4UQLA

High-resolution structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
b'AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title Crystallographic Studies of [Nife]-Hydrogenase Mutants: Towards Consensus Structures for the Elusive Unready Oxidized States.
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
total genus 83
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4uqlA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4uqlA02
4UQPA 4KO2S 5A4MS 1UBHS 3AYZB 1FRVA 1WULS 4CI0B 3ZE8A 3ZE7A 4TTTS 4UE6A 3ZE9A 4KN9S 1YRQA 5JSYA 4UCWA 4C3OB 1UBUS 2FRVA 3H3XA 4IUCS 1WUHS 4U9IS 4KO3S 4IUBS 3USES 4UD6A 5A4FS 5ADUS 4UEWA 4UPVA 4GD3Q 4IUDS 1UBMS 3USCS 4UCXA 3ZE6A 3ZEAA 5JT1A 1WUJS 4KO1S 4UCQA 4UE2A 5D51S 1YQ9A 3CUSA 1UBTS 4UEQA 4UD2A 4KO4S 5JSKA 1UBRS 4U9HS 5JSHA 5JRDS 2WPNA 1WUIS 1H2AS 4UPEA 5JSUA 1E3DA 5A4IS 4KL8S 1UBJS 3CURA 4OMFG 3AYXB 4UQLA 1UBKS 3UQYS 4UE3S 1UBOS 3RGWS 1FRFS 1WUKS 1CC1S 4URHA 1H2RS 1YQWA 3MYRA 1UBLS
chains in the Genus database with same CATH superfamily
3LQKA 1RCFA 4ZYZA 3DLAA 4E2FA 4XDHA 1H23A 1JI0A 5AVYA 2BRUC 1QRTA 2C54A 1BJTA 3KXKA 1IY9A 1OQAA 2EARA 1Z26A 1XJ0A 2PRIA 1Q16A 3RVLA 4OSPA 3TWOA 3WHKA 1UZNA 1NP7A 4V3BA 4NYJQ 5CA0F 1EWVA 3T12A 2NUBA 3TKAA 2RGGA 2WPDA 2NAFA 4EG1A 3LWNA 2B37A 1VJTA 3ZXUB 2ZYSA 4J9UE 4G8JA 1E9CA 1XKLA 2C92A 3EVCA 4GPZA 4MTLA 3O31A 1MGOA 1OX4B 2IPNA 4U5QA 2B98A 1VHDA 3NNNA 2PBLA 1KMQA 2WBLC 4D3XA 2NXJA 2V6MA 3KOYA 4YT8A 5K4GA 3ZJTA 3Q9LA 4XDZA 3T8YA 2GBLC 1NVMB 4MH0R 4RYLA 2VP3A 2V96A 1CSEE 5IDXA 4RMIA 4BN4A 2CWWA 4QYIA 3EF3A 3FSJX 1XYGA 5DU2A 3I34X 3EA0A 5PGMA 1XF9A 3LCUA 3AF6A 4R3NA 2EKQA 2AB0A 3IT0A 1L5LA 5ADVA 3KJZA 1R0RE 3CE6A 3Q15C 1BWRA 2QJTA 4IDHA 4PVCA 1FYDA 3K9FC 5A3JA 1L6IA 4ITVA 4WJKB 2GZ1A 4TRJA 1IUPA 1Z2OX 3RBAA 3D8TA 4DNPA 4LYDA 4L16A 4ZAXA 4MWCA 2O2IA 2F1IA 4IJWA 5G0WA 3VJKA 5ALXA 1GDTA 1E3EA 1PNTA 3MUOA 1WZIA 5CVCA 3H5VA 1BXKA 1I13A 2ECFA 3O4HA 1NE7A 4RD2A 5GONB 3W9SA 4DUPA 2C3UA 3ETJA 4NZYA 4AY6A 1MG5A 4OHCA 3VSBA 5KYYA 1TU3A 4Q7EA 5F9MA 3UICA 4EJMA 4DMFA 5ARBA 2EJUA 2I29A 1LSOA 4JLAA 4R5HA 3ZHUA 4WKGA 1KYWA 4GMGA 5CNJA 5D1NA 1OTYA 2EP5A 1FFSA 1KEPA 3LE8A 4PQYA 3VPAA 3KHUA 5TS2A 3I9OA 3ZU2A 3C8DA 3BD8A 2H65A 4EX7A 2O2CA 4F2DA 4O4IA 3J7AC 2RBKA 1PZHA 2P30A 3U16A 1ADGA 2AZ4A 1L7VC 4IEIA 2WJVA 3AUTA 5JQGB 4EFLA 2AMVA 2P2ZA 1OZFA 3ISTA 4MR9B 2OY0A 1JP7A 5K8TA 4ZZ2A 4EELA 3MILA 4MSUA 3NHFA 2QTMA 3M81A 5IU6A 4L8GA 3A3YA 1B14A 3U7RA 4GM1A 1AJEA 2RONA 4FLFA 1MABA 5AJXA 2V6JA 4S0ZA 4CR6A 8LDHA 3X2EA 3HU2A 1TA9A 2C5LA 2JATA 2QRVA 2ZJZA 3RTDA 2XIJA 2RHDA 4NHEA 2VDJA 1AB6A 1QMGA 4KIWA 5TQ2B 2YICA 3VDXA 2Q3BA 3TB4A 4RPGA 2GCGA 5KSZA 1XELA 3KXIA 521PA 2VC2B 1N6RA 2EBUA 2OKCA 4O08A 5E3HA 3EIEA 4MV9A 2DRIA 5LP6C 3GZTB 2YJGA 4IOJA 4Q48A 4DLZA 4B4VA 4WN9B 1MQSA 5BXYA 2O8EA 3JZIA 4JBXA 1FVXA 1SKYB 4MCJA 3HDVA 3RVJA 1GEEA 3TPCA 5HIMA 3R9KA 4CLXA 3TOZA 5KJCA 4ZRMA 1CY4A 3SOZA 1TW2A 3UEOA 4KACA 4XYMA 5CTAA 1WG8A 2ZE6A 3EARA 4Q93A 4TROA 3HGTA 5LSAA 1N2BA 1P5HA 2JVJA 2QENA 3AX6A 5BUQA 3G0HA 4L4RA 3ZGVA 2W00A 4ZVTA 3IV6A 4ML3A 2EGGA 2G9QA 1EM8A 4N1AA 5JD4A 1AK2A 1E3SA 1XJWA 1PNVA 5C8YB 4ABYA 1QZTA 2FRVA 4QJ4A 3CVYA 4KQ2A 2XQGA 3OLVA 1RLOA 1MUUA 4TLEA 1OIXA 3T3NA 1SD5A 3L7BA 5H3HA 2HPHA 1A76A 1ZCFA 1N78A 3E27A 3C3AA 1U5BA 1YZFA 3ODPA 3TCXB 4P4LA 5K0SA 1G6KA 4G1UC 3NTUA 4F97A 3Q7SA 4D79A 1BXGB 3AM1A 1W85A 2QN1A 1T1RA 4QULA 4MZDA 4C0XA 4CKCA 2GA9A 2IEYA 4XA8A 4YAKA 1O03A 3OO0A 3TRJA 2PYDA 1P4HA 3KJFA 4F12A 5A4JA 5DWVA 1PR6A 3U6BA 4FDLA 4O63O 4RCZA 4RPJA 5J5AA 1RT9A 4ZANA 1Q1ZA 1W5SA 3GUUA 4RFSA 5GY7A 2UVPB 5CM9C 4YYEA 4AWBA 5IANA 3PGA1 4WZBE 3QWBA 1QC5B 1QK5A 1CQWA 4TKVB 5C9ZA 4TQ9A 1NNI1 3UV7A 1IMOA 3ZGNA 3SS8A 1KI4A 3E15A 1GUAA 4NFLA 3KV3O 1HI9A 5FI5A 1R6XA 2IU0A 2IL1A 2D1SA 2XWPA 3ESQA 2DLNA 4B79A 1ZH4A 3UGJA 1QK3A 2J9GA 3KUXA 4EHAA 1UXJA 3M6IA 1GDDA 3KVNA 3G7UA 3T0FA 3ZU5A 5LMZA 3A7DA 1W5EA 2IQIA 1N1GA 1CHDA 2ZB7A 3GOQA 4G0OA 4N01A 5J1TB 1Z33A 3FE2A 2NVUB 3SYKA 4FNAA 1E1YA 1ZIDA 2FZVA 5DCYA 4BLRA 1LPNA 5AKEA 2VNHA 5HF6A 3A04A 1FMLA 4LOHA 4TUYB 3E7WA 1SXJD 2H85A 4F84A 1D6NA 2YWHA 3KZNA 4PSCA 5DGDA 4ZJUA 3AKCA 4LWOA 1E9SA 3BXFA 2ID8A 4PS1A 4QQKA 2VPQA 1XPOA 4TT8A 1QJCA 3DP9A 3SBEA 1EE2A 1ZNYA 3UT5B 4UNQA 3WLTA 4MO2A 1KVSA 2E6KA 1R9NA 3MT7A 3HYRA 3PQ6A 5IJ0B 5JR3A 1A82A 1IEWA 5G0VA 3SFTA 3DDOA 4DZZA 3IVAA 2BKAA 3UJNA 4WACA 3DG9A 1JHYA 2Q5IA 2ZAIA 4OA8A 4CIAA 2FR1A 3V1MA 1T24A 3V8VA 2I6QA 3QPWA 3RG2A 3BD7A 3PT9A 4EW1A 4JLVA 2BJVA 2TECE 4YDRA 4BMZA 1JHVA 5JPIA 1IXRC 3D2CA 3IDAA 2HHJA 4NZPA 2FGKA 2YWEA 4LJ9A 4OKIA 4M0CA 1NW7A 2WIDA 4F38A 5LYJB 3HKCB 4LECA 1DAFA 4HXYA 5F2NA 2FW0A 3RK1A 4MDFA 3B53X 3V1KA 4I4TB 1EA7A 2YCLA 2IPOA 2C7BA 3UKJA 5ADHA 3OC6A 4MB6A 3WYAA 1RYNA 4UEOA 3U7FB 2ALJA 4AWAA 2FX5A 4XWWA 1ILWA 4FUQA 4RUKA 4GVLA 5A2QA 1XCOA 1Z5UA 2UYGA 3ZE9A 3WDLA 5F3RA 3HCFA 3CEAA 4P4SA 5I8ZA 3GX1A 1NSYA 3KTAB 3L92A 2VDUE 3MCWA 3NVMB 4WXEA 5IF3A 5KNCA 3UMYA 3EQZA 2FEPA 4HUQB 4WE3A 2R5WA 5FJIA 3ETEA 1Q14A 4E22A 2ZE8A 2PS1A 4E09A 4RCVA 7MDHA 4GL2A 4IIXA 2YOFA 