4URAA

Crystal structure of human jmjd2a in complex with compound 14a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
349
structure length
349
Chain Sequence
b'ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Optimisation of a triazolopyridine based histone demethylase inhibitor yields a potent and selective KDM2A (FBXL11) inhibitor.
pubmed doi rcsb
total genus 109
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4uraA01
5IVJA 2VD7A 3U4SA 4QX8A 5F39A 4QXHA 2PXJA 5FY8A 5F3IA 5FPUA 5IW0A 2Q8EA 4QXBA 3N9MA 5FZMA 2OQ6A 5FY9A 5FY1A 5FZAA 4IGQA 4HONA 5FPVA 5FYSA 5FZBA 5A80A 5FP8A 4QX7A 2YPDA 5FY0A 5A3TA 5FXVA 4V2VA 4GAZA 4IGOA 4AI9A 2XUEA 3N9PA 4NUBA 5FP7A 5FZOB 3PDQA 5IVFA 5FYUA 5FZFA 5IVYA 4IGPA 5FZDA 4Y33A 5A7WA 5FZ0A 5F5CA 5FXZA 2P5BA 3UYJA 4AAPA 2YBSA 2OS2A 4E4HA 2YU1A 3AVSA 4V2WA 5ANQA 3DXUA 5A3NA 5FPLA 4BISA 3KVBA 5FP3A 5FYIA 4DO0A 3AVRA 5FBJA 2OT7A 3LD8A 2XDVA 5A3PA 5F3GA 3KV4A 5FZCA 4CSWA 5FZHA 5FYTA 4LIUA 5FJKA 3U78A 5FYZA 3PTRB 4Y3OA 4GD4A 3PU3A 3PUQA 5FYHA 4CCLA 3KVAA 5F5AA 4CCNA 3KV6A 5FZIA 3N9NA 3K3NA 5FYYA 5F2SA 1VRBA 5FZ3A 5FWJA 3KV5A 2YBKA 3LDBA 4GJYA 5A7NA 5F3CA 4UF0A 2Q8CA 2WWJA 5IVEA 5FYBA 2OQ7A 4LIVA 3N9LA 5F37A 5A7SA 5F2WA 5FUPA 5A7OA 5FZLA 4EZ4A 3ZPOA 4HOOA 3AL5A 2YBPA 4GJZA 4D6RA 2OX0A 5FPAA 4CCKA 3NJYA 4CCOA 4TN7A 4EZHA 4XDPA 2Q8DA 5LWBA 2GP5A 2XXZA 5A1FA 4QXCA 5IVBA 5A7QA 5IVVA 3N9OA 5FYCA 2XMLA 5E6HA 4CCJA 5LY2A 5FZGA 4Y4RA 4ASKA 5FZ7A 3RVHA 3PU8A 4UF0B 5CEHA 2YU2A 3KV9A 4DIQA 2GP3A 4BU2A 5FZEA 5LW9A 5FY5A 2W2IA 5FXWA 5LY1A 3PUAA 4XDOA 5FP4A 5FXXA 5A7WB 5A7PA 5FZ6A 5FPBA 4LXLA 3K3OA 5FJHA 5FY4A 5F32A 5FZ1A 5FZOA 5ISLA 5A3WA 4QU1A 5FWEA 5FUNA 4EYUA 5K4LA 3OPWA 5F3EA 5FZ4A 5FZKA 5FYMA 4D6SA 4BXFA 5IWFA 4CUGA 3PURA 3N9QA 5FP9A 4URAA 5IVCA 5FZ8A 5KR7A 3DXTA 4LITA 3AL6A 4CCMA 4C8DA 3OPTA 3PUSA 4D6QA 5FYVA 2WWUA 5A1LA 5FV3A 4QWNA 5FZ9A 5F5IA 5FY7A 3K2OA 3ZLIA
chains in the Genus database with same CATH superfamily
