA 4ESOA 1Z2CA 3ZVLA 4CG3A 1WXEA 3E7XA 2C2XA 4FDAA 4K87A 1Y6QA 4L6CA 4NFHA 1AK9A 1EG7A 1YA4A 3DKRA 3LCCA 2GUWA 3G79A 4CMHA 3EX7C 3MERA 2H54A 2W6IA 1NYRA 1THZA 4C01A 3IULA 1DBVO 2GX6A 2XIJA 3TQFA 5AKXA 2Q5IA 1T9BA 3FPKA 3GMTA 2ZYDA 4JYBA 1YZHA 4EQ6A 5EWJA 5CYGA 2DMRA 3GQBA 4YMWA 2YQZA 4KQIA 1RRMA 2GYYA 1Z0DA 1KZ1A 1ZBDA 2WD7A 1CZRA 2GNPA 4WKGA 3WGNA 2AMJA 1YD7A 2QUJA 5IH3A 2OZLB 3A2KA 1J0XO 2FRXA 4ZP1A 2R1TB 2YHUA 2P1ZA 4HLNA 4KSCA 5SYNA 1U0SY 3P2KA 4XQ9A 2PY6A 1ZK1A 3VO2A 1CRPA 2P41A 1KETA 1F51E 1QIJA 2VH5R 5L4NA 1E4OA 4NZNA 3ROGA 3NIDB 2Z4SA 1FYDA 4Q9AA 4ZAYA 3SXPA 2CLSA 2ZAOA 4QICA 2X2EA 4CTKA 2BSXA 4P0PB 1FVFA 4K86A 5KZMB 5TQ0A 3I3SR 1BAPA 1ESCA 4X7MA 5BOVA 3TE7A 5JZMA 4W6QA 1GQRA 1HG1A 1WO8A 1B73A 2EDCA 2W11A 1MV5A 2OCBA 1OH8A 3NQ41 4LS3A 3HVIA 1Y6ZA 3UMJA 1OILA 3N1UA 3TL6A 1V8ZA 4E13A 4CLOA 5IJXA 1Q1EA 4GSLA 2I3DA 4FUTA 4H7FA 3WK6A 4EYQA 4CTOA 4BMOB 4RTPA 3ID6C 3HCPA 4JNCA 1GOTA 3DUFB 1LBSA 3H04A 1II8A 2AQ8A 3LYLA 2R84A 3P32A 2EKZA 1I6KA 2OCAA 4O5AA 5K3DA 1IHYA 3QVSA 3V4LA 4G8DA 5GZ3A 2DWUA 3AHHA 4EGCB 2C2GA 2I1VB 4IH1A 1NYQA 4S1PA 2O5CA 1M75A 2P2LA 3ZG6A 1VE7A 4FEYA 3HDHA 3IE2A 1VLVA 3S8EA 5JH7A 4M38A 4L27A 4ZOQI 3NJRA 5KTOA 1JFLA 2VSYA 4PAQA 1MD9A 1OFIA 4EPVA 1JA1A 2QL7A 8ADHA 1WUKS 2NU7B 4UM8B 4CM4B 4RYLA 4QWMA 3L5OA 4PQEA 4AUMA 5BYBA 1V4NA 4WFKA 5JAZA 1US8A 2J9FA 4QNRA 2JLBA 5TC4A 2NSYA 2XMZA 5LCXA 3S2UA 3HVJA 3KETA 4IKEA 1UWKA 3VYSB 4CU5A 4LDRA 3KQNA 4PYIA 1EX9A 1H2ZA 4M8NE 3SQOA 3U3KA 1EJBA 2IDKA 2R8XA 5LN1A 2ZBFA 3TW6A 3VZSA 5JYEA 1ZG3A 2JEZA 2V7XA 2JCXA 3OQ6A 3EGDA 3QNMA 4XSHA 3BJRA 4IGEA 3U31A 3FDFA 2HNBA 4JNKA 5EWLA 5TMPA 2F1KA 4OAQA 3QKSA 2ZRLA 2R8OA 3PUWA 4XDZA 2JHGA 4EUEA 3HKBA 3URKA 4B0PA 2QP9X 4UVDA 1TCVA 4NYIQ 3I8XA 1YGYA 1VFPA 3UK0A 2M1ZA 1W94A 4O8ZA 2NTNA 3OZTA 1MXFA 4PLWA 4X91A 3T3IA 4MVJI 4BAZA 1NX6A 2J87A 4PYJA 1SC6A 4B79A 1X14A 3OFKA 1W5AA 1Y81A 2OCGA 2C00A 1GPH1 4YPFA 2G4VA 2VJDA 4EAQA 5MGNA 2GXUA 4L7VA 3ANYB 1MG5A 2WE8A 4BFVA 2R4UA 5KVVA 2FPXA 3WBKA 4BBPA 3MWJA 4CQMB 1GTJ1 3GLIA 1EWVA 1P3JA 4INPA 1G66A 2GBCA 4BFYA 1CF9A 1R0CA 3L7AA 2RBEA 5LMUB 5B4UA 4N48A 3SF8A 4TV9F 4A91A 1EXDA 3GP3A 1THTA 3D3KA 3RF6A 3KU4A 3VKWA 1R0BA 3CV3A 3OM8A 3G2JA 3VMMA 3ETLA 3SQXA 3KWMA 2IA5A 2NM0A 2OO7A 2O2GA 4KQHA 2HJVA 3I2HA 1N7GA 1Y5RA 4OXQA 1A7KA 2WT8A 3NM5A 1XDZA 1UC5B 2F48A 1II0A 2Q3HA 1KTVA 1ZNYA 2CMDA 1TB4A 2BMFA 1XN4A 2ODPA 2IUUA 4O4LF 3OLYA 4RACA 3FE2A 1ZO8A 2Y93A 2OORA 1FFBA 4YAKA 5E6SB 5DIFA 4YJHA 3CVUA 1CUZA 3OX3A 1JPNA 1UPFA 4QOFA 2KPOA 4KG7A 4DTCA 4ENSA 2WM9B 5EUBA 4PX2A 4N9QA 4OH1A 4BC0A 1U02A 4WADA 1A97A 4Y2QA 4C3UA 2DSTA 2VCYA 3L8YA 2H06A 4H4EA 1QGDA 2VDJA 4NJEA 5FD8A 4BE9A 2R7AA 2A9OA 2LR0A 3DKVA 3U19A 2IHYA 5KYXB 3KQSA 5JD5A 4YUYA 2A58A 4GDFA 1LB1B 4AZSA 1QFXA 5EKDA 3JQGA 1EVEA 1X1SA 4M36A 4Q93A 2GPAA 3OEHD 3ZCXA 1H2FA 1W47A 4ML3A 2FZVA 4BFCA 4LDNA 1CTQA 3ZZNA 4BMYA 4PTZA 5KTPA 3QMWA 1J24A 1JJBA 2VFAA 4E11A 5JY1A 2N1MA 3ROMA 4IVQA 1E5TA 4C6TB 5KNCA 3W8RA 2GLXA 3DBVO 1KIAA 3Q9LA 4MUKA 2BEKA 4DCJA 4L16A 1SUFA 4BTEA 2ORED 4KL8S 2NTEA 1E79D 1IC6A 3IL2A 1SD2A 2X4GA 1MAWA 4K26A 1Q95A 1CEYA 1T4CB 4GZLA 3KDAA 2RAFA 4LQLA 1Q7BA 4MI3A 5C4MA 2L2QA 4XGKA 3PK0A 2HPZA 2B30A 3V1TC 3IDQA 1Z25A 2I62A 4FCTA 4EUSA 3HU1A 3EK2A 4PSVA 3EGXB 3H19A 3FJOA 3GLFE 5JJKA 1WMFA 3DZDA 4BLWA 5IM4F 4IIVA 3T3PB 5CNIA 1RZRA 2X1LA 1SCQA 1WMSA 2OCIA 4HNQA 2QAGC 4YJ3A 3EDRA 4DGSA 5DX1A 3OA0A 4P5EA 3T34A 2I54A 1EUQA 1V8PA 4WK2B 4A7PA 3M4YA 3FSGA 2HLDD 1UP7A 3CUSA 2F00A 3IA7A 4ZMRA 2QUKA 5AJHA 1PX0A 4UARA 2WV7A 3RE1A 1L7VC 1P2GA 3C0KA 3C6QA 5AVWA 5HEKA 1M2VA 2WMNB 2DLCX 3AR7A 2QD5A 3I1JA 4UZFA 4B4UA 3OT5A 2PGAA 3OUUA 4H2DA 4AZVA 4X66B 1R4MA 5LLDA 5IAGA 2WE7A 4R0VA 4P0TA 2QX7A 5C1PA 1Y3DE 5H70A 5ESRA 2PJDA 3PL5A 4GICA 3R8FA 5I7RA 4MV5A 1HKUA 4K3UA 4CIVA 4ONEA 5F7JA 4OAPA 3WHPA 4A27A 2Q7XA 3LXRA 1G6KA 1CY2A 3OZBA 3GJ6A 4KX3A 2VDUE 3CF4G 2QN7A 3JD2A 1GTL1 2P78A 1YCGA 3N7AA 3WK8A 3P2MA 3VRHA 3WRVA 1U80A 1I01A 2GBLC 1Z56C 2RH4A 4BE4A 5JAMA 5JTTA 