4LNUA 3HFGA 4YAUA 5ICFA 4WCFA 1KPGA 4IGAA 2BEJA 4YBZA 3OPYA 4H16A 3UK0A 4LC1A 1FS6A 1DG1G 1Y82A 2RAPA 3N8HA 4TV8A 2YHUA 3NT5A 3VR6H 3R9XB 2GZAA 5F98A 4JLMA 2IWRA 4TN5A 5JZ9A 3OI7A 4RK0A 5HR5A 5I7RA 2WKSA 1HNZB 3IEVA 2O2EA 2ZM6B 5IZ4A 1E69A 2C9CA 4BJ5A 4RXTA 3DW1X 5CNIA 3TSWA 1E99A 2UDPA 4K2AA 1U0EA 4HS4A 5FUMA 3IVXA 1R5NA 1GT6A 2O7QA 2HWYA 5B3JC 2HMYB 4RE6A 1N4AA 4GS5A 4ZVSA 3DDSA 1JKXA 3MERA 5BNIA 5IH7A 3IXMA 2N9UA 5LQRA 1D4FA 2ODBA 1NC1A 3ZCPA 1WMBA 1C4OA 2P1ZA 4OJTA 5DISB 2GI4A 2HA4A 3GMTA 4IV0A 1Z2NX 3KFLA 4M54A 4OXIA 4ID3A 5ELXA 4X1YA 1X9GA 3B9BA 3CVWA 1L5NA 2CDRA 4N41A 4L8FA 1J0AA 1DXQA 2VQSA 4HQKA 3RJ5A 1YZGA 1ZM3A 1PYDA 1R6AA 4UM5A 3G3EA 3ROMA 2H92A 4G01B 4XRRA 4ZT6A 3T7RA 4FEYA 1H2AS 4LMRA 4DYDA 5CFQA 2AVDA 1IDOA 2X0NA 2P6OA 2WSYB 4WL0A 3TZ6A 2C58A 1ORIA 4Y67A 2GEJA 2WJJA 3U5ZB 1VE3A 3H6KA 2Z2JA 1NY6A 1YMQA 4LY0A 4QNMA 5LB2A 1M2NA 3W4KA 1H0SA 2PGJA 4EPVA 1EPUA 3HB7A 2ZSFA 2AEEA 4YCAA 5G0SA 5DXJA 2FXIA 5CX4A 4R71A 1W5AA 5AFSA 2FV8A 1RC8A 2BGUA 2W8BA 2Y9MB 2ZT8A 2NU7B 1NIJA 1EIZA 2OVFA 1W93A 2P69A 4NICA 5HGXA 2IU3A 2TMYA 2CL7X 4LBWA 4JBWA 1JSXA 4A16A 1QZZA 4LJSA 3K9HA 2J9YB 3MTJA 2Z9BA 2B4RO 4LZNA 4F4JA 4Z1OA 1PS0A 3LUKA 1SU7A 2QRMA 1ABFA 3NX4A 3MWKA 4OGWA 5GZ3A 3TUZC 3FJYA 5GWXA 3RU2A 5CA1B 2C84A 2O7VA 1ZAKA 1HDOA 3DZ8A 4Q12A 3ZKAA 1JTVA 3OZTA 4EO7A 1RIIA 4DTIA 3AEQA 3O2JA 3L40A 3OE7D 1PX2A 2D4HA 3MW8A 3MXTA 4GGOA 4U9UA 5BVHA 2AK2A 2CNKA 3D59A 4RMJA 5GOZA 1T5IA 3HI4A 3K0CC 3UQZA 3RIEA 1NSFA 2J5XA 4V0QA 1GPWB 2IHYA 2Y67A 4P38A 1ULSA 3WGUA 4EL0A 3QM1A 4IWYA 5TVGA 1W7AA 3NTLA 4N8DA 1BA3A 4IYRA 4D9CA 1L5KA 4KXNA 5BSMA 1MAVA 4DM3A 2DZDA 1ICIA 3EAGA 3M34A 1GSAA 1YL7A 5DO9A 2D7CA 3UWMA 1KO5A 4OM7A 4GU5A 1R5BA 1W5FA 1Z88A 1H2BA 3QEMA 4MARA 3VYRB 2FSGA 3PPIA 3ZDQA 2ZUFA 3L79A 5F78A 3PCTA 4BAUA 2RK3A 2VJMA 3R74A 1LB1B 2W22A 4G63A 1FZQA 2O3JA 3KQLA 1UQUA 1W29A 2YNMD 4QC2A 4ZVRA 5L4SA 3H1AA 1U3DA 2QAGA 1D6MA 1X87A 3MCZA 3P9IA 4R1SA 3FVQA 4RA6B 4XGIA 2IXBA 1NXQA 1AOXA 4DCVA 3FZNA 5DGHA 1PW5A 3M6WA 4AJNA 2BJWA 3ZI0A 3SNKA 3RYCA 3CX6A 4HNSA 3VO9A 1RPJA 3VPGA 1CEEA 1RR6A 3FMGA 3FLAA 2ZETA 3DTVA 3C3XA 3D6MA 2W2VA 2OMEA 4H1UA 1E6EA 2MINB 3B3QA 3HNPA 3QLJA 4LX8A 2XUPA 3A6EA 3E9NA 3NW9A 2PMCA 2QNIA 1MFZA 1OA0A 1FUKA 1SU6A 1KFCB 2MTBA 2XVZA 4MMXB 4K9QA 4ATNA 1FDRA 3GN1A 5JS6A 1THTA 1KJ8A 4B4KA 2RHWA 4CLHA 1T0HB 1NPTO 1OX6A 4IW3B 4ZEMA 1JHZA 4I5DA 3ICCA 4JS0A 3GGOA 1FNNA 4BVKA 1BQEA 1DRKA 4LCBA 1XZKA 2BP7A 3G8YA 3NC4A 4QVKA 1A7KA 1UZUA 5DNVA 1AY0A 2BM0A 3GJRA 5AKLA 2G28A 3R7BA 1DEHA 1C80A 1HL3A 4RYDA 4HQNA 1UDAA 1MVNA 3PTLA 3FTDA 4RLHA 3UHFA 2ACEA 2BCEA 3DT6A 2FEMA 3OJEA 4R9VA 2I91A 3IHKA 1OT3A 4EGQA 3MLBA 3TG2A 2WWYA 4CEIA 1M3SA 5FX2A 1IIRA 4C22A 4CV1A 3FOCA 4DT1B 5BR1A 2X0IA 1ATIA 5HDQA 4D8TA 2XGJA 4MYDA 4NRDA 2C4TA 4Q82A 2WIBA 4S1WA 2NQ8A 3ZXSA 2GT1A 4KMSA 5FUYA 3RLFA 4EA6A 1K8YB 1N2CE 3O75A 3INYA 1R9MA 2OB1A 3H75A 1H0HA 1CE8A 2LGJA 2WWFA 2PZJA 1IZYA 4N3NA 2R6HA 4OHWA 3GA5A 5JANA 4IZOA 5IBQA 5IHXA 1H2WA 1T8TA 1WOYA 3L8MA 4Q9LA 2FPUA 2QUKA 4KQ1A 3FKQA 2PH5A 2A33A 1V43A 1X7ZA 1SB8A 3EW9A 3O2SB 5DI3B 4Q1CA 4QGHA 1K2WA 1XTUA 1VKNA 3BXHA 1Q0UA 2ZCVA 1VM6A 2O2JA 3A6ZA 3FAKA 4NCXA 5BN3A 1E2LA 3TDKA 1DJLA 3TNFA 5J4VA 4X95A 5AJWA 3MYRA 5HG0A 4BCBA 1U99A 3T5BA 2JD0A 1UMCB 1U7OA 4XYBA 5ALKA 2MSNA 2H2HA 4JJ6A 3KXDA 4W5OA 3KAPA 3QKWA 4RPLA 2J48A 4A92A 1A2QA 5KIAA 3STWA 4YWHA 4LXXA 3CW2A 3LY8A 3G9UA 4PZPA 3KCQA 4D97A 4RK6A 4D96A 1KDTA 2WTEA 3KD3A 2WE8A 1K68A 4OXQA 1AXGA 1HYGA 4D5GA 5DNCA 4EYOA 1FDVA 1Z0SA 2PR2A 2ABWA 3ULKA 2A59A 4YMLA 2AN4A 5JAQA 2WKRA 3UBTA 1ESNA 3BXPA 3GIWA 1L5HB 3QBDA 3KJIA 1XZGA 2YHSA 3C1AA 3KVOA 1M1YE 4F04A 1A9QA 2G67A 2IHJA 4L15A 1GKKA 4U4AA 2NUTA 2X58A 2D00A 2I99A 1QHEA 1RXEA 1V6AA 2QVLA 3QXJA 3QENA 4X3OA 1X9IA 3TZHA 1MZPA 2MSEB 3WWYA 3UN1A 3BFXA 5AVTA 3QF4A 3AHCA 3QVMA 2IODA 3WQQA 4H7EA 3VBEA 2R3SA 5HWSA 1RQLA 3AI2A 4X64B 4HYEA 4UAGA 1MRNA 3GRAA 3KEFA 3WL5A 6LDHA 4AN0A 1QZXA 1G4AE 4LMAA 3FVWA 4XGQA 4DJ5X 2A35A 2YUTA 1XRPA 2Z4TA 3NHRA 5FLKA 4ERXA 3BJZA 1R8SA 2RHTA 4FFMA 4IEEA 4NU8X 4LGYA 4Y1GA 5DGXA 2EXXA 5IAGA 1JSLA 3GVPA 4RNCA 3HJFA 2H11A 4J16C 3BK2A 4JVLA 1J2TA 1CVLA 1G3UA 3GIDA 3QNMA 2YINC 2IY7A 4JUIA 2CN1A 1KOLA 4QKQA 2Z3WA 4ZALA 1XCMA 1UM9A 2X7JA 3NBKA 1U2GC 4IX9A 3WO1A 1X3SA 2QE7A 2IEAA 4B1FA 4D0RA 4F2WA 8ABPA 3NUZA 3I0MA 1CQZA 1EP1B 1WXQA 4UEKA 5FFNA 1DB3A 1UXKA 4PPQA 4FFDA 4DMCA 4B0PA 1RZVA 2BMAA 3HJTA 1QOQB 4BYGA 2G25A 4EQ6B 4WK4B 1TZMA 1BS2A 4K3VA 4D4KA 5CBPB 4FPXA 1F14A 4JR2A 4WWHA 5D7NA 2X2OA 1GUBA 1F6DA 2Q7OE 1TYDE 3D3QA 2IEDA 2O2ZA 2RGWA 3GHHA 3OHPA 1A9YA 2QN7A 1P7PA 1P4JA 4HSGA 4A27A 1LWOA 1YVEI 3D3WA 5I51A 2NZWA 5JSZB 1FFWA 3IR7A 4XH9B 4CM1A 2BTEA 1XL1A 2X6TA 4C4YA 1JIKA 3MELA 3QLVC 4EY3A 1O6FA 2ISSD 5K01A 4M0MA 5C8YF 1FTSA 2ANBA 3PGKA 1I3CA 5ALZA 1TUBA 2QK4A 1MCZA 5ILOA 2B7CA 1KEEA 1FW8A 3QU2A 3B1ZA 1OMOA 2QX8A 4MHSA 4MJLA 3U4GA 1NR7A 3A9SA 2X42A 1KZGB 1DBVO 2WYWA 3JWEA 4L9WA 5E6UA 2WJWA 3DM5A 3NRJA 4Q0MA 4LGMA 3RRNA 1NVVQ 3NZEA 5KTYA 3CLHA 1G20A 3ZDFA 5B1SA 1NGSA 4CPDA 2IE0A 1EE9A 1O77A 3HE3A 