4UQLA

High-resolution structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title Crystallographic Studies of [Nife]-Hydrogenase Mutants: Towards Consensus Structures for the Elusive Unready Oxidized States.
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
total genus 83
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4uqlA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4uqlA02
3ZE8A 1WUHS 4KO1S 1WUKS 4OMFG 5JSKA 1UBJS 1UBHS 4UD6A 3ZEAA 4IUCS 1FRVA 3CUSA 4URHA 1YRQA 4UE6A 4UPEA 4UCWA 3AYZB 5A4FS 4GD3Q 4UE2A 4KN9S 5A4MS 4U9HS 1CC1S 1UBUS 4KO3S 3ZE7A 3RGWS 1UBRS 5A4IS 4UCQA 5JSYA 1WUJS 1YQWA 4UE3S 4KO2S 4CI0B 1YQ9A 3ZE6A 5JT1A 5JSUA 4IUBS 1H2RS 1UBOS 4UEWA 1WUIS 4UQPA 5JRDS 1UBLS 2FRVA 4KO4S 3USES 3CURA 5D51S 1E3DA 2WPNA 3UQYS 4U9IS 5ADUS 1UBKS 5JSHA 4KL8S 4UPVA 1UBTS 1WULS 1UBMS 4TTTS 4UCXA 1FRFS 3USCS 3H3XA 4C3OB 3ZE9A 4UEQA 1H2AS 4IUDS 4UD2A 4UQLA 3MYRA 3AYXB
chains in the Genus database with same CATH superfamily
1G18A 1M75A 2JAWA 4BNMA 4KPEC 4CF3A 1E32A 1AKWA 5JANA 4Z1MD 3TTWA 4HNGA 4DIBA 4CQJA 1X15A 1ZGZA 2FVXA 2P27A 1YJQA 3TI9A 8LDHA 1ILWA 1AHPA 1WV1A 3DT8A 5LP6A 1YAJA 3ZEAA 4GXNA 1Y1LA 2CEAA 2GHRA 4R68A 1NLMA 3A3KA 1LDYA 1E77A 3H8WA 4ND8B 4B6RA 3GBSA 4NPAA 4HDMA 1WBJB 4PC2A 3PFBA 1BH2A 1VMKA 4P35A 1G4HA 3C1UA 1PO7A 2J0UB 2I22A 3FDJA 4WINA 4CMIA 2YL2A 4DB4A 4B6SA 2VDMB 4W5RA 3LHIA 3DZCA 2NAFA 7GPBA 4F9EA 1D2CA 2YWFA 4MK4A 5FADA 3WHKA 1DBRA 1U9ZA 4RVSA 3MQ2A 2H1FA 2H4YA 2E7ZA 5T41A 1ETHA 2QJWA 1EFPA 1DKUA 1LPPA 1T4GA 1UKAA 1UZUA 2IYNA 2AJTA 4FYJA 1CT9A 1PEDA 4B4UA 1KEVA 2W98A 3SZRA 1VJDA 2WHXA 4L3OA 3RT7A 1CC1S 2HO5A 2FSFA 1QV6A 4I1RA 4TS3A 2VCEA 5EYPA 4F4DA 5EINA 2CKDA 2Y1OA 3NH6A 4NK4A 1FFEA 2G8LA 2UZAA 2ZIGA 4EGCB 1XRPA 1ZUNB 1LB1B 2I7CA 4TLMB 1WB9A 4UFPA 3LY5A 1BMDA 5JSYA 4CLHA 3B6KA 4XUCA 1ST2A 4XRGA 1MAAA 4M1YA 4BEVA 2VA8A 2VHUA 5K0FA 4F3TA 2NXJA 3AR6A 2J1LA 2IYTA 2R9VA 1EJBA 4BO6A 1G3RA 1WW8A 3LNCA 2XLBA 4IUBS 1H6AA 1TC2A 1T5SA 1J2RA 2NO5A 1W4BA 2YFQA 2O2DA 3MPUA 4LXGA 4O5OA 3L4KA 1NLFA 3H0CA 3BFVA 5IG2A 2RHWA 2Q7OE 4AS2A 1L5SA 3TVYA 5L3SA 3HM2A 2CDCA 2I2AA 2NPIA 3PGMA 4RHTA 5E1MA 5K3FB 1TEXA 5BSTA 1T36B 4MRMB 1D07A 4O33A 4C20A 1L8AA 3N3AC 2GD1O 4YJ2B 3ZDQA 1Y9EA 3I64A 2Z3VA 3IPXA 4DTCA 1DZIA 4HEHA 4CF4A 4B44A 4WBNF 4WFKA 2QUZA 4G1UC 1KSJA 2G04A 4C7JA 4D9IA 1YKFA 2XYRA 4ZQHA 2XDYA 1SGWA 3RHSA 3F7OA 2V55B 3HP7A 4JOBA 3ZHBA 4YR9A 2WQ7A 4U3JB 1XIVA 2J5XA 1QH1A 1R0YA 4DLWA 4XWWA 4M1TA 2PT6A 5LWQA 4R83A 2B4QA 4PAQA 2Y0PA 1E0KA 1S3FA 4CU2A 1DXYA 1EXNA 3CLTD 1HH4A 1DUSA 3LAWA 3SBOA 1ORWA 2GYYA 4C1NA 1FUYB 3I1JA 4NR0A 3LUBA 5HIJA 1K7EB 4O8CA 4EABA 3PRYA 1EXMA 5CDUA 2QT1A 3LOUA 1CUCA 2V65A 1A5BB 2ID7A 4I46A 3ZU2A 1YGPA 2D74A 4EG4A 3I53A 4RJJA 4CDMA 4LVNA 1X9GA 2LE0A 2Y05A 1XA3A 3EGXA 3P9SA 2H00A 3E53A 3JATB 4RHFA 3WNQA 1IL0A 4LRWA 1THMA 4KIJA 2ZWMA 4KE6A 4YTEA 2Y2VA 2QTVA 3TWOA 5E3IA 1CY0A 1PNVA 2SKDA 1WUKS 4ZRMA 3AGQA 1TLFA 1P5RA 2EW1A 3LWNA 1TZBA 5KBYA 5KYNA 5TMDA 2GLUA 4DIDA 5EJ5A 3ELDA 4EATA 4EZEA 1QJCA 1GAJA 2ID9A 3VUEA 5DGDA 5KYVA 1X94A 3SFZA 1Q7TA 2CMHA 4LY0A 1BD3A 2FPOA 1CS0A 3STWA 3VPDA 1TNDA 1WSAA 1RBMA 4DMKA 1MW8X 5AHKA 1JJBA 4BCBA 2H1HA 3KYDB 1Z25A 3V9AA 3AYZB 3KE9A 1QVWA 4OBWA 3DCIA 2OENG 5H3HA 1IVSA 5KOIA 2PZLA 2QENA 2QAGA 4LDZA 2CF5A 4MQ5A 3R9XB 1KOFA 2EQ5A 2Z8ZA 1P1RA 4R1QA 2IU0A 2I29A 3AP2A 4MW2A 2D1SA 2CXOA 3VGPA 4EUHA 2XD4A 5SICE 5KQGA 2DQ4A 3IHWA 3OJOA 4L5JA 4KNWA 2OAEA 4IH9A 1KH3A 1S3IA 2V7UA 1MZPA 3KJIA 3U6BA 1I0LA 5B4TA 5AKXA 2B4YA 3OAAA 5TX7A 4ER5A 2JARA 4KQHA 5JC8A 3WL8A 4LJ4A 1MU0A 2PSSA 3T1TA 3FOZA 4GU5A 3UG6A 2ZSHA 2PX6A 4MDHA 2TMGA 4JKOA 4QUEA 4RF2A 4B83A 2XECA 2CL7X 3F96A 2I3ZA 4FQ8A 2IF0A 4A0HA 3B3QA 2EAUA 3MELA 3GFPA 3G8DA 3VJKA 4BLQA 1OW3B 1PT5A 4ALLA 1G42A 4JLKA 4A8PA 4QEDA 5FUQA 1B6GA 1P4JA 2BKLA 4PLHA 4Q3AA 3S2SA 5D3MA 3WKEA 3C43A 3G2NA 2DB3A 1EX1A 3VDXA 5TIIA 4NDNE 1E4VA 2YXLA 2A33A 4P7BA 4NQZA 2VN8A 5D85A 5KPJA 4LE0A 3T34A 1RQNA 5CD1A 1FTQA 2I34A 4EO9A 5E4TA 1DBVO 4EGJA 2B2CA 1FXWF 4GF5A 5KOYA 2DQSA 2XUZA 4HAIA 4Q4AB 1IVYA 2LD4A 4KWIA 1RAFA 3GGOA 2AF4C 2D00A 1FUIA 2Z2YA 1WG8A 4MW0A 3CJQA 3VJRA 1V2GA 2GCNA 4F3KA 2HD4A 2FEWB 4O0MA 2KBFA 4B81A 2FZLA 2ASVA 2XQJA 3C7DB 3NT2A 2D7CA 3QW2A 4ON9A 5JH7F 1PF7E 2A9KA 4RSMA 4A2CA 1QS0B 2C5GA 1PBNA 4LWQA 4QD3A 1K0FA 1Q0SA 3KBOA 5E6SB 3VVLA 5BNTA 5I8PA 1D1QA 5KTSA 3N75A 2WSSA 2XKAA 4Y98A 1GY8A 4PZYA 1YVPA 4F3YA 4J49A 4LA4A 4ESOA 2R8BA 4AJ9A 4EPRA 3B9RA 3EMDA 3N0XA 5FOXA 1WF3A 3DBHB 4C01A 3PKIA 1EAYA 2OE2A 4FCTA 1F0PA 5DI3A 3HR8A 5BWMA 2V7BA 4R2LA 4UUOA 1MLDA 1V6AA 2PY6A 3V2UA 4Z4HA 4G63A 2JI6A 1FYEA 1BE1A 5AVTA 3EGWA 2QZ4A 4CV1A 1KE2A 1BOFA 3GUVA 2WJAA 5JE8A 1KZ7B 1FFDA 1U5CA 2I1LA 2JIZD 2LKCA 3K0KA 4XYEA 1P74A 7ADHA 4TYNA 3GLIE 2OMEA 4IZHA 1YIOA 5K4AA 2YIVX 2NO7A 3N2KB 4DADA 4LHVA 5TB5A 4K1LA 1BJKA 4EGSA 2QJTA 1NQUA 3GLHE 2V0GA 2BHSA 2XWSA 2C2KA 5EAIA 1DIGA 3CNHA 3KTAA 3BFPA 3BQMB 1FZTA 1BVRA 1N1EA 2FDXA 4UCWA 4DJTA 2PL9A 4NECA 4X5OA 4Z51A 2NQTA 5A6SA 1RMYA 1ZU4A 3LXUX 1G98A 1N75A 4GG1A 1SVSA 3Q87B 1JYEA 2R79A 