3GBFA 1QJX3 1RUG1 2B46X 3GGLA 4I0WB 5FY8A 5JOYA 2OZ6A 2WUHA 4A6SA 5CVRA 1AXKA 1OPOA 4XZPA 2P3IA 4AOCA 1HXS2 3KQ4B 4LE3A 1HB2A 1S0GA 4MLOA 5JI7A 4QX7A 4BWOA 1HKDA 2RJKA 2R043 1PM7A 2YPDA 3GF6A 2VG9A 2FD8A 1UY0A 4CDQB 2VTXA 3I2IA 1TMF2 5T5JA 5C6CA 4QX5A 1EV11 3IPVA 1XXNA 3IKWA 1SPPA 4QD2A 4R8HA 1UPIA 2A70A 5K0UB 2X8KA 2CY6A 1QJU2 4GWMA 5FO8B 2RS31 3O1PA 4NVPA 1DP0A 2PHDA 4C0HA 1FV2A 2DFCA 3UGFA 4M3CA 1OT5A 4EN9B 2RG4A 3SQOA 3CF6E 3SH4A 4DO0A 4JQTA 3EHKA 3A0NA 1O3QA 2WZPP 3KGZA 1XYPA 1NQDA 2ZTNA 3BGAA 3VDAA 2UWAA 2WBKA 1IQDC 4G9SB 4QDRA 4QDSA 3ZXEA 4TLFA 2A3WA 1QJY3 1T6BX 3T4VA 3N9NA 1J58A 4JHTA 4K9SA 2QKDA 1VBC2 1POV0 4ZONA 3ON7A 1HB3A 1RUF1 1VRH1 1NCQB 3O1UA 5CG9A 2CGOA 3OYWA 1PK6C 2QQVA 5FZLA 3ZPOA 3THPA 1D4VB 4QB1A 4QPGC 1LOEA 3VGIA 4AF9A 4Y5SA 2VMHA 1NE4A 5LB6A 1CX4A 5K7PA 1F15A 4HBNA 2JD9A 1RUF3 5E6HA 1RHI1 5LY2A 3S30A 2FHRA 1Q8OA 3PU8A 2YU2A 2Q1ZB 3NAPA 1Q8QA 4RGAA 4W6XA 4N43A 3IM0A 2XJVA 2WNUC 1K42A 3RS6A 3FBMA 1W6PB 1H0BA 2B4KA 1A6CA 1FV3A 1UAIA 5EXOA 5DMYA 1F35A 5FLJA 4LBKA 2YY1A 5FIXA 3O1VA 1OURA 2RDQA 4FPJA 5K4LA 2YC2A 2WFF1 3ACGA 3VUOA 5JSRA 1JZ4A 4X6RB 5DZEA 1QH6A 2UYBA 2GNBA 1BLZA 4URAA 4U36A 3IMMA 1SG3A 1COV1 2BBAA 4LKSA 4P9YA 1BXHA 2ZX3A 2O8QA 1YHFA 5FK7A 4OHXA 4FCAA 1JYIA 4L92A 4CEYC 5FY7A 4XAAA 5LATA 1PHMA 2WT1A 1OF4A 5JSPA 2RM23 3AP7A 2ZGUA 4UFJA 1TZOA 2ZEYA 5LRRA 1JUHA 1HQWA 2OVUA 4HPKA 4NIIA 3SISA 3K77A 1WW6A 1S4CA 4ARXA 1AXYA 3BPSA 3IDEA 2A3XA 2GNTA 2D6KA 4HPKB 4A2UA 3DCQA 1UZZA 1GOGA 1WWYA 1CGPA 1K5JA 3OJBA 4AI9A 1RUNA 3LEGA 1XE7A 4XF0A 2HWB2 2B42B 1CAUB 4Q0PA 3O14A 4Y33A 4CVUA 5HBAA 1OKOA 1X50A 2X29A 5FXZA 1L7LA 2WT2A 5JXHA 3AZWA 5LK7B 3PVEA 4NWWA 1ZRFA 1CONA 3WNLA 5C8CB 3TRSB 3C8XA 1Q8PA 2GMEA 1IS6A 1RUD2 4B1MA 1AR91 3MHZA 1DQ0A 2VOVA 1W39A 5A3UA 3V0AA 3FWEA 2VUCA 3AP5A 4HVRA 2XUMA 4YM0A 1ZZ6A 5AFEA 3CZUA 1RUC2 1SLCA 1W8UA 2E31A 4K1ZA 3T1LA 5BNNC 2XJQA 3WG3A 5FYZA 4HSJA 5F9TA 4GB33 1ZREA 1ND2A 3N7LA 2W46A 3SHRA 2WL1A 