5SYNA 3RVRA 2JK0A 1O6BA 2VF8A 3MJSA 4QYMA 5CGQB 3WGGA 1NLZA 3KEGA 1UFOA 4I5GA 3ZGOA 3U4IA 4HMPA 1CQJA 1JAHA 3GLIE 4QU0A 3ROXA 3U1BA 1E1CB 5EE9A 2ZBRA 3BFKA 4I55A 1K8QA 1TYAE 2AA3A 1UK8A 3HUEA 5DYGA 4C0BA 5ITZB 3N2GA 5HQ3B 1XKTA 4MX8A 4PQRA 1GZ5A 3Q6IA 3NBUA 4O4LB 1Z47A 3ZY3A 3GQBA 3P9SA 2PUWA 1EP9A 4H2DA 2D6FA 2FMUA 1LNQA 1AGNA 1Y8QB 4QGBA 1XR3A 1R8YA 4LOLA 4U2DA 1E1NA 1SOVA 5DN9A 1MAAA 1NXPA 2TYSB 4DEXA 2A67A 3QX3A 5HFAA 1HG0A 5AM3A 2VTKA 3KJEA 1U98A 2O3TA 5SYMA 1JA0A 3WKEA 1M2GA 3PNLA 4QUEA 1F1JA 4Q1EA 4PG6A 2DUMA 2HIAA 1FU4A 1V48A 2XODA 1SXJE 4PU0A 4J0CA 3PQDA 3I2JA 3EIUA 1RM4A 1H4TA 1Z28A 4B48A 3B2EA 1QRAA 4IDCA 4HZUA 4J03A 1ILEA 1FFXA 1FVOA 1MKYA 4B3CA 4HNVA 1JDTA 3SYRA 3QJ5A 3U44A 3OP1A 1P17A 4H7FA 4YJFA 5E6SA 4WJLA 3LY5A 2C8JA 4DDVA 3PC2A 1YTLA 1NRIA 3AUYA 2REQA 3KKKA 4FLMA 4O4JB 4BP8A 4GT1A 1TQ2A 2HRCA 2RH8A 4URYR 2DBZA 4ND8A 1Z0AA 1VL0A 1OTXA 3F2IA 1MV5A 3BA1A 3N2EA 1NHGA 3FMFA 2HA6A 4O33A 3RVPA 3HRIA 5AK4A 4DPLA 3WJ2A 1PEYA 3A2KA 3CINA 2C2YA 2AJ8A 2BJHA 4D80A 5MN6A 1Y98A 4IHQA 1J07A 4TMVA 2VTBA 5MHTA 4RTLA 7REQB 4MP6A 3CH5A 2ONKA 2QM3A 4LKRA 5CRIA 3RT9A 3TOCA 1DC5A 3L06A 3TW4A 4CMAA 4WSOA 1NNLA 3G13A 4FZ3A 2FW7A 3KUDA 3M5CA 4NBLA 5E9JA 3WIDA 3I28A 3SP1A 3BH0A 1QV9A 1QZUA 3I6BA 4E4TA 2I1LA 3VQTA 1ZD2P 3HU5A 5A6SB 4YRBA 4N5NA 1V1JA 2HCBA 2JARA 3L6DA 3DZHA 4JC8A 3SNHA 3I2YX 2Y1CA 1GT91 1J97A 2YV3A 3UH0A 3KB1A 3M4XA 1RRVA 4OATA 1HORA 1EQAA 1VHLA 5K5EA 5F7JA 3TE7A 2CV2A 2X9LA 1PE0A 4MR8B 1VSTA 2BFFB 4HG2A 3K5IA 4EHFA 3Q1LA 3BDAA 4TYYA 2AEJA 2P77A 4BB5A 1OFGA 3UFXA 4ZODA 2SKDA 4CIVA 1GDHA 3CZ4A 3FPJA 4D9BA 4JI8B 2BMVA 5H82A 2L18A 3T9CA 4NV0A 1J9GA 3ZG6A 2RHJA 4LCJA 4RNDB 1RYDA 1MB9A 3DV0B 2OAP1 3HB9A 4ETIA 2OBBA 2RKBA 1I4DD 2MWMA 4ARSA 2C9BA 2I6TA 1M2JA 3EG9B 4EIWA 3DPSA 1FRQA 1QPBA 1T0PA 1TMYA 2QRHA 4PQGA 4AWXA 1L6RA 3SEFA 4AJIA 1QLWA 4LRYA 3QA3E 3WLKX 4B7AA 3M7IA 2GVDC 1V16A 1GQRA 3OFKA 5EYPB 2JIMA 4GGPA 3TQQA 4ARVA 1EQUA 1PJZA 4KI7A 1WOMA 2GX6A 3BCRA 3OJ0A 4D8YA 4CMEC 2F8LA 1I0LA 5A6VA 4P7BA 1H8EA 1R88A 1JEAA 2OBLA 1FFYA 1MRZA 4F85A 2HSDA 1JQJC 1H9CA 3CZ9A 2ZITA 2HJGA 1YIOA 3GCDA 5KNDH 3EGXB 1SBIA 4BFXA 1NZFA 2FG5A 4KX5A 3TLYA 3R23A 3LZDA 2E4YA 2NG1A 4P3XA 2QTBA 3FN4A 4PSDA 2A7XA 2WYOA 1U31A 5AUQA 4D4GA 2WSSA 2GPSA 1EHIA 2WP8J 3KWLA 2E4XA 5DGTA 1C1DA 1O54A 3LQ2A 3JYPA 2GNPA 1B0UA 2QIOA 1HSZA 2AQKA 2R7KA 4FCTA 1PK9A 3AXTA 1QF9A 3O6VA 4OU4A 3WLMA 2VAVA 5DBGA 3IOBA 2DWPA 1IEXA 6REQB 9GPBA 4UHKA 3EZNA 4RJ2A 3LNTA 1REQB 1KR5A 1B23P 3CLRC 3KKZA 2EIXA 3GR6A 4M89A 4MCHA 3M9WA 3HP1A 3W9BA 3FSEA 4NK4A 4PRKA 2YC2C 1LRLA 3OZVA 1TI7A 4BVAA 3N0RA 1C0KA 4JCOA 1YI1A 3RHFA 2IYQA 3QLUA 2ZK7A 2IZZA 4W5NA 5L3SB 2ZIVB 4QPZA 3HM9A 4CT4B 4ZK2A 1NAHA 5ADUS 1P8JA 3UJDA 4Y2GA 2XD4A 1P1IA 1QV6A 4QFMA 5JAOA 3THWA 1SHJA 3MLAA 3NBQA 4PLPA 3V5NA 4G41A 4Y1FA 4H4CA 3UJ3X 5M3BA 1LS1A 3EZFA 2CJFA 5JZBA 4W1QA 2O06A 1D1QA 3C3MA 5I5EA 1EVJA 4LHZA 1VJ1A 2EG9A 2NSHA 1A77A 4X61A 2J6BA 1G3MA 2ZTVA 3DE4X 4XM2A 1YQXA 1P1JA 2QMEA 4R8SA 3K35A 3X1MA 1N5RA 3S7ZA 3E9RA 2IEIA 2GM9A 4FOPA 5HW0A 2AZTA 1HKHA 3AHEA 3DFMA 4GR9A 4O59O 1KDPA 3M4JA 3DWEX 1KI6B 3K0AA 2OFFA 2JG3A 5KNDA 4TVBA 4COKA 1N6HA 3C5VA 3SXPA 1G8AA 4HWOA 2A88A 1PJRA 5B1HA 4LFBB 3BGOS 3EGOA 3LUPA 5J63A 3LGAA 4C14A 3I04A 4BFZA 3SG0A 3KZVA 3A4YA 3GUVA 5TVKA 2Q62A 4DWJA 4QRHA 3DXZA 1E2UA 4BKOA 3ZD7A 5MN5A 3EOZA 4C01A 3HCAA 4J1SA 1SBHA 4D8XA 1TK3A 2IXDA 4HPXB 4E5SA 2VN8A 2AUMA 2QTHA 3LWBA 2IP4A 3B89A 3KPVA 1DAIA 1YBFA 2DM6A 4QELA 4Z4CA 1NBIA 4DARA 3SXJA 4V38A 2AMYA 3EMDA 1WLYA 2OPBA 3JY6A 4CNQA 1W44A 1P9LA 1KEKA 3NHZA 1NXXA 2PGXA 3FDJA 1DTWA 4QO8A 4A0HA 3FI9A 3AVYA 3OOEA 2W0MA 3FYSA 3BXZA 4IHKA 3V3TA 3VHXB 4GLJA 4EGCB 1IM2A 4I4IA 2VHQA 4MEJA 1LI7A 2XNKA 2R1TB 3KAQA 4X54A 3I2IA 3LWDA 3QH4A 5AKYA 1SKYE 1TPYA 2ZWIA 3C5HA 3L0YA 4D6XA 3QVGA 2JFBA 1AUOA 1QANA 2V65A 2XVXA 4BLVA 4ZHQA 5LJIA 3SX4A 4PLZA 1L7NA 2AFVA 5EZ6B 1ST2A 3EE6A 3TLGB 1YB2A 2P0AA 4UQPA 4EYEA 3C4JA 3MHTA 2CVPA 2YC4C 4MPDA 2I8LA 2L42A 4JDPA 4ZAZA 1ANKA 5HBGA 1E63A 4A0RA 1AT1A 1BDIA 1LDNA 2QG9A 3PL5A 3UK1A 2JGDA 4CTKA 4UKDA 1YDHA 4Y1RB 2V6BA 4HWGA 4DMGA 3WFZA 1AD2A 1EJBA 4QOFA 4DV0B 3CKKA 2WF9A 2LNDA 1OYWA 3H4TA 2XDWA 3JXEA 4R68A 4ETWA 3PLAE 1L8XA 1ZD8A 2XMRA 1KC1A 3LPAA 4S0XA 1JMYA 4P31A 1JTFA 3X1YA 1IJEA 1DKMA 1X2BA 3NHWA 3FMPB 2Y1OA 2I4LA 3TAXA 4YRMA 2P2YA 3PXBA 4OLFA 2YJ4A 4YJHA 1R9JA 4ARUA 4E51A 4BWGA 1QQ7A 4EB6B 5M7EA 4IXTA 4P5PA 1YSCA 3HYTA 2J33A 3S44A 4LSWA 2XTAA 2DWUA 2I6SA 2XE8A 5LQSA 1NZDA 2XGOA 2XB4A 4QYWA 4M7RA 4I66A 4JI5B 1AKYA 2AW5A 5CK5A 1H8HA 1Y89A 3FR7A 3OEHA 4H6WA 5IUNC 2G88A 2WLSA 4XJVA 3I62A 1BA2A 2JGLA 3D5QA 1JI3A 1XN1A 4PX9A 1SQ5A 5FRDA 4MVJI 1NULA 3Q6NA 1KH2A 3GJQA 4FYKA 3JV7A 3ED1A 5CT6A 5CFZA 2FUG1 1O57A 2Z4SA 3NVDA 2EHJA 5KHAA 1RAGA 2OGWA 5DI9A 2BFPA 3WOHA 2WICA 3PQ4A 2D54A 1ELOA 3MMPA 1WA5A 1XXHB 3GVCA 3ROEA 4D9HA 5KOJA 2XUFA 1DOAA 3IXLA 2QQ0A 4H08A 1G2OA 3HGQA 2AQHA 3JD3A 4B6OA 3LQRA 1G0OA 3KSZO 1FBTA 1G41A 1JAXA 2HHLA 2C5FA 2IVFA 2PGAA 3BWCA 2C5HA 4PX3A 5EWMB 5A9TA 4E3ZA 4W5TA 2DHQA 1NG1A 3PQCA 2J85A 1YRAA 