4URAA

Crystal structure of human jmjd2a in complex with compound 14a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
349
structure length
349
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Optimisation of a triazolopyridine based histone demethylase inhibitor yields a potent and selective KDM2A (FBXL11) inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4uraA01
2PXJA 4IGOA 3KV4A 5FZDA 5FPAA 3LDBA 3KVAA 4E4HA 3N9MA 3PURA 4LIUA 5FXVA 4QXBA 5FZ7A 5ANQA 3N9NA 5F2WA 5FZ9A 4C8DA 3PUQA 5FYIA 5KR7A 4Y3OA 4DIQA 2OS2A 5FZIA 3KV6A 4GJZA 2XMLA 5F3CA 4AI9A 3AVSA 2YBSA 3PUAA 5FY8A 5FZOA 3K2OA 5FYTA 5IVCA 2GP3A 5FZ1A 4QWNA 4CCOA 3PU3A 4D6SA 5FP4A 5A7WB 5FZ6A 2XUEA 5FPUA 5FXWA 5FYYA 5F39A 4URAA 5FYZA 3ZPOA 4DO0A 4V2VA 5IVJA 5FZBA 5A7PA 4BXFA 5CEHA 4CCJA 5FY9A 5FZ8A 2Q8EA 4NUBA 4AAPA 2YBPA 2OX0A 5FWEA 4QX8A 4EZHA 4LITA 4BISA 5FYUA 5FZAA 4D6QA 5A7SA 3PU8A 3N9QA 4GJYA 5FYVA 4QXHA 5IVVA 5FZFA 2YBKA 5FP7A 3N9LA 5F3IA 2XDVA 4Y33A 5A7OA 4CCMA 4QXCA 4TN7A 5A3TA 1VRBA 4V2WA 5FY7A 5FZEA 3N9PA 5FJKA 4Y4RA 5FXXA 5FP8A 5IVYA 5F5IA 5A1FA 3K3NA 4IGQA 5FYHA 5FYSA 5FY4A 4UF0A 5ISLA 4BU2A 5LWBA 4GAZA 4LIVA 3UYJA 2YU1A 5F5AA 3DXTA 5FBJA 4HOOA 5FP3A 4HONA 3N9OA 5FZHA 5A7NA 5FY5A 5IVFA 5FP9A 5A7QA 2YPDA 5FPLA 5FZOB 5F3EA 5FYCA 3PTRB 3AVRA 4XDPA 5A3WA 5A1LA 4QU1A 4ASKA 5FZLA 4CSWA 4LXLA 5F5CA 5A3NA 5F32A 3KVBA 3K3OA 4GD4A 5FZ4A 4QX7A 2YU2A 5FZ3A 2GP5A 4IGPA 5F2SA 5FYMA 4CCLA 5FZCA 5FPVA 5E6HA 4EYUA 4EZ4A 5LW9A 5FYBA 5A7WA 5FZ0A 3OPTA 5F37A 3LD8A 5A80A 5FUNA 5FXZA 2Q8CA 3PUSA 2W2IA 5F3GA 5FUPA 5FWJA 3AL5A 4CUGA 5IWFA 4D6RA 2OQ7A 3OPWA 3PDQA 3AL6A 3KV5A 5IW0A 2VD7A 3ZLIA 2P5BA 3KV9A 2OQ6A 3RVHA 3NJYA 5FPBA 5LY1A 5K4LA 5FV3A 5FZGA 5FY1A 3U78A 2WWJA 5FZKA 2WWUA 4CCKA 4UF0B 5FJHA 5FY0A 5FZMA 5LY2A 3U4SA 4XDOA 3DXUA 4CCNA 2Q8DA 5IVEA 2OT7A 5IVBA 5A3PA 2XXZA
chains in the Genus database with same CATH superfamily
3LA7A 4QQ2A 1HRV1 1H8TB 3B00A 3VBOA 4DEQA 4PBPA 1IQDC 4N90A 3ZXJA 1RUF2 2P17A 1IS5A 2GC1A 2BBVA 4C8DA 3AXEA 4XFIA 3IAQA 3BTAA 2PHLA 5EYYA 2F4PA 3KV6A 1JHJA 4LBQD 4XAEA 4F8AA 3FN9A 3U0ZA 3I59A 4QPGB 2V09A 1AR83 2EXHA 1C3HA 2VUDA 3VD7A 1W8HA 5FZ1A 1YRZA 2VMGA 2OIIA 2ZHNA 2P1BA 4CCOA 1UY1A 4D6SA 3JCIA 3U75A 2XHNA 4AXOA 3POGA 1RUF1 2W1WA 4XFCA 5G04L 3WLUA 1CR7A 1KGYA 1ULEA 4BOWA 3LDKA 4RR3A 5C7GA 4JKKA 1S0JA 3R4DB 4Q5OA 2QTWB 4SBVA 5FMOS 5A7PA 5CVRA 3T0DA 3A22A 2AZ5A 4QKBA 2QDNA 1MS8A 3MW3A 4RHV2 4UFIA 2PAMA 4BB3A 4N43B 1OOPA 1WUVA 2DCYA 4AEJA 1W2UA 2RMU2 2RS31 2VO5A 2VMHA 3DPRB 4XZUG 1IPSA 3O0XA 4AHWA 2NP0A 2WZ8A 4GMP3 4LORA 1TQ5A 2ZS6B 1DGLA 4CDXC 2YY1A 3VDDB 1GZ9A 1G9CA 2E9QA 4UT5A 1XE7A 1OF4A 2WFF1 4QXCA 4XOGA 4GZ9A 1GSLA 1B35A 2UYAA 4OI1A 3MIEA 5A1FA 2JD9A 3K3NA 4FVVA 5F6KA 4JDMA 5FYSA 4RHV1 4U36A 2QZ2A 4AG4A 3IT8A 2RMU1 2QNKA 2R16A 4N53A 1GP6A 1H9WA 1XNDA 2IXIA 4TYSA 3WSOA 5ABJB 4KU7A 2QQPA 4N8MA 3ST7A 4BQ3A 3WNOA 4UFHA 3SKVA 3ZSKA 2IUWA 3IM0A 5A6ZA 1H8TA 4QQPA 4NIIA 1PK6C 1ULFA 3RZKA 2R063 2V5DA 3MIDA 3OGRA 1VLNA 1BQPA 5DZEA 5A1LA 4QB2A 3I2OA 2BFUL 4RD7A 4BIOA 1RUG2 5G05L 5FZLA 4CSWA 4NN0A 5DAWA 2VH9A 4NAMA 1LR5A 1D0HA 2LW8A 1IGOA 1IS4A 1XYPA 1OLQA 1G9BA 3KCCA 2ZX1A 3CQOA 4NJ4A 5FZ3A 2XHKA 1Y4WA 4R9AA 3THPA 4B4QA 4FI9A 3WW3A 1RUD3 1YQCA 4BQ2A 3LD8A 2JDAA 1SFNA 1ZYBA 1XYNA 3M7AA 4O9EA 1W6NB 2HEWF 4CUGA 3CEWA 1ZREA 2B42B 1RUG1 4QB6A 4IW3A 1GP4A 4FBFA 2QQVA 5FO9B 4OHWA 2BGPA 3ZYBA 3NJYA 4N43A 1BK0A 1JOBA 2XLFA 3DPRA 4WVMA 1E57A 4BQ1A 3TEYA 1ZRCA 3U11A 3VKFC 1H6XA 3S30A 3T1MA 3RG0A 5FZKA 3AKQA 3TYJA 3CZUA 1UZ0A 1BXHA 2Y6HA 5FY0A 3OD0A 3LIGA 3LDRA 4RQPB 3VDDA 1Q8SA 1QQP2 4IV1B 4INDA 2PLV1 4YG3A 3R4UA 4TLFA 3AMHA 5E1RA 5IVEA 3MI8A 3ASIA 1O5LA 2XLGA 1SLIA 5HCBA 4E4ZA 5JXIA 3U4XA 4XF4A 2E7TA 2PXJA 1BJQA 1ODNA 4MYEA 3GYDA 2GH8A 3N3HA 1H4HA 4AGGA 3C7HA 4KQ7A 3ZFEB 3O1SA 1DQ2A 5J09A 3K51A 1UKRA 1MEC2 4HPKB 5JZGC 3UNPA 2WBKA 1QQP1 2C26A 4PHZA 3GHNA 3ALQA 1MVEA 1ODMA 4TWTA 3HT2A 2E7QA 4AL9A 4Y4YA 1GV9A 3VBOC 4Q4Y3 4P02B 1FYUA 2GNTA 4EN7B 1FPN3 4GWNA 4PCRA 2JG9B 4UFKA 3Q8EA 1GWLA 1OI6A 5FPUA 2R072 1AYM2 5FYYA 3GBFA 2P34A 4URTA 4B29A 1MEC1 4IE7A 5CEHA 2VZOA 1U5ZA 5I8YA 4NUBA 4E4SA 4D69A 2WNOA 5FFOC 2DURA 4BJ0A 4YW3A 1DQ5A 3ZFFA 4GJYA 1IS6A 2QQLA 2ZEZA 1TEIA 2R071 2IXHA 2WNUB 2ZX4A 4CZSA 4RR3C 1HQNA 4YZ1A 5FP7A 4CCMA 5E88A 4LOSA 1A8DA 1OQEA 3ZYIB 4PDWB 5GM0A 4A6SA 2WKKA 3LF7A 1V6KA 4Y4RA 2VE1A 1CPMA 3AZVA 3ZKUA 5DZFA 2VZRA 1AXYA 3FWEA 4ZKTB 2RS12 3SEPA 1D4VB 1PVC2 4IV1A 3F95A 4QDSA 1DQ6A 2VW0A 4IE6A 2OYZA 4Z8BA 4A2UA 3USSA 4FPOB 4LE3A 1UU6A 4H2AA 1W9FA 1JI6A 3ACLA 4LTAA 4XHXA 5LA2A 1UOGA 1B35C 1K5MC 2W47A 3MFAA 2RDSA 2X5IB 3ILFA 4A44A 3R05A 1LHUA 2WO2A 4MADA 3ZFEA 3K4AA 3AVRA 3WCRA 4OZOA 5A3WA 4HPKA 4N53C 5GKAC 2RS11 3CL1A 1PVC1 3GJAA 1UXXX 3VBRB 1SDWA 3MIFA 3IWZA 2K46A 3HQUA 1UY4A 1CZVA 1DCSA 2JJ6A 3AMNA 1JYNA 2ADEA 1H8TC 3NNJA 2X10A 2VUAA 2A1XA 4LBOA 2DCJA 5H9QA 5FMBA 1NQJA 3ILNA 4I02A 4GA9A 1A3KA 4Q4V3 3PUSA 2JENA 4XUOA 5ERLA 3VB9A 3CF6E 1SCRA 5LB6A 4QPGC 4M4PA 3LEKA 3FJSA 2P3IA 2RDNA 4X8NA 2D7FA 2BVVA 2VMIA 5BXXA 1X33A 2DUOA 4LJHA 2HH9A 1PGL1 1PM7A 3I8TA 1H1MA 4CCKA 4LO7A 5A32B 2WNUA 4FFFA 5FIXA 2BWCA 4GXLA 4N7IA 2I07B 5JOWA 1YIFA 1C8NA 1SCSA 2BVBA 2MNGA 2Q8DA 3EHKA 2VZQA 3USUA 2W9XA 4DOUA 1ZX5A 3RQ0A 3H7YA 4N43C 3DPRC 1EYBA 1JTZX 3WV6A 1H6YA 3IKWA 1SBEA 3N9NA 4W6YA 4X8PA 3FLPA 5T55A 3VDDC 3ZKYA 1GKBA 4BLJA 3H0OA 3MPBA 1PZ8A 4LBQB 2A3XA 4ISQA 5DUVA 2NMOA 2PQSA 3BVCA 2X5IA 3PUAA 4YWAA 4AZZA 1VBB2 1H2NA 5IVCA 1SBFA 1ZRIA 5JCTA 1DLLA 3GZUC 5AC93 3PU3A 3D5OA 2DYCA 5K7PA 5ABJC 2VR4A 3MLJA 3VBRA 4BHPA 1MS3A 3NAPA 1I6XA 3I4IA 3RZGA 3HT1A 2W1UA 3WF2A 2EIBA 1PIV3 4BXFA 5B4XA 5CFDB 1NAEA 4LHLA 1CAWB 1FNZA 1W3XA 2VZSA 3KD4A 1KEXA 4L2NA 4Q4W2 1VBB1 3O14A 4QPIB 3KGZA 3W20A 3LOIA 3WG4A 4HKLA 1DGWA 2DU1A 3MF6A 2XPJA 1AF9A 2Y33A 4QT6A 3MEPA 2GU9A 2CWMA 1V0AA 3GZTB 3DKWA 1GFF2 3OUJA 3SHRA 4ORFA 2ZKNA 1GNZA 4JKLA 2JX9A 1OVPA 4DXRA 2NMNA 2VNVA 2QQOA 3JQWA 4QQHA 1MVQA 1AL0G 4Q29A 3WNPA 1V9U2 4Z07A 2O8QA 4CEWB 5FRAA 4Q4W1 5A32A 5BY5A 2FCVA 4K3UA 1E5RA 1A6CA 4EWEA 1IG3A 4HONA 1SQ4A 2JE9A 3U14A 1FOD2 5FZHA 3IDBB 2JXAA 3PTYA 4NPMA 1WWYA 4XYXA 2ARBA 2FCUA 2JECA 5FBZA 5A7QA 4LK6A 1LENA 5L9RA 3UKTA 1NKGA 4N9IA 3TRSB 1OLMA 4FTSA 5FZOB 3RGBA 4AVVA 4H7LA 1V9U1 3OD4A 1OLME 4RQPC 4W6WA 2FDJA 4WM8C 4IV1C 4PBOA 2X8KA 4NWWA 2HLEA 1BBT3 1HXS3 1QEXA 4CP0A 1Z7S2 2SLIA 4E9KA 4ZU4A 5A3MA 2WS92 3S57A 1HQLA 3IPVA 3FFQA 2GP5A 1GZTA 3M8LA 2OZ6A 5AFBA 4EYUA 4PQQA 2DV9A 3OUHA 2HWC3 3PMEA 5FYBA 4K40A 1JBCA 4YFWA 1WW5A 3OCPA 3RZZA 3ZDVA 3ZFEC 4RGKA 1O8SA 3GZAA 1UZZA 3AP5A 5DAXA 3SH3A 1IKQA 4UW6A 4CA9A 3AL5A 1VRH3 3L2YA 1N3QA 1NZIA 1Z7S1 1LU1A 2VW2A 1D4M2 5IFPA 2VD7A 2WS91 1CAWA 1UX7A 2ZABA 1YQ8A 3FZ3A 4QPIA 3N35A 5LY1A 2O1QA 4OMCA 1CX4A 1XB9A 2JG9C 3ZX7A 1WD4A 4XW3A 2VY0A 2QQKA 3O12A 5C8CB 3BB6A 5C3PA 1HLCA 5HXMA 3TB0A 1SPPA 4ASLA 4GB33 4LO8A 3WDVA 1HV0A 3HJRA 1WCUA 1I9RA 1RMU3 5B4NA 1REFA 4GWJA 4KGGA 1H4GA 1GNHA 3BODA 2MHFA 1D4M1 2IC1A 5CAZA 1V6MA 4IEYA 4E4HA 2AEYA 4CEWA 3A4UA 3PNAA 2K9ZA 2RVAA 3GBGA 5TSWA 4E2QA 2VCAA 4XXPA 1W9YA 3KQRA 5FZ9A 3WW4A 2WAAA 2D93A 2WNUC 5F9TA 1TMF3 3N7JA 4KI5M 4YGDA 3S0MA 1AYN2 4PDWC 3AKTA 4QMAA 1K45A 1MS9A 2JB4A 1H2MA 3UL2A 3BTXA 5C6CA 1PM4A 4HBNA 5FZOA 4XF0A 5BPXA 3MW4A 3T2PA 5FP4A 3H1WA 1JYIA 2ZACA 4AFBA 3BU0A 2ZAHA 1QXJA 3ZOIA 1UPSA 4Q8KA 1FT9A 2GMMA 3AFKA 2ZAAA 4V2VA 5T50A 3NNLA 4DXZA 2X5IC 3AYDA 1CQ9A 4FOWA 4QX2A 5L36A 4FOYA 4RS5B 2OX0A 3A7QA 1UY0A 3NMBA 3SLIA 4JRAA 1DQ1A 4QX8A 4ARXA 4EJRA 4LITA 1JZ4A 3FFZA 2DVFA 5FYUA 1JU4A 4D6QA 3VBRC 3MYXA 3V64A 4AVBA 5FLHA 3VBHB 3UJOA 3J8F3 4AF9A 2W1QA 4HETA 5DUUA 3LQCA 3VD5A 3E6CC 3GCWA 1OBNA 4XMIA 4BQWA 1XJAA 4NIAA 1AR61 4WZCA 1VMHA 2ID4A 5C8WA 1W6OA 2RJ2A 1YFUA 3KB5A 2FBEA 3DN7A 1O8PA 1URXA 5FPXA 1MQTA 2X53S 3NW4A 4QHBA 5IVFA 3I3QA 3JB4C 4NRMA 1VBA2 3SC7X 1OQ1A 5JI7A 2X09A 1RUJ3 2VMEA 2ZA9A 1R1ZA 1UXZA 4HVRA 4AI1A 3QD6A 2WC2A 3NKGA 4MXVA 5JXGA 5JLVA 3B5LB 4ISRA 5KBFA 5L19A 4AEDB 3ZYRA 1IHMA 3TAYA 2EF6A 1WCSA 5DDJ2 4AEKA 1WLWA 2PFWA 1PVXA 4NHLA 4GKXA 4YPJA 4RGAA 4A7ZA 3Q8AA 1VBA1 3SISA 1S0DA 5E6HA 3M2MA 2ERFA 4CP2A 4UI9L 3T4VA 3OPTA 4FP2A 2RJLA 5F37A 3I3EA 4FT8A 1DQ4A 2A73B 3ON7A 3WG3A 3ZN6B 4D6RA 2WL1A 2ZGUA 3I49A 3JBG3 3K75B 2ZGKA 5JPMB 3I2GA 1GOFA 5DDJ1 4YRDA 2WT0A 5C4WA 4XEZA 1DG6A 1WBFA 2A3YA 3C7OA 3VZNA 1BEV3 4RS5A 3ZMOA 1NG0A 1HDKA 4X6RB 2Y6JA 3ZFGB 2HBUA 1ZRRA 2XQRA 1A34A 4HVOA 2YMZA 3ETPA 5KXBA 5J48A 2VOVA 1QDCA 2XJPA 3VBHA 4QKDA 2TBVA 1RJ7A 4XDOA 3WHTA 1QH6A 5CFDC 2HWF3 4A7KA 4EN0A 1V6IA 4P9JA 4LBJA 1H9PA 4MGSA 4QPIC 1LOEA 2RJKA 1K3IA 5L7OB 1VBD2 3OGGA 1LULA 1ZBE2 1NCQB 3H50A 1WZXA 4MV2A 5A1AA 3LFIA 1NOVA 2WZPP 2JB8A 2A3WA 4IEPA 1ZA7A 1R083 2OUJA 1FMD2 4QX0A 2VZTA 5GALA 5F3CA 2ARAA 4ES9A 1RL3A 2VCCA 4MO3M 4XE9A 1PGW2 2PHWA 5FYTA 4CEWC 1W0NA 3THCA 3SMHA 1LOCA 4JGYB 1PGSA 1VBD1 4YW1A 3A0NA 1ZBE1 3IN9A 1PNFA 2QQMA 1TME1 3LWCA 4URAA 5I0DA 4Z2WA 2EIEA 1ASJ3 2XJSA 5FZBA 3N36A 3Q9OA 2YC0A 5FAXA 1FMD1 3WT3A 3VV1A 2EA7A 5FY9A 1C5IA 5BNQA 4XABA 5C3QA 2FCTA 1W8OA 1VALA 2ZHMA 5KXCA 1O4TA 3ATGA 1GZCA 1SLTA 1PGW1 4Y1YA 3KHBA 3FL7A 1R1A2 4I30A 3T09A 2UY8A 3B93A 1LOAA 4M01A 1S55A 3KT1A 5BNOB 3ZSEA 1RUI3 3T4HB 1XC6A 5F3IA 4Y33A 3AXDA 3X29B 3E97A 