2O8OA 4E2SA 5FZ3A 5I0TA 3P6BA 3ZR6A 3R4UA 2ZX0A 4XXAA 2GC3A 1DU3D 1TNFA 1W6MB 3K4AA 3ZYFA 3EB7A 4L8QA 1QNYA 4BLJA 3GBWA 3HQUA 1WCUA 3MW4A 3WDYA 2Y6LA 1S0BA 1XRUA 4IEOA 4CXWA 4RGKA 2LRPA 2HYXA 1CVNA 3PHMA 1QOSA 1NLRA 4XFCA 5HPOA 2FCTA 1QJX2 1ZM1A 1QDOA 2R071 3I2DA 2VZ3A 1N47A 1NLSA 1LGNA 3U0ZA 2E7TA 2R30A 3K46A 3BUCA 2R0HA 1PMHX 3QH6A 4Y4RA 1NQJA 3BODA 3DYPA 4IETA 1SFNA 2PHRA 2WYSA 4NPMA 1FNZA 4W50A 2ZA9A 1V9U1 3FE5A 4XIKA 3G7DA 4CDWC 4GB32 1IKQA 1ND2B 1JU4A 4COUA 1MS0A 1GWKA 3M3OA 1QF3A 3B02A 3I3MA 1D0GA 4YVWA 1U5YA 4GMP1 1PO21 2RMU1 1DZTA 3A23A 4ES8A 1GICA 1W2AX 4HANA 4A41A 1IPSA 3KS7A 3CMGA 4N90A 4YVSC 2BEOA 4XE9A 3P1IA 5ANNA 2UY9A 2Z69A 4X8PA 1JI6A 1HB1A 4XOGA 4AQ2A 1LHVA 3AL6A 4AHXA 2JDZA 5KHKA 3WG4A 2DVDA 3J9SA 4RQPC 3U07A 5JOZA 4P9IA 2XONA 1GP6A 2QBXA 4J1WA 1JYWA 1PIV1 1UYXA 2WO7A 3HNMA 3CQOA 5FMBA 5CG8A 2J1AA 1H2KA 4XQWA 2BU9A 1SPPB 4MHUA 3LOIA 1AJOA 4FPGA 1E5SA 2VVFA 3T2OA 1OQEA 4IE0A 4BQYA 4TZDA 4ZPIA 4BMEA 5FZMA 3WX5A 2OQ6A 1VB2A 3DEMA 1OVSA 4TWTA 3SITA 4K40A 4M00A 1AUYA 4XTPA 3L2HA 2K2SA 1FPN1 2VMEA 3D0JA 3MI8A 5CZKA 3AZXA 4XIOA 2FDKA 2DBNA 2VOXA 3O1MA 1WLDA 5DQ0A 3ZMNA 5JAXA 3GHMA 1OH3A 1REDA 4FP2A 1QJZA 1S0IA 4Q0QA 1B09A 3GZUC 1PNGA 5FZDA 4ASLA 4RN5A 4OVEA 1AL21 1KDMA 2W3JA 1UKRA 4CEYB 5IT6A 3JBG1 2JXAA 4L0PA 2OS2A 1H30A 2VCMA 5IUQA 2QZ3A 5C9AB 1BBT2 5HCBA 3NV3A 1C4RA 2D5FA 4BHPA 3NAPC 2UYAA 4NHYA 5E89A 5F3GA 4LBLA 3RZKA 3ZSMA 3M3CA 2V09A 1YI7A 4YNIA 5DZFA 3THDA 4XFIA 4AW7A 4Y3OA 3B00A 4Q0VA 4AVAA 2IUWA 5IK4A 4Q1PA 4IV1C 4FPKA 1E5RA 5FZIA 4AVTA 3O0VA 2WNOA 1O7FA 2TEPA 4CEWC 4FTBA 2WZ8A 5AVPA 1KITA 1OOPC 3W58A 1PX3A 2VUAA 1LKNA 1F9KA 4RGGA 5FYBA 1PO12 3X29B 3POJA 4B3NA 1VBD3 1DGRA 2PLV3 4RHV2 3WNNA 3WNKA 1ASJ3 4AHZA 4DZGA 2JDHA 5EJ3A 5HV4A 4TLGA 1KJLA 3ZMOA 2G9ZA 4IEYA 2RJ2A 1EY2A 4P08A 4CCOA 3LB9A 5C4WC 3C7HA 3J8F1 4YM3A 4YWAA 5L9VA 2CU5A 3SKVA 1X33A 2ADEA 5D1IA 1MS8A 2WAAA 2VQTA 2WS91 5A32B 3ZFFC 1W6OA 3IB3A 4Q1RA 4QQHA 2VTXJ 