3NEJA 2W6CX 1MV8A 5CM2Z 1HFJA 1Y4ZA 2JJ1D 3ZZ0A 3TGWA 2LE0A 5JAUA 3DT9A 1AA6A 1T9ZA 1RKVA 3B6JA 3H1EA 1CJMA 4XFJA 3SHQA 4ARZA 5DGCA 5LXTA 1EFPB 2IGBA 3R8CA 1FOEB 2D8AA 3ZDBA 1KRXA 1FLDA 3DD5A 1CEXA 4RKRA 3BA6A 4ZVUA 4XSGA 3B2NA 4M6WA 5L7TA 3N76A 3SY8A 4OQQA 4BVJA 4GMKA 3CKLA 4D5EA 2OWDA 1G2QA 3QU5A 1GZ6A 1QBGA 1CV2A 3O8OB 3GH3A 4CFYA 1VSBA 4YAWA 3QI7A 5DSTA 2WT9A 2RAVA 1NQ5A 2GTIA 3I1FA 3QGMA 1W0JA 1JA1A 4TS9A 4IINA 4RJKA 4X71A 1TVEA 3IUPA 1NKTA 1WUKS 3ZEIA 1YCHA 1PWXA 2PUHA 1FYWA 1Z0IA 3OSUA 2OCDA 1HE4A 2HQSA 1D0IA 2DVMA 1P72A 4OHKA 4B85A 1QYVA 2DQZA 3G2MA 3IC5A 3LF2A 3OQHA 4DSUA 1X42A 3KSBC 2A3NA 4Z9XA 1F4PA 1JZSA 3FNQA 1ICEA 3NRCA 2QL9A 1CZKA 3ZH9B 1IHPA 4OBWA 2R00A 3AP2A 2X5NA 3B5IA 3QW2A 3ASYA 2PVCA 3QPUA 3EVTA 3IQXA 2JANA 4X45A 3P1JA 4YMUA 2ZSHA 3ZWMA 4EJFA 1T4MA 1DP4A 3IFSA 1DIHA 4ETMA 5HJ5A 4G07A 4O4IB 2BEVA 4ZT3A 4MVYA 3RE1A 2YIMA 2O14A 1PS9A 3ZHSA 2CNDA 4CT0A 5JI3E 2FUCA 2GD6A 4EVSA 1M5RA 4JX9A 2Y1LA 1G18A 3ZHQA 2Y2UA 5CG1A 2I3GA 3EGCA 2EG5A 1BXZA 1FP1D 4UBLA 3KE9A 1B2RA 3SI7A 1STOA 3BFJA 2WM2A 4F1KA 5E0KB 4FKMA 1L7QA 4P5DA 1MJNA 2OHJA 1RCUA 2AX3A 4PN7A 4ZRNA 1DELA 2DFKB 3BM5A 3KQTA 1JH9A 2F3PA 2Z2KA 1UAAA 1VIVA 4JT9A 1Z6ZA 2E0IA 1PT8A 4K6KA 1N92A 3JTMA 1JVNA 4QFDA 1ZGHA 1BW9A 4N5IX 2EFGA 3G88A 1M0EA 1UFKA 4HMOA 3SIWA 3UMJA 1BMQA 5KTKA 3ZVMA 3HACA 3IEKA 1SVNA 4ZYLA 2WVGA 3I73A 4W7SA 2QBYA 1IWPB 1KMCA 1MB3A 5ALSA 2FFAA 2QUJA 2A5GA 1T5TA 1CIJA 5DKFA 1GNLA 4EG4A 4YJ2A 1EUYA 4MQ5A 5IM5A 1QV7A 4UBIA 3T9FA 3U7JA 3R8FA 2X0RA 1VBMA 1Z2DA 4CJXA 5ETJA 2XLCA 1FYVA 1C7EA 3IB3A 5HFJA 1EXDA 2WJ3A 2PZBA 3CWZA 2UZ1A 2KWIA 1M72A 2DB3A 1G3IA 4Q05A 3K4PA 2QRUA 1PQPA 2QD5A 5BW6B 4JCCA 5B6JA 2PX4A 4KO4S 421PA 3A1SA 1QP8A 2VA8A 3HYCA 2GAIA 2FSHA 4MVCA 2NZYA 3ND6A 4MWTA 2Y0BA 4RFLA 3U49A 3WRXC 4DLNA 1MH1A 5C81A 3MG9A 2PGLA 3Q5EA 3K0EA 3QU9A 4XM0A 3ZWQA 5EJ6A 4I1VA 3D2BA 3M5WA 1GLNA 1GQQA 4AL4A 1PCXA 4X1KB 3WNBA 3IOCA 2RHCA 1U5BB 1C0IA 3OHSX 4GLBA 1YDGA 3W3ZB 1MN6A 2VF7A 1GIAA 4C7XA 3O9VA 3PFBA 3ZWYA 1UKYA 2OXTA 1WQ4A 2BISA 3SC2A 1W85B 2RFLA 4D9FA 1U65A 2O8DB 2P2LA 3WGTA 4ITRC 3MMSA 4CKCB 1SCDA 1P0FA 1SVIA 1T8PA 1GRVA 2GK3A 4OK5A 3DNFA 4WXMA 5ENVA 5T4HA 4CMKA 1OAOA 4MO9A 1QHHA 2WAAA 2KLHA 2VUUA 4NHOA 1W6UA 3U7IA 4EHKA 1KFEB 4YC7A 3P9PA 1HBJA 1PN3A 3I9V1 3PFGA 4NLLA 3RASA 4X65B 2H57A 1GU0A 5EUQB 3EPLA 1F2UA 2C3MA 1MB4A 1O95C 1DJPA 4Y9UA 3X1ZA 3RF7A 4BTVA 3KR9A 2R2AA 3KD2A 2J30A 5JDIC 1PR2A 3QI2A 1BKYA 3ML1A 1X1TA 1KMHB 4UTXA 2JIOA 5ER6A 1K1EA 1K4YA 3IJEB 4M1YA 2VPWA 5H59A 2YQ4A 3UWSA 4X7MA 1BAPA 3TL2A 3TLAA 5JBNA 4XCXA 4DNXA 3BK7A 1KOGA 4WGGA 1UBHS 2CLHB 4Z3DA 2ZAGA 3OQ1A 1K6MA 5SY4A 4F46A 5FJJA 3BS4A 4RIIA 4WADA 1SRQA 3TSAA 3QMMA 1Q0HA 3BJMA 4LZOA 3OZRA 1DDOA 5EPOA 1II9A 1OF1A 3RAEC 1XRRA 5TPWA 1YZ3A 4DZTA 4E2ZA 1X7XA 3T1QA 1ZUHA 3MRSA 1C4KA 1P61B 4BVEA 1CS4C 3KVVA 4UHBA 5C52B 4YPFA 1ADBA 1XZEA 4UXJA 5MFPA 5MGNA 1TZKA 1C9MA 2V1UA 4HNGA 1K0UA 1O94A 2ZYTX 3N28A 3WYEA 2XW6A 3FFAA 1WP9A 4GLFA 4IAOA 1ZHOA 1YCDA 3A9WA 1JPUA 3JQPA 4PAGA 5FTWA 2OQVA 1UAYA 3EXEB 4LHVA 3KYBA 3MJDA 5CEFA 2QF7A 3B8EA 2A9KA 1D2AA 3W2IA 2YYAA 3D0KA 2B4AA 4J0QA 1EVKA 1D6SA 2YBEA 1LLUA 3QXHA 1C3OA 4PQEA 3TCKA 1QB8A 1VPVA 3S70A 3ZLVA 5C5IA 1JRLA 3K0CA 4J1TC 3K9WA 4IIYA 5H9WA 4AUMA 2HO4A 3NXKA 3RLIA 1XA0A 1VZ3A 1EK6A 1EI9A 3F47A 4B73A 4FD3A 4ZT5A 1J70A 3CJTA 4RZQA 5KSWB 3CF4G 2J32A 3OLXA 2ES4A 4YXFA 2ZUBA 1G8PA 1HT0A 2ZUDA 2M98A 3A6DA 3NYRA 2Z58A 3B1YA 4ER5A 3MJFA 4LV5B 5L51A 4AIIA 3RVOA 4CCAA 4KMOA 3QVUA 4MV8A 2HZBA 3I42A 5D3KA 4B3XA 1ZMBA 1NJSA 3B1JA 4HBGA 1UBCA 3H18A 2A7QA 4BECA 1U6KA 3DQZA 2ZM5A 3IP5A 1AN9A 3K8QA 3QVSA 4BYMA 3LPDA 5GM1A 3UUEA 4DLUA 3IO3A 2VRNA 4JZYA 4P7GA 5H9VA 4EFDA 2OT3B 1EXMA 1H4VB 5FUVA 3S28A 1C2YA 1OFHA 1GG5A 3A9CA 3U1TA 2AJCA 4JJGA 4AKTA 1T10A 4TV8B 3R3SA 2WTNA 2Q6TA 3AL2A 3PIDA 4KWEA 3ZKWA 4KMRA 4TMYA 3ACBA 4KIJA 3J80A 1N1DA 1II0A 2QIPA 3JQFC 3GJ7A 3U09A 4QJ5A 2P2CA 4K6MA 2AR0A 4RABA 4OI4A 1XDWA 2EW2A 3DQQA 1UAGA 4QGSA 5C51B 5EJ7A 3J81A 2L82A 3GO4A 1CIPA 2J0UA 1D4OA 3HBNA 4PYLA 5FOXA 3UB3A 3MZ0A 1IG3A 1VLQA 1WIWA 2Y77A 4LNHA 4NV3A 3RK4A 2ZPUA 2AK3A 2QJOA 3KWJA 4KWCA 4Q1VA 1XEWX 3LHFA 3NBZC 1YDEA 3PIIA 5EWJA 5KMGB 1GTSA 4Y8VA 2O5VA 4LDPA 4J91A 5CAEB 3GZNA 2SCUB 3HH8A 1WVIA 2JVIA 2ZU6A 1RJWA 4XFDA 4X1YB 4QU5A 1ZISA 3JWIA 2DY1A 2LDBA 3RVBA 1ZWLA 3MMNA 2XAAA 5F1YA 3Q8KA 1EDZA 4N6OA 3SHOA 1QVAA 5HKKA 5KHOC 4LJ7A 4R69A 1E2PA 2GCEA 2OILA 3UOWA 1RWKA 2FE4A 1CUIA 5G1NA 5GOTA 5IJ0A 2IHUA 5I7FA 1O0SA 1GVNB 4KTTE 3ZQ6A 5B2EA 3IQWA 3KB2A 2ORIA 3ZD9A 1LUAA 2CV0A 1UT6A 3MFQA 5I7WA 4FYPA 3I6YA 1ECGA 3UJ7A 2VHEA 4D99A 4YONB 2BFEA 3WTBA 2IRWA 3C6MA 4XJXA 4CM9D 3BIWA 2O2SA 2XYPA 4KLRA 4LYJA 2C98A 2YVLA 3WKAA 4ZI7A 4L8YA 4IGIA 4NCHA 2I2FA 2WQ6A 1U9JA 4ENUA 3WGVA 3H9QA 4MDHA 4F4IA 2PN1A 5AVXA 2DFVA 4JENA 1KXZA 1HEUA 3NVKI 2NMVA 4IIHA 5F3WB 1LJLA 5FV7A 1RRPA 4YJ3F 3CN9A 3TIVA 2WB4A 3OAAA 2H9AA 2FCAA 1KF0A 2UXDB 1Q0PA 1OYVA 4QOJA 3TAHA 1Q2XA 4TLCA 4EHDA 1UJCA 3OJLA 3KQSA 1IZ7A 3N2IA 2NO6A 3HY4A 2VNSA 4CDNA 3AV0B 2HM7A 3L8DA 2C83A 1LRKA 4MV4A 3AILA 3C85A 