1NI5A 1YA8A 2I99A 3NB0A 5DASA 2SCUB 1UOEA 1Z5WA 2XDWA 2CDNA 1R2QA 4OJQA 4HNTA 4UNPA 4EFDA 5L3VA 1YZQA 1IFXA 4KXVA 1JDTA 1GL6A 5ECYA 2X2FA 3WRVA 5L3SB 5KNCH 2PR2A 4LCBA 1E4EB 2FTKE 4PAOA 1E2MA 1QDUA 1M1YB 2MDTA 4WDQA 1NW6A 3V42A 1KYIA 4BV8A 4UTXA 4LZJA 5L7TA 3KDPA 4NJOA 4IPTA 2W93A 4KO3S 1XPUA 1QYXA 4N12A 3R7NA 5HZHA 2E0IA 4CTKA 3B6JA 5LIPA 1MZVA 1ZUD1 1PAUA 1SFRA 4LRUA 2ZOSA 2JHGA 2YKGA 1ICEA 4GOXA 3KT6A 4H1TA 5LLTA 1PR1A 2A5FA 5F9FA 2ZBGA 3B6EA 4U7FA 1HMYA 5A3QA 3F5SA 3IC5A 3L1IA 1SCBA 3ES9A 2OHOA 4RK4A 4NE2A 4WCFC 5FPQA 1QH1B 2ZB4A 3GAAA 4EL5A 2VQFB 1N6IA 2QRHA 1FDSA 3N6RA 3DNMA 4BN0A 3ASUA 1MJNA 3ELBA 4UXJA 5T4EA 1K89A 5HPYB 5B57C 5B3AA 2VH1A 4ZYUA 1IY8A 3NHMA 5L7WA 3FDZB 2CF6A 3LLVA 3AZOA 3KQPA 5EHQA 4G0PA 5EJ6A 3WDSA 4ZZ1A 1YF3A 3SM9A 2KW5A 3GDHA 1JI0A 3CLSC 3BXEA 1ZH2A 2AYYA 3P9CA 3ZYCA 5A4AA 2CWWA 3QFSA 3QUAA 2HGZA 1W36B 1Z0SA 1DTSA 3EGXB 3KAKA 1PRYA 2TSYB 3OF5A 4OM7A 5BSMA 3RH0A 1T4CB 1NNUA 2RD2A 1OLUB 1ORHA 2AJBA 4EARA 1VZ3A 2QTVB 2BDUA 3PVZA 1H66A 1H1LA 2H08A 3O91A 5EP3A 4DR5B 1KK0A 3B6IA 3P9IA 4CG1A 2HJ9A 1DNPA 1DT5A 3D3KA 1ZVKA 4S0XA 4E5YA 3DXFA 5FQNA 2O5EA 3OCVA 4M6WB 2WIBA 3T5MA 3IMEA 1V43A 4DFDA 5DGIA 2DBRA 2DUJA 1YJAA 1M10A 4IGEA 2G9NA 3RUCA 5INTA 3ITKA 4RL4A 1CS0B 1YQQA 2Z08A 2ZSAA 2O06A 3R3VA 1FRFS 1WW2A 3VOBA 1LS6A 1HUQA 3DCNA 3RQIA 1RCFA 1VI5A 2H06A 1X7HA 4INOA 2IY7A 4X8HA 1IM2A 2GN1A 3TO5A 4RM3A 5EHIA 5K0ZA 2NG1A 4A3SA 2PX5A 1N5IA 3KDSE 3QWBA 3GEDA 4E30A 4N1AA 4DLZA 5CMLA 2EF0A 4X84A 2QQ5A 4LY6A 4W5WA 2IYUA 3VYVA 4ALIA 4A2QA 1V35A 2VDPB 3F3KA 5EGNA 2FW1A 5ICMA 5KZMB 5FQOA 3TG2A 4MULA 1O96A 2CNDA 1Q14A 4PYOA 1UXJA 3M6LA 4ZAFA 2P91A 4URVR 1ODIA 5KWEA 1TGVA 2O6LA 1H2HA 1UP7A 3OIWA 1JBKA 1Y4SA 2L69A 4R0MA 2P3LA 4LBYA 3R7FA 1IMJA 4M0PA 3OJFA 4TSRA 2BMDA 3G5AA 3BX1A 3FYHA 4YCAA 4N7BA 3CLRD 2LV8A 4H18A 5TC4A 1P5FA 1VB5A 4HFMA 1E96A 1DJLA 1YQTA 3O8QA 1JMKC 1WZCA 4Z2YA 2J9YB 1AE1A 3AM3A 1GA6A 4TT3A 1Y3DE 2R47A 3TQFA 3TIVA 4BNVA 2JGIA 4M88A 1R4NA 3ENZA 4M8IA 3H9QA 2VEOA 2Q1SA 2WJYA 3B38A 4J9VA 1C8BA 1QLWA 3V1YA 4UTPA 1KMCA 3CCFA 4BEWA 4KXXA 3HO6A 4EPWA 4GXRA 1B6SA 2FZ5A 3RIYA 1O9GA 4NEHB 5JQGF 3OQ1A 2JKVA 2VP3A 1SHJA 4JNKA 2QMHA 1PL7A 2RHHA 5GIOE 3AZQA 3H17A 4WD3A 5J3JA 4B33A 1PR9A 3LK7A 5GOTA 4Q93A 3Q8LA 1KXZA 4BAUA 3EAGA 1OYOA 5LLDA 1PLJA 1JBQA 1FUKA 3Q3VA 4ALJA 5C1DA 4KH1A 4FS8A 2Y92A 3TD9A 3K9CA 3FF1A 4PN7A 4XPIB 4O2BF 5ICGA 3DDHA 3GLKA 2PTGA 3O4VA 1A9OA 1DKPA 2OCDA 3VJLA 5JSUA 4JBXA 1TKAA 5BQ3A 3PC8A 4Y2PA 5HF6A 3THSA 1PFQA 3COJA 3JVVA 4ZICA 5KVQA 4ZDWA 4J0GA 4IFIA 5DWDA 3GH1A 3PUYA 4RU1A 4CIBA 5CEEA 2CD7A 4YH1A 3IT0A 1AGYA 1VG1A 3USES 3IJ5A 3L0OA 4DDWA 3ROQA 3FUXA 3PEUA 1UJ5A 4W8GA 3ZWCA 4EPYA 1IXKA 3K9NA 5K6RA 4H35A 1R4MB 2QJFA 1F8UA 2NXWA 2WVGA 2WYIA 5AI6A 3ZWWA 2BKAA 4E3ZA 3H05A 4PNHA 3H9CA 4MMXB 4CMCA 3NBZC 4GI2A 3GVHA 2AR0A 5AKJA 2H9IA 3UKDA 5ALHA 3FJ1A 4B09A 3KU4A 2IOFK 3CRW1 4FNMA 4NSNA 2VYCA 4R2WA 2Y9MB 1NMEA 5I9IA 4DPMA 1U1EA 5K2MA 1XD9A 4ZJPA 4YAIA 2XKKA 4GPIB 2QE6A 4E07A 2JFXA 3CS3A 3D0OA 5HEKA 4D82A 5CLFA 1FQOA 1VYTA 5KHLB 1EI9A 1NF2A 6ABPA 4JUAA 4WNAB 4IDCA 2EU8A 1K86A 2DC1A 2RAVA 3L01A 4X1YB 4BNUA 5IF9A 4W5TA 1U81A 3WGVA 1C1HA 2OP0A 3D8TA 3PJGA 5KCZA 5AVYA 3EAFA 1KF0A 2XB9A 4ND4A 3ZDDA 4K9OA 4N03A 3UOGA 1HDEA 1EVJA 1XAHA 4DSOA 2QPLA 3VR6D 2DXIA 5C37A 1E58A 4V38A 4QQNA 4ZAGA 3VTAA 4E08A 1GPBA 1LKZA 2BTEA 2Q5CA 4RZQA 2VHTA 1QCCA 4CG3A 1LLQA 3WFIA 2R85A 4LNHA 3W3AA 3GJZA 5EUCA 2A84A 3HJUA 4EYEA 1E6CA 2EFCB 1Y7TA 2JZCA 4KFUA 4L2IB 5GINE 1ITZA 5CA1A 2HY7A 1ZS9A 3CNLA 2GZAA 2B5WA 3DE4X 1UJMA 3TEMA 2XBLA 4ENQA 2D7DA 1VOTA 4ZYZA 3TZCA 4V02A 4RTMA 3L07A 2M6KA 3H2BA 3DMYA 4BBPA 1NTRA 1QFMA 2FZVA 2CV0A 3LKDA 4KGXA 1ZHOA 2QBYA 1WMBA 4KQ9A 2Q1UA 3LHSA 2JLRA 3M4ZA 1NW4A 4ZDJA 1RWOA 5K51A 5FWNA 1YRHA 2C4KA 2CZQA 2F1IA 2IELA 1LTKA 3D6AA 1N1DA 2W4MA 3F8SA 4MYUA 4XWYA 1JHAA 1P9OA 1WZ2A 2IX9A 2CZCA 1Z75A 2YVLA 3ETGA 4II3A 1X7ZB 3HP1A 1OY1A 3ETCA 5FA5A 4YXFA 2V1UA 2X4DA 2D4HA 4XTRA 1U90A 3AUYA 3P2JA 3RIMA 5DGTA 3BKWA 1J5XA 2BWJA 1UFRA 1JDSA 2XGGA 3CEAA 3PYMA 2NPFA 4EJSC 1CUDA 1NMSA 1B8UA 1WQ3A 1XDWA 3ZKWA 2Z58A 5HQ3A 5LZ2A 5CX1B 2X2OA 4CF6A 4PZLA 1RYYA 2XXAB 5C81A 4GBJA 4BEBA 3M6MD 3CSUA 2OQIA 1DUVG 2OLJA 1LNZA 2PYDA 2RJOA 1WXXA 4GDFA 2AUNA 2XT6A 1O1YA 3O47A 4WXHA 5DSTA 2AEMA 721PA 2O7VA 1XZDA 2WWVD 1GDTA 1UMDA 5JCOA 3IP1A 3JQ6A 1DEHA 1BN7A 1GG8A 2E4YA 3EIXA 4EHBA 3OX4A 2OQVA 1Z2DA 4AW9A 1D5CA 2OUIA 2PJZA 5ULLA 1I2CA 1SKMA 4KNYA 4D3FA 1ZHFA 4BRZA 1RQXA 3K53A 3EZXA 2PK3A 4DMFA 5FWYB 1ZK0A 4RIIA 5ADHA 1BIFA 1QP4A 1ICIA 1PVDA 2GK7A 4YJHA 5TMBA 4GT1A 4GC5A 2HSJA 4FE4A 2W9XA 1QAOA 1VYHA 4MJXA 4PLFA 4INJA 3AO0B 4TS1A 2HRDA 1Z22A 4MVJG 2FZCA 4HH3C 5TGZA 4I4CA 2Q2WA 5KTRA 1T4MA 4YAGA 5A5EA 2WA1A 3WA7A 2DUNA 4UM9D 3COSA 1QRAA 4K1XA 3IEVA 3HBNA 3SU8A 1EK2A 2PUJA 2MYPA 3ANXA 2DFDA 5AVJA 1Q95A 3WWOA 1O96B 1E6KA 3MHPA 3MK31 2X7JA 3P8ZA 3D3WA 3WO1A 1X14A 2WFLA 1T35A 1NLUA 2GQ0A 1J9EA 4K03A 4NIMA 4D56A 3TN7A 2Q0XA 2BM8A 1CJSA 4NFHA 4Z4GA 2HT1A 3LHDA 2AS0A 2AHOA 2AFHB 4FEGA 4UTOA 4CL8A 4ZEVA 3ITDA 1NN3A 