1LHWA 1XNBA 4JGZB 3ZFGA 4D8MA 4OFGA 1F35A 2CU5A 3MV01 4B7KA 4YLZA 5FY4A 3WQ0A 1XNTA 1L7LA 4YG0A 2QDRA 4MGKE 2CGNA 4Q4X2 5D8AB 4XVHA 4CE8A 4CDXA 5I0TA 5CG9A 3RZLA 3N9OA 2W39A 1W8FA 2BQPA 3LA2A 3M3EA 4FXGB 2BNMA 4AVAA 1MS4A 3SH4A 5LBBA 4CU6A 1K5JA 2JWPA 3GALA 1YFXA 5L7OA 2AH2A 2EXIA 1VB2A 5IHRA 3RZHA 4MGTA 5C8CC 5HV0A 1NCQA 4LEJA 1SLAA 5CZKA 1RIRA 4QDRA 5FMOL 5I8TA 1SDDB 2VTXA 2ZMLA 2ZTNA 4QU2A 2QUOA 1C28A 3CZJA 3PIJA 1AR93 1EAH2 4Q4X1 1PO23 5F5CA 1UN1A 3GHMA 1ZZBA 5SV8A 1BMV1 1W06A 2D40A 1QOSA 1WLTA 3RWKX 2A6VA 2R7EB 5FREA 2RS33 3AMMA 5H9SA 5FYMA 4ZONA 5LATA 5FZCA 5FPVA 1MS1A 2D5FA 5DG2A 4AI3A 3MLLA 4XTPA 3ZR6A 2D97A 4FXKB 2UYBA 5F3GA 1W9WA 1YFYA 2WFF3 4C0HA 1W04A 1UZVA 1ENXA 2VOKA 2WQ4A 2JDNA 3QACA 3VKLA 3WQ7A 5JPNB 2PTMA 2JKXA 1EAH1 3M3OA 1SEFA 4ZZ8A 3KV5A 4Y26A 2QE3A 3CJIB 3RMYA 3KV9A 3MZHA 2OQ6A 4JHTA 3CHXA 1QJY2 2XVLA 5FY1A 4QHZA 3VKOA 3HBKA 3T2QA 5BNOA 1FAYA 1S4CA 4XFAA 3S5AA 4CDWB 3AYCA 2TEPA 4ZS2A 2Q1ZB 1H1AA 5GJ6A 4JGZA 1J3RA 4A3XA 4FTBA 4GIQA 2DF7A 5DAPA 5EQUA 2G4IA 2PAKA 4RS5C 3S5QA 4BIFA 5A33B 4C91A 2XXZA 1HRI2 5A6QA 2RM23 3LDBA 4OI4A 3TNQA 4LIUA 1T2XA 2FZ1A 4AHZA 1RVF3 1VBC2 1W0OA 5D8AA 2Y34A 1NE4A 1SFPA 1BVVA 1LEDA 2PQQA 1WMXA 2P6HA 2WN3A 3J26N 5FZ7A 5HV4A 4AAXA 1YHFA 3VBHC 2TNFA 3TWIA 2NM1A 4GJZA 4UW5A 2NQYA 4AI9A 1DYOA 3EXUA 2ZGRA 4Q27A 1RC6A 2D43A 2IVJA 3OEBA 4KWJA 1S0FA 2XB6C 3LPGA 3OYWB 4UFLA 3WUCA 2DWRA 1HRI1 2Q30A 3U37A 5GLWA 3NJXA 2E63A 5A7WB 5C33A 1G9FA 1VBC1 1S0EA 5LRRA 3WOGA 4XDQA 1QMJA 3T0AA 4L8QA 1UD1A 4MHRA 4Y24A 4YZ3A 5F39A 1GICA 2OUHA 3W5NA 1OUSA 5IYYA 1H0BA 4QX1A 1VB4A 4JKMA 5FMCA 4M4RA 4ZXEA 2VL4A 4AI0A 2XJQA 4D7YA 3I3DA 4IESA 4B7EA 2F17A 3WW2A 4EZHA 2PLV3 2ARXA 3J7HA 3K4DA 4OHXA 4AEDC 4BISA 1J59A 4Q1RA 1D2SA 3ZYPA 1XE0A 3GXUA 1XXNA 4Q8LA 4QXHA 1KS5A 3LEIA 1QJX3 1W9TA 4HKOA 3RSJA 2YBKA 4YW7A 1OURA 2H0VA 4JC1A 4BXSV 1VRBA 2BV4A 4H7MA 5HPOA 3O1OA 1CESA 4M3CF 4P9GA 1T6GC 2I45A 1I3HA 5C5TA 5FYHA 1O3RA 1Y9MA 5FOBB 1JUIA 4Q0QA 4LPLA 4CDWA 4QGLA 1KD7A 3KGLA 3HVDA 2UWCA 3FUQA 2J22A 2GAUA 1KFXL 1Y9GA 2YYOA 1D2QA 2C24A 4KMQA 2A6ZA 2I2SA 3RWNA 2WWSA 1V00A 2Z79A 3IIAA 4Z2AA 2E32A 3AYEA 2BWAA 4CUAA 3ZFGC 2GNDA 2JICA 2R043 1ZZ7A 1L7QA 2BZDA 2XL7A 1FX5A 4FFGA 1VBE2 3PTRB 3I2DA 3DF0A 4QU1A 1EV13 1TNFA 3IAPA 4KH9A 3S7EA 1X36A 2VZUA 3NL1A 1Y9QA 2HWE3 1FV3A 1WGPA 5DQ0A 3ZXGA 1UMIA 3ACFA 4BA6A 4PF5A 2IFWA 4KG8A 1K5MA 4FPHA 2O0OA 4IGPA 3OYWA 4ZS3A 4CCEA 5L7OC 1JZ2A 2LRPA 3IZOA 5A7WA 1NCQC 5IAXA 5T5LA 2GDFA 4FP3A 4EWDA 3IDAA 1VBE1 5GZFA 4WBBA 2ZMNA 1CONA 1X8MA 2OQ7A 3E5XA 3F2ZA 4FOVA 1RB8G 3EJKA 4H55A 1H1IA 5IW0A 2FQPA 5EJ3A 4PIZA 4KWLA 3UGHA 1UMZA 1DGRA 3FBMA 5SV5A 4DQAA 2XLAA 3EQEA 3CKHA 1DGRN 2D6PA 4JGYC 1W2NA 4AHYA 4NRPA 1GP5A 2IFRA 4QPWA 3CMGA 1STMA 1ZBA2 4BE3A 2W52A 3DKQA 4CPBD 5A6YA 4QPGA 2DVGA 2VBDA 3OEAA 1QY4A 1Y43B 1COV3 2J7MA 2VQTA 5DABA 5EWSA 4IEUA 1LB2A 1W90A 2J1EA 2BU9A 2C5DA 1J3PA 2DTWA 2GALA 4U2AA 4YM3A 5IAVA 1C8M2 1POV0 4LA3A 5BNOC 4OHVA 5F2WA 3PLQA 1ZBA1 3JUUA 1Q5OA 1DYKA 4R8HA 2ET7A 4JGZC 4N9HA 3D3AA 1CWPA 1US2A 1UIKA 3BOWA 4HXCA 5DN2A 4YW2A 4OI0A 4FSJA 3WNNA 5HCAA 2B9UA 2OW4A 2CDOA 2GC3A 2HBTA 1RUH2 4JDOA 4XUNA 2Z5WA 1WW7A 4XAAA 3ZYGA 4I2OA 5D8AC 2XJVA 3IMMA 1YFWA 1IPKA 2G1MA 4WM8B 3RYPA 1C8M1 3GM8A 3NV1A 1ZRDA 1POV1 1EUTA 4QD2A 4QB1A 4DO0A 4LMFA 1RUC3 5JOZA 3HMYA 4YYOA 3ZYHA 4AAPA 5EXOA 2F6BA 1W39A 3TBDA 2FHRA 1W6QB 1WCKA 5LCWL 1RUH1 3ZXEA 1Q8VA 3VD4A 5ABJA 2HYXA 1AR82 3LSDA 3P3PA 3GCXA 1NCRB 2MPFA 4FQZA 4Y5SA 1ZZCA 2WYFA 4FPFA 3KM5A 2VC9A 4I0BA 3U1XA 3VBUC 3UETA 5IATA 4AFDA 5KHIA 1CVNA 3PIGA 2O8OA 3QH7A 5J3UA 4V2WA 1CZTA 5JSPA 4DXTA 3D8CA 2ZJCA 4XBLA 1W03A 1DBNA 3KLSA 4IEOA 1SLCA 2KD7A 4PQ9A 3O1TA 3INAA 1YXWA 2R49A 3JU9A 1ULPA 5F5AA 1AR81 2PYTA 1CN1A 4QXKA 4HFSA 4S2HA 3CJIC 2V4VA 4AFMA 2HEVF 2LUWA 3HNYM 4BMEA 4ET7A 2CGPA 3JZVA 1N1SA 3WF1A 4MXWB 1LGBA 1RXGA 1W6NA 1LEMA 4CDWC 1UX6A 1OA3A 2GMEA 3K77A 1W2TA 5F1RA 1AYM1 4O9GA 2ZGNA 5DAQA 1K12A 5F32A 1PZ7A 5LASA 1LRHA 1LU2A 2YB7A 4S2DA 1WKYA 4IERA 2FDGA 2Z69A 3ZSLA 1U0AA 1OD5A 4XPVA 2WLQA 3MW2A 4M3CB 1ENQA 4RQPA 2J1TA 4WM8A 2Y8KA 3HQRA 3OOXA 2C1FA 1J1LA 1OSGA 2DVBA 5FKCA 2Q8CA 2GNBA 3ZR5A 4PI0A 4GULA 4CXWA 2GMPA 4XFBA 2R062 3WW1A 1S1AA 5IJRA 3PDQA 1SG3A 4RL7A 2L9LA 2QQIA 4YM2A 2XVGA 3VBSB 3ZLIA 4FQ4A 1HJFA 4AEMA 4DRRA 1S0CA 2YHJA 1W6QA 5K4LA 2H6BA 2ZMKA 4WM7B 5DXDA 2HWD3 4AHXA 3ES1A 5L9VA 1NCRA 4XQ4A 2WWUA 4CP9B 1JOPA 2JDYA 4HK9A 3KT4A 2ZEWA 3GNEA 1RUD2 3J4UH 2UWBA 1PMIA 3ZPYA 4HL0A 4AQ6A 3KT7A 1BZWA 1YJLA 1JHNA 1OPOA 1UIJA 2JG9A 2BFUS 3RI9A 1LKNA 4OUSA 1JYWA 1OUXA 4IEVA 5DG1A 3ZXLA 4C1WA 1W28A 5H9RA 5HXVA 2V73A 2WAOA 4LUMA 3WNLA 3AFGA 1RUD1 4QAWA 2IXKA 2Y6FA 2VGDA 4X6QB 4YNIA 1UKGA 4ZZ5A 4MXWA 3AP7A 3K2OA 2PA7A 1OPMA 1UCXA 4XIOA 1Q8PA 4PLNA 1H2LA 4YFZA 1PO13 2HWB3 4QGNA 4XBQA 5FZ6A 3OF1A 3OJBA 3ZXKA 1XOYA 1U12A 5J37A 4QQOA 5BYNA 2VMDA 3NV3A 4LUKA 3ZPOA 4PDWA 5DUXA 2FMDA 4MZUA 5GZDA 1IPJA 4PI2A 3WDXA 1UPIA 1XPWA 2IWGB 4Y20B 3SCGA 3DGTA 1UNBA 3I2KA 1IS3A 1F2NA 4M3CE 2VMFA 2VXRA 3IIIA 2XWJB 4I0AA 2DVDA 4Q4Y2 3DECA 2AYHA 1XSQA 2ZGOA 1TVGA 2BOIA 2XJUA 3R0RA 5FLIA 3VBSA 5IVVA 3DYOA 1DLCA 4FAGA 4MGYE 5FXXA 5FCCA 5C3RA 2SBAA 2XQXA 1EP0A 1S2EA 5LA9A 1UZWA 4CP9A 1DZQA 1CGPA 5CKMA 4WZFA 4ZU5A 3J9SA 1MZ5A 4META 5EYXA 4MG2A 4EROA 5DZGA 1YQ6A 4PIYA 4Q4Y1 1GQPA 3OBTA 4IEXA 4O7XA 2WN2A 3I3BA 3GF6A 3MBWA 3ACIA 3WX5A 1OA4A 2RDQA 4AW7A 1F15A 2VW1A 3KF5A 1J83A 1UZYA 2A70A 4PF1A 2ADDA 3NO8A 4HLTA 1E5SA 2ZOEB 3VDCA 4MHUA 2E26A 2D6MA 3PHMA 5FMDA 1WA6X 1F5FA 3NSTA 3NVCA 4IEWA 3WP5A 4HN0A 1O4ZA 4NIGA 1J84A 1WCDJ 4C90A 1US3A 3BKZA 1KITA 3TNPB 4XZPA 3FBYA 3URFA 3FC0A 2D6NA 2J1UA 2P3JA 1YJKA 1VR3A 2CAVA 3L2HA 3AC0A 4P9LA 1YI7A 5C71A 2RHPA 1SACA 1UYPA 3MO4A 3OTFA 5FWJA 2Y26A 5IWFA 3OUIA 3O1PA 1Z0HA 4Y20A 5T5PA 3AL6A 2VM9A 4YSFA 1AR63 2Y60A 2I74A 2YUEA 4YG6A 4E2SA 2BDRA 2XBO2 4WVZA 1POQA 2XL9A 3FHQA 2RDRA 3J7LA 5J7MA 3TEZA 1AJOA 2G19A 4LA2A 2YG0A 3HN3A 2RS52 4BQXA 4P5YA 2XKOA 1NYWA 3T0BA 4YARA 1UY3A 3LEGA 4LBQA 1X9TA 1KS4A 1FOD1 3N7LA 2EXKA 4Q4V2 3DUIA 3H7JA 1S0GA 1UL9A 2XOMA 4J1XA 3N7MA 3I7DA 3QOPA 5IK7A 1WLDA 3KS7A 3KV4A 2QKDA 2XBO1 3DV8A 4UXAA 3LPFA 2OXBA 1NCRC 1UOBA 4FPYA 3WD5A 3PVBB 3AYAA 2RS51 5FYIA 5KR7A 2B9VA 4JAAA 4YW5A 1S0BA 5CFDA 1VBA3 4HVQA 2OVUA 3NQHA 4L9BA 3G6JB 4N7UA 1QDOA 2PN5A 2LM3A 2XMLA 2D3PA 4L11A 1ENRA 2WZR3 2MEV2 4Q4V1 5ACA3 3O1RA 3KWVA 2CSGA 3OBRA 4E8CA 3VZOA 3JD73 4YZ5A 4FAHA 1OHFA 1WMEA 3TEWA 2R0HA 1XU2A 2VPVA 3MPPG 4K7JA 2E7AA 3ILRA 1NA1B 4NROA 3WZ1A 1VMJA 3E6BA 2UU8A 2YGLA 4YVWB 2VBBA 5K0UB 2EAKA 1SZBA 1RYYA 2GN3A 2MEV1 4HT1T 4IE4A 1HB3A 2YBPA 1ONAA 5KHKA 4LR4A 1Q43A 1SLLA 3LB9A 4Q26A 4CEYB 3VL8A 4EWAA 4Z92B 3JQXA 1O5UA 3N9QA 2Q4SA 3HN1A 1MZFA 2BEOA 2VECA 4OQ9A 5AC92 5BV6A 3VHOA 4BK5A 2OPKA 3OGSA 1RUE2 3OSDA 4DUWA 4UBGA 3H8OA 5FY7A 3MDPA 2WR9A 5IVYA 2D3RA 1LAJA 4XACA 1W8TA 1PIV2 2WSUA 2VZVA 2YZ4A 3DYMA 4R4ZA 4CUBA 4LIVA 4XHBA 4EN9B 1UU4A 3HWJA 3AP4A 1NXMA 1ULOA 2AREA 2BTVC 2E31A 4LULA 1O91A 1AYN1 2TUNA 4NRQA 3VBSC 4C1XA 3WEZA 3HNBM 5AC91 4HANA 4B8EA 1AL22 1RUE1 3K46A 4WM7C 5AFEA 1NLQA 3ZXFA 4G4FA 1G86A 4JQTA 2VBPA 1VJ2A 2D44A 5GLVA 1TME3 1C4RA 1E5HA 3E5UA 4LNVA 2HEYF 1AR73 5FPLA 5T52A 4CCCA 3PVNA 4J6GA 4K20A 1O6UA 3ZN5A 1FMD3 3PL0A 3I54A 4ASKA 5DUWA 2BGCA 5A3NA 2Y6GA 3RFRA 4ATFA 4Y1VA 5LA1A 1LJ7A 1GLHA 2A6XA 4L99A 3UV9A 4LLOA 1OT5A 2B5HA 3IDEA 4DMIA 5C8CA 3D0SA 4OCTA 5H9PA 1AL21 4XUPA 3MIHA 4OI2A 4QX5A 5D1IA 3HAGA 2LS6A 1RHI3 4AR2A 4AK3A 2VCBA 4JDNA 1NA1A 3QH6A 4SLIA 5J98B 1WBLA 5A3UA 2YDEA 1HW5A 4FPCA 4YVWA 3H42B 3ZXDA 4CRQA 1YQ5A 3ACGA 1T6BX 4A7YA 1ND2B 4B4RA 1BBT2 1HXS2 4ARYA 3ZO0B 4B1MA 3VDBA 3KSCA 4GKYA 4ONUA 1OFSA 2RR12 4Q0VA 4CEYA 2NYYA 5JSRA 4K1YA 3ETQA 4FPLA 5LY2A 3UK9A 1ACCA 4UAPA 3C3VA 4BWOA 4AOCA 1QJU3 1W6PB 3PJYA 1VRH2 3BUCA 1XNCA 1BBT1 1HXS1 4JZRA 3AMQA 4Y1UA 2DCZA 1H2KA 5FPAA 2ORXA 4LO4B 4OUEA 5IT6A 1DZRA 2RR11 2JD4A 1Y3TA 3V56A 1PNGA 4GH4B 2WT1A 3ACHA 3IB3A 1A8MA 3ZSMA 4AVCA 2LTNA 3I2HA 4DIQA 1WMFA 3VHRA 1JZ8A 1Z78A 1N3PA 4GB32 2A5ZA 2JE8A 4O61A 5CKNA 3FLRA 5FY8A 1RMU2 1VRH1 2JDKA 1WW6A 3AB0A 3TEXA 1EUUA 3ZXAC 2A7AA 1GU3A 2XONA 5KWRA 2XUEA 4EN6B 4XCBA 2ZX3A 5FYZA 4YGCA 2CDPA 4D94A 1W2AX 5LBFA 4I3PA 4OMDA 4MGZE 1RJ8A 1N3OA 3SCFA 1MACA 1QNYA 1ALYA 4GB31 3WF4A 5FK7A 1RMU1 4NO4A 4Y5Z0 4IV3B 3D6EA 5A7SA 2VOTA 1CAXB 2GNMA 1ND2A 2Q5TA 5FKBA 4B4PA 2WQ8A 3C7GA 4QM9A 4FPGA 4RN5A 2AACA 5FZEA 5HI0A 4AEDA 2Z4FA 5FPZA 1F9KA 4BU2A 4F3JA 3POIA 1XE8A 4XF3A 1JW6A 4HOOA 4AI8A 2JG8B 4MH0E 3FHIB 1CAVB 2VJXA 2C9AA 3WUDA 3FX3A 1W6PA 4QPYA 4OLLA 2UY9A 2DFCA 2XR4A 1HRI3 2ORZA 4NIDA 2C9KA 3WP6A 1VBC3 3W59A 1PZ9A 3J8F2 3ZN6A 3S6PA 2ET1A 1WA4A 3LCPA 1MS0A 2OKXA 4ATEA 4GH4A 1OVSA 5T5JA 1MZ6A 2K0GA 4MUVA 5JAXA 3KF3A 1HRV3 1GANA 4JRLA 1CJPA 4NMIA 3CBNA 3KVBA 5KHGA 2ZEYA 3QLQA 1QXRA 4K8RB 4BZ4A 1MZEA 1OXCA 3RYKA 2KXLA 2VZ3A 2E33A 2PHFA 4MSVA 4TTGA 5L73A 4OZXA 3JB8A 4DUVA 5LW9A 4LKSA 1YLLA 5CIRA 4BDVB 2D6KA 4R9DA 3SNMA 3VL9A 1FV2A 3J8F1 1R1A1 1H30A 4RA0A 2QFEA 1VP6A 2W2IA 1RUJ2 3GJBA 4RGGA 2Q8OA 1GOGA 3OPZA 1LCLA 4DINB 1F4HA 1OMIA 3OGVA 3ZMNA 2EAAA 5LBCA 2JE7A 1FNYA 4DZGA 1ZM1A 2W94A 2WNEA 1QXPA 1RUF3 3WXPA 1VPHA 2Q1FA 5EFUA 4AFAA 4DRVA 5FZGA 4IV3A 3BTZA 1N1YA 4MVTA 1Y7BA 3WNXA 