3CF6R 1VECA 2XZPA 4TXHA 2FKAA 1WSWA 3ONDA 1NUUA 5DF1A 5FBZA 1RQ7A 3WLSA 3C74A 3AEQB 1C9KA 5CYPA 1H0KA 4OXNA 1DO2A 1BSVA 3UXHA 3BB4A 1EDDA 1TZCA 2XLBA 2VK2A 4MI6A 2G0TA 2ZANA 3VOSA 4W9MC 2X19A 1FQJA 4UVEA 4UCXA 3TEFA 4KPGA 1TM7E 3SSOA 4BOYA 1TF5A 5KQGA 4EG8A 1AO3A 1MOSA 3ANXA 2HEIA 1EXNA 2G5PA 1ZICA 2ZATA 3K32A 2VK4A 3N3AC 4MB2A 4RS4A 3PC8C 2BYTA 1S8OA 5F51A 1KAEA 3HEBA 3HI6A 4NC9A 4CL2A 2FH5B 3QMWA 3I6ZA 2GRAA 2ROQA 2Y0DA 1RAEA 2O3QA 2RGEA 3FFTA 4Z0TA 4MUMA 4TMKA 4R3WA 3WSTA 1QWSA 3UC5A 1UR5A 3QEMB 4PBRA 4LTMA 1NBWB 3KG2A 4P84A 3AL3A 2CNLA 1X8KA 1YB5A 4W7HA 5K8CA 4MYRA 2J5RA 3HMKA 4MI9A 2O07A 4MA4A 4PZZA 1P19A 4G3XA 3T7AA 1AUQA 1C3XA 1VCHA 1TJ5A 2OO7A 4YRLA 2OO3A 1EFCA 2GUGA 1Z35A 3AOEC 3EG5A 3GAAA 2OCBA 1IULA 2TS1A 1AKTA 3DAFA 2BE7A 2QZZA 3ME5A 1G64A 2Z1NA 4Q37A 4UUQA 3O8QB 5GJWC 3EMVA 2H2GA 3T4PA 3TMKA 5JROA 5KU1A 1LV8A 3P32A 4PWZA 4HEA6 1P9NA 4RX1A 1KPHA 2XB8A 4BNVA 1W59A 2WF6A 4TMZA 3WGZA 4I8XA 1MAUA 3EDMA 1KVQA 2AN9A 4H0NA 4E33A 5IYZF 5H8WA 4J0HA 2AXPA 2B0JA 2W5UA 3R3ZA 5J2UB 2NU6A 4TVKA 4EJSA 4ONEA 4RQBA 2NU8A 4A91A 3VH2A 3GA0A 4ZYXA 2R1ZA 1YBMA 3HY3A 1RRCA 4GI2A 5BYJA 1G7CA 4CUKA 3O1IC 4TWRA 4RWEA 2C94A 1IVYA 4X6YA 3V4SA 3T7CA 2PUDA 1EVYA 4KDFA 4M37A 1CK4A 4DY6A 5F1PA 4ZAFA 1XZMA 1NF9A 1ULUA 1U2RA 4ZICA 2E5WA 5FWAA 3GFPA 2AJBA 2G80A 1E2FA 2CLLB 2XYRA 4CKEB 1U90A 4ARIA 4AO6A 1A2KC 2WP0A 3UMRA 1H69A 4C05A 4F11A 5KYWA 4CEIB 2DPMA 3KQNA 1IBCA 1II8A 3L7JA 2C9ZA 5JDCC 3PNOA 1JDPA 2H8GA 5FBVB 4EZEA 5F9FA 1Y7IA 3VYTB 1F8GA 1UK9A 3WAJA 2FQYA 4PAWA 3WE7A 1W36C 5C46F 3EXHC 2UYCA 3A37A 2QAIA 3AESB 1E3LA 1J2JA 1ZO8A 3C5CA 3DE7X 4E88A 2VZLA 1BCSB 4QOHA 1WY7A 4D9IA 4C6SA 1U3FA 4MVJM 4OHRA 4AJPA 3RO7A 1T34A 4B80A 2GPTA 4DEVA 1XVVA 3I0ZA 5CDHA 2CFSA 1X86B 3RRZA 5BN3B 4EHHA 1E79A 3DUWA 1KJYA 3QEKA 4MRNA 1U3CA 3GMSA 4NBUA 4UDYX 4BQQA 1DXHA 5DB4A 2PUGA 1WETA 4KQ6A 4UUOA 4EYSA 1QGUA 1U8CB 3JALB 2YRFA 4IPTA 1GRQA 4D3FA 4BAZA 3A25A 4QSMA 3T5CA 2YMPA 1UBMS 3S55A 3BMOA 1NBHA 1JAZA 5HXAA 1QTRA 1V37A 4G2TA 3T5MA 4BJ6A 3IVCA 1QHNA 4PCLA 5IDVA 2QGZA 1ZDMA 2GO1A 1T2FA 4V2UA 1H5QA 3V9PA 4NZZA 3DEAA 5LQDA 3UAXA 2QI9F 4YLYA 2E2WA 1G8HA 2JIZD 3Q8WA 4LMBA 4U2CA 4DRXA 4P3YA 5HF8A 3O7WA 1P39A 3THOA 3QOFA 2R6GA 5E1DA 3DE6X 4HDMA 4PSUA 5AI4A 8ADHA 5K05A 2BD0A 4AKSA 4O2RA 4FZJA 4PRYA 1ORHA 4N0EA 3QF4B 1P2TA 2GLXA 3M1AA 3DHEA 4MGZR 4LBZA 1GCOA 1T5BA 3CU5A 3V48A 1N6OA 3CQ9A 2G7ZA 4HYYA 1DKRA 4K9KA 4LWZA 4JNCA 4KDRA 3T0IA 3O8RA 1P9WA 2BL4A 5TGTA 3J81k 1JEEA 1KYVA 3NTOA 5H0IA 2NO1A 3DWIA 3IPXA 4Q3KA 2B20A 2ISCA 2PWZA 4X9XA 5CH3A 1SXGA 5KX5B 1VZ2A 2NGRA 5JCOC 3UG7A 2QE6A 3BE6A 1ECCA 3DDUA 5HEKA 1IXZA 1HE2A 4HGNA 3IPAA 5KQRA 5LNK1 1KP3A 1K5DA 2PV7A 4ASUD 2ZB3A 2P3OA 4UM9B 4HWKA 1FFGA 2O54A 4GW3A 1UM9B 2HF7A 3HN2A 3UMFA 3I5XA 2GM5A 3F46A 3UT6A 1L7BA 2JIQA 3RS3A 1YD7A 3LKDA 4NZMA 3VNBA 1DKUA 1ZX1A 3D4PA 3HDYA 3NJRA 4TTAA 4AXBA 1PHRA 1IVNA 4MMYB 3ZHRA 4GHWA 4TQAA 10MHA 3R6DA 4MLZA 1E20A 1ZK4A 1MEOA 3EFOB 3P5BA 4R84A 1GAJA 2QSJA 4ZOBA 4AURA 3JZMA 1JYSA 5DYNA 2C7VA 2WU0A 1U8XX 1R0CA 2P9HA 1T2UA 2F3SA 3H99A 4WZAA 1XQVA 1XO1A 3VPBA 4EG5A 1DRJA 1M0WA 1Z4MA 3THRA 1HG1A 3ZE2B 4N76A 3ANLA 4JN6B 4FONA 2RCNA 1ZXBA 4DABA 5DULA 3TRFA 2YJ6A 3CF4A 2Y71A 3N53A 4GEKA 4WI1A 3ZNPA 1OLUA 2BUAA 4OGGA 3OE5A 5FA8A 2V6GA 3HLYA 3A6HA 2JGMA 1FNDA 3P9XA 4Q24A 1HFWA 2A1UB 4TXNA 4B6SA 5J4LA 2BKLA 2R4UA 2YXBA 1YF3A 2CMKA 5JCJA 3AF4A 5BOSB 2D5CA 3WJ7A 2LBPA 1NVTA 4MMZB 4U7FA 1V96A 4CIDA 1ZRHA 4D0NA 2O48X 1CG6A 4TLLB 2YWXA 3JZAA 2GNOA 3O47A 2CLMB 2OEPA 3TTSA 3R3UA 5FEUA 1GPBA 1BXRA 4N3CA 1E0KA 3JAKA 1W4AA 1CQJB 1A5AB 2C2WA 1KFJB 3AINA 3ASVA 2OO5C 3FHJA 3MBOA 3PUXA 1GKYA 4Z0HO 4EPTA 2O8CA 2QR2A 2C59A 4I55B 1KJWA 2VOJA 4NP6A 4JLNA 3AUKA 1PJSA 4KZKA 2O1XA 4FHZA 4D2IA 4UVIA 1SVOA 4TYWA 5AI6A 3HJBA 3GFOA 4L0CA 3LCCA 4ALKA 4RTNA 5IVIA 1RTTA 4AMUA 3ZY5A 2GPJA 4WY2A 1PNRA 1TLTA 5B30A 2A0KA 3IPCA 4DBZA 4DLKA 1UPTA 3BIFA 2LRHA 2A94A 3H86A 4LK3A 4BZXA 2ZRDA 1JZTA 5JTUA 2YMLA 3BMXA 3WGHA 5IH3A 4JU9A 2BHNA 2VBIA 4FEAA 4QD3A 3RK0A 3ZN2A 4A36A 1SVMA 2V03A 2XB2A 2RSLA 2WD8A 4OYRA 2O1SA 4EY5A 4P9NA 1SCJA 4KZPA 4U63A 1TGYA 4L95C 4IJKA 1Z0ZA 3CRZA 3M82A 4G67A 4O4HB 4HZUB 1DDGA 2CHQA 2GJ4A 4X1IA 3WYFA 3O8BA 4RIGA 1I1OA 3IJPA 4YJFB 4OQXA 1VE9A 4AJHA 4JROA 2V4UA 4KR7A 3OU6A 2PUVA 2REQB 3VSDA 3SBOA 3DR5A 4KAFA 5G1OA 5F7XA 3DOOA 2IYTA 2V7XA 1R8XA 2POCA 4Z6KA 5ICCA 1B7GO 1L8OA 3O4JA 4K9PA 5CUQA 3VR6D 4ZZ0A 3ZZUA 1P73A 4R9SA 3KPJA 4B71A 1BWQA 3U56A 4L9AA 1NOKA 3QVOA 3CVOA 2VTBB 1CETA 4UE3S 3VMMA 2HBZA 3WKBA 2FPGA 3Q87B 4FYYA 1K75A 4MR7A 4RDXA 2OHHA 1N9KA 3MOGA 3FOBA 3ZLJA 3AR8A 1N0WA 4FILA 1ML4A 1P7YA 3E5NA 3AGPA 3B51X 3KPWA 2I65A 4DE5A 4JELA 1C14A 3FGNA 3N7TA 2PWYA 4GWLA 5B57C 5EIXA 5LOVB 4WDRA 1IAVA 2A9JA 4B83A 1NUQA 3E03A 1U7HA 4C4RA 2JJ2D 4Q03A 1NQXA 4JK3A 4QBTA 2GBPA 2XWQA 3SR3A 3G9XA 1UBSB 1HR0B 3D1JA 1W0KA 5JCZA 1T29A 4H9GA 1LC3A 2W11A 4HDSA 4NENA 3LYHA 3A1FA 3NOXA 4CF7A 1XZIA 1CJSA 1MNAA 1N6IA 4MI1A 2OV8A 4XOUA 2OC9A 3W8EA 2PKRA 3NALA 1BHSA 4PVDA 5DHAA 4YCNA 3NV9A 1CLEA 1V4NA 4CI0B 4OQEA 2BFCA 3ES9A 3WB0A 