5T54A 3D82A 3RVHA 1QQP1 1SFYA 4Q4V2 4RD7A 1HV1A 5I0SA 3KCYA 2PAMA 1GANA 1S1AA 4KBZA 5FXWA 4AWDA 3LDKA 4IEUA 4Y24A 1GWMA 5FMOL 5FZOA 2P6HA 2WS92 1AR73 3I3EA 1HRI2 4YYOA 2HWC1 4I0AA 5FQ0B 1A8MA 1ACCA 1ZZBA 3TYJA 3TEZA 2W1UA 3JD73 1ULDA 3AMMA 4FFGA 3T3YA 3WQ7A 3H9AA 2EXKA 2JG9B 1RL3A 1V6JA 1W6QB 4G4FA 1DQ1A 2GNMA 3KF3A 2PHLA 1W9FA 3OBRA 4UT5A 1SBDA 1ZA7A 5C3QA 1TVGA 3JZVA 4LK6A 2RDSA 1ONAA 1VMHA 1LESA 1UY2A 1PGSA 4DNYA 2OIIA 2R7EB 2H0BA 2PQSA 4Z2AA 4CTEA 2VOTA 2VNGA 4Q4X1 1LGBA 1RUOA 4CU6A 3ME2A 1LOAA 5FPUA 2R16A 4YARA 5KHJA 3PUIA 4OI0A 4BPZA 3JQXA 4BQ3A 1RB8G 4HONA 4XHBA 3ZXGA 3ZXLA 4CXXA 1RINA 3MV01 1NZIA 1XSQA 4OYUA 4JKLA 3AYDA 1AR82 1KFXL 4XMIA 3ZFFB 1DQ5A 3ENRA 5ACA3 1PK6B 3B01A 4QX3A 5JR2A 1FX5A 2GMMA 3DGTA 3M3QA 2JWPA 5FZFA 3USUA 4N8MA 3KGLA 2P34A 2VZUA 2ZGRA 4XF4A 1Z0HA 4DEVA 1RIRA 4JQRA 2PELA 1QJY2 3ZFGC 1PGW1 1AYN2 4XJZA 2WLQA 2PAEA 2MNGA 4LR4A 4KNCA 3AVSA 1BHGA 2E33A 2ZGMA 4YW3A 3FBYA 5H9QA 4FBFA 2ZZJA 3A22A 2ZXQA 4KWJA 5HV0A 4XZUG 5A1AA 5CFCB 2VUJA 3WF1A 2HEWF 3FFZA 3ZN6B 4XCBA 1HB4A 1F4HA 1GQHA 3VBFA 1NY71 3UGHA 3FHIB 1VRH2 2MEV3 4XCAA 5DZGA 2DCJA 4E4SA 2BYVE 4CDWB 2DTYA 1YO8A 2WJSA 1R1A3 3R4SA 5IJRA 4AZZA 4LO4B 3IBMA 4YVSA 1OLME 5I0RA 3RQ0A 1CAXB 4CDQC 3TWIA 3O1RA 2VQAA 2ORZA 2IXLA 1W0NA 3I54A 1VBA3 3G6JB 3DKWA 4JGYC 3OF1A 5A6ZA 4K7JA 1FI2A 1VBC1 1XNDA 4GA9A 1YJLA 2QQJA 4LK7A 4Z8BA 2VOKA 1H8TB 5L7OB 2GP5A 1ND3A 2PHXA 1QHDA 4QXCA 1CAWB 2XLGA 5L9BA 3LPGA 3MPPG 3UKTA 1TMF3 4ASKA 5A3OA 5LCWL 5AFBA 1UU6A 3KV9A 3TEWA 5FR3A 1K5MA 3HT2A 4BU2A 4DUWA 5LW9A 1C1FA 3H8UA 4BQWA 2W2IA 3IAQA 4BE3A 4H55A 2VCBA 1VBC3 5CFCC 5CKQA 5C4WA 4O9EA 3T0AA 1Y43B 2ZHLA 2JE7A 4GULA 1Y3TA 5FMOS 2WC2A 3W59A 2ILMA 4KU7A 3ZFEB 2V5YA 5BNNB 2EA7A 3C7OA 2WDBA 3MIFA 3ZN6A 4D6SA 3OG2A 4HLTA 3DECA 2JG8A 1VBB1 1DFQA 1QXPA 4HL0A 1DGLA 1G7YA 5IAVA 4BQ1A 3OGVA 3RZHA 4R52A 2QQUA 3JUUA 4XFAA 2PFWA 5A1LA 1V70A 1UZYA 5EFUA 2HWB3 1GNZA 3VD5A 1YFUA 4F8AA 1JZ8A 3NNGA 3RI9A 4TYSA 3TNPB 