4UFMA 1W05A 4PIXA 4UF0B 1NA1C 1CAXA 2Q1MA 2X29A 1YIPA 2B45X 1RTVA 1RUJ1 1LHNA 3AZZA 3BPSA 3POFA 4IUGA 4YVWC 3VBUB 1CIWA 5K0UC 1LNSA 2E51A 1JOJA 2J1VA 4CDQB 5JWPA 1R64A 5IVBA 1PMJX 1WMDA 2BP6A 3DYPA 2WO1A 4JGYA 3JBG2 3PURA 4CEYC 1QOTA 2GC0A 2J1SA 2WA3A 4Y22B 3BN6A 1CAVA 4AVTA 2FD8A 1W8NA 1GUIA 3PVEA 4I0WB 2VNOA 1WW4A 4Y3OA 5J1XA 2N7GA 4RHV3 1GQHA 1IOAA 2VVEA 4NWVA 1QOOA 3TN92 1EY2A 2RMU3 3H8RA 4FO9A 4AVSA 3FE5A 5I93A 2GP3A 3JBG1 2HWF2 3T30A 4HMZA 4FTEA 3B01A 1JZ6A 4J25A 3OBAA 2RG4A 4NPRA 4B3NA 1NZCA 4AE2A 2IZWA 4YM0A 3O7OA 4QX3A 4IE5A 3EBRA 5GLZA 3WNKA 1W8ZA 3POSA 3EO6A 3WCSA 2OPWA 1W9SA 5FZ8A 2H0BA 3TN91 4JTNA 1DYPA 1R082 1QJY1 2EIGA 2XUMA 2XVKA 3R4SA 3AKPA 2P3YA 2HWF1 5FUIA 1QWRA 1X9PA 4A6OA 2VTXJ 2C0ZA 1J1TA 4QHOA 4XJZA 4CTEA 2B46X 3SKJE 1LGCA 2VQ0A 5A7OA 5FQ0B 4TN7A 1HN1A 5LBEA 3O0VA 1QHDA 3T1LA 4CCDA 1RUG3 4Q0SA 1ASJ2 2PHRA 4UF0A 3ZIXA 4GWMA 5EV7A 1JYXA 3VZMA 5FO7B 2GC2A 4UWDA 1OOPB 3OGJA 3VBUA 2O14A 1QU0A 3KHCA 3WG2A 4CDQA 1ND2C 3P3NA 1X7NA 1GBGA 3SQOA 1JN2P 1DHKB 4GALA 5FP9A 3W9AA 4NOTA 2B39A 2B7YA 3C2UA 4F83A 1ULGA 4CVUA 1YEWA 4P9XA 4KWUA 1RUI2 3Q8CA 1I1EA 1DDLA 4Y22A 2Y0OA 1ASJ1 2JDZA 3SH5A 1XRUA 2OZJA 2UURA 3T2TA 4NPLA 2YROA 2P2KA 5JXJA 3CJIA 3C8XA 4RYDA 1OKOA 3J7MA 1W2OA 1AVBA 4GD4A 4MLOA 2FDFA 1RUH3 4YZ4A 4R9BA 2FDKA 2WO3A 1SBDA 4O65A 4LO6B 5F6LB 1QQP3 2P4EA 3BYWA 1RUI1 3CDZB 4DB5A 2BOJA 2VOWA 4GH4C 2EALA 3BIWE 2XH6A 2VAUA 3D82A 1KQRA 5A33A 4K1ZA 5JR2A 1RITA 2VQUA 1F4AA 1QJEA 4HG6B 2ENRA 4IQPA 5CG8A 1F5JA 5M0TA 1GQGA 4QKNA 4LE4A 4ZXKA 4AYUA 1AR92 1PO22 1BYHA 2BW8A 3ZYFA 3A0KA 1MEC3 4HKWA 2RS32 2PHDA 5EIYB 1UW8A 3O1VA 3DXUA 1VAMA 3WF0A 4IETA 5AVPA 5FQ0A 5T54A 1JXNA 2FMYA 2OT7A 2WFF2 3PJQA 5JOXA 1QKQA 1YO8A 5A6XA 4LT5A 2CNAA 1TE1B 4P14A 5E16A 3I97A 2R073 4IV3C 1AR91 1AYM3 1APNA 1PO21 1DQ0A 1HN0A 1R092 2JDHA 4Y5TA 4KWKA 3WG1A 2W95A 4WVMB 2LROA 4TLGA 3WY6A 5APAA 5DAVA 3BGAA 1KJLA 1M06G 3D0JA 2CGOA 2KR2A 1GR3A 1KJRA 4LO5B 4Q1PA 2AC1A 5DPNA 2PHTA 2YBSA 4P5HA 4JHZA 1M4WA 1H8VA 4G3YC 2A71A 1U5YA 3E1F1 3VUOA 3D4KA 4ITCA 2P3KA 3APBA 2BJSA 1UF2C 3POYA 2JG8C 1R091 2RM22 1RVF2 4BQYA 2VVDA 3B9IA 2VULA 4FPEA 2ZGMA 4AGVA 2RS13 1PVC3 1QF3A 4AQSA 4EV0A 3ES4A 5CISA 3BI3A 5C9AB 2BGOA 1G9DA 1DP0A 3CU7A 5D2AA 5FZAA 3PU8A 2B4KA 2X05A 2E6VA 2J1AA 4TXWA 4BK4A 2XJRA 2RM21 3P1IA 4K21A 2ZHLA 5FZFA 3VHNA 1RVF1 3CJXA 1ZZ6A 5GZGA 2FZ2A 1HB2A 4LOTA 1IKPA 2VQAA 2QQJA 5IFTA 1RUOA 1HIXA 3P6BA 3UYJA 1G8WA 4COUA 3PUHA 4W50A 4XXAA 5FR3A 2ATFA 2PLV2 5LZ6A 3ZFFB 5FY5A 2QZ3A 3VHPA 4W65A 4JCKA 3Q8BA 1UYXA 1LGNA 3TOJA 1HJGA 1VIWB 2IXCA 1IQAA 1QJX2 3NV4A 2QJVA 3NV2A 1BKZA 3IMNA 5FYCA 3WVJA 3V0AB 5BNNB 2DVAA 3VD9A 1HKDA 2JDUA 3RYRA 2ZCWA 4CDQC 1BCXA 1JH5A 1ST8A 4G9SB 5FZ4A 2W92A 4OYUA 3I3MA 3PUIA 1NT0A 4L97A 3LZZA 2GH2A 3ELNA 1S0IA 5FZ0A 1QJFA 1QJX1 5A80A 5JSOA 5A70A 5CA6A 4EN8B 2R042 3QBQA 2BYVE 3LE0A 4GMP0 4YGEA 4L92A 3BCWA 4FFHA 1ULDA 1W0PA 1YUDA 1EV12 3ORJA 2HJIA 2HWE2 5C9AA 4LHSA 3W5MA 1O3QA 3R6SA 4ES8A 3AZYA 1ZZ8A 5CB7A 3WNMA 3M4FA 5EJZB 3HBZA 4PJYA 4XQDA 1NXD1 2ZXQA 1JYVA 2R041 3LA3A 4R52A 1VBB3 5JI9A 3LFMA 5EPAA 4D7TA 2JDPA 4GMP1 4RSUA 4DFSA 4A4AA 1EV11 1CIYA 5A3PA 1WCQA 1J3QA 1L3JA 2HWE1 3KVAA 1LHVA 5K8SA 1JZ3A 2HYKA 4QXBA 1NQDA 3U10A 2VG9A 1SHWB 3AJZA 1HB4A 3FUOA 2W46A 4FOQA 3VDAA 4CXYA 4BYYA 4YW4A 2ZGPA 5FZIA 3NWKA 1LOBA 4KBZA 2PELA 4Q4W3 4D7SA 4KBBA 4AWDA 5FOJB 5IK5A 4HN1A 3ITQA 2J1RA 3KCXA 3WP4A 4I3GA 3USUB 3ZSJA 1G6NA 2CTVA 3B94A 5BNNA 3V0AA 2E53A 2PMWB 3RDIA 4JX0A 4BQ4A 4DXSA 4E27A 1OOPC 1COV2 4I09A 4ZPIA 2WDBA 3AX4A 3NNFA 2XWBB 3I2JA 2JIGA 5LK5A 3ZDSA 2R061 3B02A 4B1LA 4UYBA 2ZBJA 1V9U3 1OA2A 1GWKA 5C3SA 4NHXA 2QCSB 3PMSA 3CLPA 4Q2FA 2Y0IA 4DUXA 2ZGTA 5JVVA 3KZ4C 4XC9A 4KU8A 5KC5A 4TZDA 1FOD3 2R1BA 1ND3B 2RV9A 2VNGA 3HPNA 4ASMB 2ILMA 5DMYA 3NRUA 4CDUB 2NLRA 1HQWA 1COV1 4XTMA 3AP9A 5FYVA 1ZA4A 4JTOA 3ZM8A 2D5HA 1YCIA 5GZEA 2CYFA 3ME2A 2XBO3 1KDMA 3M3CA 3VGIA 5CFCB 1PHMA 3NAPB 2YC4A 5GLTA 4AQ2A 2RS53 3T08A 3WDUA 4NAOA 5JUVA 4A45A 5BNPB 1RUC2 4IGQA 1Z7S3 4IXLA 5ISLA 1SLBA 1IG0A 1OD3A 4CU7A 2WS93 5LWBA 2YU1A 1PGL2 4S2GA 5FBJA 3THDA 2QQUA 5FP3A 1U5IA 3K48A 2YFZA 4XIKA 4YW6A 3LKJA 2LALA 3BTYA 4K9SA 2CL2A 4M3CA 3UGFA 1IZ3A 4DNYA 4HSJA 5JIAA 3FLTA 4FPKA 4H14A 3HNMA 2JKBA 3PVOA 3N7KA 5F3EA 1RUC1 2Y6LA 4LLFA 4OUMA 4D3WA 3RJRA 1NLSA 3OB8A 4IDZA 1D4M3 2EIDA 1TG7A 4XFFA 1ULCA 1FPN2 5HCFA 4NR1A 2RE9A 2ZPXA 1D0GA 2A75A 2MEV3 4CU9A 3H3ZA 1W99A 3K3OA 1XNAA 4WM7A 4COYA 4A41A 1A78A 1UOJA 3O0WA 3HD8B 4W4ZA 4Y1ZA 3W58A 2K2SA 1QH7A 1AXKA 1UWWA 1AZDA 3T2OA 5FO8B 2PHXA 1PX3A 1V6JA 4QKFA 3VKNA 4BQ5A 2V4AA 4XILA 1ZVFA 3IBMA 1FPN1 3JXSA 2BNOA 2YFUA 1O59A 1N1VA 2ZGQA 1Q56A 4DPNA 1VE0A 1ND3A 1EPZA 4D0QA 2J42A 3IPVB 4OHZA 4CDUA 1CJDA 2WWJA 4LKDA 3B9CA 1AYN3 2ZX0A 1LOGA 3IDCB 3V0BB 4A42A 2R6QA 3RNSA 1BK1A 1RUE3 4DY3A 1DIWA 5CFCA 4LBNA 4ZY9A 1G9AA 2DU0A 3B69A 1RUNA 1CD3G 3AKRA 1ZRFA 1CAUB 5BNPA 5C9AC 1FXZA 2Z2SB 1J58A 3EMRA 3MIGA 4QGMA 4YVSB 3MFCA 5FZDA 1KRIA 3KMHA 3M3QA 4CUCA 3AP6A 2B8MA 2DCKA 2DFBA 5LK7B 2C4XA 2HWD2 4LKFA 3W21A 1LESA 4NHYA 2VZPA 5I0UA 2OS2A 2VTFA 2YC2A 1AL23 3VZLA 4OQ8A 1AUYA 1SPPB 1F8VA 3VZJA 3AVSA 4OHYA 5CNAA 4JVAA 4S2FA 1X8EA 4UW3A 4P00B 1ZNPA 5F7UA 5LA0A 3UESA 5E89A 4QQLA 5F8PA 5A3LA 3EYPA 4LBKA 1KXGA 3ZFFC 4XJ8A 1PX4A 3ECQA 2HWD1 3MIBA 1NUKA 3VN4A 1XQNA 4OULA 1XYOA 3H9AA 5IK8A 4CCJA 4WV8A 2Q8EA 5JXHA 3BPZA 3L9JT 3NJZA 3OY8B 1G7YA 3MUY1 5BNNC 2WNVB 3BALA 1JMUB 1HX6A 4DY5A 2EVXA 3M1HA 3G7DA 4XJ9A 5C5UA 2Y64A 3BU7A 1OFNA 2ZGLA 1JYTA 1PO12 1RINA 2HWB2 3QCWA 3RPQA 2XDVA 1DF0A 2BUKA 4LQRA 4E2GA 4E8DA 2RR13 5CADA 1AHSA 1JU3A 3N9PA 2ES3A 3POWA 5JMCA 5F5IA 3I2IA 4L0PA 1WD3A 2VZ1A 5DDJ3 2AENA 3P5BA 3POEA 3V0BA 1HV1A 2DBIA 4QDQA 2R1DA 5CKQA 1LTEA 4XFGA 4LBMA 1REEA 1CAUA 1YYNA 1PO11 2HWB1 4IE0A 3ENRA 1YQ2A 2AGSA 4YVSA 3CO2A 3H1MA 1W8UA 4HSLA 4JQRA 1LOFA 3UKVA 3E6DA 1AJKA 4NE9A 2KA3A 2A6WA 1JZ7A 3LSEA 4UFJA 4BH9A 3WDYA 3HR9A 1W6OB 3AM2A 3E5QA 5FLJA 2NPIA 4GQ7A 5HBAA 1GZWB 1SFYA 2GSYA 2VUJA 1MQTB 2CY6A 1MR5A 4EZ4A 4XJWA 3SITA 4R4XA 4CPBA 4LKEA 1OF3A 4Z82A 1LECA 3HEIA 2XKPA 4AFCA 5JMOA 1C1LA 2VOXA 4COZA 4YM1A 1AX2A 4I01A 4M00A 4DS0A 2V72A 1DFQA 2A6YA 2P37A 1VBD3 1QIQA 3H8UA 1NLRA 2P5BA 4IL7A 1ZBE3 3OY8A 1QJZA 5EHDA 5FK8A 2WNVA 3WHUA 5I0RA 2WLPA 5EZWA 3GZEA 1NX9A 1PIV1 1XBFA 3RS6A 3U78A 3VBFB 2FDHA 2VU9A 1QGLA 2D6LX 2WJSA 5FZMA 1CPNA 4COVA 2NZ9A 1BVP1 2QQNA 4XQWA 5I8SA 4LK7A 1VAVA 3MICA 2ZHKA 1ZZ9A 1AXZA 2WSVA 2CV6A 5AVAA 4NHMA 1ND3C 1GMMA 1YWKA 4IGOA 4J1WA 4CU8A 5C4WB 3N9MA 5JIUA 3LGRA 1BHGA 4CDUC 1AR62 3RJ2X 1UYZA 5ANQA 1UMHA 5E8AA 3WDTA 1WLCA 5K0UA 5KHHA 1V6OA 2WQZC 4R9CA 3NAPC 1ENSA 4CYDA 2JDMA 5CFCC 1UY2A 2HKXA 2W3JA 2CAUA 2WA4A 4KL1A 1R1A3 5BNPC 1XU1A 1VAKA 2W08A 2AEZA 5LEKA 5JR7B 1UQXA 2ZZQA 1JODA 4IEQA 5KHJA 4W8JA 5D21A 3NKTA 3UJQA 2HWC2 2WINB 1V6NA 1BLZA 3M70A 4LBLA 3UGGA 1FATA 4GWIA 2BERA 5KXEA 4K8FA 1GZWA 3VKMA 5IUQA 3MLKA 4Q4X3 3WQBA 3H8XA 1W3VA 4NIHA 1C57A 1S2KA 3AKSA 5FWEA 2WZR2 2NN8A 5ACA2 5KXDA 3LAGA 1RGSA 1JZ5A 3N4MA 2HWC1 3LIHA 3JD72 1C5HA 1UU5A 4XJUA 1GOHA 4XFHA 1GYKA 2WUHA 3N9LA 2ETEA 5CU1A 3ZYJB 1C1FA 3ZIWA 5A3TA 4Z1VA 1DU3D 3HOBA 3RMXA 4AI2A 4KG0A 3VBFA 5FP8A 2W87A 4XURA 1EAH3 2R0FA 3FMGA 4K6BA 2DUPA 1JUHA 2WZR1 4XBNA 3WQ1A 5ACA1 5JDBA 2WT2A 4XMAA 3DEMA 3LEMA 4Q0UA 4BLIA 3ROUA 4P9IA 3JD71 5A7NA 3NNMA 3J7NA 1TMF2 4MOAA 4A3ZA 4E4DX 1N1TA 2BPA2 3MF9A 5FTTC 1NY72 2YPDA 4MX3A 3WP3A 5FDBA 3K4ZA 1X50A 2YGMA 3POBA 3Q8FA 4HK8A 2VUCA 1XNKA 3MV11 2WFPA 2W0XA 2AR6A 5EJ1B 3MGUA 2C6SA 3TN93 4LXLA 2Y6KA 2ARCA 1QJY3 3H3UA 3ZN4A 3GDBA 4XF1A 2CWSA 3UKNA 4CDXB 1O7FA 2BNNA 2QQWA 2WZEA 2YU2A 1TMF1 4OVEA 5I91A 1OLRA 3NJVA 4YVSC 5F2SA 1OQDA 4ZHNA 4YGBA 3O1UA 3A21A 2W1SA 1NY71 2ZX2A 1LOFC 1O4YA 4KGQA 4P08A 4V1PA 5ANNA 1I5ZA 2GN7A 3BOPA 2D6OX 2WO7A 1Q8OA 3OG2A 2G9GA 3CNAA 1P8JA 3AK0A 1TME2 2KM2A 1AX0A 1AR72 1OC1A 2W5FA 1KFUL 3A23A 3H1YA 1YC61 2GZWA 1VMFA 3AZXA 3OPWA 4CP1A 4LHNA 1E5IA 4BMBA 3WF3A 2JEMA 1YI9A 3ABZA 5FPBA 1DGWX 2WIIB 4XJAA 4BM8A 2DDUA 1W6MB 1FI2A 4UOJA 2W91A 1PK6B 1MPXA 1NE6A 5LEJA 1L7RA 5BUVA 2VVFA 5FJHA 3AMPA 1JS9A 3MHZA 5I0SA 1HB1A 1V6LA 4NVPA 1S2BA 1RHI2 5T5OA 5JOYA 4XCAA 4CCNA 1AR71 2Y38A 2QVSB 3FHAA 4Y1XA 3O1MA 2YPJA 3AZWA 2PHUA 1SMVA 3WDWA 1I5PA 2WNVC 1EPWA 2AUYA 3SCHA 3DCQA 4F7ZA 1QNWA 5FXVA 4CXXA 4WVWA 1LHOA 2YXSA 3RZMA 4NHKA 3PUQA 1LODA 2ZZJA 2IXJA 3CIHA 3SEEA 4AQTA 1UO9A 2FDIA 4FCAA 4FFIA 2UWAA 4TSVA 1RHI1 1TZOA 4XETA 2VNRA 2OA2A 5IK4A 2BBAA 3H3LA 1QJU2 4P9YA 4UW4A 3M3IA 4QWNA 5HCHA 4JV4A 1V70A 2XGXA 2EICA 5FXWA 2WABA 3EB7A 3KQ4B 1GNYA 2DBNA 5B2GB 1BMV2 1F31A 4PT6A 5IVJA 4QM8A 2Z42A 5T3NA 2W68A 5J36A 3O5SA 1BEV2 4BCUA 2JG8A 1UAIA 2ZEXA 1QJU1 3NNGA 3WINE 1REDA 2WRAA 3C7EA 4EQVA 1XSRA 2PAEA 5KC6A 5JZGB 1MQTC 5F5QA 4P9WA 1VBE3 5K9YA 3THTA 5J96B 1W6MA 2DUQA 2VMCA 1YNAA 4W6XA 5FJKA 5LRSA 1U5XA 2F4LA 1PK6A 1X82A 2VXJA 4COWA 1MS5A 3VBOB 2ZGSA 1BEV1 3S7IA 3KCYA 2XJTA 4GAZA 3GGLA 3U07A 5CYYA 3DXTA 1O3SA 4H3WA 3AJYA 1OH4A 2JIJA 4YZ2A 2BRTA 3UT0A 5GZCA 3I2FA 3MUZ1 5GLUA 2DCTA 1R093 3VBFC 3I59B 1RXFA 4MGQA 3LOBA 3DL3A 2P6CA 5A3OA 2D3SA 4BPZA 5CBLA 3HQXA 3BIEA 1Q8QA 3T3YA 4XDPA 5EP9A 1W8WA 3B7MA 5C70A 2ZKLA 5L9BA 1PMHX 3VD3A 2IXLA 1O3TA 2QBXA 3VLBB 1K42A 2WYSA 1B09A 2H6CA 4XUQA 4RFRB 4M0NA 4QX7A 2R30A 4RR3B 5C4WC 2R32A 1UYYA 4PLMA 1R081 4CCLA 1CX1A 3GBWA 1ZBA3 2VCMA 5C3OA 2D98A 2EXJA 3OBZA 4XUTA 1GWMA 3HIFA 4XF9A 5FUNA 3RI8A 3VZKA 1TNRA 5FXZA 5FUPA 2CHHA 2Q0AA 2G9FA 4WVVA 2V5YA 2DTYA 3B3QE 4IEZA 1CZSA 1Q3EA 2IVIB 3V65A 3RRDA 1C8M3 1OH3A 1HRV2 3RVHA 3RZJA 4LHKA 1POV3 4Q0PA 4UBHA 4DEVA 1OKQA 5FV3A 3SXWA 2XG3A 1B35B 1K5MB 1JYCA 3C7FA 4C0BA 4RFT0 1UOFA 2YV8A 4EE2A 1DZTA 2G9ZA 1N47A 3WR0A 1AX1A 3U4SA 4FPJA 4HZFA 1D7PM 4MGIE 4N53B 3ZVXA 5JZGA 4M0HA 4KNCA 4ZU7A 3POJA 4AGRA 4PLOA 1KDKA