2HYDA 4OLFA 2PMEA 3FZNA 1PE0A 1HL7A 1HEUA 5L6MB 5D3KA 2O8CB 1MO6A 3KAPA 2E5LB 5M3BA 2ZE5A 4Y98A 3W2TA 1FNDA 2I65A 2XITA 3E5MA 3IAS6 1NL3A 3ZZUA 3AUSA 1Z63A 1JQAA 1UADA 2Q4RA 1LLCA 4INAA 1LEHA 2XTAA 3V5NA 3LDAA 3TW0A 3F5FA 1QZ3A 4B4OA 2PZAA 1P1KA 1XFDA 2FSPA 3SD7A 3BH6A 1PT8A 2VTDA 1LTHR 3ZY2A 4BVHA 1RYYA 4R4JA 3EGWA 4IICA 1N1MA 2FMIA 2K6GA 3G5UA 2FEKA 3QW2A 4Q6BA 2C7GA 2CXOA 2CDNA 3GDHA 2P9EA 4N54A 3EXIA 1L5LA 5TDHA 4AG5A 4N3NA 1SCUA 2X8WA 5DWVA 3UQZA 5IJ0A 1VOTA 3W8EA 5IN4A 5KYNA 1DI0A 1AO3A 3V8RA 3LOPA 1KOFA 1FNNA 4MI9A 1OWPA 1RYDA 1Z6PA 1UK9A 3ZVNA 2I22A 3HEMA 1JH8A 4OQPA 2OGSA 1MGPA 1OIWA 2B5WA 3EWIA 2QL9A 4MQUA 1DIHA 4NNOA 4BV3A 5LOVF 1VGVA 4RHXA 4CM8B 4MRPA 4EZEA 2XE8A 1YL6A 1CDOA 1RM3A 3OECA 4LWPA 4AFNA 4ZYUA 3LX6A 1ZDMA 3VHLB 2A9RA 4LOJA 3I2GA 4JP1A 3I0ZA 4WKOA 3UJDA 4RAOA 3PUJA 5C8YB 2XNCA 4NZ9A 3Q8LA 2YYAA 3RWOA 2V7PA 1IN8A 4IUBS 4KO4S 2GFHA 4D57A 4AJ1A 4LKOA 4U7FA 1WMBA 5DGHA 1YDMA 4LZZA 3T99A 3HY4A 4F4DA 3SZRA 3ZQ4A 1K6EA 1WKCA 5AJYA 4Q4DA 3OLWA 3VNBA 3C85A 4C04A 4E07A 4EL5A 2ERXA 1ZJWA 1YQEA 3UUGA 2I76A 3PFHA 3NKLA 4LTDA 4ZRMA 2Y1KA 1QOQB 1XTUA 1YR7A 2PMFA 3EGVA 2JI9A 5CIQA 3UV7A 2MSLA 4D42A 5BVHA 4POAA 3P0IA 1GGMA 4KFCA 1ADJA 2GO1A 5BNFA 1E1LA 1SKYB 2B9EA 3I04M 4F7WA 3MT9A 1S8AA 3MJHA 4GXTA 1JMVA 2C1ZA 3AOEA 3ENKA 3ZQJA 1YJ8A 2CXXA 2P9CA 3QVOA 3QEOA 4B1FA 3RC2A 1OBFO 4J1TC 2VCHA 3R5XA 3K6RA 1AKYA 1DMRA 1DELA 1OA1A 1W4ZA 4J3JA 4BVBA 4Y1FA 4D7AA 3QK7A 1K2WA 1CFZA 4RS4A 5E9AA 3TEMA 3UHAA 3QVGA 1P1HA 4EEXA 5IDYA 4KGXA 4E2XA 2GRUA 4LEIA 5CG2A 1IUNA 5AJVB 4Q48A 1OGYA 5AK4A 1FDTA 2W4QA 1R8JA 1VTKA 3AUFA 3GIDA 1Y37A 3HUTA 2JFNA 3FMGA 1T2NA 3GLSA 3JVVA 1U31A 5AOCA 5BSTA 4EI8A 4ZODA 4JT2A 2QVLA 1AS3A 4G01B 4HZUA 5BRJA 1OE0A 2GN4A 4HPWA 3NX4A 4XB1A 3F9CA 1V41E 5KX5A 2XOKD 3OY7A 1T3ZA 3ITNA 4N3BA 4UJ3A 1WF6A 2GYVA 2OV8A 4P4SB 3QUTA 5FWDA 3WL6A 1HE8B 1N2GA 3BRWD 2DM6A 3ELUA 4RUKA 5G40A 1XLTA 1M8JA 5I9IA 1R10A 1SMKA 2NVUB 1ZZEA 3SFTA 3S27A 2VDPB 3B53X 3DVLA 1SCUB 4DBLC 3C2QA 1YB7A 4LJAA 1NXTA 5JAQA 5DTEA 4XFJA 3BJMA 5IANA 3U44A 4EHLA 2AJ8A 5FBZA 1VMKA 3QA3E 4JVMA 4D9IA 3LCVB 2CNBA 4L73A 4QJ4A 4Q4JB 4QFCA 4FYXA 2IKSA 5BSWA 5CB6A 1WPQA 4TWBA 4CIBA 1ZCFA 1WW2A 2PIDA 2XUDA 5FXMA 5B3KA 2HPAA 4RKQA 3AJAA 2D7JA 4U5QA 2YJ4A 2YQ4A 4ZYVA 3WLJA 5K6AC 2JHAA 2YOGA 1ZH4A 1E1CA 4GQIA 4RZSA 4OJMX 5FNZA 2JIZD 1TYBE 3D7LA 1CQJB 3N9IA 4PC2A 5H9WA 4QU9A 3U7HB 2W71A 1VCNA 3REQA 1M5UA 5DPMA 2QUZA 3A05A 3M4JA 4RZHA 5ITWA 2NV0A 5AOVA 5E7QA 2G76A 3KTAA 4RPJA 4UZEA 2HBZA 4IR7A 2I6GA 4BQQA 2DY0A 1X9HA 2DETA 3ABSB 3QFTA 5AVRA 1AUOA 4DNFA 4MWBA 4RGVA 2O8FA 4FN5A 4JKYA 1LRKA 1E32A 2TRSB 2HJGA 4DHEA 1MBZA 4YYEA 1U9YA 3AI1A 4KRGA 4KYTA 3VO1A 5AVSA 5BV7A 5D00A 2H63A 1RXWA 4NCBA 5E7IA 4W7SA 4FWIB 2EF1A 3G85A 3UANA 2XUPA 1JP7A 3T54A 4IJKA 2P2CA 4B32A 3B6MA 4MYRA 2ZPAA 2GPNA 2BHSA 2ZRDA 3FMVA 4TLMB 2PXHA 4NG5A 4ENUA 1GPAA 4IYJA 1HBJA 4UBOA 3ZQ6A 1L5GB 3Q6IA 5J5CA 4AG3A 5HGJA 2R62A 3BZBA 5G4KA 4DCSA 2F8TA 1U8EA 1GQQA 2JGEA 2JCGA 4YREA 1ODKA 1RHMA 4L8WB 4RDHA 4DNQA 4JEIA 1V1MB 2DR3A 1CC1S 4Z7QB 3DMGA 3KJXA 1ZH2A 1SXJE 4WNAB 3AVVA 3WICA 1OV4A 2B1QA 2WTUA 2C88A 2WKWA 3ET4A 4WUVA 3R44A 3L6UA 4N01A 3T1NA 4IJ5A 1BMFA 4ZFNA 4JBYA 4C3VA 2HMSA 3ZHBA 1O95A 1BYUA 4W4TA 3EXEA 1RP1A 1OUMA 4Y18A 5ALKA 3LCJA 3T41A 4B3FX 1OCEA 5JZOA 2VDKB 1Q77A 3GBSA 4FX2A 3IV7A 3AVUA 2OHJA 5HS6A 3C5EA 4PAGA 1EK2A 1RAAA 1B8UA 3A3OA 3LTEA 4K05A 2QV0A 2AF4C 2REXB 1UQRA 1QCCA 5A7HA 2O4UX 3HP4A 1RNLA 4DV3B 2A5LA 3N5KA 1TZCA 1W2WB 2HCTA 3M3HA 1GXSB 3ZBPA 2YUTA 3R6GA 1DUVG 4M7RA 2C4MA 4NTZA 1Z6XA 1D1PA 2XZTA 3CLSC 4NMWA 4R7GA 1EGAA 4TMWA 3I5XA 4D8WA 3ZBQA 2JFGA 2AZTA 4BGDA 3VPHA 3I73A 4C20A 4J0EA 2J5QA 2FMUA 1X7WB 1PJLA 1LY1A 4AO6A 4CM8A 4QUKA 3EPJA 5EIWA 2QD3A 1GNSA 2C4WA 4MA5A 2J3EA 4D82A 3L7KA 4F2DA 5IH7A 2VAVA 3CH7A 4P4UA 4ZQIA 5C5IA 2ZUDA 3IAAA 1QIDA 3PHBE 4CKWB 3E70C 4K6MA 4CR6A 1QJCA 3PDUA 2FB9A 2R5WA 2IS6A 3EISA 3KPUA 4Y0NA 1YVEI 1Q50A 3FVWA 5EWMA 5CHYA 5LJIA 4DLVA 2IX9A 4R1TA 5FYDA 