1KWKA 1LDMA 2WJPA 3ZHTA 2WE8A 3FNIA 3QEKA 4OUDB 1YIAA 3ST7A 4E6PA 5IJ0B 5EUQB 1IPEA 1ZKMA 4LYEA 2ZUTA 1Z6GA 1WU7A 4X6LA 3QLTA 4JYZA 1HA3A 5EWJA 3B8HA 1Y82A 3LC7O 4QYIA 3ZI0A 4ZT3A 1HSZA 2QZPA 4UZEA 5IJWA 3VR5H 1L9XA 5EP2A 1GU7A 4JYMA 5IYZB 1BCRA 4L8FA 1MTOA 1Q22A 2RH4A 4E6EA 2RHCA 4DS3A 5C7LO 2ZSJA 2V7GA 3L79A 1JE1A 2V7PA 3R44A 4R7ZA 1TAQA 4J0KA 4FONA 1GYRA 2ORVA 1GNRA 3PCTA 2C2ZA 5FOWA 4GZMA 1CJMA 1TTQB 2BR4A 5DHPA 5REQB 5B7QA 4WVLA 2B30A 3AF6A 3WLHA 3WQBA 3OM0A 5DYIA 4XOUA 2JBAA 4FN4A 2QQEA 4GUDA 1E6LA 3MQ4A 2FF7A 1J0XO 4PIPA 1E6UA 1BE0A 1SAYA 2OHJA 4MUJA 4PVCA 3OJEA 1MFPA 1ISIA 1RC1A 2J7PA 3GFRA 4TKLA 2GZSA 1N2JA 1K66A 3B48A 4FKBA 4BASA 4CLRA 4OPMA 5A4FS 4RAOA 4PSUA 5B53A 1ADBA 1IBCA 3N07A 2CNLA 5BNZA 3PI7A 3FTFA 1BWQA 4JB2A 4PPYA 4DVGA 4ES6A 1PGJA 1BW9A 1DX4A 4Q9NA 1UQRA 4JCCA 4EHAA 4LTMA 4CQNA 3CPEA 2ODPA 1C7JA 3EJWA 4PAMA 4RD1A 3M6WA 2QK4A 3AHCA 1Z29A 4NYJR 1OBHA 2X19A 4JI6B 1AKRA 3ROTA 3LBYA 3OE7D 2CFCA 3H65A 1QDEA 4AZ3B 2HT6A 4UBKA 2HMWA 4HNUA 3HR7A 1DAIA 2DR3A 1OAOA 1Q7EA 2DUWA 3AHDA 3N8DA 3B82A 3FKJA 2EVWX 4AKSA 4CUZA 1YQ9A 4KQJA 4J2TA 2P1DA 4KC0A 2FEPA 4BNYA 1DXQA 3LVBA 5CNKA 1EP3B 4DSNA 1EFCA 5CDHA 3D6JA 1GTMA 3TLXA 2VJQA 4MARA 3UAYA 5JYBA 1M6NA 4RF4A 3SDZA 3VKVA 1GAEO 1N36B 4TWZA 4AUKA 3UAOA 5C51B 1XDSA 3G9TA 5DX8A 4Y0NA 1B8OA 2EHDA 2BGGA 1Z3IX 3R3UA 3SX4A 2J9FB 1ZJJA 2JFWA 4ZU1X 3IKMB 3SEFA 3I1FA 1IG0A 4ND3A 3FB4A 5B37A 3I12A 3AR5A 1QGOA 3L4SO 1GLGA 3EARA 4P7FA 2O3TA 1XT6A 4L9RA 4OJNA 3IEUA 3MWDB 3N0VA 1QH0A 1SO8A 2WG2A 1EDZA 1KP3A 2QV7A 4M1EA 1MPTA 2B8JA 3GGCA 1KR2A 2C42A 3UQYS 3W8EA 4E2FA 4MCHA 5I51A 1G9TA 2ORYA 2YOFA 3ZDAA 3W5VA 4I50B 1ZJ6A 3WBFA 2ZK7A 4JUDX 3T12A 4PBRA 3DPSA 3JQAB 4NYJQ 5H16A 1P0QA 4NZ9A 3NHWA 3B89A 5IDXA 2YJ6A 4G09A 3BWEA 3KQOA 3FW1A 4FHCA 2OT3B 3AKEA 5CJ2A 3IAFA 1Q1NA 4HHEA 1RWVA 3GRAA 3I5UA 2XVAA 1HE5A 1NQVA 2CXTA 1NSFA 2C7VA 2NV2B 4C0AC 1GPJA 1T6BY 2MSCB 2AD1A 2GO7A 1ESCA 2NTYC 4GMDA 4QL3A 4DWWA 1COZA 5ABPA 1MRZA 3IIEA 2X8BA 4XASA 3ROPA 1WDKA 2PEYA 4YV7A 4RC9A 3AUXA 3LI2A 3ABRB 5AI9A 5DU2A 5FI0B 2DU8A 1OBOA 1V3QE 3IURA 2XYPA 3Q8WA 3AB7A 2H7XA 1YZUA 1NM5A 3H3FA 4PHTA 4QXMA 1GLVA 4X95A 1ZU5A 2OM6A 5A7HA 3H16A 1ND5A 4EJ6A 5AQ1A 3NLLA 4R6WA 3AB3A 3WGMA 2XE7A 3DDOA 3WZMA 5KVSA 3L0CA 1H1DA 3QE9Y 4MQBA 1C9YA 3R5HA 4A16A 3Q6MA 2MOKA 3QI7A 4XQCA 3JD0A 1SXJA 3GU3A 4DG9A 5I6DA 2P2ZA 2WHEA 4ISCA 2DP4E 2NYUA 1B6TA 1R50A 3OETA 3EOZA 1NNLA 3ANSA 3F7NA 3KWFA 3WRXC 5BW8A 3G88A 1AK1A 1W73A 3KK0A 3KQYA 3B53X 1DG3A 2QLMA 4LYAA 1U3WA 3EDQA 2Y99A 1OU0A 2X13A 5C5DA 2OV8A 4V0MA 3AY3A 2ZJBA 3UTCA 5C5IA 1U3UA 1I4WA 3EGCA 3PX2A 5HIIA 4EMSA 2ENUA 2OVBA 4LJ8A 1T9HA 1VKOA 1HE2A 1P0PA 1PQYA 3AHJA 3JCZA 3A2KA 3WG9A 1BCSB 3KHSA 3LCJA 4RKQA 3BL5A 1XSEA 4R81A 1NJ8A 4WRRA 3IHTA 3BE4A 3WNVA 5ITZB 2X2EA 5ICCA 3VR2A 2GR9A 4Q7EA 5CA0F 1QGUA 1U7HA 3QSYA 4HWPA 4TUYF 3E9DA 1F2TA 2E87A 5JAIA 2QUKA 1VIYA 1KH2A 2I4MA 3FWKA 1PZMA 2ECKA 2XSZA 3ICOA 3EVAA 3L4EA 1SC9A 4IGIA 1NVKA 1SCQA 1WQ4A 4MVJI 1C0IA 3E05A 4CKEA 3I5XA 4CT0A 4HJXA 2C3OA 2OWEA 2HA3A 1XK6A 2ZWIA 3U49A 3A26A 4W6ZA 4Y2XA 3N05A 3DFUA 1P8JA 1R88A 4V1CI 1JLSA 2RBGA 3EF0A 4UEWA 4F5YA 3KOOA 5ALYA 5K6AA 1ULZA 3WIBA 1U6IA 4EMBA 3ADBA 4F6RA 3E8SA 1PV4A 3EXG1 1AUQA 4LJRA 1RT9A 5EKDA 3FROA 5BORA 5EWJB 2XMZA 1U0SY 2VNHA 3KTOA 3EGOA 2OSVA 3OLXA 1O0BA 4WXRA 2WHQA 3R7LA 3KQQA 4GKBA 3UIEA 4RD6A 3RC3A 4YRKA 1N32B 2PIAA 1U2DC 2ZZMA 4GO1A 3C7AA 6NULA 1VHQA 2E9SA 3CIOA 8GPBA 5AW9A 2QW1A 2M6LA 2VT7A 4NENA 3S99A 1ZVMA 1Y48E 3FVQA 3IOYA 4IOMA 1CEEA 3AX6A 2XOEA 1QRDA 3FFXA 3HA7A 4EMTA 5MGBA 1NYLA 4R1MA 2PMCA 4I9GA 4YJKA 5FI5A 1NPDA 1QYCA 3K6KA 3JPWA 4RS3A 2PUCA 2JBAB 1PK7A 1W36D 2XMBA 1XQ9A 4ZP1A 5CT6A 3V55A 2R1VB 2GHIA 2C1ZA 4C3OB 2VUIB 4PPGA 2XWQA 1M5UA 5EWLA 5EWMA 3WHLA 13PKA 3GDOA 3SS7X 1PQPA 2FR8A 4DXHA 2Z6QA 3QHAA 5LQKA 1CBUA 1JHXA 5LMZA 3F3MA 1YCDA 1XEWX 4F5ZA 4IILA 1FUUA 5ALKA 4QOIA 5KTTA 3HXOA 2C2HA 4BGIA 5ISMA 2HPZA 2R4TA 3PFWO 2HJVA 4ONEA 5TEVA 2XVYA 2YJ4A 1U99A 3BTVA 3B9BA 1PR4A 1Y3HA 1Y4UA 1DMSA 5M29A 1HDRA 3R2JA 3EFEA 2L2QA 1HF3A 2V4ZA 1QMPA 3H7IA 3KELA 3Q88A 1OVGA 4UE6A 2QA5A 3IOCA 2CUZA 4INZA 4CN9A 1SRQA 1Z34A 3B2QA 3NFRA 1M2GA 5EXXA 1TYCA 1MJGA 1OAKA 1XGKA 2H1SA 1QIGA 1NUTA 1C1XA 3BHIA 3C2QA 3JASB 1DLIA 1KJYA 3BB1A 3DDWA 4UU1A 4I81A 5F2EA 2FPGA 3PDCA 5FAKA 1N7GA 5EKTA 3UUWA 3H2IA 3WLMA 3SX0A 2Z8YA 1NVTA 1NIJA 2KWIA 4RK1A 1QVAA 2GBFA 1AC5A 3C3PA 3OAAD 4ZU6X 3GRVA 1MNAA 4YPFA 4BLVA 5B7NA 4X65B 4B3GA 3VKGA 5HVNA 1Y98A 1NJGA 2AT1A 4ZOEA 4E5KA 3ISTA 1K88A 3GUHA 1V0JA 1RADA 1V9CA 2MSKA 1U6JA 2GCOB 3VO9A 1X92A 1JU3A 2JZOA 4Y7DA 5DDIP 1CS4C 1ZCJA 2XOKD 2QYOA 2WIFA 1YDEA 3PNMA 4C5CA 4N47A 5CB4B 1NRWA 2A3RA 4F3NA 3ZE6A 2CDBA 1CW2B 3G6KA 2C88A 2QY6A 1ORVA 1YI8A 1KRHA 3FA2A 1AB5A 1PHRA 3KLBA 4UHKA 5DM2A 3X1DA 4Z9BA 4FE7A 3HKBA 1EJ6A 1PGPA 3NI2A 1K3UB 1P5JA 1CUWA 1EWTA 4AKIA 3OZCA 4GGMX 1I9GA 1B1CA 4YJ3F 1PLKA 1RRVA 2AMVA 1N8NA 3VFDA 5DT9A 3CBGA 1G1AA 4BKUA 2HBYA 5IF3A 4JP3A 4ZVPA 2BF4A 3NIBA 2ZM6B 1WPXA 2BAGA 1KMNA 2MU1A 3UK0A 1NKSA 5CM8B 2XLCA 4XYLA 3D4LA 1M54A 1T10A 