chains in the Genus database with same CATH topology
2PXJA 4IGOA 3KV4A 5FZDA 5FPAA 3LDBA 3KVAA 4E4HA 3N9MA 3PURA 4LIUA 5FXVA 4QXBA 5FZ7A 5ANQA 3N9NA 5F2WA 5FZ9A 4C8DA 3PUQA 5FYIA 5KR7A 4Y3OA 4DIQA 2OS2A 5FZIA 3KV6A 4GJZA 2XMLA 5F3CA 4AI9A 3AVSA 2YBSA 3PUAA 5FY8A 5FZOA 3K2OA 5FYTA 5IVCA 2GP3A 5FZ1A 4QWNA 4CCOA 3PU3A 4D6SA 5FP4A 5A7WB 5FZ6A 2XUEA 5FPUA 5FXWA 5FYYA 5F39A 4URAA 5FYZA 3ZPOA 4DO0A 4V2VA 5IVJA 5FZBA 5A7PA 4BXFA 5CEHA 4CCJA 5FY9A 5FZ8A 2Q8EA 4NUBA 4AAPA 2YBPA 2OX0A 5FWEA 4QX8A 4EZHA 4LITA 4BISA 5FYUA 5FZAA 4D6QA 5A7SA 3PU8A 3N9QA 4GJYA 5FYVA 4QXHA 5IVVA 5FZFA 2YBKA 5FP7A 3N9LA 5F3IA 2XDVA 4Y33A 5A7OA 4CCMA 4QXCA 4TN7A 5A3TA 1VRBA 4V2WA 5FY7A 5FZEA 3N9PA 5FJKA 4Y4RA 5FXXA 5FP8A 5IVYA 5F5IA 5A1FA 3K3NA 4IGQA 5FYHA 5FYSA 5FY4A 4UF0A 5ISLA 4BU2A 5LWBA 4GAZA 4LIVA 3UYJA 2YU1A 5F5AA 3DXTA 5FBJA 4HOOA 5FP3A 4HONA 3N9OA 5FZHA 5A7NA 5FY5A 5IVFA 5FP9A 5A7QA 2YPDA 5FPLA 5FZOB 5F3EA 5FYCA 3PTRB 3AVRA 4XDPA 5A3WA 5A1LA 4QU1A 4ASKA 5FZLA 4CSWA 4LXLA 5F5CA 5A3NA 5F32A 3KVBA 3K3OA 4GD4A 5FZ4A 4QX7A 2YU2A 5FZ3A 2GP5A 4IGPA 5F2SA 5FYMA 4CCLA 5FZCA 5FPVA 5E6HA 4EYUA 4EZ4A 5LW9A 5FYBA 5A7WA 5FZ0A 3OPTA 5F37A 3LD8A 5A80A 5FUNA 5FXZA 2Q8CA 3PUSA 2W2IA 5F3GA 5FUPA 5FWJA 3AL5A 4CUGA 5IWFA 4D6RA 2OQ7A 3OPWA 3PDQA 3AL6A 3KV5A 5IW0A 2VD7A 3ZLIA 2P5BA 3KV9A 2OQ6A 3RVHA 3NJYA 5FPBA 5LY1A 5K4LA 5FV3A 5FZGA 5FY1A 3U78A 2WWJA 5FZKA 2WWUA 4CCKA 4UF0B 5FJHA 5FY0A 5FZMA 5LY2A 3U4SA 4XDOA 3DXUA 4CCNA 2Q8DA 5IVEA 2OT7A 5IVBA 5A3PA 2XXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXJ A;  4IGO A;  3KV4 A;  5FZD A;  5FPA A;  3LDB A;  3KVA A;  4E4H A;  3N9M A;  3PUR A;  4LIU A;  5FXV A;  4QXB A;  5FZ7 A;  5ANQ A;  3N9N A;  5F2W A;  5FZ9 A;  4C8D A;  3PUQ A;  5FYI A;  5KR7 A;  4Y3O A;  4DIQ A;  2OS2 A;  5FZI A;  3KV6 A;  4GJZ A;  2XML A;  5F3C A;  4AI9 A;  3AVS A;  2YBS A;  3PUA A;  5FY8 A;  5FZO A;  3K2O A;  5FYT A;  5IVC A;  2GP3 A;  5FZ1 A;  4QWN A;  4CCO A;  3PU3 A;  4D6S A;  5FP4 A;  5A7W B;  5FZ6 A;  2XUE A;  5FPU A;  5FXW A;  5FYY A;  5F39 A;  4URA A;  5FYZ A;  3ZPO A;  4DO0 A;  4V2V A;  5IVJ A;  5FZB A;  5A7P A;  4BXF A;  5CEH A;  4CCJ A;  5FY9 A;  5FZ8 A;  2Q8E A;  4NUB A;  4AAP A;  2YBP A;  2OX0 A;  5FWE A;  4QX8 A;  4EZH A;  4LIT A;  4BIS A;  5FYU A;  5FZA A;  4D6Q A;  5A7S A;  3PU8 A;  3N9Q A;  4GJY A;  5FYV A;  4QXH A;  5IVV A;  5FZF A;  2YBK A;  5FP7 A;  3N9L A;  5F3I A;  2XDV A;  4Y33 A;  5A7O A;  4CCM A;  4QXC A;  4TN7 A;  5A3T A;  1VRB A;  4V2W A;  5FY7 A;  5FZE A;  3N9P A;  5FJK A;  4Y4R A;  5FXX A;  5FP8 A;  5IVY A;  5F5I A;  5A1F A;  3K3N A;  4IGQ A;  5FYH A;  5FYS A;  5FY4 A;  4UF0 A;  5ISL A;  4BU2 A;  5LWB A;  4GAZ A;  4LIV A;  3UYJ A;  2YU1 A;  5F5A A;  3DXT A;  5FBJ A;  4HOO A;  5FP3 A;  4HON A;  3N9O A;  5FZH A;  5A7N A;  5FY5 A;  5IVF A;  5FP9 A;  5A7Q A;  2YPD A;  5FPL A;  5FZO B;  5F3E A;  5FYC A;  3PTR B;  3AVR A;  4XDP A;  5A3W A;  5A1L A;  4QU1 A;  4ASK A;  5FZL A;  4CSW A;  4LXL A;  5F5C A;  5A3N A;  5F32 A;  3KVB A;  3K3O A;  4GD4 A;  5FZ4 A;  4QX7 A;  2YU2 A;  5FZ3 A;  2GP5 A;  4IGP A;  5F2S A;  5FYM A;  4CCL A;  5FZC A;  5FPV A;  5E6H A;  4EYU A;  4EZ4 A;  5LW9 A;  5FYB A;  5A7W A;  5FZ0 A;  3OPT A;  5F37 A;  3LD8 A;  5A80 A;  5FUN A;  5FXZ A;  2Q8C A;  3PUS A;  2W2I A;  5F3G A;  5FUP A;  5FWJ A;  3AL5 A;  4CUG A;  5IWF A;  4D6R A;  2OQ7 A;  3OPW A;  3PDQ A;  3AL6 A;  3KV5 A;  5IW0 A;  2VD7 A;  3ZLI A;  2P5B A;  3KV9 A;  2OQ6 A;  3RVH A;  3NJY A;  5FPB A;  5LY1 A;  5K4L A;  5FV3 A;  5FZG A;  5FY1 A;  3U78 A;  2WWJ A;  5FZK A;  2WWU A;  4CCK A;  4UF0 B;  5FJH A;  5FY0 A;  5FZM A;  5LY2 A;  3U4S A;  4XDO A;  3DXU A;  4CCN A;  2Q8D A;  5IVE A;  2OT7 A;  5IVB A;  5A3P A;  2XXZ A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  4QQ2 A;  1HRV 1;  1H8T B;  3B00 A;  3VBO A;  4DEQ A;  4PBP A;  1IQD C;  4N90 A;  3ZXJ A;  1RUF 2;  2P17 A;  1IS5 A;  2GC1 A;  2BBV A;  4C8D A;  3AXE A;  4XFI A;  3IAQ A;  3BTA A;  2PHL A;  5EYY A;  2F4P A;  3KV6 A;  1JHJ A;  4LBQ D;  4XAE A;  4F8A A;  3FN9 A;  3U0Z A;  3I59 A;  4QPG B;  2V09 A;  1AR8 3;  2EXH A;  1C3H A;  2VUD A;  3VD7 A;  1W8H A;  5FZ1 A;  1YRZ A;  2VMG A;  2OII A;  2ZHN A;  2P1B A;  4CCO A;  1UY1 A;  4D6S A;  3JCI A;  3U75 A;  2XHN A;  4AXO A;  3POG A;  1RUF 1;  2W1W A;  4XFC A;  5G04 L;  3WLU A;  1CR7 A;  1KGY A;  1ULE A;  4BOW A;  3LDK A;  4RR3 A;  5C7G A;  4JKK A;  1S0J A;  3R4D B;  4Q5O A;  2QTW B;  4SBV A;  5FMO S;  5A7P A;  5CVR A;  3T0D A;  3A22 A;  2AZ5 A;  4QKB A;  2QDN A;  1MS8 A;  3MW3 A;  4RHV 2;  4UFI A;  2PAM A;  4BB3 A;  4N43 B;  1OOP A;  1WUV A;  2DCY A;  4AEJ A;  1W2U A;  2RMU 2;  2RS3 1;  2VO5 A;  2VMH A;  3DPR B;  4XZU G;  1IPS A;  3O0X A;  4AHW A;  2NP0 A;  2WZ8 A;  4GMP 3;  4LOR A;  1TQ5 A;  2ZS6 B;  1DGL A;  4CDX C;  2YY1 A;  3VDD B;  1GZ9 A;  1G9C A;  2E9Q A;  4UT5 A;  1XE7 A;  1OF4 A;  2WFF 1;  4QXC A;  4XOG A;  4GZ9 A;  1GSL A;  1B35 A;  2UYA A;  4OI1 A;  3MIE A;  5A1F A;  2JD9 A;  3K3N A;  4FVV A;  5F6K A;  4JDM A;  5FYS A;  4RHV 1;  4U36 A;  2QZ2 A;  4AG4 A;  3IT8 A;  2RMU 1;  2QNK A;  2R16 A;  4N53 A;  1GP6 A;  1H9W A;  1XND A;  2IXI A;  4TYS A;  3WSO A;  5ABJ B;  4KU7 A;  2QQP A;  4N8M A;  3ST7 A;  4BQ3 A;  3WNO A;  4UFH A;  3SKV A;  3ZSK A;  2IUW A;  3IM0 A;  5A6Z A;  1H8T A;  4QQP A;  4NII A;  1PK6 C;  1ULF A;  3RZK A;  2R06 3;  2V5D A;  3MID A;  3OGR A;  1VLN A;  1BQP A;  5DZE A;  5A1L A;  4QB2 A;  3I2O A;  2BFU L;  4RD7 A;  4BIO A;  1RUG 2;  5G05 L;  5FZL A;  4CSW A;  4NN0 A;  5DAW A;  2VH9 A;  4NAM A;  1LR5 A;  1D0H A;  2LW8 A;  1IGO A;  1IS4 A;  1XYP A;  1OLQ A;  1G9B A;  3KCC A;  2ZX1 A;  3CQO A;  4NJ4 A;  5FZ3 A;  2XHK A;  1Y4W A;  4R9A A;  3THP A;  4B4Q A;  4FI9 A;  3WW3 A;  1RUD 3;  1YQC A;  4BQ2 A;  3LD8 A;  2JDA A;  1SFN A;  1ZYB A;  1XYN A;  3M7A A;  4O9E A;  1W6N B;  2HEW F;  4CUG A;  3CEW A;  1ZRE A;  2B42 B;  1RUG 1;  4QB6 A;  4IW3 A;  1GP4 A;  4FBF A;  2QQV A;  5FO9 B;  4OHW A;  2BGP A;  3ZYB A;  3NJY A;  4N43 A;  1BK0 A;  1JOB A;  2XLF A;  3DPR A;  4WVM A;  1E57 A;  4BQ1 A;  3TEY A;  1ZRC A;  3U11 A;  3VKF C;  1H6X A;  3S30 A;  3T1M A;  3RG0 A;  5FZK A;  3AKQ A;  3TYJ A;  3CZU A;  1UZ0 A;  1BXH A;  2Y6H A;  5FY0 A;  3OD0 A;  3LIG A;  3LDR A;  4RQP B;  3VDD A;  1Q8S A;  1QQP 2;  4IV1 B;  4IND A;  2PLV 1;  4YG3 A;  3R4U A;  4TLF A;  3AMH A;  5E1R A;  5IVE A;  3MI8 A;  3ASI A;  1O5L A;  2XLG A;  1SLI A;  5HCB A;  4E4Z A;  5JXI A;  3U4X A;  4XF4 A;  2E7T A;  2PXJ A;  1BJQ A;  1ODN A;  4MYE A;  3GYD A;  2GH8 A;  3N3H A;  1H4H A;  4AGG A;  3C7H A;  4KQ7 A;  3ZFE B;  3O1S A;  1DQ2 A;  5J09 A;  3K51 A;  1UKR A;  1MEC 2;  4HPK B;  5JZG C;  3UNP A;  2WBK A;  1QQP 1;  2C26 A;  4PHZ A;  3GHN A;  3ALQ A;  1MVE A;  1ODM A;  4TWT A;  3HT2 A;  2E7Q A;  4AL9 A;  4Y4Y A;  1GV9 A;  3VBO C;  4Q4Y 3;  4P02 B;  1FYU A;  2GNT A;  4EN7 B;  1FPN 3;  4GWN A;  4PCR A;  2JG9 B;  4UFK A;  3Q8E A;  1GWL A;  1OI6 A;  5FPU A;  2R07 2;  1AYM 2;  5FYY A;  3GBF A;  2P34 A;  4URT A;  4B29 A;  1MEC 1;  4IE7 A;  5CEH A;  2VZO A;  1U5Z A;  5I8Y A;  4NUB A;  4E4S A;  4D69 A;  2WNO A;  5FFO C;  2DUR A;  4BJ0 A;  4YW3 A;  1DQ5 A;  3ZFF A;  4GJY A;  1IS6 A;  2QQL A;  2ZEZ A;  1TEI A;  2R07 1;  2IXH A;  2WNU B;  2ZX4 A;  4CZS A;  4RR3 C;  1HQN A;  4YZ1 A;  5FP7 A;  4CCM A;  5E88 A;  4LOS A;  1A8D A;  1OQE A;  3ZYI B;  4PDW B;  5GM0 A;  4A6S A;  2WKK A;  3LF7 A;  1V6K A;  4Y4R A;  2VE1 A;  1CPM A;  3AZV A;  3ZKU A;  5DZF A;  2VZR A;  1AXY A;  3FWE A;  4ZKT B;  2RS1 2;  3SEP A;  1D4V B;  1PVC 2;  4IV1 A;  3F95 A;  4QDS A;  1DQ6 A;  2VW0 A;  4IE6 A;  2OYZ A;  4Z8B A;  4A2U A;  3USS A;  4FPO B;  4LE3 A;  1UU6 A;  4H2A A;  1W9F A;  1JI6 A;  3ACL A;  4LTA A;  4XHX A;  5LA2 A;  1UOG A;  1B35 C;  1K5M C;  2W47 A;  3MFA A;  2RDS A;  2X5I B;  3ILF A;  4A44 A;  3R05 A;  1LHU A;  2WO2 A;  4MAD A;  3ZFE A;  3K4A A;  3AVR A;  3WCR A;  4OZO A;  5A3W A;  4HPK A;  4N53 C;  5GKA C;  2RS1 1;  3CL1 A;  1PVC 1;  3GJA A;  1UXX X;  3VBR B;  1SDW A;  3MIF A;  3IWZ A;  2K46 A;  3HQU A;  1UY4 A;  1CZV A;  1DCS A;  2JJ6 A;  3AMN A;  1JYN A;  2ADE A;  1H8T C;  3NNJ A;  2X10 A;  2VUA A;  2A1X A;  4LBO A;  2DCJ A;  5H9Q A;  5FMB A;  1NQJ A;  3ILN A;  4I02 A;  4GA9 A;  1A3K A;  4Q4V 3;  3PUS A;  2JEN A;  4XUO A;  5ERL A;  3VB9 A;  3CF6 E;  1SCR A;  5LB6 A;  4QPG C;  4M4P A;  3LEK A;  3FJS A;  2P3I A;  2RDN A;  4X8N A;  2D7F A;  2BVV A;  2VMI A;  5BXX A;  1X33 A;  2DUO A;  4LJH A;  2HH9 A;  1PGL 1;  1PM7 A;  3I8T A;  1H1M A;  4CCK A;  4LO7 A;  5A32 B;  2WNU A;  4FFF A;  5FIX A;  2BWC A;  4GXL A;  4N7I