1XNAA 4LORA 3U4SA 3KHBA 1LULA 3O1TA 2PXJA 2I07B 4L11A 1LOGA 4UW4A 1U0AA 1AZDA 2NN8A 2VMDA 4XFGA 3ZOIA 1NYWA 1GZTA 2E51A 4BOWA 2JB4A 5E88A 4C0BA 1C5IA 4XDQA 4BIOA 2UU8A 3B9CA 5CFDC 2ZX4A 4JGZA 5FP8A 3I3BA 2ARXA 5KWRA 3SEPA 5FY0A 4KQ7A 3VDDA 4GAZA 4XHXA 3WG2A 1RUC3 2J22A 2XHKA 3ZYHA 1ASJ2 2DF7A 1RC6A 3S5AA 2HJIA 3AYCA 3B9IA 3MW2A 3OY8A 3WW2A 2XVLA 2X5IC 3IIIA 3LGRA 2JG9C 4UFKA 3WUCA 1WW7A 4C91A 3GZAA 2AUYA 4KH9A 4NPRA 4EWEA 1RJ8A 1EPZA 1MEC2 1SEFA 3H7JA 5T52A 4XBQA 3THCA 1I6XA 1RMU3 5EV7A 1R1A2 3JB8A 3AM2A 1PK6A 1Q56A 1GP4A 3KWVA 1J3PA 3OGJA 4YM1A 3AB0A 1GZCA 3HD8B 1XBFA 2XDVA 5CYYA 4CP9B 1SLIA 5C5TA 3E1F1 2DWRA 3SXWA 3MZHA 2FCVA 2VZQA 1J84A 1FNYA 1RXFA 3AK0A 3PJYA 4J1XA 3SCGA 4YFZA 1JZ6A 2PA7A 3RMYA 1ZVFA 3BOPA 3KT4A 4OLLA 2A6WA 5GZDA 5CFDA 3QBQA 2VU9A 5T5LA 1UYZA 4QKDA 4RYDA 5BY5A 5F3CA 4FPYA 5I8SA 4UW6A 4XILA 1SHWB 1L3JA 2CHHA 3VBSC 2OQ7A 2EAKA 2WQ4A 1SCSA 5F6KA 1VJ2A 4BK4A 5AC91 4EWAA 1OLMA 4RSUA 5GM0A 4HOOA 4B7EA 3SMHA 3HJRA 4NR1A 4EZHA 1LU2A 4XDPA 4UAPA 3I59A 2GDFA 3HQRA 2BDRA 4XBNA 5JLVA 1NG0A 4CXYA 3FFQA 4YPJA 5BYNA 5FYCA 2DBIA 2Y38A 1XE0A 3CBNA 2DUOA 3OBAA 2W9XA 4XW3A 3AYAA 5EYYA 5KXEA 1LOBA 4LLOA 2B9VA 1I5ZA 1PO22 2E7QA 2YHJA 3VKMA 1R64A 2OZJA 4FPHA 4NROA 2P4EA 1W6OB 3HWJA 2CAVA 4B4PA 3K3OA 4I3PA 4C1XA 3VL9A 1ULCA 3NL1A 5ISLA 1YQ5A 4HMZA 1GQPA 2CV6A 2GN3A 2R062 2PLV1 4NAMA 5SV8A 4Z92B 3Q9OA 1XJAA 4Q4V1 4LBMA 2QQWA 5FZ4A 1NLQA 3H8RA 1KEXA 3H8OA 2MHFA 3MFCA 3QOPA 2QDRA 5IWFA 4BZ4A 4BH9A 1XB9A 5IVCA 3WDVA 4AE2A 2WQ8A 1O4ZA 4Y1ZA 2PHUA 1YYNA 3AMHA 2VTFA 3IN9A 4N7UA 2Y6KA 1OA4A 2D3PA 2W08A 3B93A 5LASA 3VZOA 4DS0A 1YFXA 3RPQA 4NIHA 1VMFA 4RS5B 3O1OA 1YC61 3BKZA 1HXS1 1ZRCA 4AVVA 3GJBA 3KCXA 1VBB2 4DQAA 3M8LA 3VBFC 3K2OA 2YGMA 4RS5A 1OQDA 3E97A 4LHSA 2BFUS 2BJSA 3J26N 3VBOC 1N1VA 2P3KA 2GZWA 1VE0A 3HAGA 1RVF2 1HQNA 1WCSA 3OGRA 4XMAA 1CJPA 1PMJX 4OHZA 2DDUA 3LA7A 3VKFC 1LENA 2ARAA 1MEC3 2PHTA 5LBCA 5FYSA 1W04A 2Q5TA 3IDBB 4NMIA 4LHKA 4UXAA 