1HT3A 3Q8XB 5HP4A 3TQIA 3SC4A 5BV8A 2O8FB 3WYBA 1GR0A 4PYRA 1XTPA 2HK7A 2VF7A 4E5MA 4I6EA 2DKFA 3SE0A 4B3MB 1GZUA 4PG5A 4OKNA 2JHAA 2C9OA 2PZ8A 3B1ZA 3GLGB 1DIOB 2IF2A 2WSSD 2Y0CA 3AOGA 1M8FA 3BWXA 1V8PA 4BECA 3C3AA 3RVMA 3TFWA 4POOA 4W6QA 5ALFA 4E3WA 5JECA 2VOEA 3U4QA 2BEJA 3SR3A 4G0WA 3A1DA 3USZA 2A9QA 2FMHA 1BOOA 3EZ7A 3NIFB 5FO0A 1E4YA 3SNKA 3QX9A 3DQPA 5G0WA 1D09A 3E7FA 2JJ2A 2RHGB 1X8KA 2Q3MA 4AUMA 2EWWA 4AICA 3IE2A 2N0SA 3C15C 1O95A 4C4ZA 2G82A 1MJHA 4H7DA 3I4FA 1KFJB 4MV1A 5T64A 1J2TA 4DC9A 4RMJA 1Q20A 4RGVA 3AVUA 2HTFA 2H5EA 3FVTA 4HOYA 2HIAA 4U5QA 5LA6B 3KQMA 3HYSA 3L7OA 3FIUA 3QENA 2GFIA 2CLHB 1X1RA 5A9RA 2QTRA 4GBED 3ZOKA 3VPAA 1TIBA 3QWIA 2MSDB 1XLTA 1JH9A 3D5TA 1P72A 5KOHA 1RCUA 2WWWA 3WLJA 5SY9A 1T8RA 3EW9A 4KJZA 5DISB 1E2LA 2PG3A 3GVPA 5DOZA 4JGGA 3GPLA 4NEGA 4C0SA 3KWLA 3ZK7A 4D92A 2C2OA 4XUDA 5D00A 4KXMA 5CDGA 2QRVA 5C8ZA 2JS7A 1MENA 3U6KA 2Q28A 3MJCA 2V4MA 4IG9A 5LDGA 3ZUGA 8ATCA 4FMDF 1PT8A 2ODAA 1UT8A 3JWEA 2VWQA 5H7XA 1PFKA 2IEDA 4EB6A 1PD0A 2H3HA 2IUSA 3HNOA 3TBFA 1SBQA 3HMQA 1W88A 1XTZA 1CY4A 2FSPA 5JS1A 2DAPA 3CLTC 2HXGA 4YRCA 4ZA2A 4B48A 4EG1A 2IV7A 1TMGE 1ODCA 2WYUA 3ZIUA 4X1OA 3CVYA 1YO6A 1Y4DE 4LMRA 3OF3A 2IVFA 2FU5C 5K09A 4IVQA 3QELB 1NXWA 2PUEA 3CV3A 5F5XA 3EQ2A 3PTZA 3BSWA 1FFYA 3D3JA 1GEGA 3CH4B 3RGGA 3M3PA 3RD5A 1MA3A 3IELA 2I66A 2VCHA 3RAFC 5HJ7A 2ZUDA 3L7CA 3DLAA 5LMUB 2YVUA 5JNTA 2Q7XA 3Q9LA 3ZCRA 3WYNA 1PFWA 2CB0A 2QRUA 2Q1XA 3O21A 4NENB 2FOIA 2R68A 1SIOA 2HIGA 4GECA 2DLDA 2WRZA 3RC7A 2B3TA 4TVKA 3OQHA 2BEWB 3K9HA 1YVUA 3A28A 4XQ9A 4BJ3A 4KBGA 4GBMA 4CKCB 3ZY3A 2JLBA 4B75A 4JV5B 3N58A 3AEZA 1U9IC 3E22B 3RS5A 1HYQA 3K9FC 3KETA 4XGKA 5IT9A 3D7MA 4G0ZA 4JH0A 2M98A 1XP8A 3EUAA 3LUFA 4KX3A 1HFJA 4MR8B 4ZD6A 2IODA 4D4HA 3ED5A 4G9BA 1RP7A 3C97A 4MLPA 2XH8A 3UGKA 3BMCA 1YB6A 2AFVA 1QK5A 4KACA 3OZDA 3ENQA 2E1RA 2VXOA 5AKHA 2P5TB 4IIGA 3CB2A 2OYSA 4C7MA 1H42A 1W30A 2V5UA 3ILXA 1QGDA 3L04A 4IIBA 3WSWA 5EJ4A 1X7YA 2VQ6A 2UV8A 3I4CA 3HVHA 2P9QA 2WD9A 4G65A 4HGPA 3DZKA 1ADYA 1BNCA 4X7MA 2OFWA 3LQKA 1A2OA 3WYFA 5DNUA 3FHTA 1DJMA 4M22A 3C4QA 5SY4A 3WL5A 3ZV3A 2JF0A 1OX4A 3UK2A 1QGYA 3AVYA 1PBTA 4QG3A 2ZROA 4I14A 4AY5A 2ATVA 1ADCA 4PG4A 5SYAA 4B1FA 2OB2A 2A59A 2FPPA 2H1CA 4G0YA 3SF0A 5C34B 1A50B 1KI1A 2FFQA 3BC1A 3HUUA 4W9RA 1IZZA 3U16A 2UZ4A 1QHFA 1VSQA 2CHEA 4ZAYA 3A9SA 5C7IO 2QI9C 2VQEB 1E1LA 1YXMA 4C0BA 1L5OA 1CUHA 4XYGA 2PS0A 3IEMA 3TLEA 1T2AA 4BXOB 4G56A 4GLJA 2EZ4A 3LRXA 3C87A 4ZVMA 1SCNE 4ACAA 1VP9A 3SC3A 3DE2X 4PF1A 3ZZNA 5FBKA 2ZJ4A 5FA8A 1IYZA 2Q3CA 4LRTB 3I6MA 2JH3A 4JQSA 5H0IA 2IH2A 2BKEA 1QTQA 2GASA 2P78A 2VK8A 3SZOA 3SXPA 2I4OA 2R5FA 2VF4X 3AUKA 5CP8A 5F23A 5FPKA 2EBUA 1L8LA 4YK7A 1JAXA 4EKDA 4QFBA 3VZCA 2JEZA 2A9OA 2PRYA 1G9XA 1Z6PA 2R87A 2ATXA 4LMAA 3WIEA 3R4VA 3DWEX 5AKKA 5ERXA 4TT3D 2ODWA 2HCRA 1XZ8A 4KE7A 4XFKA 2KLBA 4UMDA 5I4CA 4XD2A 2DSNA 2YZ2A 1AT1A 1NN1A 1CUFA 5DXFA 5FTLA 2VZ8A 4REQA 4ZCLA 2RGDA 5G3YA 3I34X 3MD9A 2XTNA 1SG9A 3EUFA 1JMYA 2JJ1D 4MEJA 1WDMA 2DTDA 3QZUA 1EHCA 4YRLA 3QE4A 1D9XA 3QOFA 1IXYA 4JLJA 1RKXA 1U9YA 3HKBB 4JSYA 2IYLD 4A8TA 2VBGA 4RJTA 5LZ4A 1LLUA 1RLMA 1WJGA 1L4LA 1PU2A 4NFSA 3SEZA 4H08A 1TK9A 4WZAE 2Z4SA 1DPGA 4Y6LA 4R7GA 5T57A 1VGVA 4K2AA 2ERXA 1XWWA 2XB8A 4E2YA 2DVMA 4A8JC 2IBTA 2EGHA 3SS9X 1YJXA 1M34E 3FFTA 3NIWA 5GOZA 5CB6A 1GUBA 3ZIAA 1AXGA 1MC8A 3PDIB 2Q29A 1LS1A 2AFRA 3E5MA 1E2DA 4FLMA 2FMXA 4OXRA 1YWGO 3U7QA 4BE7B 1S2DA 5JT1A 4GVPA 5HJ2A 4HO1X 1ONOA 1ADJA 3KKLA 2G9UA 1G16A 4RZUA 1KQNA 3RRZA 3TJRA 2C2YA 2CXHA 3W6UA 2W6CX 2CZGA 2DFKB 1LV7A 2B9EA 2DKOA 3JAWB 5BN3B 1CKEA 1IXSB 3JD3A 4YJGB 4ER3A 1WXEA 4FYVA 1PGOA 3QLJA 3DMNA 3I42A 5K5EA 1K2VN 3I9LA 3JD1A 1FPMA 2VNJA 1W76A 5CA0B 4HFJA 2R11A 1IWPB 2OBMA 3QLEA 1RTKA 3HXLA 3Q12A 4QBIA 3FOWA 4LFAB 4RA6B 4KYUA 4ID9A 1BEEA 2JD0A 3LWBA 1K97A 5D3KA 3TK1A 5ESDA 5FWDA 3U4CA 4EMUA 4IVNA 2AYXA 3BS4A 4D1YA 1GZHB 4MH0R 4UOEA 4WCVA 1F2VA 4GAEA 2DBVO 2X5KO 3NAQA 4AJKA 3BD8A 5DXAA 3PFFA 3UJHA 5DHSA 4MITA 2OZLB 2OZVA 2IRWA 1E1MA 3C8UA 2ZIEA 1M73E 3G23A 2A0WA 3IP8A 4KG7A 4BMXA 3DKVA 3EHEA 3OECA 4N6NA 4YFYA 5BQOA 4LF4B 4YC7A 3ELUA 5DGHA 2C7QA 4PFKA 4R01A 2QRVB 1C2YA 1OXTA 5K8UA 1DAOA 4Y9DA 3VHXA 2O2IA 3N2NA 2NIPA 1MABA 2FHSA 3K6RA 1OH8A 2QDXA 3LLSA 3A9TA 4XIFA 1YQGA 3E3NA 5DIZA 3K20A 4TL9A 3W3AD 3ZXSA 4ZMRA 3O84A 5HXAA 4ZO8A 3V1NA 4BZWA 3I9V1 3D6HA 5JTUA 1QZTA 1W88B 1CRWG 2WM9B 3GRFA 5CU7A 3IVAA 4FWIB 2W37A 1PJLA 3LC1O 3O2JA 4ZGWA 3ZHOA 3WYAA 1QKIA 2EHJA 3H5RA 4BMCA 3GY0A 1DJPA 3OO1A 4F38A 4ITRC 4B3BA 3S81A 2ZKIA 2B2XA 4FJ0A 2BGTA 3S28A 1W6RA 1XFAA 3EDMA 3QUTA 4WV3A 4ARSA 3TEFA 4P54A 1GADO 1H65A 5AM2A 2CLCX 3JQFA 1B74A 4EX6A 2CV1A 2PSFA 3V7NA 3SQNA 2GN0A 1T4DA 3OPYA 1PGQA 1PS9A 3WYCA 3WP1B 3KT0A 1SCAA 1M2FA 3FPHA 4K28A 4MKXA 3AERA 3FIJA 1SU7A 1L5LA 1M76A 2UVPA 2VSXA 1W5EA 3QPCA 4UUMA 3M89A 3WNDA 4CCWA 1VLMA 5ILGA 3CX7A 1Z5GA 1FVHA 2XUDA 3CE9A 3JQRA 4W8HA 5BRJA 3FR7A 3R3SA 4FFBA 3RBAA 3QLUA 2EG9A 1PIWA 1VIMA 2F1RA 2QVXX 3PD7A 4R5HA 3RPEA 3ZK9A 4UJ3A 1OVMA 2XBUA 1UH5A 4L95C 4JROA 3QEAZ 2YW9A 3MWJA 4I8IA 1IVNA 