A;  2I07 B;  5JOW A;  1YIF A;  1C8N A;  1SCS A;  2BVB A;  2MNG A;  2Q8D A;  3EHK A;  2VZQ A;  3USU A;  2W9X A;  4DOU A;  1ZX5 A;  3RQ0 A;  3H7Y A;  4N43 C;  3DPR C;  1EYB A;  1JTZ X;  3WV6 A;  1H6Y A;  3IKW A;  1SBE A;  3N9N A;  4W6Y A;  4X8P A;  3FLP A;  5T55 A;  3VDD C;  3ZKY A;  1GKB A;  4BLJ A;  3H0O A;  3MPB A;  1PZ8 A;  4LBQ B;  2A3X A;  4ISQ A;  5DUV A;  2NMO A;  2PQS A;  3BVC A;  2X5I A;  3PUA A;  4YWA A;  4AZZ A;  1VBB 2;  1H2N A;  5IVC A;  1SBF A;  1ZRI A;  5JCT A;  1DLL A;  3GZU C;  5AC9 3;  3PU3 A;  3D5O A;  2DYC A;  5K7P A;  5ABJ C;  2VR4 A;  3MLJ A;  3VBR A;  4BHP A;  1MS3 A;  3NAP A;  1I6X A;  3I4I A;  3RZG A;  3HT1 A;  2W1U A;  3WF2 A;  2EIB A;  1PIV 3;  4BXF A;  5B4X A;  5CFD B;  1NAE A;  4LHL A;  1CAW B;  1FNZ A;  1W3X A;  2VZS A;  3KD4 A;  1KEX A;  4L2N A;  4Q4W 2;  1VBB 1;  3O14 A;  4QPI B;  3KGZ A;  3W20 A;  3LOI A;  3WG4 A;  4HKL A;  1DGW A;  2DU1 A;  3MF6 A;  2XPJ A;  1AF9 A;  2Y33 A;  4QT6 A;  3MEP A;  2GU9 A;  2CWM A;  1V0A A;  3GZT B;  3DKW A;  1GFF 2;  3OUJ A;  3SHR A;  4ORF A;  2ZKN A;  1GNZ A;  4JKL A;  2JX9 A;  1OVP A;  4DXR A;  2NMN A;  2VNV A;  2QQO A;  3JQW A;  4QQH A;  1MVQ A;  1AL0 G;  4Q29 A;  3WNP A;  1V9U 2;  4Z07 A;  2O8Q A;  4CEW B;  5FRA A;  4Q4W 1;  5A32 A;  5BY5 A;  2FCV A;  4K3U A;  1E5R A;  1A6C A;  4EWE A;  1IG3 A;  4HON A;  1SQ4 A;  2JE9 A;  3U14 A;  1FOD 2;  5FZH A;  3IDB B;  2JXA A;  3PTY A;  4NPM A;  1WWY A;  4XYX A;  2ARB A;  2FCU A;  2JEC A;  5FBZ A;  5A7Q A;  4LK6 A;  1LEN A;  5L9R A;  3UKT A;  1NKG A;  4N9I A;  3TRS B;  1OLM A;  4FTS A;  5FZO B;  3RGB A;  4AVV A;  4H7L A;  1V9U 1;  3OD4 A;  1OLM E;  4RQP C;  4W6W A;  2FDJ A;  4WM8 C;  4IV1 C;  4PBO A;  2X8K A;  4NWW A;  2HLE A;  1BBT 3;  1HXS 3;  1QEX A;  4CP0 A;  1Z7S 2;  2SLI A;  4E9K A;  4ZU4 A;  5A3M A;  2WS9 2;  3S57 A;  1HQL A;  3IPV A;  3FFQ A;  2GP5 A;  1GZT A;  3M8L A;  2OZ6 A;  5AFB A;  4EYU A;  4PQQ A;  2DV9 A;  3OUH A;  2HWC 3;  3PME A;  5FYB A;  4K40 A;  1JBC A;  4YFW A;  1WW5 A;  3OCP A;  3RZZ A;  3ZDV A;  3ZFE C;  4RGK A;  1O8S A;  3GZA A;  1UZZ A;  3AP5 A;  5DAX A;  3SH3 A;  1IKQ A;  4UW6 A;  4CA9 A;  3AL5 A;  1VRH 3;  3L2Y A;  1N3Q A;  1NZI A;  1Z7S 1;  1LU1 A;  2VW2 A;  1D4M 2;  5IFP A;  2VD7 A;  2WS9 1;  1CAW A;  1UX7 A;  2ZAB A;  1YQ8 A;  3FZ3 A;  4QPI A;  3N35 A;  5LY1 A;  2O1Q A;  4OMC A;  1CX4 A;  1XB9 A;  2JG9 C;  3ZX7 A;  1WD4 A;  4XW3 A;  2VY0 A;  2QQK A;  3O12 A;  5C8C B;  3BB6 A;  5C3P A;  1HLC A;  5HXM A;  3TB0 A;  1SPP A;  4ASL A;  4GB3 3;  4LO8 A;  3WDV A;  1HV0 A;  3HJR A;  1WCU A;  1I9R A;  1RMU 3;  5B4N A;  1REF A;  4GWJ A;  4KGG A;  1H4G A;  1GNH A;  3BOD A;  2MHF A;  1D4M 1;  2IC1 A;  5CAZ A;  1V6M A;  4IEY A;  4E4H A;  2AEY A;  4CEW A;  3A4U A;  3PNA A;  2K9Z A;  2RVA A;  3GBG A;  5TSW A;  4E2Q A;  2VCA A;  4XXP A;  1W9Y A;  3KQR A;  5FZ9 A;  3WW4 A;  2WAA A;  2D93 A;  2WNU C;  5F9T A;  1TMF 3;  3N7J A;  4KI5 M;  4YGD A;  3S0M A;  1AYN 2;  4PDW C;  3AKT A;  4QMA A;  1K45 A;  1MS9 A;  2JB4 A;  1H2M A;  3UL2 A;  3BTX A;  5C6C A;  1PM4 A;  4HBN A;  5FZO A;  4XF0 A;  5BPX A;  3MW4 A;  3T2P A;  5FP4 A;  3H1W A;  1JYI A;  2ZAC A;  4AFB A;  3BU0 A;  2ZAH A;  1QXJ A;  3ZOI A;  1UPS A;  4Q8K A;  1FT9 A;  2GMM A;  3AFK A;  2ZAA A;  4V2V A;  5T50 A;  3NNL A;  4DXZ A;  2X5I C;  3AYD A;  1CQ9 A;  4FOW A;  4QX2 A;  5L36 A;  4FOY A;  4RS5 B;  2OX0 A;  3A7Q A;  1UY0 A;  3NMB A;  3SLI A;  4JRA A;  1DQ1 A;  4QX8 A;  4ARX A;  4EJR A;  4LIT A;  1JZ4 A;  3FFZ A;  2DVF A;  5FYU A;  1JU4 A;  4D6Q A;  3VBR C;  3MYX A;  3V64 A;  4AVB A;  5FLH A;  3VBH B;  3UJO A;  3J8F 3;  4AF9 A;  2W1Q A;  4HET A;  5DUU A;  3LQC A;  3VD5 A;  3E6C C;  3GCW A;  1OBN A;  4XMI A;  4BQW A;  1XJA A;  4NIA A;  1AR6 1;  4WZC A;  1VMH A;  2ID4 A;  5C8W A;  1W6O A;  2RJ2 A;  1YFU A;  3KB5 A;  2FBE A;  3DN7 A;  1O8P A;  1URX A;  5FPX A;  1MQT A;  2X53 S;  3NW4 A;  4QHB A;  5IVF A;  3I3Q A;  3JB4 C;  4NRM A;  1VBA 2;  3SC7 X;  1OQ1 A;  5JI7 A;  2X09 A;  1RUJ 3;  2VME A;  2ZA9 A;  1R1Z A;  1UXZ A;  4HVR A;  4AI1 A;  3QD6 A;  2WC2 A;  3NKG A;  4MXV A;  5JXG A;  5JLV A;  3B5L B;  4ISR A;  5KBF A;  5L19 A;  4AED B;  3ZYR A;  1IHM A;  3TAY A;  2EF6 A;  1WCS A;  5DDJ 2;  4AEK A;  1WLW A;  2PFW A;  1PVX A;  4NHL A;  4GKX A;  4YPJ A;  4RGA A;  4A7Z A;  3Q8A A;  1VBA 1;  3SIS A;  1S0D A;  5E6H A;  3M2M A;  2ERF A;  4CP2 A;  4UI9 L;  3T4V A;  3OPT A;  4FP2 A;  2RJL A;  5F37 A;  3I3E A;  4FT8 A;  1DQ4 A;  2A73 B;  3ON7 A;  3WG3 A;  3ZN6 B;  4D6R A;  2WL1 A;  2ZGU A;  3I49 A;  3JBG 3;  3K75 B;  2ZGK A;  5JPM B;  3I2G A;  1GOF A;  5DDJ 1;  4YRD A;  2WT0 A;  5C4W A;  4XEZ A;  1DG6 A;  1WBF A;  2A3Y A;  3C7O A;  3VZN A;  1BEV 3;  4RS5 A;  3ZMO A;  1NG0 A;  1HDK A;  4X6R B;  2Y6J A;  3ZFG B;  2HBU A;  1ZRR A;  2XQR A;  1A34 A;  4HVO A;  2YMZ A;  3ETP A;  5KXB A;  5J48 A;  2VOV A;  1QDC A;  2XJP A;  3VBH A;  4QKD A;  2TBV A;  1RJ7 A;  4XDO A;  3WHT A;  1QH6 A;  5CFD C;  2HWF 3;  4A7K A;  4EN0 A;  1V6I A;  4P9J A;  4LBJ A;  1H9P A;  4MGS A;  4QPI C;  1LOE A;  2RJK A;  1K3I A;  5L7O B;  1VBD 2;  3OGG A;  1LUL A;  1ZBE 2;  1NCQ B;  3H50 A;  1WZX A;  4MV2 A;  5A1A A;  3LFI A;  1NOV A;  2WZP P;  2JB8 A;  2A3W A;  4IEP A;  1ZA7 A;  1R08 3;  2OUJ A;  1FMD 2;  4QX0 A;  2VZT A;  5GAL A;  5F3C A;  2ARA A;  4ES9 A;  1RL3 A;  2VCC A;  4MO3 M;  4XE9 A;  1PGW 2;  2PHW A;  5FYT A;  4CEW C;  1W0N A;  3THC A;  3SMH A;  1LOC A;  4JGY B;  1PGS A;  1VBD 1;  4YW1 A;  3A0N A;  1ZBE 1;  3IN9 A;  1PNF A;  2QQM A;  1TME 1;  3LWC A;  4URA A;  5I0D A;  4Z2W A;  2EIE A;  1ASJ 3;  2XJS A;  5FZB A;  3N36 A;  3Q9O A;  2YC0 A;  5FAX A;  1FMD 1;  3WT3 A;  3VV1 A;  2EA7 A;  5FY9 A;  1C5I A;  5BNQ A;  4XAB A;  5C3Q A;  2FCT A;  1W8O A;  1VAL A;  2ZHM A;  5KXC A;  1O4T A;  3ATG A;  1GZC A;  1SLT A;  1PGW 1;  4Y1Y A;  3KHB A;  3FL7 A;  1R1A 2;  4I30 A;  3T09 A;  2UY8 A;  3B93 A;  1LOA A;  4M01 A;  1S55 A;  3KT1 A;  5BNO B;  3ZSE A;  1RUI 3;  3T4H B;  1XC6 A;  5F3I A;  4Y33 A;  3AXD A;  3X29 B;  3E97 A;  1LHW A;  1XNB A;  4JGZ B;  3ZFG A;  4D8M A;  4OFG A;  1F35 A;  2CU5 A;  3MV0 1;  4B7K A;  4YLZ A;  5FY4 A;  3WQ0 A;  1XNT A;  1L7L A;  4YG0 A;  2QDR A;  4MGK E;  2CGN A;  4Q4X 2;  5D8A B;  4XVH A;  4CE8 A;  4CDX A;  5I0T A;  5CG9 A;  3RZL A;  3N9O A;  2W39 A;  1W8F A;  2BQP A;  3LA2 A;  3M3E A;  4FXG B;  2BNM A;  4AVA A;  1MS4 A;  3SH4 A;  5LBB A;  4CU6 A;  1K5J A;  2JWP A;  3GAL A;  1YFX A;  5L7O A;  2AH2 A;  2EXI A;  1VB2 A;  5IHR A;  3RZH A;  4MGT A;  5C8C C;  5HV0 A;  1NCQ A;  4LEJ A;  1SLA A;  5CZK A;  1RIR A;  4QDR A;  5FMO L;  5I8T A;  1SDD B;  2VTX A;  2ZML A;  2ZTN A;  4QU2 A;  2QUO A;  1C28 A;  3CZJ A;  3PIJ A;  1AR9 3;  1EAH 2;  4Q4X 1;  1PO2 3;  5F5C A;  1UN1 A;  3GHM A;  1ZZB A;  5SV8 A;  1BMV 1;  1W06 A;  2D40 A;  1QOS A;  1WLT A;  3RWK X;  2A6V A;  2R7E B;  5FRE A;  2RS3 3;  3AMM A;  5H9S A;  5FYM A;  4ZON A;  5LAT A;  5FZC A;  5FPV A;  1MS1 A;  2D5F A;  5DG2 A;  4AI3 A;  3MLL A;  4XTP A;  3ZR6 A;  2D97 A;  4FXK B;  2UYB A;  5F3G A;  1W9W A;  1YFY A;  2WFF 3;  4C0H A;  1W04 A;  1UZV A;  1ENX A;  2VOK A;  2WQ4 A;  2JDN A;  3QAC A;  3VKL A;  3WQ7 A;  5JPN B;  2PTM A;  2JKX A;  1EAH 1;  3M3O A;  1SEF A;  4ZZ8 A;  3KV5 A;  4Y26 A;  2QE3 A;  3CJI B;  3RMY A;  3KV9 A;  3MZH A;  2OQ6 A;  4JHT A;  3CHX A;  1QJY 2;  2XVL A;  5FY1 A;  4QHZ A;  3VKO A;  3HBK A;  3T2Q A;  5BNO A;  1FAY A;  1S4C A;  4XFA A;  3S5A A;  4CDW B;  3AYC A;  2TEP A;  4ZS2 A;  2Q1Z B;  1H1A A;  5GJ6 A;  4JGZ A;  1J3R A;  4A3X A;  4FTB A;  4GIQ A;  2DF7 A;  5DAP A;  5EQU A;  2G4I A;  2PAK A;  4RS5 C;  3S5Q A;  4BIF A;  5A33 B;  4C91 A;  2XXZ A;  1HRI 2;  5A6Q A;  2RM2 3;  3LDB A;  4OI4 A;  3TNQ A;  4LIU A;  1T2X A;  2FZ1 A;  4AHZ A;  1RVF 3;  1VBC 2;  1W0O A;  5D8A A;  2Y34 A;  1NE4 A;  1SFP A;  1BVV A;  1LED A;  2PQQ A;  1WMX A;  2P6H A;  2WN3 A;  3J26 N;  5FZ7 A;  5HV4 A;  4AAX A;  1YHF A;  3VBH C;  2TNF A;  3TWI A;  2NM1 A;  4GJZ A;  4UW5 A;  2NQY A;  4AI9 A;  1DYO A;  3EXU A;  2ZGR A;  4Q27 A;  1RC6 A;  2D43 A;  2IVJ A;  3OEB A;  4KWJ A;  1S0F A;  2XB6 C;  3LPG A;  3OYW B;  4UFL A;  3WUC A;  2DWR A;  1HRI 1;  2Q30 A;  3U37 A;  5GLW A;  3NJX A;  2E63 A;  5A7W B;  5C33 A;  1G9F A;  1VBC 1;  1S0E A;  5LRR A;  3WOG A;  4XDQ A;  1QMJ A;  3T0A A;  4L8Q A;  1UD1 A;  4MHR A;  4Y24 A;  4YZ3 A;  5F39 A;  1GIC A;  2OUH A;  3W5N A;  1OUS A;  5IYY A;  1H0B A;  4QX1 A;  1VB4 A;  4JKM A;  5FMC A;  4M4R A;  4ZXE A;  2VL4 A;  4AI0 A;  2XJQ A;  4D7Y A;  3I3D A;  4IES A;  4B7E A;  2F17 A;  3WW2 A;  4EZH A;  2PLV 3;  2ARX A;  3J7H A;  3K4D A;  4OHX A;  4AED C;  4BIS A;  1J59 A;  4Q1R A;  1D2S A;  3ZYP A;  1XE0 A;  3GXU A;  1XXN A;  4Q8L A;  4QXH A;  1KS5 A;  3LEI A;  1QJX 3;  1W9T A;  4HKO A;  3RSJ A;  2YBK A;  4YW7 A;  1OUR A;  2H0V A;  4JC1 A;  4BXS V;  1VRB A;  2BV4 A;  4H7M A;  5HPO A;  3O1O A;  1CES A;  4M3C F;  4P9G A;  1T6G C;  2I45 A;  1I3H A;  5C5T A;  5FYH A;  1O3R A;  1Y9M A;  5FOB B;  1JUI A;  4Q0Q A;  4LPL A;  4CDW A;  4QGL A;  1KD7 A;  3KGL A;  3HVD A;  2UWC A;  3FUQ A;  2J22 A;  2GAU A;  1KFX L;  1Y9G A;  2YYO A;  1D2Q A;  