4GP9A 5BQXA 4OQ4A 3R9IA 3COVA 2LWIA 2QY6A 2AJTA 1ENPA 4XVUA 1D9XA 5KTSA 1E3QA 3W4IA 4CI9A 1KH2A 2IZ5A 1F0PA 3M9XA 4HAUA 4R40A 3UMMA 5DYGA 1W87A 5I4IA 1F0NA 1JB9A 1OZFA 2QSJA 3L05A 1IEWA 3CB2A 4KGDA 2O0MA 3IO5A 2O8FB 2BZ0A 3H9CA 2X15A 4HADA 1NNSA 2O23A 1CUGA 3GNTA 1CYEA 2BM8A 1IIRA 1EFKA 1T6XA 3H2JA 3KYDA 3O91A 3R3UA 3ZBTA 4YJGB 4YCLA 4NEHB 5AVVA 2NN3C 1CR1A 3VBCA 2Q41A 3WMRA 1ONBA 1OYVA 1X8XA 4JHLA 2ZTLA 5CDHA 3DE3X 3JQFC 1LK5A 2FKNA 2FPLA 3T3HA 2XKJE 2KX7A 1GRVA 3P45A 3VVLA 1EXWA 4IVNA 1DKMA 4G84A 1KDTA 1SUPA 4WNYA 5BR7A 3EVBA 1QGYA 4F8JA 2YUIA 4IOJA 5HMLA 4YRMA 2YYYA 4UUPA 1D8AA 2QTFA 4AJ4A 1M1YE 1MEJA 4CKCB 1DXOA 2WJYA 5ARBA 2C9CA 2XCUA 4ARIA 1MAVA 5K6AA 1F9EA 1GRNA 1WX1A 2AZ4A 4IQFA 4NENA 3EZFA 4R8KA 3G49A 3VR3D 5L3QA 1HEIA 1Z07A 4Q9JA 1WZEA 2PNJA 2JJ2A 3L8EA 3MQ4A 3IT1A 4BQFA 4B84A 5JNVA 3GEEA 4AF6A 5F76A 5FHRA 4IIGA 4JI8B 2ZIWB 1U2DC 3DXZA 4AS3A 1KYYA 3WQQA 4F4HA 1SVWA 3AX6A 4GOMD 1Z33A 2H4JA 5A4JA 5AK6A 1ZC4A 2YY6A 4TS9A 4ENVA 1TD1A 1W8DA 3LF1A 4HTFA 5DBFA 4R8SA 4EDHA 3IELA 3ABRB 4KAJA 2FJUA 4LHWA 3NKVA 3SYNA 1EZZA 2IIQA 4KE6A 3EVDA 3I34X 4CTNA 4YCMA 5DM70 4RIFA 4WDQA 4CZ2A 1E7RA 1VBMA 1CJTC 2BTEA 4C7VA 3LSYA 1U7WA 3QHQA 4EGQA 1CP2A 1SZJG 1U7TA 3ABOB 3PWTA 3ENVA 3STVA 4DDMA 3V97A 1MOSA 1ZQ9A 4JYAB 4ISCA 2X0KA 3O93A 5JD3A 5ALIA 1RYNA 4RABA 3OFVA 2JFHA 1FRNA 2GCNA 1J21A 3ORRA 4B87A 4F3YA 5C0OE 5KTNA 5D87A 1UP4A 5EE9A 3OC6A 3NAZA 3WMEA 3WYFA 1F6WA 4DXAA 3Q6NA 1YRLA 2NO0A 2IY9A 4K9RA 4BBZA 1EFDN 1R15A 3UB4A 2YZGA 1A72A 5BT8A 4E3ZA 2OL4A 4C5BA 3K6SA 2AWOA 2IV2X 2W9XA 3ZV4A 1Q83A 2GD1O 3PGXA 2PX3A 1YRWA 3SC4A 2EKPA 3FGOA 4FOSA 2XXJA 3JWPA 1R66A 4F9TA 3W9UA 1GTMA 4J07A 1CULC 1KNXA 4JQSA 5ALSA 2CT8A 5FI1B 3BIFA 4F93B 4YAUA 4R0MA 3Q6MA 3BMOB 1IN6A 1SOMA 3JR3A 2VTEA 1UBOS 1TZJA 2EFYA 8OHMA 3ME5A 3ZU3A 4I6EA 4MIKA 1ZI6A 2K2QB 3JVUA 5KU7A 4ZGWA 2HK7A 3L6RA 4XDHA 3PF9A 1AK2A 1OROA 4V0OA 2JFOA 1QUEA 5DSXA 2HTFA 3EXG2 4FI3C 5EXXA 3GB9A 3KLOA 4N3CA 2XUJA 4E4RA 2LIPA 3FTNA 2QJOA 5JCPA 2FLKA 1VSBA 1B2RA 1RPJA 1EFRA 1FRVA 2XTJA 3BULA 4GPAA 3VKUA 3VR6H 2PA3A 2QD4A 2XMRA 4N7JA 2DPLA 3RUDA 1H9AA 2LGJA 1OLSB 4NABA 3WMWA 3KLPX 1ZNWA 4XX0A 1CUVA 1JDNA 1VJ5A 4NBUA 4C4RA 2X5XA 1X70A 3S2YA 1DUIA 3NWBA 1J22A 4ZREA 1G21B 3C3AA 4XRGA 3AIMA 4WWHA 3L7CA 2J3MA 5JSHA 3PDCA 5LP6C 2XQFA 3VBEA 4Y1RA 4LDJA 1FU4A 5I01A 2E18A 3I9OA 2ARKA 3E22B 3ZE2B 1UR5A 4RTLA 1MCZA 3U49A 1PD1A 3DV0A 2VT6A 4RWZA 1Y5NA 4CQLB 1JKJB 3UV3A 2VATA 2YXEA 2Q49A 2GOYA 3H5RA 4K9OA 1NT4A 4PPQA 4RY9A 2G9RA 5JVDF 3BWBA 1EVJA 3VPFA 3Q4GA 1EP3B 1Q5PA 1OAKA 4N0QA 5AVOA 3B6ZA 1MB9A 2I6XA 3QKSB 4JQOA 3V1NA 3P2OA 1WXWA 2WTAA 4QQFA 5E8RA 1BHQ1 5HF6A 2H08A 1H6CA 4DYDA 2QD1A 1O94D 2BFBB 5HCUA 2WJWA 3W0LB 1D7AA 1T9CA 2H59A 2C77A 1HRDA 1NE7A 3V7FA 5IVPA 3FJ1A 2SICE 3HYNA 5E1MA 4MDFA 1DC8A 3RRZA 3MINA 1OBOA 2HC9A 4G6ZA 3Q2OA 3BZWA 4CEHA 1QBGA 3L84A 3R7NA 1AHHA 3E5RA 1ULAA 2B0JA 3VKGA 5JNLA 2AJBA 4AM8A 2O8DB 1YDHA 4DJ5X 2IOFK 5BORA 2ZRQA 4QZVA 1JU4A 1YVPA 1ZWLA 4GW3A 3MJFA 1Y4AE 1YRHA 1OF1A 4HQNA 5DP2A 5J2TF 3T5CA 1XBTA 1N4AA 4E5VA 2QSZA 3I0NA 4WVFA 3RYCA 1ZN9A 4RH3A 2HRDA 3ILVA 4KK4A 2O57A 4KR0A 1SHLA 3P0FA 2E3JA 4JA2A 4C0WA 2XQVA 1DCTA 3P5SA 4M8SA 3ZCRA 1WVMA 3FX2A 2YWDA 3V4SA 1K7XB 5D5PA 4J2TA 3U4QB 4R8RA 1HO3A 4BJHB 5CFPA 4ZIRA 4F8YA 2JI7A 3MS2A 4MGYR 1ORVA 4YRPA 1NRXA 5KYTA 1RP7A 1G4UR 3H16A 4G0PA 1B8OA 4HWRA 4ANFA 2HHJA 1U7PA 1N5RA 1U7UA 3H5OA 3L8FA 4G85A 5EIBC 3SEFA 4DLLA 1XT6A 5KB3A 3VJRA 4PIPA 4RZUA 4ZI7A 5FWNA 3TG8A 1M34A 5DI3A 2H8KA 2OSBA 2ANCA 4JQCA 5B2FA 2W2XA 2VQFB 4DSTA 1UMCA 2F4VB 3AFGA 5T6BA 3TMKA 2NUTB 3SE0A 4DMLA 2QX4A 4ZCIA 5JUWA 5JADA 3RLIA 1JLKA 4N4AA 1E3LA 2QN9A 2VJQA 3RYTC 2MSEB 3QYAA 5IUNC 4K9MA 3F2VA 4LNHA 1FUUA 1GQYA 2VWGA 1KI6A 4D0GA 2DBVO 2J59A 2O59A 3EGIA 2JARA 2WKPA 2ZAYA 3AB3A 3ECCA 3SQDA 5HUHA 4DCOA 4I1UA 1XDWA 5CTAA 1Z37A 2OXIA 5EJ5A 5G1NA 4EY5A 1Q91A 3DE2X 3KJNA 1V16A 1KOJA 4GGPA 4WXEA 1KYTA 4DQUA 1RRPA 4LTMA 1GAWA 3UJ3X 4BNJA 1QGUB 1P9NA 3S28A 4ZYTA 1JLRA 2ACVA 