5JJLA 1OHHA 1SNYA 4IEFB 5K8IA 1P9WA 1L4GA 1UDXA 1NV9A 3C6MA 5J2UA 4EI9A 5FX2A 4REMA 3MJHA 2APJA 4JQYA 4DW8A 1S2GA 2ZS9A 3BMOB 4FCVA 1G4UR 1ZSYA 1R15A 1U28A 2BBOA 2JCGA 2NU9A 4M9ZA 3PRHA 4ND6A 1U2EA 5CHYA 1KA9H 3TXYA 2HA0A 4KE9A 2L18A 3BXZA 5K0CA 1ZJYA 3HXQA 3H1BA 5EHGA 2AOTB 4QLOA 3DMTA 5FUWA 3PITA 4CEJA 1L4BA 5F78A 1OLXB 4P80A 3W8FA 1P60A 5BQXA 3FNBA 5EPOA 3HGQA 2OYRA 4NU8X 2UXDB 3MMZA 3KKOA 4YWHA 1MJFA 3N8GA 1ECFA 1U04A 5C18A 1SUAA 4PGGA 2I03A 4ZANA 1IB6A 2UUOA 2HJRA 4L76A 1VC2A 5LD2C 4NMLA 5IYZF 4F84A 5A3SA 3TNFA 2OCKA 5KKAA 1DV1A 4GKAA 5I9MA 4FB4A 3K8ZA 4DEYA 1TUGA 2REQB 1QZXA 1V96A 3ETLA 3Q85A 4HUQA 1IN4A 4W7HA 4N48A 2B5OA 2O0LA 2VNAA 1GT6A 4TRNA 3ZQUA 2GDJA 3GXBA 2JFPA 2Y9PB 1WULS 3FMFA 1CUYA 1GNQA 2Q0SA 1K3FA 3Q6IA 1FJ2A 1GZ3A 1PTJA 1XTRA 3BB4A 1ML4A 3O8OB 4ZYVA 5B6JA 5JISA 1PV2A 3D64A 1G3IA 3H13A 3LRPA 4MUEA 3QUCA 4I55A 1CIVA 3ESAA 2WR8A 1QH9A 3QLVC 4D9KA 4EA9A 5ILOA 1Y8RB 2CV2A 1N2ZA 4MS4A 4OVKA 4WZBE 3VM6A 4G1BA 4NHEA 3LT5A 5L4LA 1MOPA 3WKAA 1RHMA 3QV2A 1H4VB 2AZTA 4LFCB 1EUZA 2X23A 3O8BA 4YO7A 3AVWA 5CH3A 4TKVA 4CM1A 1YL7A 1YE8A 1XX6A 4J1QA 1L5HA 1ZOLA 1GFWA 4JWTA 1KQGA 5EY5B 4LZAA 5FULA 4AM8A 2JPDA 3LMKA 2JLZA 1XI2A 2WJWA 4TYYA 4Z2AA 3A06A 3RG2A 2IP4A 2AWNA 4H77A 1AVTA 3TZ6A 3CEHA 4PRLA 4FR0A 3R5JA 2J7PD 5T5QA 1W2HA 2XVZA 5HYVA 3HC7A 3KQHA 4G23A 3O3CA 3TFOA 3ZV5A 4DR3B 4YQEA 3CPHA 5KSPA 2HPAA 4PO8A 2GKSA 5B2EA 2SNIE 1GNSA 5K0NA 4M83A 4PQGA 1KXJA 1OFTA 1VJTA 4HQ0A 2FEMA 3JQCA 2VBCA 2WW8A 5JMTA 1FNSA 4Z6KA 1FBTA 2ZBUA 2BL4A 2JVJA 2ZYSA 1P33A 1B3RA 2CK3A 5FYQA 4AP9A 4B85A 4JXKA 4BJ5A 4DIOA 3VU9B 4AG6A 2CHUA 1JPUA 1ZRMA 1C3LA 3E0XA 4JASB 5TEWA 3QMMA 4BCDA 5LMCA 2HRRA 5JYCA 3G1WA 5HIKA 2V3CC 4JJGA 4OHBA 2TMKA 4AJ2A 2IY9A 4C7OB 3SN6A 3O31A 3F2IA 3HI6A 4YCBA 5IMBA 4GBGA 4AKEA 5HKKA 2ZI5A 3GGPA 3LWDA 3IVGA 1IUPA 1O2DA 2CFTA 4IIXA 2A1UB 2QN8A 4RJ2A 2ICAA 1WMFA 1CPYA 2DHEA 3AVPA 4WQMA 1EKXA 4IP0A 5CBPB 1HOTA 4HB0A 2O2HA 2J6HA 5AUQA 1LPAB 1W1WA 3O5AA 3STHA 5AVUA 4ZOQI 4RD0A 2DY1A 1CNFA 4L5YA 2JFQA 1O54A 5FBQB 3THOA 3WWDA 4XDZA 3QYAA 5LZ8A 1G8GA 5AW5A 2VDNB 2ZULA 4RMIA 3P0HA 1FNCA 4O4IF 1YACA 4Q4HB 4AD8A 4KR0A 3OU2A 4WACA 2JGMA 4KDFA 1MVOA 4P2GA 5C4GB 1IULA 621PA 3UAWA 2HV9A 1C5KA 3UOAB 1P19A 2R62A 1E5LA 4ZO6A 5A4KA 1EJ2A 1O5OA 5J59A 1TUBB 3CHYA 3NO4A 3R7SA 1E1NA 2ZB8A 3T99A 2I7XA 1MBZA 3WK8A 3WAGA 4XQGA 2ZR9A 3CZMA 4OHYA 1XDGA 4LS3A 2QMUA 1HETA 1ZCAA 2ODTX 1NW7A 3H5NA 3LX6A 4X20A 4GQIA 4DBLC 5JS8A 3KVRA 1D3AA 2ODNA 4BMNA 1QIKA 1VI2A 2X76A 1E59A 1OTHA 5CFQA 1BU5A 1D2AA 3R1IA 2WSLA 5DBOA 4BKRA 3RYIA 2EX0A 1TPZA 3ROZA 5TPWB 5CLGA 4GI7A 5BSVA 3BREA 3H4TA 3RU7A 1JEDA 2QYSA 2JLSA 3BCRA 2W6ZA 4Y6SA 3TD6A 1M9NA 4EJ2A 5B1EA 5LXTB 1T5TA 4L0DA 3TR5A 3L4JA 3L7AA 1ONBA 4D5EA 4JLBA 4B7XA 5JHHB 3ZVMA 4F4FA 4TWRA 3EF1A 4MWEA 1E3SA 5E1DA 5FT9A 2CL0X 4CM7A 1S02A 2PBZA 4RVDA 3CT6A 3WHPA 1S2MA 2EZ9A 1I30A 3DPUA 3T9EA 3VPHA 2FFHA 1Q0QA 1WU8A 2JEOA 3PHGA 3OPXA 2ZRPA 2P4QA 4YUAA 4R16A 3DVLA 1W5FA 2IIPA 5CM9C 3MC1A 1GUAA 2O2XA 4K9SA 1E9RA 1IM8A 2IUFA 2Q27A 3GWGA 2CLSA 4YN3A 2QL5A 2A30A 3EGVA 1E9FA 4LJSA 4RH1A 2WY2D 2QP3A 3TL2A 4N5MA 2GD2A 5AI5A 3R7BA 3E4DA 4W1SA 3OIVA 3KFLA 1PW5A 4QFDA 2YBEA 1SXJD 4XIGS 1MO6A 2VPIA 4G2NA 3PQ5A 1FFGA 4MUXA 4MYTA 5I9BA 4NV0A 2C7PA 2VXCA 5T6BA 1KJNA 1XZCA 2AXPA 1U2PA 2BHLA 1A9SA 3EZ2A 3HCOA 3FGZA 3IBGA 1VGQA 5LNK1 4FS3A 3L43A 4C22A 2D5IA 2FG6C 1ZINA 4IQFA 1MO5A 2HYIC 4KRYA 1J70A 1I7NA 3IP9A 3T3OA 4I1YA 1D6JA 1DIRA 3LO5A 2G83A 3TZEA 4J91A 3U40A 2ZUEA 4X66B 1A95A 1EP1B 2DPMA 4UHJA 1OGIA 4P32A 2FWPA 2WMOB 3HWRA 4A0FA 3LWZA 1SEPA 5D5QA 2QD4A 4F4JA 1KGDA 5TMPA 4BVKA 3NORA 2WJHA 4GZ3A 2BFPA 2XSZD 2PA0A 4N18A 2DTEA 3TTXA 5BSFA 2JATA 2XCSB 4IEIA 2AXNA 1K6IA 5IBRA 2JG3A 4Z7OB 4QWMA 3TG8A 1X7GA 2C8VA 3F9CA 3IAM1 3CO0S 3Q2KA 2NSHA 4I1OA 1Z4NA 1Z8HA 2OFXA 4R8MA 4O1IA 2ZJ5A 3C1TA 3HYNA 3L7IA 5FTKA 1K5PA 1Z2CA 4LXUA 1PD1A 1ZCBA 4PLWA 3NOXA 4Z4EA 5JQWA 1QBKC 2WAYA 4HUQB 4ODIA 3AI2A 3MRTA 3CLKA 2EJVA 3HPRA 4RXMA 3VQTA 3A1SA 3H8JA 4F0JA 1C30A 4HSGA 3W9UA 3Q41A 4DPLA 4IDFA 1TX4B 4HUJA 1A8HA 2R1TB 1X7XA 3AVOA 2LZ0A 3B3GA 4QHYA 4Y2JA 3TOZA 3NETA 3V32A 3IILA 1KQOA 1FL9A 4HNVA 4J16A 2XYGA 1EDDA 4QNRA 4R8VA 4WHMA 5TPZA 1MIOA 1QANA 1W1UA 1UFQA 2OXEA 4AJ1A 1XQYA 1Z6XA 1ZG3A 3HG7A 2X58A 4NH4A 5F3WB 4D5GA 3MSXA 1S9DA 3AY6A 2VEDA 4QKQA 4L08A 4DQVA 4OLAA 4QFMA 5JS6A 1MJ5A 2IE8A 1EG2A 1PFGA 2DUUA 2VS1A 4TKVB 3UB4A 2PX2A 1NHWA 2HU8A 3WFJA 3VC1A 4IXMA 3BEDA 3WIUA 2F4NA 3KALA 1X9IA 4V1CB 1DC8A 1N6HA 2IZ1A 1UF9A 5HQTA 2O8BA 3WTBA 2O7SA 1BVHA 1BDMA 1YK1A 5TXGA 3NAZA 1OXBB 3EXFA 3YASA 2WJ4A 3NM6B 3PR2B 4G9EA 1WBBA 1VDMA 1J25A 2QIOA 3BPSA 4NAUA 2N42A 3DUWA 2RI1A 4G67A 4BNDB 5EE5B 3G5UA 1AHNA 2BR3A 5K05A 3W3ZB 3UJNA 1ZOOA 3GDFA 2XCRB 1UK9A 1WZIA 1TEHA 2EFEB 3FPSA 4XVHA 5F7JA 5GQSA 3JWHA 4CFSA 4YT4A 1YZFA 1NP3A 1T9CA 3VYTB 3GJQA 3WRYA 5IULC 3N7UA 4WKPA 4KLAA 1E0DA 3DULA 4D6XA 1XVVA 3DKRA 3CWZA 5EIBC 3GGGA 1RRFA 2OAGA 4WKOA 2HU2A 2HOQA 4LZLA 4WEQA 5SY6A 4D4GA 4ACBA 3BF7A 3HFGA 4FOLA 1D0IA 1JA0A 3BUSA 3HCBA 3ZWVA 2Q07A 2VVTA 5AVSA 2OXRA 