4ZY9A 2AZ5A 5JXJA 1PVC1 4JRLA 4BYYA 3CJIC 1JXNA 3E6BA 2GALA 5FXVA 3O12A 5DUVA 2A6ZA 2GMPA 3OGGA 1UU5A 5C9AA 4ZXKA 1G9DA 1APNA 1AR61 3FN9A 2ZMKA 4NUBA 4D8MA 5C71A 1JHJA 1FOD1 4MADA 2RR11 5FREA 3V64A 1S2EA 4QPGB 5FLIA 2D93A 1QQP3 1MACA 2A71A 1RUC1 3POFA 3ASIA 1UMZA 1Y4WA 3OCPA 4F7ZA 3VBSB 3ZSLA 2TUNA 3VD3A 5C9AC 1PO13 5FBJA 1REFA 1QJY1 4A7KA 3JBG2 3BB6A 4KWKA 3GALA 3Q8AA 2W68A 4X6QB 2Z79A 2QTWB 2TNFA 4P02B 4YVWB 1IQAA 2Z4FA 3DF0A 2XJSA 2TBVA 4GXLA 4KGGA 1UY4A 4AI0A 2F6BA 1QJFA 1AR92 2A75A 2QJVA 1CAVB 3CDZB 4FSJA 5F5AA 2G4IA 1W9YA 2RMU3 4I02A 2Z5WA 4LO8A 5HCFA 1UD1A 5FMDA 4LBQD 1VPHA 1RGSA 1JOBA 3Q8FA 1Q8SA 3DN7A 4MO3M 1H2NA 1PO23 1G9FA 4AI3A 2AGSA 1U5XA 2J1EA 1EPWA 4XJ9A 4IESA 2QQIA 3M3IA 4ZU7A 3L2YA 4JGYB 1ULEA 3J4UH 2I2SA 5I8YA 3CZJA 4JV4A 4AL9A 5IVVA 5JMOA 4NJ4A 4XETA 5AC92 4XUPA 3RDIA 3WNMA 3RZZA 2P3YA 1UU4A 1AHSA 4LMFA 3VBSA 4AHWA 5KC6A 1XNKA 1VMJA 4R9BA 3JBG3 2D40A 3NJVA 4UWDA 3WDXA 3QACA 4COWA 1LODA 1IZ3A 1XC6A 4ORFA 2Y6FA 5LY1A 5FP4A 1OFNA 1TME2 4OHVA 3OY8B 4RFT0 1QJX1 1RUG3 2R072 4RQPB 2Y26A 4BK5A 4LBJA 4P9JA 4Q26A 1D4M2 3FLPA 5J1XA 3DPRA 5FWEA 3AKSA 1Z7S2 1GR3A 2JECA 1W9WA 1FPN3 2WO1A 4A7ZA 3NWKA 2Y60A 3U37A 2WN3A 1GNHA 4K3UA 1QY4A 4P14A 2D6LX 1JH5A 1VBA1 4GB31 4QHOA 3A4UA 3N9QA 2W47A 4JDOA 1KD7A 5BV6A 4OHYA 1X7NA 4QX2A 4HK9A 5C8CA 1TG7A 3VKNA 3Q8CA 4CCCA 4IEPA 4C8DA 2HWE1 3LEIA 4EJRA 2XL9A 2VQ0A 1DLLA 1YNAA 5JI9A 2ZMNA 4XABA 2DCYA 2J1SA 3NV4A 5JVVA 3NQHA 1HN0A 1DCSA 4MYEA 5IVJA 2DURA 5F39A 4QXHA 4BB3A 2FCUA 2PHWA 2ET7A 4O65A 3SEEA 4BLIA 1K3IA 3O0XA 4GQ7A 3C7EA 3RFRA 2VZPA 2NP0A 2FZ2A 3HOBA 2ZKNA 3VD4A 2WYFA 2ZPXA 3BU7A 3PIJA 3FX3A 4IXLA 4K8RB 1GKBA 5GLWA 3RJ2X 4Q8KA 1CIWA 1RITA 2XUEA 4FFIA 4YZ2A 2B8MA 1G9CA 1DHKB 4KI5M 1PZ9A 4P5HA 5FYUA 3VD7A 1W03A 3ABZA 1YQ6A 2QVSB 5J48A 3T2QA 4LKFA 4IE5A 3POIA 3FUQA 3MEPA 3NMBA 4FPEA 3WZ1A 1POV1 4UBHA 1O5LA 2Q30A 1SACA 2BW8A 3LA2A 1B35C 1JN2P 1ASJ1 1UN1A 1LJ7A 2VZOA 1JS9A 4MH0E 5FP3A 5LEKA 3JD72 