5DO9A 5FA8A 2DBQA 4FBLA 2CBZA 2VP5A 4MCAA 2AZDA 3JQ8A 1RABA 3H2ZA 3N0VA 4HMQA 4HWKA 1RFGE 1P3Y1 5CHEA 1ORTA 5DWDA 1PV4A 5JHHB 2ZUTA 2NO6A 5JECA 3F6PA 3BG5A 1R0ZA 4FOPA 3WMGA 3O4VA 1ZRNA 3C16C 3SJAA 3IP9A 4D6PA 1OW3B 2JIZA 2HF7A 2EG5A 1RU3A 3CF0A 2JGAA 4WZAB 4OYHA 1NX9A 2BEWB 3E6AA 4E08A 2C58A 5DCYA 4D9HA 2PH5A 3B20A 3EVTA 3MBIA 3RSCA 4AVYA 4EYEA 4ZYYA 1WD7A 1ZUNA 1KY2A 6AT1A 5EPEA 1YKFA 1XOIA 2Q2QA 5ALLA 1AJEA 3LNCA 2WT9A 3TFWA 3JZMA 5DXAA 2E5FA 1ORIA 3G2PA 1PUXA 4AY3A 2E48A 3HZZA 3LK7A 1PFQA 4BEBA 3RVBA 1LBEA 5GWXA 4EW2A 5BRAA 2FJ0A 1L8OA 2VJCA 5F52A 4ITRC 3CRVA 3SOZA 3TEFA 1P8AA 3WJ2A 4RLHA 4DBZA 1N2CB 2VQSA 5JI2E 1NG9A 3AP3A 1K97A 3AR8A 3F7OA 4P3OA 2Z6QA 4IILA 2HIGA 2P6OA 3NRCA 1XTKA 4U7PB 4CLDA 3RYCB 4LMRA 2FMKA 2C4NA 4X3CA 2XNJA 3HRHA 1RKQA 2BVNA 2HW8A 3QEMA 4EA9A 5BWOA 4BNLA 3F5SA 2V58A 5LZ7A 1VHQA 3BGDA 3N2YA 3EPRA 3PQ2A 4B6PA 4FHCA 2J8ZA 2KLBA 5LQSA 3R8CA 4AP5A 4QULA 5ENDA 1E9VA 4ZIRB 3BGOS 5ALRA 1L0BA 3J7TA 2P3LA 2XT6A 3EH1A 1M2KA 4PCUA 2C20A 3QXSA 2O3QA 4OHXA 1ISIA 3E61A 3L92A 1IZ7A 3FPAA 4EYKA 3PHIA 3EIXA 1HDCA 1R12A 1CJSA 1IAQA 1V1RA 2D0OB 4OM7A 5D8DA 1G98A 1T29A 1YS9A 3PB3A 4K8OA 4L07A 3D1JA 4OUDA 3GNSA 3PPIA 4X60A 3RSLA 1NN1A 4ZYLA 1JKMA 1Y1KE 4YPOA 2I55A 2Q2WA 2FPPA 4O4IA 1THGA 1LBIA 4R6WA 2W6JD 1M8PA 3FDZB 2O48X 1QWSA 1IOWA 2FZKA 4PPNA 4G0WA 2FY8A 2HMWA 4NARA 4BLOA 1ORRA 1NOJA 2HK6A 2LTAA 3O8DA 4CKCA 2C42A 4OHCA 3VU9B 4AJKA 2Q5JA 2WOJA 1OA0A 5CLLA 4QAQA 4MR8A 2XIQA 4HDOB 4YLEA 2VNAA 4D25A 2H11A 2CNDA 1BOFA 5IF9A 3ONNA 1ESZA 1WP4A 2YNMC 3HFJA 4TV8B 2ORWA 2CSXA 3C43A 4A03A 1E9CA 3WL3A 2H2AA 4KPGA 2OQIA 1PT5A 4GMHA 3C3WA 1VG8A 1E89A 2EFCB 4QPDA 2ZJOA 4P5PA 2ZJ6A 3LXUX 5EE0A 1WQ1R 4LCEA 1N6RA 1NXVA 1R8QA 4MA4A 4WT7A 3T0IA 1HLDA 4XQGA 1NJ6A 1CW2B 4DSZA 3KR9A 2OO5C 2WMYA 4LJ7A 3JQQA 4I55A 5J3JA 1P1JA 1KO7A 4LBYA 3W90A 2XVMA 3FPGA 4TOIA 1GADO 4WZAA 4L6AA 5C34B 2H3HA 2Z4TA 2QL5A 5J5AA 3R9KA 5MN6A 2O8EB 3RK1A 3VGJA 4EVQA 1GU1A 2WA2A 1H65A 1FTWA 3LQKA 2G5GX 3TW8B 3H5TA 1CHDA 2Z9DA 3DPSA 3DFMA 2VDLB 3O95A 3TMYA 5IX8A 1GNPA 3AXTA 3ETGA 4LYAA 5H02A 1XZBA 3IMKA 1GSIA 3KSDO 4LQCA 4DC1A 5DN6D 2MYNA 3OQ1A 1QX4A 5DNEA 2ZYGA 3O8QB 5JSYA 1UEIA 4MGKR 4M7WA 4R6XA 1T3TA 1SCBA 1WPRA 2JFZA 1YS4A 2PX8A 1ZGJA 4G5HA 2JW5A 5LQJA 3CRQA 4KKVA 5IDXA 5BR1A 5LQUA 3ICQB 3HJRA 1E2DA 2WLTA 1SBIA 2DY1A 3OZFA 4EHJA 2F1RA 2PSFA 4C7MA 1OJ7A 3NFYA 5IP5A 1Z2AA 2H4YA 5ICEA 4RTNA 4OXYA 5KWEA 1M2OA 2D0IA 1WDWB 3EXAA 1OU4A 1SU7A 2JPDA 5J40A 2VJPA 1WZIA 1NXOA 2O6LA 4H31A 2D2EA 2PWBA 3AUTA 4L4XA 3UCEA 5K3BA 1C7ZA 2BMAA 3UGQA 3OIVA 3HMQA 5A9RA 4EW6A 5KX5B 2PSHA 2FJPA 1EGVB 2QBYA 2Y1OA 3AKYA 1UL1X 3QE9Y 1JMKC 1GAQA 3R0XA 5AVZA 2WVAA 1DKUA 2AS0A 4DJJA 3ZWWA 4I4TF 2JI4A 2JD1A 3FETA 1NKSA 4HH1A 4M9XA 1K8YB 1JBKA 2Q8QA 3MT8A 4OQNA 2J3JA 4PLHA 3CSUA 3DDUA 2C4KA 3IBYA 3IALA 4JVOA 3SJBA 3B1WA 1HYQA 4YIHA 3SHVA 4F96A 2ID4A 3OH8A 1Z26A 2WW8A 1KS9A 3H1GA 2AKYA 4ZQHA 3PXEA 2XNDD 1GP2A 3D4PA 3AW8A 3TZBA 1JW9B 1EWRA 1WP9A 1C9DB 2WINI 4HXGA 4WSOA 4BGUA 1Z6QA 4YMLA 4BC1A 1TAGA 3E3NA 4NE7A 4OI0A 1XF9A 3P8ZA 2VSQA 4DR1B 3OEEA 2XVAA 1JIXA 3NCTA 3QYFA 1KIFA 4B0OA 1JHRA 4K6OA 3ZEIA 2K2WA 4FMDB 3H2YA 4DW8A 1E77A 2QE7D 3TAHA 5ALQA 1UOOA 2HU7A 1VB3A 4L8YA 3BE5A 3NORA 4HNRA 3I3OA 3HYCA 3GFRA 1O6CA 3H1TA 3Q3JB 4IS2A 4KMSA 1E6EA 3OT4A 4F9GA 3MTQA 1SK9A 2WZBA 1DX4A 1I9CA 3PRJA 3M89A 4LRSB 4UHFA 4WBNF 5GZ1A 5IARA 1PEDA 1LK0A 1H0RA 2IHKA 5LL6P 4ALIA 5CMLA 3T1HB 3A58B 4IIBA 4S1OA 1S01A 2GCPA 3LS2A 3G89A 4RHUA 5CLHA 4BFXA 5JDIA 4RFVA 3BHMA 4W5TA 4CKBB 1ZFNA 2YZNA 5DASA 4E2YA 1T6NA 1RKBA 1QRSA 4TKVB 3CO0S 5C18A 3GRAA 3ZXIA 1F20A 3A9VA 3ZYCA 4MMYB 4XASA 4I99A 2QR3A 3CB4A 5TS3A 3ZI4A 3FOEC 3PCRB 1C30A 3UWSA 4WJLA 4AB1A 3ONVA 3Q9NA 4GXNA 2GN6A 4KQ6A 4WZAE 5DVZA 2JGLA 1V2HE 4B44A 2W42A 1XC7A 3GYGA 1QFSA 3ZV7A 1PNRA 4XARA 3OLVA 1TMGE 5AVJA 1BXKA 1G5QA 3MUNA 3NETA 1N8NA 5HILA 4FR2A 4PYNA 1YQ9A 5KNDD 1USGA 4J4BA 1QYXA 5BXYA 1Q44A 4KZPA 4P93A 5A5EA 4BO7A 3JWGA 1RHJA 4MWOA 2OAEA 5KEIA 4U02A 2Q0XA 