3VR1A 3FJOA 1Q91A 3RLFA 5L7YA 5TF4A 2B61A 2YFKA 1CETA 5J1TB 4MO9A 1XJQA 5T3UA 4MYSA 3R5KA 3QYPA 121PA 2QVYX 1DOHA 2P67A 3KCNA 4YXWA 5BNWA 3UMFA 4TV9B 1XD2A 1X7WA 5ITSA 2FX5A 2BBSA 3CKMA 3KLNA 3AEUB 4H59A 3C3YA 4UJ5A 3NTVA 2D0OB 1V11A 3NHRA 4YMTA 1O03A 2YV5A 3WDMA 4MAAA 1AKQA 4K6HA 4OEHA 5HZMA 2COEA 2JCSA 4PO1A 2A58A 1NMYA 2BCEA 4BCCA 2X1LA 3AF3A 3DSRA 5E7JA 3UO8B 5TGDA 1F5NA 1HT2E 2EV9A 5B6IA 1DWOA 5KC9A 2VK2A 4LZNA 5J43A 2F62A 4IIVA 2Q8NA 3G5LA 3VVBA 4YRMA 2F4VB 4H3KB 1EE1A 2C5EA 4BFYA 2YC2C 4C0XA 1CQJB 3F3SA 1BEUB 5FJJA 2GVNA 3BDIA 3DMFA 5ALXA 4P8RA 1D2NA 2DPYA 1WZNA 2QP9X 1ETUA 1XMPA 4ZEOA 3Q72A 3AVXA 5AIAA 5L8VA 2CLOB 2XPCA 4QODA 3KXIA 4QYTA 4ZOAA 1RKVA 3F67A 4RY2A 4OLBA 5TT0A 4Q39A 1YASA 4U2FA 4BFWA 1DKNA 3RI3A 2RAFA 2WMYA 4H7KA 5FA6A 2Y1GA 3LCCA 3OUUA 2DM6A 2F3TA 4J7UA 1QR2A 1II8A 4HNQA 2X9VA 3FYSA 3PXUA 3QVMA 2Z30A 4M0EA 3SHOA 3TCKA 4R41A 5C7YA 4EHLA 3PX7A 1J0AA 2XGJA 3RB8A 1QNFA 4YCSA 5GMOA 4C0HA 2F48A 1S96A 5HRUA 3GLFA 2WDZA 3RYIB 3ONNA 2OY0A 4UEKA 3TX2A 1WP9A 2X22A 4MQLA 4F5WA 1A2QA 4C89A 3R0ZA 1ENYA 1WUIS 4QZVA 2FRVA 3UJBA 3PJRA 2QSUA 2R8YA 4ZCTA 1OGYA 2IYWA 1RWNA 3ZBPA 2FUNB 3RHZA 2PUTA 1HKHA 3UMRA 4WA8A 2C8JA 3U5ZB 4GL2A 1I1QB 1M7GA 1Y37A 3UJ9A 4LOLA 5J4HA 4FOSA 3D8NA 2C77A 1JLKA 2CB9A 5BSRA 1DPFA 1M6WA 1USWA 1Z9BA 2HDNB 3D7SA 1I4EB 4ZQGA 4F46A 5A5GA 2W2TA 2Z8XA 1R0ZA 1A76A 4AZ0A 3EDYA 1TDJA 3D8SA 4D97A 1AHHA 3H9BA 5J2TF 2IWRA 3O6VA 2CL6X 1T24A 4BO2A 1X1TA 2HQSA 3HBJA 5IVHA 3IL2A 3IIJA 4WUTA 1JEEA 1HDOA 3SP1A 1YDFA 2G80A 2VXYA 1A8QA 4RD2A 5AH0A 3U1VA 3BMNB 4EYKA 3U81A 1O95D 3CG0A 3EXEB 3HK2A 4O4JA 3PNYA 1ECPA 3FGOA 3I5MA 5H59A 4YP5A 4J03A 3FVVA 2WU8A 1WPQA 4MIKA 4X6YA 4KSCA 4IS2A 3UK7A 3B70A 1YD7A 2AUTA 2IZ0A 2X7HA 1AO3A 1T5IA 2GAAA 3E3AA 3DVSX 4HKTA 1QXSA 4CRWB 1WKBA 1WM1A 1TXGA 3OC0A 4Q3BA 2YV4A 4LZZA 3GPBA 4DCGA 3NJRA 3ODGA 1XZQA 2QN3A 3FYCA 3AVVA 4A0GA 3WIVA 1J07A 4MNTA 1M72A 4DLAA 1GG2A 2AB0A 2H31A 3A6HA 1N2OA 1YR1A 5KAMA 1RQPA 1JG2A 2PLAA 2RH9B 1AQUA 4PICA 2YNMC 2P1RA 3ZIDA 1G2QA 5IPFA 2M9MA 5EZYA 1K8YB 1Z38A 1ST3A 4XWKA 4NULA 1WOMA 1QH8A 4DHWA 5KYXA 1E20A 1SUDA 1GDDA 4Q1FA 3RE1A 1HX7A 2A7XA 4XCVA 3DTVA 3FYUB 2C84A 4FOPA 3WOHA 3WKCA 4BGUA 4BC0A 3KYCA 3AT1A 3IS3A 3ZHSA 4CM6A 2FFJA 5EMLA 1HDIA 1B16A 4C4OA 1JQBA 3OZBA 4QBTA 2CUKA 1XD8A 3SIPA 2K5UA 1FRNA 2IHTA 4EENA 5CFRA 1JP7A 1RYEA 5FP0A 1N77A 1Z63A 1P75A 2GFQA 3P9RA 4WXPA 3AETA 4DQ0A 2H59A 3N2IA 1SUSA 3ET4A 5TDHA 4F2GA 1US8A 1LTHR 2F9MA 1QIJA 4LECA 3ZTYA 1LBTA 2AFIB 5C1IA 1QWOA 3B2EA 5GONA 2JBHA 5IT0A 3A2LA 1UEXC 4HEA1 4QTZA 3ND9A 4BE4A 1NNEA 1W36C 5BXQC 4LF8B 2HX1A 2OLEA 4IX9A 1E61A 5DBHX 2GLXA 1W0CA 3CZAA 2VAMA 4UBOA 5JARA 3HB7A 2H4JA 1B6RA 4V0NA 2ZANA 1C9KA 4LYYA 1Z0UA 1WUJS 2IJGX 1FTSA 2ZTVA 1B14A 5IAGA 4ARUA 1H9BA 3F4KA 3GEHA 1YAHA 3QVXA 4FZ3A 5B1SA 3W5SA 1GM5A 4KX5A 4DM4A 4WL0A 1S9HA 1JXOA 4K9RA 2BSAA 2SKEA 1KYVA 3Q5EA 1C81A 1LI5A 1UAYA 2HHLA 2JIPA 1S0UA 3F6EX 1KI2A 1KQ3A 1MGOA 2Y1DA 3GMDA 1L3IA 4F93B 4DR1B 1YVDA 2JCVA 4L27A 5GADl 4GKJB 4DJEC 1WCXA 2ZIFA 3KT3A 4MA0A 4AYTA 5HBGA 5THKA 2P2NA 3EXHC 4DAOA 3PXXA 1QHYA 2D1YA 2VPQA 3QHQA 4FX2A 2ZAOA 1G5TA 2WM8A 5E4FA 3UYKA 1RPAA 3MJRA 1N5MA 4B45A 5LM3A 2JD1A 2V58A 1EH5A 2V8BA 3CUKA 5IMSA 1JX6A 3COZA 3M34A 3KJEA 2PSJA 4BVLA 4NMXB 4TXHA 3A1TA 1G7TA 3THRA 3DMPA 2HMAA 3WLNA 3STVA 1VDZA 4D3ZA 5BVGB 3HU3A 2Q6KA 3AJDA 5LKAA 1RPJA 1RM0A 4ZAXA 3WGZA 5ADUS 4BATA 4YWJA 3QOWA 3L8MA 3IRVA 4KXFB 1TADA 4XZ3A 5FTNA 3DE0X 2AUMA 1NAIA 3EZFA 4QEZA 4JWKA 1NL3A 4MKGA 3DJFA 4UM8B 5BUZA 2GWHA 3V1MA 3IHKA 3C5EA 5TF0A 1HLDA 2OILA 3ZE9A 4HAUA 4MPTA 2VHWA 3NYQA 2G71A 4OHRA 4WECA 5CVCA 5CUQA 3UJCA 4WPGA 1IOVA 4DPKA 1ACJA 5D5PA 3K6SB 1PZFA 2X40A 1C3VA 1TL7C 1DBPA 3I9JA 3H04A 5IW8A 4EPTA 4G4SO 4DUGA 3BDVA 3IQHX 3LUJA 1ZJ4A 3ZGVA 5JSKA 3ZHCA 5FAXA 4ZHQA 2XB2A 1T91A 3M5DA 1YQUA 1YGYA 2ZJFA 1O4WA 3PXAA 2W70A 2AOWA 5GV8A 2GILA 3SMVA 2VXBA 1KP9A 5JZSA 4PVDA 3WL4A 2HEIA 1N6NA 3MWGA 2AG8A 4NS1A 4URHA 3W5DA 2PZBA 3I8XA 1NJSA 1E7MA 2QGZA 4GKKB 4XDGA 5HHTA 2HA2A 3I1YA 4OYHA 3O3OB 3AW9A 2B7BA 2O2EA 2ODEA 3BD9A 5FNVA 1BXRA 1NVDA 4X1IA 5LZ5A 2C9DA 1Z7EA 3N0TA 1CHDA 1JKFA 2H2AA 4QA9A 5KPDA 3KV1A 1V7PC 3T5GA 1HPLA 4YFVA 2PV7A 5A3RA 2GDZA 1IZ7A 1WVGA 2VCYA 3VZSA 3L6BA 3ZJYA 3LW8A 3ONFA 1UM9B 1S6YA 1OYWA 1UKEA 2JK0A 4PC7A 3LUPA 4HDAA 1WCIA 4PZPA 3RK0A 4MUMA 4Q05A 4QXOA 1V41E 5I9TA 1JDBB 4HRVA 1TKBA 1HZZC 3ZIAD 4BY9E 3L02A 4RKFA 3KSMA 2NXNA 3TSYA 5B12A 4BFUA 2Z3WA 1KK2A 1ZP6A 4EA7A 4D96A 1J8VA 1XXLA 3BHJA 4ZOCA 4YR7A 5IVKA 4Y18A 3JD2A 2PL1A 3RC8A 3QY0A 2GN9A 4P3XA 3H5TA 1M6VA 3IUEA 4KXQA 2CYAA 3U3OA 4AZ0B 3SVLA 1ZONA 2ZUFA 2PWPA 4UDOA 3L0SA 2I2XB 2QX8A 2NO6A 1LSUA 2WKWA 3ROFA 2BW0A 3LFTA 4G8JA 5FIUA 5FWXA 3W6OA 1FSPA 4MWZA 1FP2A 2XA1A 2OWDA 3IH5A 5TR9A 3RYFA 4ZN6A 4RTQA 2WICA 2D5AA 1QR6A 3CPJB 4BKPA 4MKRA 4CQMA 4FB5A 2RARA 3P97A 3W4JA 1SBNE 2NYVA 4FYIA 4N6OA 1Z7GA 5F4ZA 3RU9A 1JIQA 1IONA 1AQLA 3VOSA 1RMTA 4D74A 1F60A 3EPJA 1EFVA 5KTMA 4PEVA 3SOZA 1IB0A 2O52A 2OZPA 4JCOA 5G41A 2ACWA 2YFHA 1X1SA 1EINA 2NT3A 2HQBA 3MIIA 1XTUA 3OFKA 1G3UA 