2BV4A 4H7LA 1F5FA 1H8TA 1QMJA 2JX9A 5A3PA 1I1EA 1SLBA 2B45X 5DAQA 3NNJA 1PX4A 4LIUA 1RUJ3 3GYDA 4CUAA 2D6OX 3AJYA 1JZ7A 1RUD1 3ATGA 4E4DX 4KWUA 3NNMA 2V73A 4Y20B 3KVAA 3WQBA 4YM2A 5FYYA 1O4YA 2RS52 4AYUA 1URXA 1VRBA 4QM8A 4XJAA 5IHRA 1VALA 3LIGA 3W5NA 4WVVA 5A7NA 5IK5A 1R091 4OCTA 5TSWA 1VBD2 5HCHA 1ZRIA 3OD0A 4OI4A 5F7UA 3N9LA 4OZOA 2AACA 1GOFA 1YXWA 2VE1A 3KF5A 4HN0A 5LA1A 2ZEZA 4K8FA 2EAAA 5LK5A 1BKZA 4QQ2A 2FDGA 4D6RA 5EJ1B 1OSGA 2OX0A 4QB6A 3WW4A 1EUTA 1SMVA 3F2ZA 3AC0A 1JYVA 3GCWA 4K1YA 4OFGA 4Y22B 4RS5C 1POQA 4AXOA 4Y5Z0 1C8NA 4I30A 4M3CB 3ZXJA 3UJQA 5D8AA 2CNAA 1OOPB 1H8TC 4UF0B 2ZGSA 3FZ3A 5CEHA 2D43A 3VHOA 4V1PA 3QLQA 4N43B 1SLLA 3MIGA 5JR7B 2XJRA 5GKAC 3UKVA 4BIFA 5A70A 1FOD3 1U5IA 2DVBA 5KHGA 2WS93 2BZDA 3H3LA 3THTA 4LBNA 4A45A 4E2QA 1PGL1 4XQDA 3R0RA 5JIUA 2XKPA 4UFLA 4FI9A 4JDNA 4AEDA 4GKYA 4LEJA 3RNSA 4QPIA 1M4WA 2ZEWA 4CYDA 2Q8OA 3H3UA 5BUVA 4MXWA 2HWF1 2BRTA 3DXTA 4Q4Y2 3BTYA 2XJPA 2ZGQA 4LITA 5KBFA 1JODA 2JDPA 4CCMA 1PVXA 1W8WA 2VO5A 2ZHKA 4YVSB 2BOJA 5D21A 3VBHB 1LOCA 5KHIA 1ZBA3 4EE2A 1D7PM 4IE4A 4QPIC 3AXDA 5JMCA 1XU1A 4CDWA 3FUOA 4NN0A 3LKJA 3VZKA 1OPMA 4Q4W1 2QQOA 1RUD3 2VL4A 2WNVA 1X36A 3LOBA 5J7MA 1V6MA 1RMU2 2Q0AA 5FY1A 3SH5A 2VZRA 5FPVA 2JDNA 1FOD2 4CPBA 1J3RA 1V9U3 2WFF3 2XR4A 4QPIB 4XC9A 1OD5A 1AYN1 4LULA 4Q4X2 2LM3A 4O7XA 1FMD2 3L9JT 2Y64A 3ZFEA 4IGOA 2HWF3 2ATFA 2HKXA 3VBOB 1UIKA 5FZOB 4NIGA 1VIWB 1SZBA 4IW3A 5C4WB 4OI1A 1H9WA 1W90A 3ILRA 1AL23 1D2QA 2C0ZA 2EIBA 2IXKA 4FFFA 4LBOA 3RZMA 3LA3A 4XYXA 3EQEA 2WT0A 1OXCA 2C24A 5H9SA 5C3RA 2FDIA 2WZR2 2RDRA 5CKMA 4AVCA 4XUNA 1HRV3 2IVJA 5SV5A 4IL7A 5ANQA 3MO4A 5EZWA 5FKCA 3N4MA 1GV9A 1O59A 1UMIA 1QXRA 4KU8A 4YFWA 5G05L 1RUH1 4CU9A 4MUVA 3AVRA 1VAVA 5T55A 3TN92 2AEYA 4I0BA 1N3OA 1ZZ7A 3MFAA 4FOWA 3ELNA 5A3LA 5BNOC 3BI3A 4Q5OA 2BP6A 2RS32 3I4IA 4S2DA 3E6DA 3TBDA 4CSWA 5A6YA 2ENRA 1R092 1S0CA 3H7YA 2FQPA 1YIFA 3UV9A 1DGWX 4YVWC 4RA0A 1XOYA 2CWMA 4CCLA 5FYHA 3GZEA 1IS5A 