2XTMA 3RAPR 3PXUA 1A82A 2COKA 2W7TA 4TRRA 1O0CA 2ZT5A 2ZTHA 5AI6A 5BMOA 2N42A 1H23A 4QOSA 1QVAA 3UWKA 1S2NA 1V5EA 2EFJA 4UU0A 4A6PA 2XWSA 3FH0A 4GECA 4H0NA 4L5CA 4BFTA 4IYRA 5FOSA 3VZPA 3IDAA 4HR7A 4BKRA 4V3CA 5LMNB 3GLHE 1NM5C 1LJ8A 2IF0A 3AESA 3WGYA 2B78A 1XDSA 1O97C 1BU8A 1L4FA 4K0RA 2QRVA 3K5IA 5ALVA 2IBTA 2J6BA 2AEFA 1Q19A 3RC7A 1UPTA 1X7YA 4Z4EA 1WXIA 3DDNA 4OBBA 1UAYA 3V2IA 3GUCA 3QEKA 1CUHA 4O4IF 1IMOA 3DAYA 1V9LA 3G9QA 3RAFC 1NFQA 3HXKA 4GYWA 4BVGA 5FORA 2I5PO 3IAXA 3GEBA 1YQXA 1JXQA 2J0VA 5CDGA 1V48A 1IJEA 3IJRA 3TGPA 1LVUA 5HFAA 4US2R 1ZMTA 3EVGA 4ZYZA 4RV5A 5CIWA 2X3YA 3GLGE 4IZOA 2OO5A 1NC3A 2C61A 2WHEA 1U0HC 2Y0DA 4NICA 5EUQB 3TOSA 1DOHA 1ZICA 1E2BA 4DY6A 9ATCA 1D6JA 1K0FA 1J7JA 2QRNA 1XTSA 1RLUA 3PPXA 4V0SA 3LBAA 1UM9B 2JLCA 3W4KA 1FBNA 4X62B 5JTUA 3DMNA 3VA7A 2LV8A 4XWTA 3WR5A 3F8SA 1EDZA 4RJJA 2AYYA 4CCSA 2X3FA 5U4QA 2GPBA 2QY9A 1PW5A 3AINA 4RDCA 4A10A 5K6RA 3WWZA 1JR3D 5CNMA 3WWEA 2GPWA 3MN1A 4EO9A 1M2HA 3R3HA 2W4MA 5K3AA 3WFJA 4X1OA 2R79A 3EC2A 3CNLA 3RNOA 2Y1EA 2RB5A 4RVHA 1N3LA 3N2GA 4AJPA 3VVBA 4Z49A 3WNCA 5G0TA 4NATA 1ESDA 2P11A 4PZUA 3MILA 1DT3A 3STWA 1DJMA 2GJKA 3ZTWA 3VR5A 4G65A 5I9SA 2HQRA 3HS3A 3IPXA 4ZVMA 1MVLA 4ND4A 3K31A 4L22A 3G7SA 1UAAA 1J42A 3NHJA 3M1YA 2BISA 5CLJA 1QO7A 2Z56A 1HURA 1QC5B 1T1GA 1JUDA 3ESCA 4H7DA 4AMZA 3VAZA 4W7HA 5A7GA 1BKSB 4KRYA 4U8GA 3E9ZA 4A8PA 1FS4A 3BSYA 3JVIA 3L4EA 1QKIA 2BDUA 3PRKE 5DEOA 2IXGA 1LI7A 5HTOA 1BDJA 2SCUB 2OFXA 1FE8A 4Q9HA 3ULKA 1QE5A 1JAIA 1USKA 1VBNA 4QGHA 2VRNA 4TTAA 4ZOCA 5DM1A 1VSQA 3TKYA 3V46A 4JC5A 4BP9A 2W0MA 2IV3A 5M2QA 1JQKA 4OX9Y 1VRWA 1QS0A 5DGXA 3WY9A 5EZQA 3GVIA 2MSDB 4CN8A 1UBEA 2BGMA 2ZIFA 3BGWA 2FR8A 2BGUA 2C29D 1H2HA 3I1YA 1W7AA 1UC8A 3RGGA 4OXRA 4DA7A 5IW8A 4KGVA 3QLEA 1E8DA 5CTJA 5CFNA 3LVRE 4B74A 3C7KA 4B9EA 1Y63A 4RMIA 5A03A 1ZY2A 1XU9A 1RBQA 1G20E 3FRJA 1A76A 2HREA 5EJAA 1RWKA 1YR8A 4KXQA 3TR6A 2CMGA 2V6IA 2A4KA 2CLHB 2I71A 3GHHA 2OY0A 2W2OA 2H85A 3ETEA 4O02B 4MITA 1J2UA 1HF3A 3IPRA 4K6FA 3A3PA 1P5JA 3DF7A 4EJSA 2AXQA 4IXWA 1AKVA 2JHPA 4OFZA 1YQTA 1Z18A 3QV1A 2ZG6A 5CM9C 3S8MA 3RODA 3OOEA 5K3FB 3WIDA 2EEZA 2FFJA 1CUBA 5KKNB 2UYOA 2H51A 3U60B 2PZKA 5TB5A 3KR2A 2YWJA 2HUNA 2CXTA 4LF8B 1SCAA 5FNVB 3U2QA 5EFZA 3RYIB 4ZJZA 3LGAA 1G5FA 2OPHA 2YXNA 3HEAA 3KSMA 2NP7A 4GLJA 4L3OA 2RDMA 1KYVA 3GYBA 3H9QA 4IAOA 2FWJA 4O1IA 1HDXA 2NO1A 1VXOA 3OZWA 4GXQA 4LNUB 1XZCA 4I9UA 4OL0A 2ZJZA 5AJUA 3BIXA 5ES3A 4AX8A 4F12A 2FW7A 4AK9A 4FCVA 1KKMA 2E9SA 1CR0A 2FWBA 2OOKA 2DAPA 3GLRA 4ALKA 1QOZA 4H7JA 4JI0B 1EYZA 3JALB 2A4MA 1Y42X 3IAM6 1MMFB 4MS3B 4MRMB 4O2AB 1N6LA 5C32A 1B3BA 4PZZA 3U3MA 2QKYA 5K3EA 3KDPA 4CMKA 4OQFA 1EXVA 1NW9B 4EITA 3ZJ5A 1XB2A 1XEXA 2OILA 2QU7A 4HXYA 3I2FA 5CURA 1X77A 5C31A 3WB9A 2GRAA 5IMSA 1M5RA 3MWGA 1QSGA 1RXCA 4UVGA 3CLKA 1N8TA 2JRCA 4G0MA 3VTKA 4MO9A 2REQA 3PGA1 4YH1A 1XPUA 1V3UA 3HDJA 1EWTA 3W4JA 2Q9BA 1FIUA 4FBGA 1R6XA 4GKAA 5ALGA 4R7ZA 3MBKA 1FXWA 2BUAA 1CQIB 2AZXA 3DDWA 1L7MA 3HYLA 4IXMA 5BYAA 2C54A 2FX3A 3R5HA 5DISB 4MB6A 1HNNA 5JXHA 2ONKA 3KVYA 3OA2A 3EULA 2YZMA 3F3MA 4WZ6A 1C3LA 1AZWA 5GTDA 2V55B 3IXLA 5GIOE 4FYYA 4OIFA 1VG1A 3DBHA 1RZVA 3RVPA 3A10A 2IHNA 2GZDA 4MJ7A 4EY8A 3MXTA 3QP9A 2D59A 1ANKA 1R50A 1SURA 2D2IA 1R6UA 2D4HA 2IOYA 1H8EA 1HT2E 2QQ0A 2FDXA 2XT9A 1FFYA 4QRHA 3HKDB 5NLLA 1H8ED 2TS1A 3LLMA 5H0IA 2W2MA 2WD7B 1UDCA 3KC2A 4YCAA 3BXFA 4DWWA 1NP7A 3WYEA 1KY4A 5B6PA 1QDLB 4IIJB 5ITVA 4EG4A 4MRSA 3RW9A 3RADC 3L0YA 3A4TA 3GN2A 4EB6A 4HGRA 4KLRA 2NTVA 2H29A 1LDMA 4KN5A 4PXSA 1VJTA 4ND6A 2NLOA 4KVZA 2I03A 4Q1VA 2QX6A 4UMDA 1K3UB 3WNVA 1FSPA 2BPOA 1XAJA 3C3JA 1Z4IA 2YRWA 3HU3A 3CZPA 1LF5A 2GXQA 4QDKA 5JRDS 3IVRA 1A4UA 3FBTA 3M1AA 3PUKA 5MN5A 3GAAA 3ILSA 1VL8A 2VNHA 2PRYA 2VPWA 1MEOA 2E6UX 3D0OA 4N5NA 1L1FA 3WZLA 3AUXA 4ZEVA 4X85A 1J2TA 4AULA 2PUFA 4W5NA 1C8LA 1JB1A 2UVPA 1FP4A 2V5AA 4FGWA 3I61A 4R71A 1X8LA 1KO4A 5ALUA 5B12A 2RGUA 3ASVA 3CIOA 5L3SB 1NWHA 1ZITA 2YVQA 1JA9A 2C5FA 1JHZA 3QITA 4QEZA 4X20A 5DSZA 4EG0A 4FNGA 