2C24 A;  4KMQ A;  2A6Z A;  2I2S A;  3RWN A;  2WWS A;  1V00 A;  2Z79 A;  3IIA A;  4Z2A A;  2E32 A;  3AYE A;  2BWA A;  4CUA A;  3ZFG C;  2GND A;  2JIC A;  2R04 3;  1ZZ7 A;  1L7Q A;  2BZD A;  2XL7 A;  1FX5 A;  4FFG A;  1VBE 2;  3PTR B;  3I2D A;  3DF0 A;  4QU1 A;  1EV1 3;  1TNF A;  3IAP A;  4KH9 A;  3S7E A;  1X36 A;  2VZU A;  3NL1 A;  1Y9Q A;  2HWE 3;  1FV3 A;  1WGP A;  5DQ0 A;  3ZXG A;  1UMI A;  3ACF A;  4BA6 A;  4PF5 A;  2IFW A;  4KG8 A;  1K5M A;  4FPH A;  2O0O A;  4IGP A;  3OYW A;  4ZS3 A;  4CCE A;  5L7O C;  1JZ2 A;  2LRP A;  3IZO A;  5A7W A;  1NCQ C;  5IAX A;  5T5L A;  2GDF A;  4FP3 A;  4EWD A;  3IDA A;  1VBE 1;  5GZF A;  4WBB A;  2ZMN A;  1CON A;  1X8M A;  2OQ7 A;  3E5X A;  3F2Z A;  4FOV A;  1RB8 G;  3EJK A;  4H55 A;  1H1I A;  5IW0 A;  2FQP A;  5EJ3 A;  4PIZ A;  4KWL A;  3UGH A;  1UMZ A;  1DGR A;  3FBM A;  5SV5 A;  4DQA A;  2XLA A;  3EQE A;  3CKH A;  1DGR N;  2D6P A;  4JGY C;  1W2N A;  4AHY A;  4NRP A;  1GP5 A;  2IFR A;  4QPW A;  3CMG A;  1STM A;  1ZBA 2;  4BE3 A;  2W52 A;  3DKQ A;  4CPB D;  5A6Y A;  4QPG A;  2DVG A;  2VBD A;  3OEA A;  1QY4 A;  1Y43 B;  1COV 3;  2J7M A;  2VQT A;  5DAB A;  5EWS A;  4IEU A;  1LB2 A;  1W90 A;  2J1E A;  2BU9 A;  2C5D A;  1J3P A;  2DTW A;  2GAL A;  4U2A A;  4YM3 A;  5IAV A;  1C8M 2;  1POV 0;  4LA3 A;  5BNO C;  4OHV A;  5F2W A;  3PLQ A;  1ZBA 1;  3JUU A;  1Q5O A;  1DYK A;  4R8H A;  2ET7 A;  4JGZ C;  4N9H A;  3D3A A;  1CWP A;  1US2 A;  1UIK A;  3BOW A;  4HXC A;  5DN2 A;  4YW2 A;  4OI0 A;  4FSJ A;  3WNN A;  5HCA A;  2B9U A;  2OW4 A;  2CDO A;  2GC3 A;  2HBT A;  1RUH 2;  4JDO A;  4XUN A;  2Z5W A;  1WW7 A;  4XAA A;  3ZYG A;  4I2O A;  5D8A C;  2XJV A;  3IMM A;  1YFW A;  1IPK A;  2G1M A;  4WM8 B;  3RYP A;  1C8M 1;  3GM8 A;  3NV1 A;  1ZRD A;  1POV 1;  1EUT A;  4QD2 A;  4QB1 A;  4DO0 A;  4LMF A;  1RUC 3;  5JOZ A;  3HMY A;  4YYO A;  3ZYH A;  4AAP A;  5EXO A;  2F6B A;  1W39 A;  3TBD A;  2FHR A;  1W6Q B;  1WCK A;  5LCW L;  1RUH 1;  3ZXE A;  1Q8V A;  3VD4 A;  5ABJ A;  2HYX A;  1AR8 2;  3LSD A;  3P3P A;  3GCX A;  1NCR B;  2MPF A;  4FQZ A;  4Y5S A;  1ZZC A;  2WYF A;  4FPF A;  3KM5 A;  2VC9 A;  4I0B A;  3U1X A;  3VBU C;  3UET A;  5IAT A;  4AFD A;  5KHI A;  1CVN A;  3PIG A;  2O8O A;  3QH7 A;  5J3U A;  4V2W A;  1CZT A;  5JSP A;  4DXT A;  3D8C A;  2ZJC A;  4XBL A;  1W03 A;  1DBN A;  3KLS A;  4IEO A;  1SLC A;  2KD7 A;  4PQ9 A;  3O1T A;  3INA A;  1YXW A;  2R49 A;  3JU9 A;  1ULP A;  5F5A A;  1AR8 1;  2PYT A;  1CN1 A;  4QXK A;  4HFS A;  4S2H A;  3CJI C;  2V4V A;  4AFM A;  2HEV F;  2LUW A;  3HNY M;  4BME A;  4ET7 A;  2CGP A;  3JZV A;  1N1S A;  3WF1 A;  4MXW B;  1LGB A;  1RXG A;  1W6N A;  1LEM A;  4CDW C;  1UX6 A;  1OA3 A;  2GME A;  3K77 A;  1W2T A;  5F1R A;  1AYM 1;  4O9G A;  2ZGN A;  5DAQ A;  1K12 A;  5F32 A;  1PZ7 A;  5LAS A;  1LRH A;  1LU2 A;  2YB7 A;  4S2D A;  1WKY A;  4IER A;  2FDG A;  2Z69 A;  3ZSL A;  1U0A A;  1OD5 A;  4XPV A;  2WLQ A;  3MW2 A;  4M3C B;  1ENQ A;  4RQP A;  2J1T A;  4WM8 A;  2Y8K A;  3HQR A;  3OOX A;  2C1F A;  1J1L A;  1OSG A;  2DVB A;  5FKC A;  2Q8C A;  2GNB A;  3ZR5 A;  4PI0 A;  4GUL A;  4CXW A;  2GMP A;  4XFB A;  2R06 2;  3WW1 A;  1S1A A;  5IJR A;  3PDQ A;  1SG3 A;  4RL7 A;  2L9L A;  2QQI A;  4YM2 A;  2XVG A;  3VBS B;  3ZLI A;  4FQ4 A;  1HJF A;  4AEM A;  4DRR A;  1S0C A;  2YHJ A;  1W6Q A;  5K4L A;  2H6B A;  2ZMK A;  4WM7 B;  5DXD A;  2HWD 3;  4AHX A;  3ES1 A;  5L9V A;  1NCR A;  4XQ4 A;  2WWU A;  4CP9 B;  1JOP A;  2JDY A;  4HK9 A;  3KT4 A;  2ZEW A;  3GNE A;  1RUD 2;  3J4U H;  2UWB A;  1PMI A;  3ZPY A;  4HL0 A;  4AQ6 A;  3KT7 A;  1BZW A;  1YJL A;  1JHN A;  1OPO A;  1UIJ A;  2JG9 A;  2BFU S;  3RI9 A;  1LKN A;  4OUS A;  1JYW A;  1OUX A;  4IEV A;  5DG1 A;  3ZXL A;  4C1W A;  1W28 A;  5H9R A;  5HXV A;  2V73 A;  2WAO A;  4LUM A;  3WNL A;  3AFG A;  1RUD 1;  4QAW A;  2IXK A;  2Y6F A;  2VGD A;  4X6Q B;  4YNI A;  1UKG A;  4ZZ5 A;  4MXW A;  3AP7 A;  3K2O A;  2PA7 A;  1OPM A;  1UCX A;  4XIO A;  1Q8P A;  4PLN A;  1H2L A;  4YFZ A;  1PO1 3;  2HWB 3;  4QGN A;  4XBQ A;  5FZ6 A;  3OF1 A;  3OJB A;  3ZXK A;  1XOY A;  1U12 A;  5J37 A;  4QQO A;  5BYN A;  2VMD A;  3NV3 A;  4LUK A;  3ZPO A;  4PDW A;  5DUX A;  2FMD A;  4MZU A;  5GZD A;  1IPJ A;  4PI2 A;  3WDX A;  1UPI A;  1XPW A;  2IWG B;  4Y20 B;  3SCG A;  3DGT A;  1UNB A;  3I2K A;  1IS3 A;  1F2N A;  4M3C E;  2VMF A;  2VXR A;  3III A;  2XWJ B;  4I0A A;  2DVD A;  4Q4Y 2;  3DEC A;  2AYH A;  1XSQ A;  2ZGO A;  1TVG A;  2BOI A;  2XJU A;  3R0R A;  5FLI A;  3VBS A;  5IVV A;  3DYO A;  1DLC A;  4FAG A;  4MGY E;  5FXX A;  5FCC A;  5C3R A;  2SBA A;  2XQX A;  1EP0 A;  1S2E A;  5LA9 A;  1UZW A;  4CP9 A;  1DZQ A;  1CGP A;  5CKM A;  4WZF A;  4ZU5 A;  3J9S A;  1MZ5 A;  4MET A;  5EYX A;  4MG2 A;  4ERO A;  5DZG A;  1YQ6 A;  4PIY A;  4Q4Y 1;  1GQP A;  3OBT A;  4IEX A;  4O7X A;  2WN2 A;  3I3B A;  3GF6 A;  3MBW A;  3ACI A;  3WX5 A;  1OA4 A;  2RDQ A;  4AW7 A;  1F15 A;  2VW1 A;  3KF5 A;  1J83 A;  1UZY A;  2A70 A;  4PF1 A;  2ADD A;  3NO8 A;  4HLT A;  1E5S A;  2ZOE B;  3VDC A;  4MHU A;  2E26 A;  2D6M A;  3PHM A;  5FMD A;  1WA6 X;  1F5F A;  3NST A;  3NVC A;  4IEW A;  3WP5 A;  4HN0 A;  1O4Z A;  4NIG A;  1J84 A;  1WCD J;  4C90 A;  1US3 A;  3BKZ A;  1KIT A;  3TNP B;  4XZP A;  3FBY A;  3URF A;  3FC0 A;  2D6N A;  2J1U A;  2P3J A;  1YJK A;  1VR3 A;  2CAV A;  3L2H A;  3AC0 A;  4P9L A;  1YI7 A;  5C71 A;  2RHP A;  1SAC A;  1UYP A;  3MO4 A;  3OTF A;  5FWJ A;  2Y26 A;  5IWF A;  3OUI A;  3O1P A;  1Z0H A;  4Y20 A;  5T5P A;  3AL6 A;  2VM9 A;  4YSF A;  1AR6 3;  2Y60 A;  2I74 A;  2YUE A;  4YG6 A;  4E2S A;  2BDR A;  2XBO 2;  4WVZ A;  1POQ A;  2XL9 A;  3FHQ A;  2RDR A;  3J7L A;  5J7M A;  3TEZ A;  1AJO A;  2G19 A;  4LA2 A;  2YG0 A;  3HN3 A;  2RS5 2;  4BQX A;  4P5Y A;  2XKO A;  1NYW A;  3T0B A;  4YAR A;  1UY3 A;  3LEG A;  4LBQ A;  1X9T A;  1KS4 A;  1FOD 1;  3N7L A;  2EXK A;  4Q4V 2;  3DUI A;  3H7J A;  1S0G A;  1UL9 A;  2XOM A;  4J1X A;  3N7M A;  3I7D A;  3QOP A;  5IK7 A;  1WLD A;  3KS7 A;  3KV4 A;  2QKD A;  2XBO 1;  3DV8 A;  4UXA A;  3LPF A;  2OXB A;  1NCR C;  1UOB A;  4FPY A;  3WD5 A;  3PVB B;  3AYA A;  2RS5 1;  5FYI A;  5KR7 A;  2B9V A;  4JAA A;  4YW5 A;  1S0B A;  5CFD A;  1VBA 3;  4HVQ A;  2OVU A;  3NQH A;  4L9B A;  3G6J B;  4N7U A;  1QDO A;  2PN5 A;  2LM3 A;  2XML A;  2D3P A;  4L11 A;  1ENR A;  2WZR 3;  2MEV 2;  4Q4V 1;  5ACA 3;  3O1R A;  3KWV A;  2CSG A;  3OBR A;  4E8C A;  3VZO A;  3JD7 3;  4YZ5 A;  4FAH A;  1OHF A;  1WME A;  3TEW A;  2R0H A;  1XU2 A;  2VPV A;  3MPP G;  4K7J A;  2E7A A;  3ILR A;  1NA1 B;  4NRO A;  3WZ1 A;  1VMJ A;  3E6B A;  2UU8 A;  2YGL A;  4YVW B;  2VBB A;  5K0U B;  2EAK A;  1SZB A;  1RYY A;  2GN3 A;  2MEV 1;  4HT1 T;  4IE4 A;  1HB3 A;  2YBP A;  1ONA A;  5KHK A;  4LR4 A;  1Q43 A;  1SLL A;  3LB9 A;  4Q26 A;  4CEY B;  3VL8 A;  4EWA A;  4Z92 B;  3JQX A;  1O5U A;  3N9Q A;  2Q4S A;  3HN1 A;  1MZF A;  2BEO A;  2VEC A;  4OQ9 A;  5AC9 2;  5BV6 A;  3VHO A;  4BK5 A;  2OPK A;  3OGS A;  1RUE 2;  3OSD A;  4DUW A;  4UBG A;  3H8O A;  5FY7 A;  3MDP A;  2WR9 A;  5IVY A;  2D3R A;  1LAJ A;  4XAC A;  1W8T A;  1PIV 2;  2WSU A;  2VZV A;  2YZ4 A;  3DYM A;  4R4Z A;  4CUB A;  4LIV A;  4XHB A;  4EN9 B;  1UU4 A;  3HWJ A;  3AP4 A;  1NXM A;  1ULO A;  2ARE A;  2BTV C;  2E31 A;  4LUL A;  1O91 A;  1AYN 1;  2TUN A;  4NRQ A;  3VBS C;  4C1X A;  3WEZ A;  3HNB M;  5AC9 1;  4HAN A;  4B8E A;  1AL2 2;  1RUE 1;  3K46 A;  4WM7 C;  5AFE A;  1NLQ A;  3ZXF A;  4G4F A;  1G86 A;  4JQT A;  2VBP A;  1VJ2 A;  2D44 A;  5GLV A;  1TME 3;  1C4R A;  1E5H A;  3E5U A;  4LNV A;  2HEY F;  1AR7 3;  5FPL A;  5T52 A;  4CCC A;  3PVN A;  4J6G A;  4K20 A;  1O6U A;  3ZN5 A;  1FMD 3;  3PL0 A;  3I54 A;  4ASK A;  5DUW A;  2BGC A;  5A3N A;  2Y6G A;  3RFR A;  4ATF A;  4Y1V A;  5LA1 A;  1LJ7 A;  1GLH A;  2A6X A;  4L99 A;  3UV9 A;  4LLO A;  1OT5 A;  2B5H A;  3IDE A;  4DMI A;  5C8C A;  3D0S A;  4OCT A;  5H9P A;  1AL2 1;  4XUP A;  3MIH A;  4OI2 A;  4QX5 A;  5D1I A;  3HAG A;  2LS6 A;  1RHI 3;  4AR2 A;  4AK3 A;  2VCB A;  4JDN A;  1NA1 A;  3QH6 A;  4SLI A;  5J98 B;  1WBL A;  5A3U A;  2YDE A;  1HW5 A;  4FPC A;  4YVW A;  3H42 B;  3ZXD A;  4CRQ A;  1YQ5 A;  3ACG A;  1T6B X;  4A7Y A;  1ND2 B;  4B4R A;  1BBT 2;  1HXS 2;  4ARY A;  3ZO0 B;  4B1M A;  3VDB A;  3KSC A;  4GKY A;  4ONU A;  1OFS A;  2RR1 2;  4Q0V A;  4CEY A;  2NYY A;  5JSR A;  4K1Y A;  3ETQ A;  4FPL A;  5LY2 A;  3UK9 A;  1ACC A;  4UAP A;  3C3V A;  4BWO A;  4AOC A;  1QJU 3;  1W6P B;  3PJY A;  1VRH 2;  3BUC A;  1XNC A;  1BBT 1;  1HXS 1;  4JZR A;  3AMQ A;  4Y1U A;  2DCZ A;  1H2K A;  5FPA A;  2ORX A;  4LO4 B;  4OUE A;  5IT6 A;  1DZR A;  2RR1 1;  2JD4 A;  1Y3T A;  3V56 A;  1PNG A;  4GH4 B;  2WT1 A;  3ACH A;  3IB3 A;  1A8M A;  3ZSM A;  4AVC A;  2LTN A;  3I2H A;  4DIQ A;  1WMF A;  3VHR A;  1JZ8 A;  1Z78 A;  1N3P A;  4GB3 2;  2A5Z A;  2JE8 A;  4O61 A;  5CKN A;  3FLR A;  5FY8 A;  1RMU 2;  1VRH 1;  2JDK A;  1WW6 A;  3AB0 A;  3TEX A;  1EUU A;  3ZXA C;  2A7A A;  1GU3 A;  2XON A;  5KWR A;  2XUE A;  4EN6 B;  4XCB A;  2ZX3 A;  5FYZ A;  4YGC A;  2CDP A;  4D94 A;  1W2A X;  5LBF A;  4I3P A;  4OMD A;  4MGZ E;  1RJ8 A;  1N3O A;  3SCF A;  1MAC A;  