3ZWNA 4BBJA 3CVVA 3ZXXA 1OASA 2JH8A 3CR7A 4RIEA 3A6JA 3AIKA 4OQPA 2D2VA 2CJXA 1SNYA 5T3YA 4OJYA 1UPFA 1JHMA 2IKQA 2OV1A 5JPDA 1WHTB 4IDPA 4GE0A 4MDYA 1T2CA 3FMIA 2G6BA 1CYEA 5K3OA 2ZJ8A 2GH1A 4UFOA 3GRYA 4TM8A 4TV8F 2H7VA 2NADA 3FUTA 2MYPA 1LDMA 5ED4A 1QXSA 1SC9A 2ZYDA 4X44A 3GDHA 1SOAA 7AT1A 1RXWA 1QRSA 1X1AA 721PA 2PYZA 3RHSA 1CKEA 2W6PA 2XOKD 3HM2A 3H9BA 4JJZA 4ZVPA 1ZPDA 3WZLA 5CT9A 3ILYA 2XTMA 1Y1RA 3WA6A 1V7QA 5D1HA 1DG9A 3WDKA 3AZOA 2HSJA 2QYTA 1XXHE 3KNZA 4HNAB 1S3GA 1NDHA 2FWPA 2V0NA 2CSXA 4QA9A 1ZR4A 2YDXA 2CXHA 1OH8A 1ORTA 5M29A 2ZRIA 1B26A 6PFKA 5HTKA 1OT5A 1UL1X 5D00A 1BHO1 1ESMA 3WL3A 1C1DB 4W1RA 4AX8A 3SZLA 2V7GA 5G41A 5DK4A 2LW7A 3CEJA 2IU4A 5DYIA 1TVCA 3O21A 4HGPA 4XASA 4BVGA 2REXB 2H7YA 1E7MA 4LVOA 4MQFA 1XFDA 2GETA 2Q5HA 4P32A 4X90A 5J5VA 4F5YA 3MPUA 1ZIYA 4G23A 1NG9A 2HJ9A 2I76A 1PV2A 4DRYA 4Z4FA 1JLRA 2Q8QA 4KFSA 4X66B 3DOUA 4UATA 3KQUA 4OMUA 3V8BA 5C3MA 4HWPA 2B30A 2AR9A 1EDEA 1KO7A 2G1KA 3BRSA 4IYJA 4OJKA 4D9JA 4K03A 5KSOA 4I99A 2VNKA 3BILA 4BLSA 4JX8A 4GI5A 1AQ6A 2OOSA 3R7WA 1PJQA 1PZEA 4G5GA 4A5OA 1O0BA 3ETGA 3NB0A 4LK2A 1CEYA 3UG6A 1C9EA 1XD2A 1O4VA 4KR2A 2NO7A 3BFPA 1HNWB 3G2KA 4JUFA 4YT5A 1LPSA 1QFJA 1OR8A 4LHWA 1XQ6A 4Y0VA 1NIPA 4UMEA 4D3DA 5I8PA 3CUVA 1E8MA 3HSYA 2X5JO 2EFHB 2QVCA 2YNMC 3JVVA 1C7ZA 1NXOA 4JYMA 4C4SA 1J1UA 3IR5A 2M6KA 3WGQA 2W2LA 3QPVA 1ZA2A 5JSQA 3I6QA 5IC4A 4DXDA 4KXVA 3C48A 3R5HA 4X85A 4BMYA 2X9QA 2RGBA 2WWWA 3SXUA 2ZE5A 1ULHA 3NDIA 2XCRB 1Z6QA 1EUQA 2PIDA 3ONEA 3PQFA 5D3MA 4CLOA 3IBYA 3PIRA 4RHEA 4FSHA 2ZR0A 5DSZA 2ZKLA 4OQNA 1ZYUA 1G7TA 1TM3E 4BVBA 5I7SA 1QBKC 1QQTA 5K3EA 1HRDA 3PB3A 5ESXA 3RC2A 1OWMA 2VAMA 3BH7A 3R0QA 3ZYZA 3GEPA 1ZCZA 1QHSA 4TKUA 4F91B 3HUFA 5TMEA 3WBFA 2A14A 1RMYA 4Q9AA 3SSMA 5A5VA 1P6QA 1E9FA 1F8FA 3U60B 4J4TA 1W1WA 1C7IA 2QPTA 4AJOA 5LQMA 4KNVA 3PITA 4AMGA 4UAUA 3QU4A 4P93A 4NAHA 1P3DA 4NTZA 4U6SA 3V97A 3VKUA 4ND1A 3AY6A 1YR9A 4IHJB 3VVBA 4BWFB 2H4FA 3FMOB 3B9PA 1LSJA 2Q4BA 4RBNA 2IS4A 1DTWB 2RBGA 4E5UA 2WJZB 3F5SA 4M9CA 3CNQS 1R15A 3LOUA 3UAGA 2GRUA 4C5BA 2P9FA 2XA1A 1KZ7B 3FSGA 1SUEA 3SZRA 4E1BA 3DKPA 5A3SA 3KHSA 1P44A 1WTCA 3IDOA 4Q5IA 4KXLA 3EGDB 1PW7A 3MCVA 3OT4A 1W581 2PJZA 3N07A 3GRCA 3BRWD 4GZLA 2WJPA 1TM1E 4ZHQB 3CISA 3PRYA 3ZJUA 4HGOA 4KPUA 1YJ5A 3U4AA 1PVVA 3EVGA 1OKKD 3JQGA 4I14A 1MC5A 2Z2IA 4KU4A 1LF0A 4FSDA 4RTRA 1DVRA 2YWDA 3R5KA 3HCNA 2FSPA 2AOUA 2G9VA 3F6SA 3DB2A 2NZVG 1L2TA 4NEGA 3T7DA 4JA2A 2QV0A 3GRVA 5L40A 4OQDA 4D9NA 3SQOA 2MMGA 4HNHA 2LCFA 3TR0A 4LBVA 4RHXA 4US1R 3RUEA 1TM5E 1QKIA 1A2BA 3IEUA 2CEKA 4ZEWA 1DNPA 1FNMA 3FCAA 5FBQB 2A58A 4F06A 1WUJS 2PL1A 3A9VA 3IIKA 2GXQA 2P35A 4TKLA 2PTHA 1V3QE 4LI0A 2OV2A 2ZREA 1ZA1A 4PICA 4ZIRA 2WUEA 3Q3VA 3AF2A 2J5QA 1GTRA 3BZUA 3K1TA 4AY3A 1NMQA 1TM4E 5AVKA 5EQTA 3RYFA 1SIBE 1MO2A 3BULA 1ECJA 3DZKA 2H4JA 3ND8A 4NIMA 2JLRA 4DWVA 3CPJB 4CEHA 2TMKA 4XLTA 5KTOA 2WC1A 2EYUA 4MCAA 3EWNA 1PT9A 3F4KA 4IIJA 4PYRA 1TF2A 4H0CA 5LP6B 1Q1NA 2ATCA 2DHRA 1SC3A 2F4NA 2V7BA 3AO0B 3HDHA 3OJCA 3BVPA 1Y6QA 4GOXA 4PGGA 1TRHA 4G97A 4RDHA 4CQMD 2Y6VA 4F6LA 5BNFA 3P4XA 2H5IA 3SX2A 3LHKA 2G06A 5HOQA 2J07A 5JMWA 2ZIEA 3MGGA 3RU7A 1I80A 3STXA 4DR5B 1WQ3A 4ZI2A 3LP8A 4BFCA 1GPDG 4I5EA 3FUUA 1K6IA 1UXGA 1Y63A 3GJTA 5IMBA 2W71A 4DCJA 2V7QD 2UZ3A 5HK8A 3OFJA 1ACMA 2OFOA 5HBRA 2QY9A 4NNOA 4NMHA 4PGHA 4TWJA 3N9IA 1CQPA 2ADFA 1ISFA 3ORFA 4MWOA 5IJAA 2PEYA 2O2XA 4UTVA 2ARKA 4AY2A 1YE8A 2UUBB 4CQNA 2Q2NA 2CHUA 2Q6KA 2EWMA 5YASA 4BTEA 4B4DA 1ZK2A 3L93A 5L9AA 1YE5A 1FL9A 3ETNA 4WZBA 1QO9A 4MYSA 3UAVA 1T6BY 3O1LA 2RBEA 3UB2A 1UM8A 1V39A 2WDZA 1B74A 3D2LA 3NAQA 4HOYA 3HJNA 1PFKA 5ECDA 5EP1A 3V8NA 4ZCIA 1Z17A 2C0CA 2GTHA 1CF9A 2P1DA 3N7AA 5LDGA 2L0XA 3FGOA 4DDKA 1ZJYA 3NWBA 4H3VA 2C2GA 4OQMA 4RPIA 4TS3A 2Z57A 3H5IA 4LOAA 1Z63A 1NLMA 2PANA 2I9KA 4CE6A 4N5HX 2VHZA 4IV8A 6ABPA 3VUFA 1EG2A 1WB5A 2AF4C 5A7GA 3QZUA 2WW8A 3R9IA 2QD4A 3SZMA 1A2OA 1NVVR 2FQ1A 3HZHA 5DM1A 1Y1PA 2PKXA 3QF7A 4Y2VA 3WAGA 2V7WA 3NEYA 1T4GA 3JWJA 1XZPA 1X1DA 1FP6A 1T1IA 3A05A 4G1VA 1TT5A 5I4CA 4MV6A 1ZW6A 4N8SA 1M76A 1VFPA 3RF6A 1QZ3A 4NMLA 5GVRA 3ZXYA 4U0KA 3A1EA 3LC1O 1U94A 2XGMA 3HUUA 2FN3A 4OX9Y 3D6VA 3E2IA 3V55A 3BL6A 1OVGA 3DMPA 2HMTA 4CM6A 4N47A 2B4KA 5KYVA 2EX1A 3H2SA 4BB9A 5EIOA 5ILQA 3RIHA 3PZBA 5IAOA 3U9TA 2XB6A 4B34A 4HF7A 3SJ7A 2AD5A 3FOWA 3TTXA 4DANA 2C97A 2QTRA 1C1XB 3DR3A 4JQOA 5BVGB 2H52A 2O5CA 2VAXA 1Y3BE 1Y48E 3ZHBA 4E5DA 1E2EA 1W2GA 4KSCA 4JUDX 2WYIA 2DPLA 4D45A 4EVIA 5GZ6A 2LV8A 4BRSA 1GUZA 4MUYA 2R66A 4TL8A 3DAPA 1GZ7A 1XA3A 2WIKA 1IM8A 4JBHA 2BR3A 4MLCA 4CF4A 3DXFA 2HHHB 1N5LA 2NSLA 3O2NA 4B0OA 2ET6A 2FF5A 3LLUA 3P27A 1WO8A 2ODWA 1E1RD 5DBFA 3H9GA 4I81A 1SC6A 5CJ2A 3S2EA 4RAOA 1EUCA 1P6UA 2VDWB 3VJRA 3Q9SA 4L4XA 1X74A 1ZGGA 3ETHA 1ST3A 1VYHA 1YRYE 5GZ1A 1BGWA 2YWJA 3H6HA 3ZHXA 1I4OA 2EP7A 2JLBA 2R84A 2X9VA 2ZSEA 4INPA 1KZ1A 4K6CA 2DPHA 3MS4A 3KFXA 4R81A 1KMNA 1KI2A 2Z6QA 4F4HA 2OGUA 3SJCA 2JAUA 1E4EA 4OMFG 1R18A 3ZCTA 3M1IA 1ZJ6A 1Q50A 3CIFA 3H5AA 3TLMA 4C2BA 4ABTA 1GXSA 3QHAA 4GRIA 1JH8A 1ATZA 5B1YA 2DQKA 2NVBA 3FNRA 5B6PA 5HK9A 