5F9HA 4RM3A 1EUZA 2X5KO 3BH7A 1MQ9A 1PI3A 2N46A 2OGZA 3EEIA 3MTBA 1YK0A 4NZZA 4OJQA 1JJ7A 4YVFA 3WWOA 5CLGA 1XMXA 4HGZA 3DLIA 1P9LA 5CVCA 3AFIA 4K6GA 3NDBB 1YNOA 3ZIAD 1E9BA 3G17A 3R24A 3WQSB 5F1YA 4E4YA 1CQXA 1JEJA 2YWHA 2FH5B 4CVNA 2NO5A 2WAMA 4UNNA 5EHQA 5BSVA 3EMKA 5I9LA 2YXPX 3K5HA 4NNJA 3TQIA 4H6PA 2UZ3A 4PLYA 4YRBA 2ZBVA 2C95A 3CFYA 4BO8A 1CK4A 2C4HA 2CK3A 1MN6A 2TYSB 1JEYB 1I4LD 1Y5MA 3LWZA 5AKYA 2P7IA 4CMIA 4Q9LA 5KHLB 2R97A 5FL7A 3T7TA 1VA5A 1BRMA 2IZ0A 4GX0A 1W5EA 4QDTA 5DTJA 3NH6A 3UUFA 3SJZA 4BZZA 4NMLA 3GFPA 1NXWA 1Z82A 1PGPA 2HF8A 2JZNA 2VL7A 3RVRA 5J2UF 5HKOA 2HU2A 3HP1A 2AR7A 5DJ5A 2XWPA 3FIJA 1FRQA 3KJGA 1V7PC 3E15A 2BM1A 3AOGA 5TMDA 1MAUA 1ST3A 3RAJA 2VRBA 3VNSA 1H69A 3TUZC 3HBJA 2H1HA 3DMRA 2VT2A 1S9DA 1GL9B 4BJ5A 3D2LA 4S0XA 3RLFA 4BVKA 2CMKA 3CSSA 4HL6A 3AWIA 4QPCA 4U2GA 4WCVA 1MT0A 1L1QA 2NADA 3TRDA 1CZLA 1QHFA 2WDZA 2BI4A 3VV2A 2DKFA 4A8JA 3JR7A 3PR1A 3AR6A 4E88A 4DCMA 2QVYX 4II7A 1NQUA 4JJ6A 4M1EA 5TQVA 4MX8A 4TLAA 3UJAA 4MWEA 4XIGS 2JLVA 4DR6B 1KJ8A 2G8NA 3G2MA 2C0QA 4Z9YA 3U3DA 4CM3A 1AX9A 3DTYA 4IO0A 5AICA 1A8IA 5GV7A 2GNAA 2R7NA 5M5BA 4XYEA 3M83A 3I8OA 4HEJA 3KG2A 2K7FA 3R41A 1COZA 1R9GA 4HUJA 5J43A 3R6DA 3PVZA 3I5MA 1N2CA 3ZWBA 2Z3WA 3C3MA 4YJFB 3MPUA 4NEGA 4RTSA 1DKLA 4MQFA 4H77A 1CEXA 2EJWA 4TT3D 3T7EA 3ZWOA 3TZKA 2H2DA 4ZT5A 4FILA 4LXGA 4LXXA 5KDLA 3TMAA 2BI8A 3BA1A 5ILQA 3PC2A 4QNNA 1T3LA 2CB9A 4CMBA 2OHIA 2JGNA 4HQLA 1JQJC 1LJUA 1W59A 3ONEA 2XGGA 3RU3A 4UUOA 1A27A 3FTCA 4XGNA 1GFSA 5IULC 1VE9A 3NATA 4EYOA 1XCPA 5HIJA 2WVHA 1L5FA 1GNTA 5L3SA 1JKIA 1XV5A 3FZQA 1PS8A 1DRVA 1JKFA 1ZL0A 3EMBA 3JZFA 1T3GA 2MTBA 3O26A 4K2AA 2ZTVA 4V3BA 2JAXA 3NZEA 4EELA 3KKNA 3ZDRA 3QOXA 4KUHA 3VISA 1U6IA 2O1EA 1IBMB 4TTVA 1GILA 3IKLA 1BCSA 1UKZA 3R9XA 2D5IA 3ZK8A 3M81A 2M32A 2GF2A 2C2BA 4D8UA 4NJOA 4IY1A 1XTVA 4DRXA 3N0XA 5ARDA 5FUMA 3A6PC 1N33B 1PLLA 1HOXA 1GAEO 1CIPA 5I9NA 3EXG1 2JAHA 1W36D 3R40A 1ODCA 4W8HA 3TI7A 2UZ0A 3K4HA 3VR5H 5IZ4A 3QPVA 3LRTA 4BXOB 1NMYA 1QVVA 2HX1A 3R5FA 5F21A 2Y1FA 3QH4A 4GU5A 5CEEA 4Z9AA 1WULS 5K9ZA 3Q98A 2VDVE 5BURA 2X5OA 3L79A 4Q4AB 3G2NA 3FFAA 4PBSA 2OCYC 2W6PA 4Y6SA 3THYB 1QYCA 2B25A 4F3CA 2X19A 5LA6F 4KR7A 3OF2A 2XWQA 2FUG6 1YZUA 2VJKA 3C3BA 3CR7A 1AF4A 1R0LA 3MWEA 4YR9A 5L3ZA 4F9EA 4D41A 2W2KA 3GMSA 4QL3A 3C98A 2ZQZA 1U3VA 4B3BA 2H1IA 1L4GA 3TRJA 4R54A 4DV2B 3ICWA 5A1TA 2QTTA 2ZBGA 3MTJA 1YTUA 2Y92A 3FLEA 2GD6A 4RETA 3NT5A 4DDWA 5ALYA 2X8JB 4TVKA 3TIVA 2M2IA 1UBUS 1D6SA 2B3DA 2RSLA 2WF7A 1XL1A 2XDQA 4EKDA 2F43A 5HRCA 2GFQA 1AN0A 3AEQA 5COAA 1KEWA 3SFVA 4NCAA 1LI5A 2EW2A 3I9JA 3W5DA 3AU8A 2GPTA 4RYDA 1MTOA 1M54A 2RAUA 1PGNA 2ATVA 2ZPTX 4MUNA 1PUJA 2RC5A 4IDDA 4XVRA 2ESRA 3E2IA 3PUXA 4JXZA 1KS2A 4TXJA 4V0NA 3CEHA 4U3JA 5HE8A 2A5DA 2I91A 2ZJ2A 4TRMA 1HMYA 3RHFA 3EYAA 3N2EA 4ZK6A 1Y4UA 1NW3A 2TECE 3P2YA 2A59A 1G0OA 4XUGB 1Z08A 4QEDA 3WMXA 4BL5A 1T2FA 3HB4X 3I37X 3LHDA 1C7IA 1IJBA 4ZU6X 3ZW9A 2IY7A 4EHDA 5FOQA 2BE9A 3IDZA 5HM6A 3LQFA 1KJQA 5TMEA 4RDXA 1GZ4A 2VYFA 4L72A 3ZZTA 5A7FA 4B2LA 2PWAA 3BAFA 4PGFA 2HCRA 1X19A 1XQ6A 2AHOA 4IZ6A 3SEAA 3DQPA 3OLQA 1RVDA 2HD4A 2EZTA 2OBNA 1YBAA 2O2IA 3P7MA 4D5GA 5AKJA 5ENVA 5KI6A 1HE3A 3I6BA 3PX3A 1WB6A 4V38A 5EIXA 1KI7A 2O20A 2OVFA 4HX9A 4HYYA 4W9NA 3QOYA 1RBYA 3T3GA 3DE4X 1IY2A 1RI3A 4IWNA 4ES6A 4HDCA 4LI3X 1KC3A 4A6XA 4UM9B 4QXAA 5K8LA 2PXCA 1FVHA 2EP5A 1KMCA 3IPLA 3D4NA 3E7PA 4LY9A 5HF9A 1G21A 1EQAA 1WDLA 2E85A 2O50A 3UMCA 1HEYA 2PS1A 2BFEA 1ZJ6A 3EZGA 4Q1AA 3R7BA 4G0XA 4TYQA 3QPCA 3SIRA 4A2WA 4F3NA 4AJLA 1NURA 1IOZA 2D1FA 2FP4A 2JH3A 3EASA 3PX2A 5HCIA 3PI6A 4TTPA 1CZKA 2FDRA 4KR9A 3R8XA 1WS6A 4Z9BA 3WLPA 2VK4A 1XI2A 4ESHA 3T1YB 3EVCA 4JDPA 4MW4A 4NMHA 1RTTA 3AF4A 3STTA 4QUAA 4ROTA 2AKAB 1ATZA 5EFOA 2IITA 2GUGA 1QKJA 1TOAA 5I47A 2V97A 5JCOC 1VYVA 3QG5A 2BR3A 3DLCA 5EMKA 4E1AA 3BN3A 3WBBA 1UKVY 3AJEA 1Q1BA 1ZNQO 3IDSA 1WXDA 2ZYTX 4ZZ0A 1C3OB 1E4VA 3QWBA 3NV7A 4AKGA 1YBVA 3GLFA 2LCIA 4V0ME 1PJ2A 4XZ3A 3HXLA 4HAIA 1KEUA 3VZBA 1C3XA 3IOBA 4LZLA 