1QNY A;  1ALY A;  4GB3 1;  3WF4 A;  5FK7 A;  1RMU 1;  4NO4 A;  4Y5Z 0;  4IV3 B;  3D6E A;  5A7S A;  2VOT A;  1CAX B;  2GNM A;  1ND2 A;  2Q5T A;  5FKB A;  4B4P A;  2WQ8 A;  3C7G A;  4QM9 A;  4FPG A;  4RN5 A;  2AAC A;  5FZE A;  5HI0 A;  4AED A;  2Z4F A;  5FPZ A;  1F9K A;  4BU2 A;  4F3J A;  3POI A;  1XE8 A;  4XF3 A;  1JW6 A;  4HOO A;  4AI8 A;  2JG8 B;  4MH0 E;  3FHI B;  1CAV B;  2VJX A;  2C9A A;  3WUD A;  3FX3 A;  1W6P A;  4QPY A;  4OLL A;  2UY9 A;  2DFC A;  2XR4 A;  1HRI 3;  2ORZ A;  4NID A;  2C9K A;  3WP6 A;  1VBC 3;  3W59 A;  1PZ9 A;  3J8F 2;  3ZN6 A;  3S6P A;  2ET1 A;  1WA4 A;  3LCP A;  1MS0 A;  2OKX A;  4ATE A;  4GH4 A;  1OVS A;  5T5J A;  1MZ6 A;  2K0G A;  4MUV A;  5JAX A;  3KF3 A;  1HRV 3;  1GAN A;  4JRL A;  1CJP A;  4NMI A;  3CBN A;  3KVB A;  5KHG A;  2ZEY A;  3QLQ A;  1QXR A;  4K8R B;  4BZ4 A;  1MZE A;  1OXC A;  3RYK A;  2KXL A;  2VZ3 A;  2E33 A;  2PHF A;  4MSV A;  4TTG A;  5L73 A;  4OZX A;  3JB8 A;  4DUV A;  5LW9 A;  4LKS A;  1YLL A;  5CIR A;  4BDV B;  2D6K A;  4R9D A;  3SNM A;  3VL9 A;  1FV2 A;  3J8F 1;  1R1A 1;  1H30 A;  4RA0 A;  2QFE A;  1VP6 A;  2W2I A;  1RUJ 2;  3GJB A;  4RGG A;  2Q8O A;  1GOG A;  3OPZ A;  1LCL A;  4DIN B;  1F4H A;  1OMI A;  3OGV A;  3ZMN A;  2EAA A;  5LBC A;  2JE7 A;  1FNY A;  4DZG A;  1ZM1 A;  2W94 A;  2WNE A;  1QXP A;  1RUF 3;  3WXP A;  1VPH A;  2Q1F A;  5EFU A;  4AFA A;  4DRV A;  5FZG A;  4IV3 A;  3BTZ A;  1N1Y A;  4MVT A;  1Y7B A;  3WNX A;  4UFM A;  1W05 A;  4PIX A;  4UF0 B;  1NA1 C;  1CAX A;  2Q1M A;  2X29 A;  1YIP A;  2B45 X;  1RTV A;  1RUJ 1;  1LHN A;  3AZZ A;  3BPS A;  3POF A;  4IUG A;  4YVW C;  3VBU B;  1CIW A;  5K0U C;  1LNS A;  2E51 A;  1JOJ A;  2J1V A;  4CDQ B;  5JWP A;  1R64 A;  5IVB A;  1PMJ X;  1WMD A;  2BP6 A;  3DYP A;  2WO1 A;  4JGY A;  3JBG 2;  3PUR A;  4CEY C;  1QOT A;  2GC0 A;  2J1S A;  2WA3 A;  4Y22 B;  3BN6 A;  1CAV A;  4AVT A;  2FD8 A;  1W8N A;  1GUI A;  3PVE A;  4I0W B;  2VNO A;  1WW4 A;  4Y3O A;  5J1X A;  2N7G A;  4RHV 3;  1GQH A;  1IOA A;  2VVE A;  4NWV A;  1QOO A;  3TN9 2;  1EY2 A;  2RMU 3;  3H8R A;  4FO9 A;  4AVS A;  3FE5 A;  5I93 A;  2GP3 A;  3JBG 1;  2HWF 2;  3T30 A;  4HMZ A;  4FTE A;  3B01 A;  1JZ6 A;  4J25 A;  3OBA A;  2RG4 A;  4NPR A;  4B3N A;  1NZC A;  4AE2 A;  2IZW A;  4YM0 A;  3O7O A;  4QX3 A;  4IE5 A;  3EBR A;  5GLZ A;  3WNK A;  1W8Z A;  3POS A;  3EO6 A;  3WCS A;  2OPW A;  1W9S A;  5FZ8 A;  2H0B A;  3TN9 1;  4JTN A;  1DYP A;  1R08 2;  1QJY 1;  2EIG A;  2XUM A;  2XVK A;  3R4S A;  3AKP A;  2P3Y A;  2HWF 1;  5FUI A;  1QWR A;  1X9P A;  4A6O A;  2VTX J;  2C0Z A;  1J1T A;  4QHO A;  4XJZ A;  4CTE A;  2B46 X;  3SKJ E;  1LGC A;  2VQ0 A;  5A7O A;  5FQ0 B;  4TN7 A;  1HN1 A;  5LBE A;  3O0V A;  1QHD A;  3T1L A;  4CCD A;  1RUG 3;  4Q0S A;  1ASJ 2;  2PHR A;  4UF0 A;  3ZIX A;  4GWM A;  5EV7 A;  1JYX A;  3VZM A;  5FO7 B;  2GC2 A;  4UWD A;  1OOP B;  3OGJ A;  3VBU A;  2O14 A;  1QU0 A;  3KHC A;  3WG2 A;  4CDQ A;  1ND2 C;  3P3N A;  1X7N A;  1GBG A;  3SQO A;  1JN2 P;  1DHK B;  4GAL A;  5FP9 A;  3W9A A;  4NOT A;  2B39 A;  2B7Y A;  3C2U A;  4F83 A;  1ULG A;  4CVU A;  1YEW A;  4P9X A;  4KWU A;  1RUI 2;  3Q8C A;  1I1E A;  1DDL A;  4Y22 A;  2Y0O A;  1ASJ 1;  2JDZ A;  3SH5 A;  1XRU A;  2OZJ A;  2UUR A;  3T2T A;  4NPL A;  2YRO A;  2P2K A;  5JXJ A;  3CJI A;  3C8X A;  4RYD A;  1OKO A;  3J7M A;  1W2O A;  1AVB A;  4GD4 A;  4MLO A;  2FDF A;  1RUH 3;  4YZ4 A;  4R9B A;  2FDK A;  2WO3 A;  1SBD A;  4O65 A;  4LO6 B;  5F6L B;  1QQP 3;  2P4E A;  3BYW A;  1RUI 1;  3CDZ B;  4DB5 A;  2BOJ A;  2VOW A;  4GH4 C;  2EAL A;  3BIW E;  2XH6 A;  2VAU A;  3D82 A;  1KQR A;  5A33 A;  4K1Z A;  5JR2 A;  1RIT A;  2VQU A;  1F4A A;  1QJE A;  4HG6 B;  2ENR A;  4IQP A;  5CG8 A;  1F5J A;  5M0T A;  1GQG A;  4QKN A;  4LE4 A;  4ZXK A;  4AYU A;  1AR9 2;  1PO2 2;  1BYH A;  2BW8 A;  3ZYF A;  3A0K A;  1MEC 3;  4HKW A;  2RS3 2;  2PHD A;  5EIY B;  1UW8 A;  3O1V A;  3DXU A;  1VAM A;  3WF0 A;  4IET A;  5AVP A;  5FQ0 A;  5T54 A;  1JXN A;  2FMY A;  2OT7 A;  2WFF 2;  3PJQ A;  5JOX A;  1QKQ A;  1YO8 A;  5A6X A;  4LT5 A;  2CNA A;  1TE1 B;  4P14 A;  5E16 A;  3I97 A;  2R07 3;  4IV3 C;  1AR9 1;  1AYM 3;  1APN A;  1PO2 1;  1DQ0 A;  1HN0 A;  1R09 2;  2JDH A;  4Y5T A;  4KWK A;  3WG1 A;  2W95 A;  4WVM B;  2LRO A;  4TLG A;  3WY6 A;  5APA A;  5DAV A;  3BGA A;  1KJL A;  1M06 G;  3D0J A;  2CGO A;  2KR2 A;  1GR3 A;  1KJR A;  4LO5 B;  4Q1P A;  2AC1 A;  5DPN A;  2PHT A;  2YBS A;  4P5H A;  4JHZ A;  1M4W A;  1H8V A;  4G3Y C;  2A71 A;  1U5Y A;  3E1F 1;  3VUO A;  3D4K A;  4ITC A;  2P3K A;  3APB A;  2BJS A;  1UF2 C;  3POY A;  2JG8 C;  1R09 1;  2RM2 2;  1RVF 2;  4BQY A;  2VVD A;  3B9I A;  2VUL A;  4FPE A;  2ZGM A;  4AGV A;  2RS1 3;  1PVC 3;  1QF3 A;  4AQS A;  4EV0 A;  3ES4 A;  5CIS A;  3BI3 A;  5C9A B;  2BGO A;  1G9D A;  1DP0 A;  3CU7 A;  5D2A A;  5FZA A;  3PU8 A;  2B4K A;  2X05 A;  2E6V A;  2J1A A;  4TXW A;  4BK4 A;  2XJR A;  2RM2 1;  3P1I A;  4K21 A;  2ZHL A;  5FZF A;  3VHN A;  1RVF 1;  3CJX A;  1ZZ6 A;  5GZG A;  2FZ2 A;  1HB2 A;  4LOT A;  1IKP A;  2VQA A;  2QQJ A;  5IFT A;  1RUO A;  1HIX A;  3P6B A;  3UYJ A;  1G8W A;  4COU A;  3PUH A;  4W50 A;  4XXA A;  5FR3 A;  2ATF A;  2PLV 2;  5LZ6 A;  3ZFF B;  5FY5 A;  2QZ3 A;  3VHP A;  4W65 A;  4JCK A;  3Q8B A;  1UYX A;  1LGN A;  3TOJ A;  1HJG A;  1VIW B;  2IXC A;  1IQA A;  1QJX 2;  3NV4 A;  2QJV A;  3NV2 A;  1BKZ A;  3IMN A;  5FYC A;  3WVJ A;  3V0A B;  5BNN B;  2DVA A;  3VD9 A;  1HKD A;  2JDU A;  3RYR A;  2ZCW A;  4CDQ C;  1BCX A;  1JH5 A;  1ST8 A;  4G9S B;  5FZ4 A;  2W92 A;  4OYU A;  3I3M A;  3PUI A;  1NT0 A;  4L97 A;  3LZZ A;  2GH2 A;  3ELN A;  1S0I A;  5FZ0 A;  1QJF A;  1QJX 1;  5A80 A;  5JSO A;  5A70 A;  5CA6 A;  4EN8 B;  2R04 2;  3QBQ A;  2BYV E;  3LE0 A;  4GMP 0;  4YGE A;  4L92 A;  3BCW A;  4FFH A;  1ULD A;  1W0P A;  1YUD A;  1EV1 2;  3ORJ A;  2HJI A;  2HWE 2;  5C9A A;  4LHS A;  3W5M A;  1O3Q A;  3R6S A;  4ES8 A;  3AZY A;  1ZZ8 A;  5CB7 A;  3WNM A;  3M4F A;  5EJZ B;  3HBZ A;  4PJY A;  4XQD A;  1NXD 1;  2ZXQ A;  1JYV A;  2R04 1;  3LA3 A;  4R52 A;  1VBB 3;  5JI9 A;  3LFM A;  5EPA A;  4D7T A;  2JDP A;  4GMP 1;  4RSU A;  4DFS A;  4A4A A;  1EV1 1;  1CIY A;  5A3P A;  1WCQ A;  1J3Q A;  1L3J A;  2HWE 1;  3KVA A;  1LHV A;  5K8S A;  1JZ3 A;  2HYK A;  4QXB A;  1NQD A;  3U10 A;  2VG9 A;  1SHW B;  3AJZ A;  1HB4 A;  3FUO A;  2W46 A;  4FOQ A;  3VDA A;  4CXY A;  4BYY A;  4YW4 A;  2ZGP A;  5FZI A;  3NWK A;  1LOB A;  4KBZ A;  2PEL A;  4Q4W 3;  4D7S A;  4KBB A;  4AWD A;  5FOJ B;  5IK5 A;  4HN1 A;  3ITQ A;  2J1R A;  3KCX A;  3WP4 A;  4I3G A;  3USU B;  3ZSJ A;  1G6N A;  2CTV A;  3B94 A;  5BNN A;  3V0A A;  2E53 A;  2PMW B;  3RDI A;  4JX0 A;  4BQ4 A;  4DXS A;  4E27 A;  1OOP C;  1COV 2;  4I09 A;  4ZPI A;  2WDB A;  3AX4 A;  3NNF A;  2XWB B;  3I2J A;  2JIG A;  5LK5 A;  3ZDS A;  2R06 1;  3B02 A;  4B1L A;  4UYB A;  2ZBJ A;  1V9U 3;  1OA2 A;  1GWK A;  5C3S A;  4NHX A;  2QCS B;  3PMS A;  3CLP A;  4Q2F A;  2Y0I A;  4DUX A;  2ZGT A;  5JVV A;  3KZ4 C;  4XC9 A;  4KU8 A;  5KC5 A;  4TZD A;  1FOD 3;  2R1B A;  1ND3 B;  2RV9 A;  2VNG A;  3HPN A;  4ASM B;  2ILM A;  5DMY A;  3NRU A;  4CDU B;  2NLR A;  1HQW A;  1COV 1;  4XTM A;  3AP9 A;  5FYV A;  1ZA4 A;  4JTO A;  3ZM8 A;  2D5H A;  1YCI A;  5GZE A;  2CYF A;  3ME2 A;  2XBO 3;  1KDM A;  3M3C A;  3VGI A;  5CFC B;  1PHM A;  3NAP B;  2YC4 A;  5GLT A;  4AQ2 A;  2RS5 3;  3T08 A;  3WDU A;  4NAO A;  5JUV A;  4A45 A;  5BNP B;  1RUC 2;  4IGQ A;  1Z7S 3;  4IXL A;  5ISL A;  1SLB A;  1IG0 A;  1OD3 A;  4CU7 A;  2WS9 3;  5LWB A;  2YU1 A;  1PGL 2;  4S2G A;  5FBJ A;  3THD A;  2QQU A;  5FP3 A;  1U5I A;  3K48 A;  2YFZ A;  4XIK A;  4YW6 A;  3LKJ A;  2LAL A;  3BTY A;  4K9S A;  2CL2 A;  4M3C A;  3UGF A;  1IZ3 A;  4DNY A;  4HSJ A;  5JIA A;  3FLT A;  4FPK A;  4H14 A;  3HNM A;  2JKB A;  3PVO A;  3N7K A;  5F3E A;  1RUC 1;  2Y6L A;  4LLF A;  4OUM A;  4D3W A;  3RJR A;  1NLS A;  3OB8 A;  4IDZ A;  1D4M 3;  2EID A;  1TG7 A;  4XFF A;  1ULC A;  1FPN 2;  5HCF A;  4NR1 A;  2RE9 A;  2ZPX A;  1D0G A;  2A75 A;  2MEV 3;  4CU9 A;  3H3Z A;  1W99 A;  3K3O A;  1XNA A;  4WM7 A;  4COY A;  4A41 A;  1A78 A;  1UOJ A;  3O0W A;  3HD8 B;  4W4Z A;  4Y1Z A;  3W58 A;  2K2S A;  1QH7 A;  1AXK A;  1UWW A;  1AZD A;  3T2O A;  5FO8 B;  2PHX A;  1PX3 A;  1V6J A;  4QKF A;  3VKN A;  4BQ5 A;  2V4A A;  4XIL A;  1ZVF A;  3IBM A;  1FPN 1;  3JXS A;  2BNO A;  2YFU A;  1O59 A;  1N1V A;  2ZGQ A;  1Q56 A;  4DPN A;  1VE0 A;  1ND3 A;  1EPZ A;  4D0Q A;  2J42 A;  3IPV B;  4OHZ A;  4CDU A;  1CJD A;  2WWJ A;  4LKD A;  3B9C A;  1AYN 3;  2ZX0 A;  1LOG A;  3IDC B;  3V0B B;  4A42 A;  2R6Q A;  3RNS A;  1BK1 A;  1RUE 3;  4DY3 A;  1DIW A;  5CFC A;  4LBN A;  4ZY9 A;  1G9A A;  2DU0 A;  3B69 A;  1RUN A;  1CD3 G;  3AKR A;  1ZRF A;  1CAU B;  5BNP A;  5C9A C;  1FXZ A;  2Z2S B;  1J58 A;  3EMR A;  3MIG A;  4QGM A;  4YVS B;  3MFC A;  5FZD A;  1KRI A;  3KMH A;  3M3Q A;  4CUC A;  3AP6 A;  2B8M A;  2DCK A;  2DFB A;  5LK7 B;  2C4X A;  2HWD 2;  4LKF A;  3W21 A;  1LES A;  4NHY A;  2VZP A;  5I0U A;  2OS2 A;  2VTF A;  2YC2 A;  1AL2 3;  3VZL A;  4OQ8 A;  1AUY A;  1SPP B;  1F8V A;  3VZJ A;  3AVS A;  4OHY A;  5CNA A;  