5LU9A 2E48A 2IS6A 4RV4A 5HA5A 3RNLA 1RQPA 3NWPA 1POWA 3AHFA 3KX2A 4I55F 3KJNA 4CODB 3EQ6A 1M34E 5FR1A 4PG8A 1LGYA 2FPPA 1CUDA 4OV6B 3KKLA 4AC9A 2DUUA 3P96A 3M2PA 2HXSA 4MYTA 4F1JA 1VP9A 4ECEA 4XRGA 2YN2A 3F96A 3LXUX 3PD7A 5KYNA 2PX2A 3KTFA 4IQGA 1DV2A 3FPFA 4TSFA 1BU8A 1OSNA 2OL4A 2ZI6A 3E1GA 5IDWA 4HSEA 1RNLA 2FMHA 4M9RA 3W6ZA 3S8EA 5U4XA 1OXSC 4LWQA 1KI9A 1NUAA 4K6OA 3LT1A 3NIFB 4Z8YA 1VG1A 3QFFA 4W1PA 1CVIA 3AP1A 4RMNA 5FBLB 1MVOA 4D42A 4MGKR 1GSHA 3RSOA 3LWZA 4URWR 1QGAA 2FPOA 4DR2B 1TTPB 4ZA2A 4NNPA 2ZYRA 3W5JA 2G4LA 3SC2B 5K3BA 3PLRA 4D9MA 1PQWA 1X1RA 2YV1A 2JJYA 1BDMA 1TEXA 1NVKA 3I01A 5TMPA 4QYTA 4UNPA 5LQCA 2QKYA 4HY3A 4RSHA 1LNSA 1SFRA 1KH1A 2NVOA 1M1ZA 4JP5A 4BZQA 4ILEA 2E18A 4DB4A 2MYNA 4FN4A 5LJLA 1CFJA 2IHVA 3HLKA 4LA4A 5CH8A 3VDNB 1WVMA 1CUJA 1X14A 3T5GA 1YTUA 4Y6LA 1RDFA 3THXA 5JCPA 4DLRA 1RP1A 1YS6A 1M2OA 3E8XA 4KO3S 1IQ0A 3LUBA 4YLEA 5TDHA 4GOKA 4OQ4A 3U3ZA 4CI9A 1MHPA 3H8WA 1GCUA 5KCZA 4NE9A 2I2WA 2K7ZA 1MJHA 1A95A 2ZLBA 4WGFA 4A0QA 1QDEA 2CUNA 3X1DA 1LBEA 2WOJA 3HYNA 4W8GA 1Q77A 2HSZA 1VCMA 1OZ0A 3TS1A 2ACKA 4X24A 1ZUNA 4YMSA 4DV7B 5TV2A 2P5SA 1WZ2A 2LPMA 3E70C 2X5XA 5LQKA 3KWMA 3PKJA 2Q21A 4IIDA 1TKBA 4QPCA 5FL7D 3T99A 1IK4A 3TM5A 3L1VA 5JNUA 1U5AA 4I50B 4X60A 3UH1A 4OI0A 2XQKA 1UZLA 3ENQA 3HBJA 3D0OA 3D5TA 2VP4A 4HH4A 2Q1UA 1C8LA 5THXA 3DJYA 1QIKA 3LG2A 1IDN1 2FPIB 1X7XB 1ISGA 4H0FA 4AAYA 4S1VA 3VA7A 3AUUA 4QPDA 2Z3ZA 1V9SA 2X41A 2YW2A 4REQA 1IEVA 1V8FA 2BGLA 5JSHA 3MWFA 5GTDA 1YJXA 4OB7A 3A4LA 1DC8A 1XHLA 2J59A 1JX6A 1FP4A 3IKLA 3AETA 1VBNA 1CERA 2OCAA 4ZVMA 5LD2C 3WLAA 3VKVA 1JKJA 1UPUA 3IUNA 2VHUA 2VNAA 4XUCA 1A8PA 1NW8A 1XLUA 3HZRA 3FGZA 3IAM6 3GJ3A 4QEKA 4DA8A 1CEQA 2BEWA 3N6XA 3MRVA 4U1RA 3TJMA 1HT2E 3P9QA 3QY0A 1SUFA 2VJCA 3VJLA 1VGRA 4RK5A 2C03A 4RTQA 1C3OB 4NZOA 4TMTA 3K5PA 3CR3C 4CHGA 1JIXA 3DAGA 3H5LA 2HF8A 4J1NA 2C2HA 1DMSA 4ND6A 4PANA 3EODA 3FCUB 5I7AA 1CUBA 4LF8B 3I5AA 2QGNA 3DF7A 3PC8A 3TK1A 5IK2D 4R1UA 4EI8A 1Z4IA 3LV8A 5A3RA 2VCHA 3GXOA 3NO4A 4HPJB 4XD7D 1EX1A 1C7FA 1U8FO 4CG1A 2VBGA 3C6QA 4RHCA 2EATA 5ENDA 4FQ7A 4ZTUB 3L0ZA 4RJTA 1YIAA 1MJGM 1S4MA 1E2DA 5DJ5A 3P0FA 2X4DA 2JLAA 1NBMD 4FIZA 3AIOA 4NJOA 3PC6A 1P0MA 4PQFA 2O6HA 1TJYA 2VUTA 5AUNB 4OHPA 1SMKA 4L76A 3A6GA 2GGSA 4F96A 1E6MA 4Q1FA 3WNQA 1Y8AA 1VLZA 1Q7TA 2PHZA 3KLBA 2A6PA 3V8PA 1Y3AA 1H1LA 3M8KA 4I8DA 5CDSA 3BDIA 2GBGA 1GGFA 1G19A 1K4MA 4GYYA 4AFNA 5CLFA 4BMXA 2C95A 2HXYA 1K7XB 3K1AA 4JL8A 4R0NA 5TT1A 3D81A 1TCCA 4QLOA 2QT9A 5IKMA 3SEAA 1NFFA 1KJQA 2I1VB 5L3QA 3K72B 1M6VB 2CCGA 1D3AA 5BQOA 1CRZA 4IFTA 5DCLA 2X5OA 4BNZA 3RSQA 1BRMA 5CB4B 3TOSA 2M6SA 4GP9A 2J0UB 3ANSA 1A98A 1N2CA 2F1KA 5BW8A 2WZQA 4BXOB 3CNEA 2PS9A 4PLWA 4KC0A 2GD2A 2P27A 5FYQA 3UJ6A 2HQRA 1HC7A 4NKRA 3F4BA 5LIRA 4S3MA 4PZ9A 2VSNA 5FPHA 2XUDA 3KOOA 3P2IA 3QOWA 2N3ZA 2IYFA 2Q29A 2C20A 1C3EA 3BN3A 3ZZMA 1XPJA 4AKEA 3QKUA 1CP3A 2AHRA 5J43A 5AUOB 1MU0A 2YFHA 2ZBGA 3EPRA 1F0PA 1JVBA 2CDBA 1B8OA 1SBQA 4I3FA 1VLLA 1WXHA 2W6MA 4LYFA 4D81A 4JR1A 3U3DA 3CKYA 4B76A 2VS1A 5LN1A 2H0AA 1XWWA 2VDPB 1DINA 1M7GA 1KYZA 4RDIA 2YJ5A 3LA8A 4Q9KA 4BU1A 2GXUA 2J0EA 1M1YA 1ODTC 4Y2PA 3WL8A 4Z3KA 4XWGA 2FFJA 4TTJA 1JNXX 1N8KA 4ZOQI 2EOAA 2VP9A 2V8BA 2FP3A 3SC6A 1YS2X 1VYVA 3W6UA 2OD9A 1HUQA 4F45A 5K4AA 1Q91A 3BQMB 3R0JA 5JS2A 1CBUA 1Q57A 3A7EA 1G4UR 4F5WA 5DM0A 3O91A 1MEEA 2Z1DA 4KR3A 2VIIA 1V6CA 4UU7A 2ZI4A 2AI3A 3PVZA 4AF7A 3AKYA 4ZJZA 1UEJA 2V3VA 1MQ9A 4L5YA 2BFDB 4OSEA 4B6EA 2ECOA 3WL7A 1T0BA 4ZHQF 1VP3A 3FRIA 4ER7A 4L51A 2R2GA 4QUGA 3LT0A 2UVDA 4D82A 3NQ41 3OH8A 3QE0A 2ODAA 3CZPA 5DX0A 3GH1A 4FOLA 3E5RA 3FROA 4Q3OA 1EIWA 1SU8A 4E6PA 4M99A 2WTXA 3DOCA 3DVAB 2AN3A 4MV0A 1A96A 5PNTA 4J1QA 5K0NA 4BFWA 4OXXA 2GOYA 2R5FA 3B12A 5EP2A 1OXVA 2EW8A 2QTNA 4IVRA 3OTGA 3MMXA 2NXCA 2I4MA 5BV2P 1QGDA 3KSDO 3C4QA 4H3SA 5A0FA 1HDYA 1RZRA 4P0QB 2OBYA 1YBAA 3HJRA 3MPOA 1Y8RB 4FR2A 4Q3DA 1OREA 4UVHA 4OP3A 2E37A 2BTOA 4NPHA 3RC3A 3KCNA 3OQVA 2RGCA 4LJ5A 2QMYA 1ZBDA 1Q95A 3QHPA 4JH0A 5IUKC 5B4UA 4P4NA 4J6FA 3O84A 1IN7A 3AC0A 1ZI9A 4C4ZA 2IIPA 5JCOA 2PXAA 2I4OA 1CZLA 1DADA 3HCOA 4YUXA 5D6NA 4M1OA 2H5JA 1AK9A 1N6KA 1T8WA 4KN9S 4NZNA 2HT1A 2JLQA 1C9DB 4H6PA 2O1EA 4FN5A 4C21A 1PEKE 3OESA 2FLWA 2VF2A 2I4RA 1SWVA 3E3NA 4AU1A 3LH5A 3FW1A 3IHWA 3QUQA 4OHBA 1CF4A 1EVEA 2VXOA 1PSDA 4S1NA 5BSWA 2GBIA 4FM9A 3DE1X 3GLKA 3DEZA 2ZIGA 1QH1B 3BTOA 1KQGA 2B4YA 4UEJA 5B4TA 2C2KA 1N3LA 3RFFA 1EVIA 1FDSA 3H5TA 4GSYA 4R8VA 1NN3A 2PA3A 3LCVB 5EHIA 4AN4A 4URZR 5A4FS 3D7KA 3AZQA 3UJPA 6REQA 1Q7RA 4CCYA 1AE1A 4QATA 1ENPA 3ZUPA 1A9XA 3FLBA 3GLIA 2ZS7A 5KYXB 1KIAA 1PQ4A 2F48A 3QNUA 4V02A 1GG2A 1GPH1 5MN4A 3KP1A 4TKZA 3MA0A 1CY0A 5DOZA 2IBSA 1P8AA 1KK1A 3AFNA 3PUWA 3A9UA 1V4VA 1P31A 4LJ4A 2FKNA 3CG4A 3H84A 2I1WA 2ECPA 3DMTA 4MI3A 1TF7A 5KYWB 4PTYA 5ICEA 2C4WA 3I2FA 1WR8A 1XAHA 4HJRA 3HSSA 4IMIB 1C4XA 2KQUA 4ZCQA 2CBXA 2BGIA 4EUNA 1VMKA 1CRQA 5JMOA 4U7DA 1SKMA 1VPTA 5LXTF 4Y2TA 3MMZA 4G2NA 4Q4LA 5HQTA 4EKDA 1DBRA 5DBIA 1ZNWA 3AM3A 1ULZA 1P18A 5E4TA 2ZGVA 5I9BA 1LDGA 4QJIA 1I9CA 1Z7EA 3HHPA 2H00A 5DNYB 1N9GA 5ECYA 3ZDEA 