3U4CA 4FGZA 4FZVA 1UJ4A 4TUYA 4EK9A 4CEHB 2P30A 5T3YA 1CDDA 2AUNA 1RC0A 3O3CA 4PNPA 5AKHA 4HLQB 1BJTA 3VH1A 5CUQA 3OJWA 5DV9A 3F74A 5TX7A 1RQNA 3L1UA 4A9AA 5G02A 2B2NA 2C92A 4LISA 2ERYA 2V54A 4MQEB 4OHWA 5H8WA 2WHPB 4ZVLA 4NOLA 4RCYA 4ZEXA 2F4NA 2IIPA 1B1AA 1ZC3A 3LRXA 1JALA 3CF2A 1AKRA 4RTKA 4C14A 1CNEA 1QG2A 1T0PA 5A4FS 2DTXA 1W52X 2SKCA 3L7LA 1I3CA 1TA4A 1USVA 1U3FA 3WLFA 1VRCA 2OV3A 2LNDA 4D98A 2VA8A 1CUSA 1WBJB 1NF2A 1Q57A 1Y82A 4LY6A 3MFQA 3P26A 1HNWB 3DKKA 4AAYA 3O73A 1TU4A 2GTIA 3OX1A 1IVNA 4YLYA 1IVSA 5CW1A 4ZVNA 2G04A 1IN7A 2IUYA 1FB5A 1R5NA 3P0JA 3UJNA 1YDFA 3KDSE 3G1UA 1EM6A 2CBGA 2QMQA 4JJAA 3U9LA 4LDPA 4KRFA 3BCHA 4NULA 4D9FA 5IK2D 2PT6A 1FMLA 2O7NA 4XB2A 5EZ5A 1QPGA 3PXCX 4FB5A 3I42A 4B7ZA 1FVXA 13PKA 3LUKA 1GGVA 2GARA 2WM8A 3LBNA 2EXXA 3NJ8A 5AI9A 3SHFA 3U48A 3V1MA 4DSUA 5A6SA 2DP4E 3O2NA 3ZR4B 2AFVA 3M49A 4PANA 3D6JA 4AJJA 8AT1A 5C1OA 1ZN8A 2PH1A 3PC7A 1AM4D 3H0EA 2WNSA 3MJVA 2A1UB 2GA9A 3IQEA 2BGKA 5F73A 4CNBA 3CNQS 5CEFA 3B6JA 5FBQB 3HO1A 1DXHA 1UFRA 4PWZA 4TSKA 3STYA 1S2LA 2C8VA 5BQ3A 3MCWA 1U0RA 3VSAA 1XJ5A 3A6JA 4XYBA 2V0GA 2V6FA 2O8NA 4I81A 2MSCB 2E89A 1ZPDA 2RHMA 5CXXA 2QLNA 3C5WP 1U2SA 3E1SA 1AQIA 1M74A 1FVOA 1WCXA 2AW5A 3DMTC 2AMYA 5DHUA 5FOXA 4EHFA 3L3BA 2J9RA 4BTVA 4XD7D 1V47A 3CJTA 1SQ5A 3ZE9A 2OOSA 1XA3A 2PGJA 1V8DA 1THMA 2GCOA 3HA5A 2EJVA 3MTIA 3SR4A 1JQBA 1YFLA 1G1AA 2OV6A 5DX8A 1NR5A 3SWWA 2VJBA 1KEEB 3BGVA 3IBCA 1W1WA 1YO6A 1I5EA 1G5RA 2L0XA 2XADA 4WQMA 1KJIA 2C2WA 4JR2A 5KHOC 3Q3IA 4Q7JB 2JDID 5DTMA 3HU5A 5LLSA 2DWQA 3K70C 1TU3A 3OCVA 2GPJA 1ZVQA 2BIFA 4E5PA 4Q6WA 4ENWA 4Z54A 2YN2A 4K8RB 1NV9A 1CUAA 4D3DA 1RPZA 4EJFA 1CRQA 1WB5A 3LD9A 3LF2A 3TKAA 3TM4A 4XWKA 4JI7B 5HKKD 2IOFA 3EIUA 2IEIA 3UICA 5AW3A 4AF8A 5IT0A 4KN6A 1WDTA 1MH1A 4JJ8A 4M86A 1OBVA 1XZAA 2JNWA 4BOYA 3DT6A 3K1AB 1ZA1A 2PZ8A 3FM9A 4JUAA 2JHCA 5AW7A 5JXJA 3MW8A 2I7VA 2NXCA 4R3UC 2I9PA 3PT9A 1EVLA 5TGTA 1YCHA 3EFHA 2POCA 4ARSA 3ZY6A 3AKDA 1CSEE 1AB6A 1PJ4A 3EE6A 2Q28A 2ZAIA 3PLNA 1OC2A 2VIIA 3ZJVA 2VAPA 1PFVA 3WDLA 4X1YB 2WAXA 4QNMA 2P7HA 5GZ6A 2ADFA 1QIFA 2WK1A 2B4AA 2OD9A 1X2BA 2JCVA 2E4AA 1EFCA 2QW0X 2V03A 3ADKA 3I6IA 1ZN7A 4KX5A 4P92A 5A0FA 5SV2A 4N03A 3PXAA 1COWD 1KNQA 2GZRA 4GMXA 2ID7A 5CM2Z 2Q8PA 5AHOA 4D6YA 4EO4A 2FWPA 5JH7B 2AXNA 2JD0A 5FLXA 1VB5A 3PCTA 3RIGA 4BN4A 2X0RA 1Z3IX 4ZVKA 3QJ5A 3ZGNA 4JLMA 3GFQA 4I8XA 3HCCA 1TAQA 3HCBA 4MVXA 5EQJB 4LSMA 4F3RA 5FBRB 2AG5A 2JFVA 2RHDA 3D6UA 2WYUA 5EZSA 4A4DA 3R9XB 2EFGA 1ODSA 3PWSA 4DVGA 1U3WA 2ZM5A 1XDGA 4MVJP 1F1BA 3N0TA 3DM5A 2AFIB 2YHIB 1JLSA 3EIWA 1R9JA 2DUJA 1VSUA 3ZWYA 4QE3A 5A3QA 4BQSA 3TECE 3V6MA 2A8YA 1CQPA 1YA6A 1ZL2A 4OGKA 4N0EA 2EWVA 3KSBC 1MDFA 1QONA 4PFKA 2C98A 4D74A 3GZNB 3U3JA 4W5RA 3PX7A 4H08A 4J0FA 4FSXA 1D4OA 1DBSA 4CQLA 3S6JA 1OBHA 1VPEA 1DARA 1G6HA 5LD2B 3T0FA 3WHLA 3JQFA 2HTEA 1EEHA 5DEIA 3DZJA 4DLAA 4TLCA 4DIMA 2C2ZA 1Q0UA 4GRIA 3LY5A 2JCYA 1W36B 5LQRA 1H3FA 1YI8A 3L40A 3DXXA 4AUKA 3NDJA 3DZCA 3RVLA 2J09A 3CONA 5EIAA 4FYIA 3RS3A 3ISVA 1T5TA 1WL8A 5T8KA 1P6UA 5IUKC 1W5TA 2GFIA 2EF0A 3CUEF 1HETA 4HGOA 5A3SA 3TLXA 3NPMA 4MUYA 4CFZA 1ML3A 4JT9A 3SCZA 3OQOA 4P7FA 4MAAA 1W6UA 5BYJA 5DNAA 5B37A 3S1SA 3N6XA 1UODA 2ZT8A 1SBQA 3C45A 5E3IA 4OYYA 3USCS 3QSYA 2PZMA 2BFFA 5DE3A 2PAAA 4RU1A 1IDN1 1AHNA 3FA2A 4KXXA 1QZUA 2EKBA 2HJRA 3V2UA 4HATA 5U4XA 3UMVA 2XAAA 1URPA 3I01A 3LC7O 2IPLA 1K27A 5FTJA 3VYUB 1OT5A 1VECA 1EPUA 2I4RA 1HZZA 3F4BA 3JRXA 3Q7QA 3WKAA 1QR2A 1EH5A 2FOLA 3HWX1 3ROTA 3S2FA 4DA0A 4KREA 2X7JA 2CCKA 4ZI7B 1JMYA 4YJGA 5B2ZA 1N34B 1X7ZB 5EQDA 1JQEA 4D26A 4A73A 5B58T 5LDGA 2JJQA 1ECGA 1QIHA 3BILA 2J9ZB 3LQ4A 1YBHA 3K70B 4OIMA 4OI1A 1HDIA 2F90A 4GI5A 4L4YA 3WK5A 1WXXA 4GBJA 1VXRA 2PLWA 3O7WA 3GJSA 4UE3S 5I9BA 1YJBA 1ECJA 2HRCA 3QY0A 4EJMA 2HM7A 3HKBB 2WU4A 4Q3NA 4RMNA 3G68A 3UPTA 2ZB7A 4MWTA 1SXQA 5HM8A 1KEPA 3FBWA 4WZBE 2BHRA 2BMWA 5GJVC 1FS6A 2N3ZA 2R2AA 3Q7SA 4J7AA 4GEGA 1RDFA 3JQBA 4RH1A 5IJZA 3IV6A 3NYWA 5FAKA 2EAUA 3E3MA 2RAVA 5BNWA 2ZZKA 1PQ4A 4KIJA 