4JVA A;  4S2F A;  1X8E A;  4UW3 A;  4P00 B;  1ZNP A;  5F7U A;  5LA0 A;  3UES A;  5E89 A;  4QQL A;  5F8P A;  5A3L A;  3EYP A;  4LBK A;  1KXG A;  3ZFF C;  4XJ8 A;  1PX4 A;  3ECQ A;  2HWD 1;  3MIB A;  1NUK A;  3VN4 A;  1XQN A;  4OUL A;  1XYO A;  3H9A A;  5IK8 A;  4CCJ A;  4WV8 A;  2Q8E A;  5JXH A;  3BPZ A;  3L9J T;  3NJZ A;  3OY8 B;  1G7Y A;  3MUY 1;  5BNN C;  2WNV B;  3BAL A;  1JMU B;  1HX6 A;  4DY5 A;  2EVX A;  3M1H A;  3G7D A;  4XJ9 A;  5C5U A;  2Y64 A;  3BU7 A;  1OFN A;  2ZGL A;  1JYT A;  1PO1 2;  1RIN A;  2HWB 2;  3QCW A;  3RPQ A;  2XDV A;  1DF0 A;  2BUK A;  4LQR A;  4E2G A;  4E8D A;  2RR1 3;  5CAD A;  1AHS A;  1JU3 A;  3N9P A;  2ES3 A;  3POW A;  5JMC A;  5F5I A;  3I2I A;  4L0P A;  1WD3 A;  2VZ1 A;  5DDJ 3;  2AEN A;  3P5B A;  3POE A;  3V0B A;  1HV1 A;  2DBI A;  4QDQ A;  2R1D A;  5CKQ A;  1LTE A;  4XFG A;  4LBM A;  1REE A;  1CAU A;  1YYN A;  1PO1 1;  2HWB 1;  4IE0 A;  3ENR A;  1YQ2 A;  2AGS A;  4YVS A;  3CO2 A;  3H1M A;  1W8U A;  4HSL A;  4JQR A;  1LOF A;  3UKV A;  3E6D A;  1AJK A;  4NE9 A;  2KA3 A;  2A6W A;  1JZ7 A;  3LSE A;  4UFJ A;  4BH9 A;  3WDY A;  3HR9 A;  1W6O B;  3AM2 A;  3E5Q A;  5FLJ A;  2NPI A;  4GQ7 A;  5HBA A;  1GZW B;  1SFY A;  2GSY A;  2VUJ A;  1MQT B;  2CY6 A;  1MR5 A;  4EZ4 A;  4XJW A;  3SIT A;  4R4X A;  4CPB A;  4LKE A;  1OF3 A;  4Z82 A;  1LEC A;  3HEI A;  2XKP A;  4AFC A;  5JMO A;  1C1L A;  2VOX A;  4COZ A;  4YM1 A;  1AX2 A;  4I01 A;  4M00 A;  4DS0 A;  2V72 A;  1DFQ A;  2A6Y A;  2P37 A;  1VBD 3;  1QIQ A;  3H8U A;  1NLR A;  2P5B A;  4IL7 A;  1ZBE 3;  3OY8 A;  1QJZ A;  5EHD A;  5FK8 A;  2WNV A;  3WHU A;  5I0R A;  2WLP A;  5EZW A;  3GZE A;  1NX9 A;  1PIV 1;  1XBF A;  3RS6 A;  3U78 A;  3VBF B;  2FDH A;  2VU9 A;  1QGL A;  2D6L X;  2WJS A;  5FZM A;  1CPN A;  4COV A;  2NZ9 A;  1BVP 1;  2QQN A;  4XQW A;  5I8S A;  4LK7 A;  1VAV A;  3MIC A;  2ZHK A;  1ZZ9 A;  1AXZ A;  2WSV A;  2CV6 A;  5AVA A;  4NHM A;  1ND3 C;  1GMM A;  1YWK A;  4IGO A;  4J1W A;  4CU8 A;  5C4W B;  3N9M A;  5JIU A;  3LGR A;  1BHG A;  4CDU C;  1AR6 2;  3RJ2 X;  1UYZ A;  5ANQ A;  1UMH A;  5E8A A;  3WDT A;  1WLC A;  5K0U A;  5KHH A;  1V6O A;  2WQZ C;  4R9C A;  3NAP C;  1ENS A;  4CYD A;  2JDM A;  5CFC C;  1UY2 A;  2HKX A;  2W3J A;  2CAU A;  2WA4 A;  4KL1 A;  1R1A 3;  5BNP C;  1XU1 A;  1VAK A;  2W08 A;  2AEZ A;  5LEK A;  5JR7 B;  1UQX A;  2ZZQ A;  1JOD A;  4IEQ A;  5KHJ A;  4W8J A;  5D21 A;  3NKT A;  3UJQ A;  2HWC 2;  2WIN B;  1V6N A;  1BLZ A;  3M70 A;  4LBL A;  3UGG A;  1FAT A;  4GWI A;  2BER A;  5KXE A;  4K8F A;  1GZW A;  3VKM A;  5IUQ A;  3MLK A;  4Q4X 3;  3WQB A;  3H8X A;  1W3V A;  4NIH A;  1C57 A;  1S2K A;  3AKS A;  5FWE A;  2WZR 2;  2NN8 A;  5ACA 2;  5KXD A;  3LAG A;  1RGS A;  1JZ5 A;  3N4M A;  2HWC 1;  3LIH A;  3JD7 2;  1C5H A;  1UU5 A;  4XJU A;  1GOH A;  4XFH A;  1GYK A;  2WUH A;  3N9L A;  2ETE A;  5CU1 A;  3ZYJ B;  1C1F A;  3ZIW A;  5A3T A;  4Z1V A;  1DU3 D;  3HOB A;  3RMX A;  4AI2 A;  4KG0 A;  3VBF A;  5FP8 A;  2W87 A;  4XUR A;  1EAH 3;  2R0F A;  3FMG A;  4K6B A;  2DUP A;  1JUH A;  2WZR 1;  4XBN A;  3WQ1 A;  5ACA 1;  5JDB A;  2WT2 A;  4XMA A;  3DEM A;  3LEM A;  4Q0U A;  4BLI A;  3ROU A;  4P9I A;  3JD7 1;  5A7N A;  3NNM A;  3J7N A;  1TMF 2;  4MOA A;  4A3Z A;  4E4D X;  1N1T A;  2BPA 2;  3MF9 A;  5FTT C;  1NY7 2;  2YPD A;  4MX3 A;  3WP3 A;  5FDB A;  3K4Z A;  1X50 A;  2YGM A;  3POB A;  3Q8F A;  4HK8 A;  2VUC A;  1XNK A;  3MV1 1;  2WFP A;  2W0X A;  2AR6 A;  5EJ1 B;  3MGU A;  2C6S A;  3TN9 3;  4LXL A;  2Y6K A;  2ARC A;  1QJY 3;  3H3U A;  3ZN4 A;  3GDB A;  4XF1 A;  2CWS A;  3UKN A;  4CDX B;  1O7F A;  2BNN A;  2QQW A;  2WZE A;  2YU2 A;  1TMF 1;  4OVE A;  5I91 A;  1OLR A;  3NJV A;  4YVS C;  5F2S A;  1OQD A;  4ZHN A;  4YGB A;  3O1U A;  3A21 A;  2W1S A;  1NY7 1;  2ZX2 A;  1LOF C;  1O4Y A;  4KGQ A;  4P08 A;  4V1P A;  5ANN A;  1I5Z A;  2GN7 A;  3BOP A;  2D6O X;  2WO7 A;  1Q8O A;  3OG2 A;  2G9G A;  3CNA A;  1P8J A;  3AK0 A;  1TME 2;  2KM2 A;  1AX0 A;  1AR7 2;  1OC1 A;  2W5F A;  1KFU L;  3A23 A;  3H1Y A;  1YC6 1;  2GZW A;  1VMF A;  3AZX A;  3OPW A;  4CP1 A;  4LHN A;  1E5I A;  4BMB A;  3WF3 A;  2JEM A;  1YI9 A;  3ABZ A;  5FPB A;  1DGW X;  2WII B;  4XJA A;  4BM8 A;  2DDU A;  1W6M B;  1FI2 A;  4UOJ A;  2W91 A;  1PK6 B;  1MPX A;  1NE6 A;  5LEJ A;  1L7R A;  5BUV A;  2VVF A;  5FJH A;  3AMP A;  1JS9 A;  3MHZ A;  5I0S A;  1HB1 A;  1V6L A;  4NVP A;  1S2B A;  1RHI 2;  5T5O A;  5JOY A;  4XCA A;  4CCN A;  1AR7 1;  2Y38 A;  2QVS B;  3FHA A;  4Y1X A;  3O1M A;  2YPJ A;  3AZW A;  2PHU A;  1SMV A;  3WDW A;  1I5P A;  2WNV C;  1EPW A;  2AUY A;  3SCH A;  3DCQ A;  4F7Z A;  1QNW A;  5FXV A;  4CXX A;  4WVW A;  1LHO A;  2YXS A;  3RZM A;  4NHK A;  3PUQ A;  1LOD A;  2ZZJ A;  2IXJ A;  3CIH A;  3SEE A;  4AQT A;  1UO9 A;  2FDI A;  4FCA A;  4FFI A;  2UWA A;  4TSV A;  1RHI 1;  1TZO A;  4XET A;  2VNR A;  2OA2 A;  5IK4 A;  2BBA A;  3H3L A;  1QJU 2;  4P9Y A;  4UW4 A;  3M3I A;  4QWN A;  5HCH A;  4JV4 A;  1V70 A;  2XGX A;  2EIC A;  5FXW A;  2WAB A;  3EB7 A;  3KQ4 B;  1GNY A;  2DBN A;  5B2G B;  1BMV 2;  1F31 A;  4PT6 A;  5IVJ A;  4QM8 A;  2Z42 A;  5T3N A;  2W68 A;  5J36 A;  3O5S A;  1BEV 2;  4BCU A;  2JG8 A;  1UAI A;  2ZEX A;  1QJU 1;  3NNG A;  3WIN E;  1RED A;  2WRA A;  3C7E A;  4EQV A;  1XSR A;  2PAE A;  5KC6 A;  5JZG B;  1MQT C;  5F5Q A;  4P9W A;  1VBE 3;  5K9Y A;  3THT A;  5J96 B;  1W6M A;  2DUQ A;  2VMC A;  1YNA A;  4W6X A;  5FJK A;  5LRS A;  1U5X A;  2F4L A;  1PK6 A;  1X82 A;  2VXJ A;  4COW A;  1MS5 A;  3VBO B;  2ZGS A;  1BEV 1;  3S7I A;  3KCY A;  2XJT A;  4GAZ A;  3GGL A;  3U07 A;  5CYY A;  3DXT A;  1O3S A;  4H3W A;  3AJY A;  1OH4 A;  2JIJ A;  4YZ2 A;  2BRT A;  3UT0 A;  5GZC A;  3I2F A;  3MUZ 1;  5GLU A;  2DCT A;  1R09 3;  3VBF C;  3I59 B;  1RXF A;  4MGQ A;  3LOB A;  3DL3 A;  2P6C A;  5A3O A;  2D3S A;  4BPZ A;  5CBL A;  3HQX A;  3BIE A;  1Q8Q A;  3T3Y A;  4XDP A;  5EP9 A;  1W8W A;  3B7M A;  5C70 A;  2ZKL A;  5L9B A;  1PMH X;  3VD3 A;  2IXL A;  1O3T A;  2QBX A;  3VLB B;  1K42 A;  2WYS A;  1B09 A;  2H6C A;  4XUQ A;  4RFR B;  4M0N A;  4QX7 A;  2R30 A;  4RR3 B;  5C4W C;  2R32 A;  1UYY A;  4PLM A;  1R08 1;  4CCL A;  1CX1 A;  3GBW A;  1ZBA 3;  2VCM A;  5C3O A;  2D98 A;  2EXJ A;  3OBZ A;  4XUT A;  1GWM A;  3HIF A;  4XF9 A;  5FUN A;  3RI8 A;  3VZK A;  1TNR A;  5FXZ A;  5FUP A;  2CHH A;  2Q0A A;  2G9F A;  4WVV A;  2V5Y A;  2DTY A;  3B3Q E;  4IEZ A;  1CZS A;  1Q3E A;  2IVI B;  3V65 A;  3RRD A;  1C8M 3;  1OH3 A;  1HRV 2;  3RVH A;  3RZJ A;  4LHK A;  1POV 3;  4Q0P A;  4UBH A;  4DEV A;  1OKQ A;  5FV3 A;  3SXW A;  2XG3 A;  1B35 B;  1K5M B;  1JYC A;  3C7F A;  4C0B A;  4RFT 0;  1UOF A;  2YV8 A;  4EE2 A;  1DZT A;  2G9Z A;  1N47 A;  3WR0 A;  1AX1 A;  3U4S A;  4FPJ A;  4HZF A;  1D7P M;  4MGI E;  4N53 B;  3ZVX A;  5JZG A;  4M0H A;  4KNC A;  4ZU7 A;  3POJ A;  4AGR A;  4PLO A;  1KDK A; 
#chains in the Genus database with same CATH homology
 2PXJ A;  4IGO A;  3KV4 A;  5FZD A;  5FPA A;  3LDB A;  3KVA A;  4E4H A;  3N9M A;  3PUR A;  4LIU A;  5FXV A;  4QXB A;  5FZ7 A;  5ANQ A;  3N9N A;  5F2W A;  5FZ9 A;  4C8D A;  3PUQ A;  5FYI A;  5KR7 A;  4Y3O A;  4DIQ A;  2OS2 A;  5FZI A;  3KV6 A;  4GJZ A;  2XML A;  5F3C A;  4AI9 A;  3AVS A;  2YBS A;  3PUA A;  5FY8 A;  5FZO A;  3K2O A;  5FYT A;  5IVC A;  2GP3 A;  5FZ1 A;  4QWN A;  4CCO A;  3PU3 A;  4D6S A;  5FP4 A;  5A7W B;  5FZ6 A;  2XUE A;  5FPU A;  5FXW A;  5FYY A;  5F39 A;  4URA A;  5FYZ A;  3ZPO A;  4DO0 A;  4V2V A;  5IVJ A;  5FZB A;  5A7P A;  4BXF A;  5CEH A;  4CCJ A;  5FY9 A;  5FZ8 A;  2Q8E A;  4NUB A;  4AAP A;  2YBP A;  2OX0 A;  5FWE A;  4QX8 A;  4EZH A;  4LIT A;  4BIS A;  5FYU A;  5FZA A;  4D6Q A;  5A7S A;  3PU8 A;  3N9Q A;  4GJY A;  5FYV A;  4QXH A;  5IVV A;  5FZF A;  2YBK A;  5FP7 A;  3N9L A;  5F3I A;  2XDV A;  4Y33 A;  5A7O A;  4CCM A;  4QXC A;  4TN7 A;  5A3T A;  1VRB A;  4V2W A;  5FY7 A;  5FZE A;  3N9P A;  5FJK A;  4Y4R A;  5FXX A;  5FP8 A;  5IVY A;  5F5I A;  5A1F A;  3K3N A;  4IGQ A;  5FYH A;  5FYS A;  5FY4 A;  4UF0 A;  5ISL A;  4BU2 A;  5LWB A;  4GAZ A;  4LIV A;  3UYJ A;  2YU1 A;  5F5A A;  3DXT A;  5FBJ A;  4HOO A;  5FP3 A;  4HON A;  3N9O A;  5FZH A;  5A7N A;  5FY5 A;  5IVF A;  5FP9 A;  5A7Q A;  2YPD A;  5FPL A;  5FZO B;  5F3E A;  5FYC A;  3PTR B;  3AVR A;  4XDP A;  5A3W A;  5A1L A;  4QU1 A;  4ASK A;  5FZL A;  4CSW A;  4LXL A;  5F5C A;  5A3N A;  5F32 A;  3KVB A;  3K3O A;  4GD4 A;  5FZ4 A;  4QX7 A;  2YU2 A;  5FZ3 A;  2GP5 A;  4IGP A;  5F2S A;  5FYM A;  4CCL A;  5FZC A;  5FPV A;  5E6H A;  4EYU A;  4EZ4 A;  5LW9 A;  5FYB A;  5A7W A;  5FZ0 A;  3OPT A;  5F37 A;  3LD8 A;  5A80 A;  5FUN A;  5FXZ A;  2Q8C A;  3PUS A;  2W2I A;  5F3G A;  5FUP A;  5FWJ A;  3AL5 A;  4CUG A;  5IWF A;  4D6R A;  2OQ7 A;  3OPW A;  3PDQ A;  3AL6 A;  3KV5 A;  5IW0 A;  2VD7 A;  3ZLI A;  2P5B A;  3KV9 A;  2OQ6 A;  3RVH A;  3NJY A;  5FPB A;  5LY1 A;  5K4L A;  5FV3 A;  5FZG A;  5FY1 A;  3U78 A;  2WWJ A;  5FZK A;  2WWU A;  4CCK A;  4UF0 B;  5FJH A;  5FY0 A;  5FZM A;  5LY2 A;  3U4S A;  4XDO A;  3DXU A;  4CCN A;  2Q8D A;  5IVE A;  2OT7 A;  5IVB A;  5A3P A;  2XXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...