1I3OA 2CKDA 4NJEB 2PRJA 4RACA 1SXJA 3C24A 4EUKA 5JVDA 4LDNA 4UPEA 4N03A 1ZC4A 2Q8NA 3USZA 4F3KA 2GKSA 1G17A 1UDXA 2OO5A 2P0YA 1UKCA 5CEJA 5JSUA 1THZA 2WJ6A 4FGLA 4QWWA 2AZXA 2P41A 2FWMX 3AFHA 1YNSA 1Z34A 2YW9A 3IBCA 1RM3A 3M6LA 2IYYA 2HLNA 2YKGA 3U37A 1QGUB 1I7LA 1N75A 4MKXA 1OH7A 4OL9A 2IWHA 2Q3MA 5LKRA 1T2DA 3HVHA 1ZI8A 3VU8A 1F3OA 3HXTA 3OQJA 5E3IA 1CJVC 3IVRA 5FFMA 2PAFA 4PAQA 2QW1A 1ESCA 1SEVA 2BW0A 4GE3A 3C8MA 3CH6A 3HBAA 3NT4A 3TTTA 1YOVA 2OAEA 4P7JA 4WK2B 3LBHA 1WVGA 3KO8A 3Q5GA 3C3BA 5JNSA 3GAFA 4ZI5A 3B85A 5T8KA 4CKWA 5DM2A 3FOAA 3TQTA 3TL3A 1JT2A 1UMBA 3P4UA 4WK0B 5F35A 4KR6A 4DCUA 1J8VA 3KQHA 1JJBA 3EOBI 4HDMB 3SZOA 4I9GA 3KEQA 1KVUA 5CXXA 2G04A 2JAPA 4A3SA 4YIHA 2CLIB 2D1TA 1VKRA 1VCOA 1Z7YA 1YB1A 1N6PA 3VHQA 2HFKA 4MUIA 5COAA 3ESRA 3FVRA 3PS9A 4O1HA 4XVHA 1VJCA 5D6OA 1J0EA 2JGNA 1XOIA 4XYEA 4PN3A 1WDLA 2Q3FA 1M8JA 1F6WA 3JQBC 4KXQA 2YFQA 1FVHA 2CHGA 4WBNA 5J1SB 3I4FA 4NPAA 3W1WA 2DCMA 3TRKA 4DA6A 1BCRA 5EEGA 1YZTA 3WVNA 1E0AA 3GLRA 2G09A 3UKDA 1RYMA 1FQOA 1YQTA 3UMCA 4ZYWA 1WKBA 2R6R1 4G9BA 2FPSA 3EIQA 3QFCA 4QTXA 2QZPA 3OKAA 4XAQA 5A06A 3R5JA 4F9FA 2OESA 4PHCA 2L69A 2JFOA 3P9KA 3DTYA 3UHPA 4AO7A 4DUZB 3GFBA 1EUDA 4U9IS 4ALMA 3A1UA 2WHQA 1I1NA 3NUGA 1PL7A 2OHOA 3WRWA 2H2DA 3PGMA 4YJ2F 2C0PA 5FBWB 2CLOB 2B92A 3II6X 1Q3HA 3BE5A 1TU0A 4Z7NB 3WRVA 3FBTA 1ESDA 2WM9B 3H42B 2I66A 3IYLW 2ATXA 4WOKA 2FN4A 3PUZA 4MWDA 3TXYA 5EXEA 1ZVKA 3OCWA 4P2GA 4RXMA 3W8DA 4PY2A 4WZAB 2NPFA 5FYDA 3DL4A 4JT4A 2JGIA 4DV5B 4EHJA 3KL2A 1MH9A 2P7IA 3VZPA 1Q7BA 2XCOA 3FPKA 1Y3HA 2DUJA 4G1CA 1QAMA 1IUNA 3QBJA 4JJKA 1KDOA 1I14A 1UCFA 3BRCA 4QYXA 4BDTA 1IHUA 1OLUB 2MSKA 4WX2B 5AQEA 1XHEA 2EX0A 2BZGA 5HMMA 4LX0A 2ONCA 2TMDA 3N86A 1F0YA 1DIAA 2JHAA 4JL5A 1P9RA 2IX9A 2FG6C 3M5DA 4LDQA 4REMA 4AS3A 5A62A 3A6KA 1UXOA 2X0FA 1GG8A 4R2JA 1VE7A 5F33A 2XXJA 5B7NA 5H3CA 1UF9A 1GLGA 3M1LA 1IY0A 4F9EA 3ELUA 1RYEA 1JV2B 1BXRB 2WWHA 5A4IS 4FFNA 5FXMA 4ANFA 5EHGA 4DCTA 1PSZA 1YR2A 4J4HA 5KKNB 4KYIB 4AKIA 1P2DA 2OSBA 4NATA 2HEGA 1RQRA 3DVLA 4FINA 5TF0A 3RPEA 3K94A 3SZ3A 1K0FA 2B2NA 3W3AD 4JAVC 5BSVA 3HBLA 4I1UA 3EMKA 1RE1A 2DPYA 3FYUA 3PHHA 2QRGA 4GOOD 4M7WA 4R51A 5HM6A 2G72A 3VZBA 5GONA 3R6WA 1E2GA 3D7NA 3C1UA 2WAYA 1NUTA 1KE2A 1WMDA 3JYNA 3RV3A 2W2MA 2Z3VA 3KFVA 2B8EA 1SKAA 3ZV4A 1K8XB 3CO5A 4EKYA 4KPEC 3C6ZA 4NG4A 1H6AA 1B00A 3EIOA 3KVYA 1DIGA 3VR4D 1BKDR 4HO1X 4P1ZA 1CY2A 2ZIWB 4IS3A 4NXMB 3ED5A 3OOHA 1JIUA 2IH2A 1SBNE 1GGMA 1T4CB 2NT3A 3OEYA 4RLFA 5JQGA 3I5YA 4MR9A 1U4NA 1CY7A 1ZVMA 3FWZA 4BQOA 2PIAA 5KOIA 4I7EA 1LBSA 5M34A 2H9YA 3VAYA 2RD2A 3L8GA 4KUHA 3TF5A 3FPHA 1QIHA 4ICIA 3D7LA 3L7OA 2W6QA 4IIUA 5JZSA 1LPMA 3OE1A 2ZJOA 3E23A 1E5LA 4V39A 2R9VA 3V1YA 2XRMA 1DBIA 2HADA 2VATA 2YNMA 3WV4A 1B0ZA 1JQKA 5JSYA 4B7ZA 3RS9A 5JXIA 2NZXA 2XNDA 5M04A 821PA 4MRPA 5TQ2A 4C3OB 4KQFA 3K2QA 1A9PA 1B6GA 4I1SA 2F8MA 1D2NA 2I80A 4PGFA 4WKNA 2MOKA 1ZJJA 2PKCA 4GNRA 4XDGA 1J9EA 1FYFA 2FPGB 3KLMX 4H6VA 1EBBA 4ZAGA 4QJ3A 3RBXA 1MDFA 4X8MA 1TIBA 5LQNA 5I48A 3ESZA 1E89A 4NYIQ 2Z08A 4WN9A 3O74A 2RGNA 1T1SA 2QQFA 3K09C 4QO7A 5BMVB 3DUFB 2NZUG 3ZWBA 5LP1A 5AWFC 1QAQA 3PXCX 1UEXC 1MLDA 4GZ6A 3GNSA 4FGSA 1W1IA 4N4AA 3HMQA 1NBME 3INGA 4U39A 3B3FA 1JN0A 1Q7EA 3OF5A 2A0YA 1AZSC 4C04A 2WKQA 4EWLA 4TTRA 5HKBA 5BVHB 1EGVB 2JK1A 4YROA 4YRQA 1NWHA 2O4CA 2OYSA 1IUKA 2F1RA 4HGRA 3CUTA 2C2XA 2B35A 2E55A 3U4QA 1X7WB 5A05A 3KETA 3EZ6A 4GFDA 2Q49A 2PKWA 2XUOA 4P08A 3CCFA 1BEEA 3GFSA 4B35A 1XF1A 4G4JA 5HNKA 4DNOA 3DP7A 4HLUA 2Z9CA 4Q1AA 4YFVA 3R8XA 3EY9A 4OF4A 3L4BA 3UWOA 1GUFA 4W6ZA 4DVGA 3THYB 2ZB8A 2X86A 2JNWA 2X4GA 3MAJA 2B7LA 4GQIA 1KJIA 5CIWA 3T06B 5JXHA 1NQVA 2QYOA 1QIIA 1M9NA 3CMCO 1DFIA 1BXGA 4R1TA 4CLEA 3OP4A 1E2HA 4RKQA 5ARCA 4B31A 1ZM2A 1Z5GA 4F8JA 1G21B 3LXXA 2Y0CA 4CM4A 3WQHA 4WA8A 3UOAB 3GRKA 1U11A 2ENUA 2YZ2A 4FCCA 1YQEA 4WKCA 2ZJ4A 3K2EA 3UT0A 1VHQA 2FK7A 1V1RB 2V97A 1Q6ZA 4MGHA 3ZWAA 2HH9A 3WGKA 5EEHA 1ZONA 1WZUA 2OBXA 2UVPA 3Q7EA 4FUTA 1W88B 4GMDA 1V26A 1ZOPA 2AOXA 2GF0A 3AJ9A 3Q40A 3MTIA 4H7JA 3PE3A 1P1RA 2GCNA 3NHBA 3W7AA 2FR0A 4BUZA 4TKVA 2R6DA 1FRFS 2JVKA 5FO1A 2HAEA 1T25A 2O05A 3OJXA 5SICE 4JXXA 2XI4A 4P81A 1R8JA 1JVSA 7ABPA 2XYHA 1MOPA 2DU8A 4KFRA 1TU4A 3Q3CA 5JYDA 1JU4A 2A5JA 2A78A 1KSFX 2PKQP 1WTAA 3DYBA 3GU3A 2ZYHA 4MQFB 4BB6A 3VTAA 4PNEA 4MUEA 4FYJA 1RYFA 3TSYA 2J4DA 1CIVA 3TPFA 2PFSA 3F8WA 3B48A 4RL4A 1YGYA 5JNRA 2E4UA 3MGKA 3GDWA 3DBRB 4C2UA 3KKNA 1R8QA 2NVUA 2R6AA 3WIOA 3QX9A 4GDMA 3UXEA 1L4EA 4UU1A 3STHA 1TEZA 1YB4A 4ZI7F 4TTVA 2JAWA 1PK7A 5T3UA 2QRZA 5KPDA 3L49A 4Y6GB 2JCXA 4TUYA 2OHFA 2VTVA 5K6AC 1WSDA 4UZSA 5KQPA 4YAGA 4MPRA 1W87A 3B1VA 3UOGA 1CRPA 4W9NA 2PMDA 4HFJA 2V98A 3ZHVA 4IDEA 4O2BA 5G53C 2EDCA 2VWGA 3JQ9A 3TRHA 3UT5A 5ER9A 1QS0B 3ZVLA 4ZO8A 2IEBA 3V42A 1M33A 2Z8XA 4QQNA 4AKHA 3CNHA 1SCUB 3H3XA 4DQKA 4BO1A 3CLTC 3WGMA 3X3HA 3HO6A 5DNWA 3U17A 3ZW9A 4OVKA 3RC9A 5BSFA 2XUAA 3D8SA 1IUOA 3SVLA 5A5FA 2P1RA 3AEUB 4OLBA 4D74A 2MT9A 3SXUB 1W8IA 4LJKA 2WM3A 3LSTA 1QLJA 3RS8A 3SQMA 3WZ2A 4C76A 4Z49A 4CLOB 1BGVA 2O50A 2ORYA 2VRBA 3P9YA 3RAGA 3S2UA 3W77A