4QARA 4RK5A 5TXGA 3TLYA 2R25B 4TPKA 3ILYA 5LNK6 1S3GA 3IH5A 3PQ6A 5THKA 3DCIA 3TTYA 4LQ4A 3TYXA 4F60A 2O0LA 2GZMA 2JCSA 2WUFA 4JSYA 4E46A 3ICVA 4FKMA 3MELA 3MSCA 4W1RA 4BRWA 5HGXA 2VQEB 5F5NA 1K92A 2RK3A 4X94A 3E4DA 3BMCA 5FPPA 4TQ9A 2N47A 3EFBA 4G5OA 4LE0A 4RHEA 4JL8A 5HJ5A 4X1IA 1XKXA 1EFPA 3NWJA 1C9YA 4HNAB 3EY4A 1U3DA 3AW9A 3PHGA 1E5XA 3UMFA 3MAAC 2X13A 1LXCA 2C59A 3KYCB 3LMKA 2M6KA 2MINA 3GA5A 2LBPA 4Y1EA 3V4ZA 1QAQA 5KU1A 4PSKA 1FW6A 4IX9A 4NJMB 3HKEA 1HE4A 1C1DB 1MF7A 4PC6A 1G60A 3G6WA 4EG6A 2GVZC 3OAAA 4LXIA 2ZP1A 1ENZA 4ZDIA 5FOTA 4B17A 3WB1A 3QUAA 1GPLA 5KVQA 4GP7A 4XSVA 3TLJA 5A06A 3L6CA 1AD2A 3H17A 1Q7GA 2IJGX 4KC0A 3P5BA 4Y2JA 3EMDA 5MGBA 1TJ4A 1ULSA 2FR1A 4XM1A 5EY5B 2WIGA 4ZVPA 3ZD9A 1TW3A 4D02A 4US0R 3ZGOA 3DAPA 1I2MA 5IZCA 4HEQA 1TTQB 3DWIA 2C3OA 2AI3A 2G77B 2HIMA 2AK3A 2ZRIA 3AUAA 1Z47A 4MKXA 5KYYA 2RIRA 2J30A 5HDBB 2MU1A 3CTMA 1IFXA 3E27A 2V6GA 3MNFA 1TVCA 3Q5GA 3OM9A 3L8ZA 4Y3UA 3TSWA 3AUJB 1UKAA 3L02A 1DO0A 2J7PD 3DF9A 2EQAA 4QXQA 4X20B 4EFKA 1G21E 4XRRA 3QE3A 3U61B 4FS3A 4B81A 1TGVA 3CA8A 5BQFA 3L2OB 1SVLA 1N5OX 1B8NA 4DPLA 2P9ZA 1G8SA 2HT6A 2QB5A 3DCYA 3O0TA 4M1ZA 3FPFA 1E0AA 3JZDA 2M6LA 1L9XA 2FQXA 2HZBA 4ZEWA 1HX7A 1N75A 2ZYIA 3HPQA 3N53A 4HX5A 2MWMA 1BFDA 2O2HA 3HCEA 4CT4B 4IVRA 4P5DA 5C2JB 1JFSA 3ZDEA 1RWOA 2V5UA 3H9UA 3AFNA 4RFSA 5HQJA 4YV1A 4G0UA 1SA0A 1P4GA 1MHPA 3OHMA 1LSOA 2FSHA 5JLAA 4KH1A 3EDQA 2IHJA 1JV2B 5H83A 3OE4A 3DUWA 3KYDB 1W29A 3SAJA 2R6FA 1I7QB 3CPHA 5FTLA 3TS1A 4PR3A 1YNSA 2O7VA 3OZUA 4MZDA 2CZCA 3ZHVA 1MX3A 3PG5A 3AU9A 1TU0A 2DHEA 1P81A 3BIJA 4IQ4A 4LUCA 2VS1A 4EI9A 1ENYA 1OB5A 2V7TA 2WABA 5F33A 2NNWB 2XGSA 4YP1A 3PHLA 4HDRA 1OWLA 4LDQA 3OX4A 5F7OA 1SUIA 1XA4A 2H52A 1Q7TA 2XMQA 4I9HA 5D5HA 5CJ2A 4E03A 2CL0X 5K0EA 2KB0A 2GEBA 4C22A 2IZ1A 2VJMA 3HXMA 3FVRA 3JATB 4RIEA 1S3SA 4P4NA 1K7SN 1LSJA 5DHRA 3TSCA 2IE8A 3DV9A 3HY3A 2VI5A 3MGGA 3OZVA 4M89A 3EVFA 3PTZA 4MJXA 1QIKA 2BMEA 2JFFA 3N05A 2FWIA 2FWMX 2I6TA 2VZ9A 1IRIA 3VU1A 2LKDA 1YE5A 3IOMA 4EG1A 3O8RA 1EM8B 5AUOB 4H6VA 5E9JA 2HKIA 4JLAA 4X8MA 4JH0A 1U28C 4KBGA 5GONF 4Z9FA 2F8SA 1ADYA 1UJ6A 4OJYA 2DECA 1X1TA 2IHVA 3RBZA 2HADA 4UNRA 5DNYB 1H5QA 1R9NA 3WIUA 3SR3A 3GG2A 3ROQA 1D3AA 2QENA 3NXSA 1IBLB 5GONB 4Z1OA 5BW4A 2I2FA 2IZZA 4E3WA 1Z68A 2PN1A 3EQ7A 2HXSA 3GPIA 3P9KA 5JFTA 4H1HA 4MUJA 3D81A 3WFIA 3ZD7A 2OC4A 1T9GS 3ADOA 4Q02A 5BW8A 5JCXA 3PGVA 4BZPA 2ZRHA 4TS4A 4FIZA 3FWHA 4J3FA 4L28A 3NOQA 4OBXA 4WE3A 1PG5A 1XKQA 2QGFA 1ZUHA 2R48A 5IJWA 5C7IO 1NSTA 2AC2A 4PAMA 5CFRA 1C7EA 1QF7A 2QN8A 5G41A 4Q3BA 3PVSA 2PKRA 4BV2A 4DSAA 4QOGA 1WMEA 4ZOLB 1WZ2A 1TECE 4KUEA 2WWIA 4YQFA 4BNDA 2GSDA 1O6FA 4D4MA 1DAIA 4JEHA 4UMFA 3SEQA 4ARAA 4ETWA 1RQGA 4U1RA 4WUTA 2QSUA 2BGNA 2B94A 5AJTA 2VEDA 5CNKA 4F5ZA 1XZHA 3K6KA 7ABPA 1D04A 3T9EA 3VKFA 4G63A 4PCLA 4DABA 3RH0A 1L5RA 2YV4A 4DLZA 5BP7A 5KREA 4LF5B 2ZITA 2VT7A 7REQA 1MKYA 2AJLI 3W8DA 2IPAB 4RXMA 2EW8A 1LPOA 1YZNA 2C4UA 4MQ4A 3A3YA 3DAOA 3TR5A 1C1HA 3Q2KA 5HCNA 2JBAB 1OKKA 2JIOA 2LXNA 2MDTA 3HJNA 1Q7EA 1FDWA 3KVOA 2YBDA 1Z2OX 3OM0A 1T8UA 3D31A 2O3TA 2TMGA 4PZAA 4B33A 2Q1UA 5IWCA 3HWRA 1GUDA 4C6RA 5BV2P 3ECAA 3F6SA 3N86A 4YP5A 3TNLA 4OTZA 1KKUA 1YUNA 1YCFA 3ZWDA 4DYVA 5DM2A 1NNEA 2P4HX 1GYPA 1QMPA 3FF1A 3LPDA 3O4RA 3EW9A 1C1YA 4XQ0A 1BDBA 4B3HA 4ZGGA 1D0IA 2BBOA 4P4TA 2VP3A 3L0OA 2P9HA 3JRWA 2C03A 2D1RA 3IUQA 4JJGA 2GAJA 4XGQA 1R88A 5DXJA 4ZKEA 3U26A 3W34A 2DH6A 3ZKWB 4EQ6B 6LDHA 5K2OA 1Y3FE 3SZMA 4OMFG 5FNVA 3ITDA 3HB9A 4H3KB 3ED5A 4HF7A 4MGZR 2IYZA 1I2CA 4L6IA 3W5UA 1NBEA 1I10A 3KUKA 2DVMA 4WLEA 4BFWA 4C4ZA 1BNCA 2GMWA 3K96A 3R0ZA 4IHJF 4OGWA 1SCKA 1NN3A 1X42A 1XDDA 3BC1A 2B20A 3L7DA 3PPYA 5TARA 5EJ8A 2DULA 2R1TA 3I1FA 1H2XA 2J5BA 3Q9UA 1N78A 1CZHA 2O8DA 5ITSA 3QHAA 1L7DA 5A4DA 4FEGA 1CS0A 3H4VA 4KI7A 3ZWPA 2AX3A 3KV1A 4EB8A 1FJGB 2G5TA 1GSAA 2J0UB 3EQ8A 1ZJ5A 3A6EA 3QELA 3WK7A 1GLNA 1DB3A 1N2BA 4ZVVA 3SZGA 3PCXA 3O1LA 1U1CA 1D1SA 2WSBA 4Q7QA 3DTNA 2QAGB 3CE9A 2EJTA 4X8HA 3RIXA 2C7OA 4I4CA 3SK0A 1WF3A