1H6DA 5JC1A 4NOLA 1J1ZA 4G3XA 2OCGA 3QUBA 3SICE 4V0OA 2XE4A 3VYWA 5KYUB 4J43A 4E7PA 4JC0A 1HE8B 4E5VA 4FNOA 4WOCA 1DWQA 4IRUB 2CT8A 1GO2A 1V37A 1ZUWA 2BMAA 3G79A 1L5GB 2ZUVA 3OX1A 4F91B 3Q0IA 4WCFA 4U7PB 5IAKA 4AMBA 4IDDA 1N4AA 1NJ2A 3EFOA 3HY3A 1AKEA 2KB0A 3QWFA 1MP0A 4LSMA 1F6DA 4HDRB 1JG6A 4HYQA 4JD5A 2CXXA 4N8DA 5EL0A 4DLVA 1QH8B 3SDSA 4O4LB 3WNZA 4S1PA 2JGEA 1OKKA 2WF5A 3GJYA 3LDGA 4UCXA 1Z6AA 5CCDA 3S44A 1YR8A 2IUEA 3KYCB 3TOXA 4BQEA 1C9EA 3T1VA 1ABBA 3ZX5A 2I1WA 3EVDA 3DPIA 2NZJA 1N5DA 1WS6A 1ZGGA 4Z4IA 3H11A 1GXSB 1Z2EA 2ZSEA 4AJOA 5IKMA 1BHJA 3BE8A 5KUTA 2E4XA 4BIIA 3NOQA 2A0UA 2WAAA 4MQ4A 4JU9A 5C80A 4UTNA 5JD5A 2BMWA 3UHAA 4E03A 2PAFA 5ED4A 1K63A 2A5YB 2IXFA 1ACMA 2QRZA 2YZNA 3VDMA 1FFBA 1OE0A 3W5JA 3ZJTA 2V96A 2GVZC 1DCFA 1FP6A 2I3BA 4ZJUA 1IQRA 4B6OA 1ZVJA 2I9PA 1GZSA 4JEMA 5DYWA 1WSBA 2P11A 3C4JA 3FTPA 1BXZA 2QAIA 4N7RA 2HNBA 2ZJ2A 1NXVA 5MF6A 4EYQA 3GFQA 1OJ7A 2XY4A 4IV8A 1AQNA 4F71A 2RHOA 4KRGA 1QKJA 3GJRA 1PP4A 2NU8B 4ITUA 4U7GA 1YTLA 3I1IA 1COWD 4J4TA 3CO5A 4L02A 4ESVA 5DLEA 1KVQA 4ZGGA 1OHHD 4F4IA 5KVAA 2ZI3A 2LIPA 2V6BA 5ESXA 2O8CA 2JEYA 1G21B 2GPSA 4R54A 3T5CA 3QPBA 4D4LA 1X6VA 1M1NA 3LT0A 3DFIA 5C52B 4PSAA 5C0OE 4PS0A 4H7HA 4NWIA 1RXYA 3JRXA 3Q7RA 4POAA 1D4FA 4O4HB 1GP2A 2FQQA 2FEKA 3KZCA 4P08A 3TLBA 2C94A 2OCXA 1BROA 4G5QA 1VHWA 3CN9A 4BFTA 4BQFA 2R8OA 2IP1A 1XTTA 3G8AA 1YI1A 1Q7GA 1KVRA 1XVIA 3KJQA 3PQ4A 3S68A 4CR7A 5I7UA 3DZJA 1JEQA 3LKBA 2X0FA 1UXGA 2VJMB 2OHGA 5F2KA 5AXDA 4EDFA 1J09A 1AN0A 1IXRC 1J39A 1O58A 4ILKA 4BLPA 2NZXA 1B73A 1P3Y1 1P39A 2DMRA 2XTJA 4FMBB 3HCAA 4Y67A 1G8HA 1D7AA 1ZJWA 3LIPA 2QDKA 4IHJF 3ZWPA 1SKUA 3WVNA 1G8KA 3AEYA 2JGKA 3ZWAA 1GITA 4ITVA 5JXIA 4FFMA 4ENVA 4MR9B 4IHAA 4C2UA 4JODA 5KTYA 3GT3A 3Q8MA 3OICA 1W87A 2R84A 5K03A 2WTNA 1EWVA 3PHJA 4FCWA 3ILVA 5HFAA 3SJAA 1LD3A 3C5WP 3F0TA 2O19A 2QROA 2XUIA 1PSZA 3DDZX 3ENWA 3AU8A 4EKEA 4BP1A 2JVIA 2PSHA 1FQKA 2ZM5A 4URUR 2GHQA 2IUUA 4ZHQB 1CFJA 3IX7A 1P2GA 3Q5DA 1DMRA 3T8YA 4IDHA 3OWXA 2XT0A 1VL6A 3QBJA 1XAGA 3NHSA 4XH9B 1OWNA 1AKNA 4F2HA 4TMKA 3Q2IA 4NMMA 3UH0A 1OROA 2UUAB 5KKNB 1VJGA 4HXEB 1XRMA 1DRKA 1FYXA 1GRVA 2C8KA 1T3LA 2P90A 2X8JA 1AS0A 2B35A 3FUUA 5LYJB 1J2YA 1YZGA 2QYTA 4UBLA 2QT0A 3V1TC 3RF6A 3BZUA 4L6IA 2P4UA 1AHIA 2G4VA 3NBYC 5KYKA 2EWVA 2DWOA 4OM8A 3PWKA 2Q6VA 3JYPA 4LISA 2JI8A 4QPDA 4EG3A 5E6RB 3WB1A 1D9ZA 2ZEJA 3LVQE 4IMPA 4Y6GB 4P81A 1ECGA 1VE9A 2VDWB 4HQKA 5F76A 3ID6C 4EUNA 3NHAA 1TA4A 2DHCA 4D8UA 2C4NA 3SEAA 1DEOA 1PWEA 2IV2X 1F2UB 1HOXA 2BCGY 3P4XA 4DDMA 3MINA 3MD0A 3V3TA 4F12A 2WWGA 1Q74A 2WC1A 2A6PA 5C9ZA 4D99A 1NG1A 4KPYA 1FTWA 1TVKA 3I2YX 5G02A 4L78A 3GUYA 2JLCA 4CE6A 2QXTA 4BDSA 1QYVA 5SYNA 3R7WA 1M0SA 3SQMA 4HQOA 3IDFA 4LAFA 2BTQA 3RVKA 1V1JA 2WE7A 5JNLA 4EJMA 1SXGA 2ZSUA 3NHZA 4HRAA 4F7WA 2HA4A 1R6TA 4RANA 4X92A 4FGLA 5KDLA 1AZLA 1Z08A 1J21A 4WCDA 1FTYA 2C3MA 3S2FA 3A6GA 3AHHA 5ALEA 1ZOPA 5DMHA 4YRIA 4BDTA 1SKAA 2YRFA 1QP0A 3JSXA 2FFBA 3W5BA 3CBQA 3EXIA 1N9GA 2DHDA 3L7KA 5FWAA 5K8VA 1ULHA 4GWLA 4DMRA 4AURA 1MDBA 1XOIA 3K4QA 1YU9A 3DXYA 5DV9A 3UAVA 5JMPA 4KRXA 221PA 2XB6A 1L8XA 1TT5B 1NNI1 2R86A 4JENA 2ATEA 1LQ2A 1SOWA 3C8DA 3GRZA 1DU4A 2ZS8A 4ZTBA 4BVBA 3L0BA 1JYSA 5ALRA 1BVYF 2GHTA 4D79A 5KYWA 3OMLA 4WBSA 3TQQA 1SUWA 1MORA 3VKHA 1W5SA 1QHNA 4ZYLA 3MYYA 2H8KA 5LBUA 2JLAA 5G4KA 4EB3A 4ZMSA 3ZGZA 1L8QA 4X41A 3EFOB 3ORFA 1UK6A 1DEXA 5AXCA 2RAUA 6LDHA 1XTBA 1HFWA 4RUKA 4OP3A 4Z9FA 2QRPA 1AMUA 3PGVA 1Z73A 5DTIA 1W52X 1U0RA 1NQXA 2D6FA 5EXDA 1Y80A 2VHEA 3EZNA 3HU2A 3PQDA 4MS1A 1OI2A 4MDYA 3D4NA 1RYFA 4EJSA 5ETJA 5CRIA 4U2DA 5F9HA 4PQEA 3DTTA 4KOEC 4OQNA 4HX9A 2PXAA 1L4HA 3QPUA 3KJGA 2GBPA 2REBA 4PYLA 3AF4A 1DAFA 4LE2A 4F4UA 4Y2RA 1OGJA 5A6VA 1QTRA 3MJTA 1LH0A 1Q6YA 2WI8A 3GOHA 3H8VA 4IWXA 3ZD7A 1QPZA 1LX6A 3TSZA 5B5SA 5LUAA 4UOZA 1U6KA 1UODA 1U8YA 1IEVA 2J09A 4DV2B 4CLOB 3NS7A 1U11A 5CYOA 4MB6A 1BMQA 1PS0A 5ECDA 3CEMA 1FE8A 2B98A 3TIFA 5DHUA 1PWYE 4MRVA 2FMFA 3CNQS 3W2TA 4ZFNA 2PHZA 3A11A 1KEUA 3HDJA 3T15A 4BB6A 3FPLA 3N8HA 2XYVA 2VFAA 3PC3A 4MDFA 4W9NC 5JZMA 1XELA 3HSKA 3AEKA 3THXB 1PL6A 2VSYA 4AUEA 3AJAA 3WZ2A 3X2SA 1Y4AE 4QECA 5LLSA 1UZNA 4MQFA 3WXBA 2LKDA 3RSCA 1NNSA 4G5RA 1DE0A 1VJCA 2H52A 2DG2A 4XR4A 3ORYA 4YJFA 5L4NA 1Z82A 5LP6F 1Y8ZA 1M7BA 1KJIA 2ZBFA 4MAFA 1HK7A 1XYGA 4P4SA 4IIJB 3ENKA 1MB3A 4UTRA 2V7WA 5E0KB 4I6GA 4JLSA 1R5JA 2C9BA 1NW8A 3OG9A 2O7RA 1GRRA 2TS1A 2W8BA 1R0RE 1INLA 4UMEA 3P27A 5L3QB 3CM0A 4OIFA 3UM9A 1E6MA 3FBGA 5I7AA 3VZPA 3VSBA 3SHVA 4RJKA 3R0JA 4R8KA 3T4XA 4AF6A 5L51A 3TMKA 1U0EA 1KBQA 4FXPA 4OJTA 2B36A 4G5FA 5E38A 1CDEA 5JTTA 4Q1CA 3V33A 1KTIA 2QTTA 2ONKA 3AF1A 2JLWA 2WINI 4A91A 1K6EA 3D7RA 3U3RA 1XZGA 2CE2X 4Q18A 1PFUA 3OY2A 1WL8A 2HAEA 3QVOA 4ARIA 1KY3A 4HZUA 3KX2A 4KN9S 4JT8A 4EFNA 4FGUA 2WD8A 4M1MA 5I9LA 4KZPA 2G07A 2VPWA 5JO0A 1GU1A 2QZJA 5KMGA 2CJWB 4FJ2A 1W85A 2ZYHA 3HB4X 3REQB 4AMVA 4YEDA 5A4IS 2Z09A 1CY2A 2H63A 4EY4A 4RDXA 4IFTA 2E5WA 3AR2A 1W7AA 3TQCA 1VRCA 4QG7A 1JQAA 3EVCA 2FE1A 3IT1A 3DE7X 4IM7A 1B8NA 1JIJA 3E3LA 1T9GR 1KFCB 1R9NA 2WSIA 1T2VA 5TQJA 3B3FA 4ALMA 4DIKA 4ER7A 4ZEWA 4DR2B 3WMRA 1SXJE 3HB0A 2PU7A 3DAYA 4ZCRA 1GUFA 3CR3C 1E0JA 4U39A 4L72A 4N0QA 3T41A 4M7RA 3NASA 5EXTA 5TPZD 3RSLA 3TRDA 1V39A 4TV8B 1XZFA 4GC9A 4BAGA 3PBKA 2H7YA 2HJGA 4XVQA 4GFDA 3S2IA 4OOFA 1G5IA 2IXAA 1C9NA 3V7UA 1BGWA 4V0ME 4LV8B 3D0QA 3LBIA 1Z16A 4HN4B 1E3WB 1PNRA 3PNSA 3IUPA 4BLSA 3MILA 1V3TA 3UFXB 2Q9CA 2XT9A 3JALB 1RC0A 3KKZA 1R0XA 4BP8A 1CJTC 1DRVA 4IGFA 4O2AA 2NTVA 3MLBA 2EWMA 4ARZA 4MS3A 1EIZA 1POWA 4OI1A 2FPWA 4AP5A 4GOLD 3INNA 1EFLA 2M6RA 3BA1A 3K5PA 3VNRA 3KFVA 4PC1A 1PVVA 1B7GO 2JHPA 4IX1A 1WNTA 1CR4A 1BRTA 2FYTA 2XNDA 4FR5A 4DIMA 2HB6A 2VHYA 3WB9A 1Z6TA 4OQQA 2VP4A 1DFIA 4U6SA 5BUSA 4CEHB 3M3HA 3PGA1 1N2CB 4TV9F 1Q7CA 4BB5A 1S01A 2ISQA 1XVUA 4B35A 3PT9A 4PE5B 4GVLA 4AQ7A 1AGNA 3ZCXA 1TVKB 4NBNA 5FV7A 3N6VA 1FJHA 3BWYA 3NZEA 4HGQA 3BIJA 3THYA 1WWKA 4GPD1 3DTYA 3QPAA 1UXKA 4RTPA 4RJIA 1EUCB 2O0JA 5G3ZA 3W06A 3T3DA 4GP9A 3TAHA 3GN2A 2H9YA 4U8GA 4HX5A 3N74A 3GMSA 2PV0A 1RQRA 1SHZA 2FXIA 3DV0A 4FPXA 1YCFA 2C83A 2RGNC 3ENVA 1GKIA 2VDRB 1LNSA 2EC5A 1FLAA 2WWHA 3GJTA 4U7JA 1AK9A 2VA9A 3T7RA 2I2FA 3E9MA 3KKKA 4HGRA 1AV7A 1DQZA 4YACA 3KOXA 5KJEA 1USGA 2VAPA 4YXWD 1CF2O 1CD5A 3JZMA 4FMPA 1UDRA 3FAKA 3G2LA 5BNFA 3F7TA 5TQ0A 3M70A 3PZBA 2GS9A 3RC9A 1YOBA 4G84A 1O97C 1AM4D 3QXSA 4RD3A 5DO9A 4OU4A 2DFTA 3LM8A 4C6RA 2HV8A 5DBFA 4HMQA 3WL7A 2P2GA 2HBQA 3HUTA 4BJHB 2MSWA 2R3SA 1RAAA 1MEJA 5AM5A 1UBGA 2YICA 1M6YA 4QSHA 2ZSKA 1M0TA 5KYWB 3S8EA 1V3VA 1Q16A 3CW2A 4GPZA 3T9FA 1QP8A 1W4RA 5CIWA 3S5UA 1U0HC 4H4EA 5G4KB 2GESA 4TQUS 1GGVA 2ZRGA 1IRIA 2C20A 3PL5A 4L74A 5FHQA 3HFSA 1ZY2A 3HMKA 4H7IA 4C7XA 1BHQ1 2QAJA 2BGLA 1VBKA 3U1BA 2TRSB 3W5UA 3Q8KA 3I9V6 4A6PA 1PGNA 4R6XA 4KH0A 3SC2A 4YRGA 1XE3A 2FY8A 2QX6A 4DQDA 1W34A 5HKOA 4OX9B 5JLJA 4UBMA 3ICVA 5DE3A 3A3OA 4X85A 3UHJA 5AJUA 4NKRA 1U8CB 2OK8A 5LZ9A 1IEQA 3HLTA 1J97A 1D8TA 1R6VA 4E31A 3LGXA 3DS8A 1KTVA 3HDTA 1GAQA 5HUJA 3GZNA 1EDBA 1MT3A 3WADA 2EKBA 4DV6B 3L6OO 5CXUA 1SVMA 3WRXA 4WASA 4RELA 3EEQA 4UARA 3ZY4A 1FRZA 4MVYA 4R1LA 2V45A 3UC9A 1TZCA 2GBGA 1CZUA 1BS2A 5NLLA 4CM9D 1M2NA 2VPPA 2FX2A 3GDGA 4MV9A 4XWAA 5AT1A 1ISJA 1DO2A 1Q7BA 4Q02A 1CY8A 2B69A 4JYBA 1U8XX 5A9SA 4CEIA 2P41A 3HUEA 3G13A 2WHPA 4XUGB 3WLKX 1DDIA 2PRJA 2XCIA 2C2WA 2NWQA 4B84A 2AC4A 1T6NA 4MQFB 1MJGM 5FFNA 4YRSA 1JFSA 3IEIA 3MQFA 2J9RA 3TW6A 3AUJB 3ZW7A 3MBIA 2IEZA 2QR5A 1E9DA 2CXQA 3VH2A 4IGKA 1EWQA 4YYEA 1JT9A 3ZDFA 5C3MA 1XTIA 1M67A 3PQ6A 3C70A 3ILHA 1Z37A 2X0KA 4FX5A 4KMMA 3TLMA 3EF3A 4MUAA 4UVHA 3TRHA 1W48A 2BY4A 1BRMA 3D2CA 5HWSA 2Y2UA 1R4AA 3I0ZA 4HFRA 1V5FA 1EBUA 2JK1A 4X90A 3ZD8A 4C6TB 1Y7HA 1EK1A 5D1NA 4YRZA 1GPUA 2J3EA 2PGXA 3BH0A 5LQCA 3QKWA 4L9WA 9ATCA 3AJEA 5LN1A 1WA5A 3QJGA 3BICA 3NBMA 4FZJA 1K7FB 1XMJA 1YQEA 4A73A 1YR7A 1Q83A 1YB4A 2I6XA 3PHBE 3TOCA 4DA7A 4BRUA 5FB3A 1LVHA 2IYSA 2VUUA 1UKYA 2E37A 3GJ8A 4ID3A 4M76B 4P0TA 5JSHA 4FEEA 2WHRA 2DTXA 3VJMA 1SVLA 3WL6A 4E2XA 1OWMA 2VRBA 1KO8A 5DPMA 2BFBA 1TJ4A 1YUNA 1X3SA 3U39A 1A5SB 4ARBA 1T43A 4HLQB 3VR3D 3RAEC 2XOXA 2VF2A 1I6MA 5EHZA 4JS0A 4E22A 1U2DA 2GNAA 1BYUA 2JGRA 5E9AA 4A2WA 3L0YA 4XSVA 3WLIA 3H75A 1KOGA 1F7VA 2J4FA 2POQX 2YZKA 1E2EA 2PA3A 3O83A 4IDEA 3A04A 3SJCA 3ZGNA 2A35A 2PVPA 5K45A 2EFGA 5T7BA 3CNBA 4Q4CA 3K2EA 3QX8A 1KJQA 4QVKA 1KMQA 1FJGB 2IEYA 4UHEA 5ALNA 3O95A 5FBZA 3A3YA 1ECJA 3RAPR 2WJ6A 1E2QA 1RXSA 4PINA 3ZXIA 4ZTUB 2YDXA 1KFKB 3LO8A 4WLFA 1F3LA 3B5IA 3TL6A 1SCUB 1YULA 3TKLA 1DSSG 5AXBA 4EG5A 2CDAA 1Z74A 4PFSA 1O57A 3RRYA 4YCMA 1SBCA 2IOFA 2HQRA 4JITA 4LJ9A 1CR1A 4AN1A 5KX5F 1OIXA 1L5FA 1QOZA 1QYDA 2AIRA 3ZE7A 2E49A 4J1TC 4YQFA 3NEAA 4Q34A 3QY9A 4DMMA 1V7CA 4MS3B 5B3LA 4HWOA 5GY7A 4CIAA 3OLCX 3N2ZB 4KAXA 3DEJA 3GCGA 3SSMA 1YOVB 3KVYA 4BHTA 5GJWC 2PKCA 4EEKA 1RP1A 2XMCA 5TT1A 1SCJA 1XMIA 1JIIA 3K32A 4KKXB 2PH3A 4EVIA 4IFEA 4HBZA 1OC2A 1Q0HA 2H16A 3MF4A 4IV5A 3U17A 4BBAA 5EHXA 2FOLA 3G49A 5AJYA 1A88A 2Y71A 1ZQ1A 3H9JA 1I7LA 1ZK2A 2OFOA 3L6EA 4W9MC 1M5RA 3KKMA 4IXNA 4KGDA 2JIRA 3MJEA 1CLUA 3T3EA 1P4AA 3BTSA 3SYTA 2N46A 5KNBH 1C7EA 4IUYA 1FLDA 1U0TA 1P1HA 4JEUA 4NCNA 2QKYA 5H82A 4NOKA 3TBHA 2O8NA 1WZEA 2PSDA 3CSSA 4ZMBA 1UBCA 4IMIB 4IMRA 2G6TA 2J8ZA 2OGWA 2B6NA 5BN4B 1J24A 1Q57A 3I83A 3IKLA 3NUGA 1VHTA 3VPGA 1L5WA 3WFZA 2IA5A 4KKVA 3WTCA 1T2CA 4L0QA 5HTOA 1XN1A 3GLTA 3LOPA 3MN1A 4DGSA 4E88A 1B0PA 3WYGA 3AY0A 2JH9A 3A0UA 1FW8A 1QC5A 1J7KA 2O5VA 5TQ0B 1V71A 4N0PA 3HYRA 3L7DA 1NLYA 3NX4A 2BI4A 2J3KA 2WUDA 3LUGA 4P1ZA 4XM2A 1QRUA 2QLFA 2YHIB 3AEQA 1JDVA 5H4GA 1ZQ9A 1N6PA 2BKXA 1AF7A 1J7JA 4LXYA 3GROA 2NO0A 9LDTA 1GPAA 4XQ0A 2Y76A 5AJXA 2KLHA 3EODA 2C03A 3P0FA 3JR7A 1J90A 3WJ7A 3SQDA 1JDNA 1E79A 3IESA 4I2NA 4GPTA 1CZLA 3AIIA 4TVBA 3UMMA 1MG5A 2EKPA 4KVGA 4AF8A 4IZ6A 5E2IA 3IFSA 4J94A 5FCDA 4R1OA 5KNCD 2J4CA 4I4IA 4FMCF 4GYYA 5H8WA 5IU6A 2V7XA 1I24A 3L7LA 1FXWA 3JRWA 2ZIZA 1T3GA 3S55A 4AUNA 4OK3A 4F7DA 5BVHB 4HYEA 1GARA 1XTSA 5EERA 3QJYA 3G2KA 4C4TA 1P44A 4ZDIA 4HAOA 5K0LA 4YMHA 5JJ5A 1TFRA 2Z4RA 1I2MA 4IUCS 3IR7A 5CT5A 2BFNA 3WAJA 5A7FA 1KDTA 1ISGA 1SQ0A 5LDHA 3LDFA 1RQ2A 5JS7A 1XCPA 4YCJA 3OZUA 4JBIA