2G9FA 4YGBA 3LEMA 1LNSA 3T09A 1AX0A 2QQLA 5F2SA 4PIXA 1I3HA 4QPWA 5BNOA 3P5BA 1MS1A 4IE7A 4YG0A 1JYNA 2G9GA 3V65A 3KM5A 3NRUA 5GLZA 1KJRA 2YGLA 1AF9A 2WLPA 3ZPYA 3RZGA 2JB8A 4TSVA 1O3RA 1BMV2 4AFBA 3AX4A 4OQ9A 1RUE1 2WABA 4IDZA 3FLRA 4XQ4A 1N1YA 2NYYA 3AYEA 4XF3A 2WQZC 3UNPA 3PUHA 3VBFB 2QQKA 4Y1XA 2WZR3 4TN7A 2LROA 5FOJB 3NKTA 3OUHA 1UXXX 2LTNA 5A1FA 2XBO2 1X8EA 1BMV1 3N9OA 4ZU5A 5T3NA 3WNXA 3DUIA 4XUQA 5EWSA 2W91A 1UF2C 5FMCA 2PLV2 2Y6HA 3GBGA 4NPLA 3EBRA 3ZSJA 1ENQA 4EROA 5FPXA 2VXJA 2O14A 3AFGA 4WVZA 2H0VA 3POEA 3TOJA 2WRAA 3J8F2 4AGGA 3WDUA 2XBO1 1ENXA 1OBNA 1F2NA 1R081 4LHNA 5EP9A 2YPJA 4Y20A 1ZBA2 2VVDA 1COV2 4WM8A 2AENA 4AK3A 1W28A 4PDWC 5A33A 2CGPA 2EICA 1WMXA 4YW1A 1IPKA 1S2BA 2JDKA 5KXCA 2R6QA 4UFHA 3BIWE 2QQNA 3CIHA 3D8CA 3ZYIB 4COZA 2VJXA 1M06G 3ZFGB 4H14A 4YW2A 4NHKA 5FP9A 2BBVA 1D4M3 3ZKYA 4XPVA 1RYYA 1P8JA 2W52A 2YUEA 4CDXB 4DB5A 5C8CC 5JUVA 1FYUA 4IV1A 4CEWA 4XF9A 2A6VA 4XFBA 2WFF2 4MGZE 1QOTA 1CIYA 1TE1B 5DUWA 3IDAA 4D6QA 2ZGLA 2XB6C 3I2GA 2HWF2 1J83A 3ZLIA 1AR81 3USSA 4R9AA 3S6PA 5DAWA 4PF5A 4BJ0A 1HRI3 4N9IA 4BA6A 5IYYA 1S2KA 4LTAA 4A4AA 2DVFA 1UO9A 2FMDA 5FZAA 3UJOA 1V6IA 4AEKA 4MXVA 4LNVA 3ILNA 3OD4A 4YZ5A 1BQPA 3ZXDA 2J1RA 1PGW2 4PI2A 5I0DA 2V72A 1HDKA 2QCSB 2RM22 5KHHA 3ZXAC 4DINB 1Y9QA 3H42B 4MVTA 4V2VA 5JZGA 5JCTA 2JICA 1V6LA 4P9LA 4BQXA 1ULGA 1JZ2A 1XSRA 4D7TA 3KB5A 3M3EA 4K21A 2FBEA 2XGXA 2DCTA 2RJLA 3PNAA 4HN1A 2XLFA 5CU1A 3E5UA 1UL9A 4YSFA 2PAKA 1F8VA 1A78A 2PYTA 4PI0A 3Q8BA 4ATFA 2EVXA 3BTAA 3KZ4C 4IV1B 1UYYA 4CEWB 3WF2A 4PLMA 4CDXA 1TMF1 1AR62 1RUH3 3NSTA 3KVBA 5GZFA 5H9PA 4WV8A 2C6SA 4PJYA 3RRDA 1GNYA 2QUOA 1U5ZA 2HEVF 2VW1A 2WN2A 1YJKA 4MV2A 4PIYA 1MEC1 1Z78A 5FZCA 3RGBA 4LUMA 1ULPA 4E9KA 2ID4A 1O4TA 4GH4B 4RR3C 5A3MA 4WM8B 3M4FA 3IAPA 2Y6GA 1ST8A 3DPRB 4GD4A 1WGPA 3WQ0A 4R4XA 2J1VA 4QKNA 4JC1A 4FOQA 1QGLA 1EAH3 2XOMA 5JXGA 1UY1A 4YZ4A 5J96B 4IERA 1GZWA 1AYN3 2D97A 4Z82A 3T0DA 1V6OA 5DN2A 4Q0SA 3GNEA 5JXIA 1MS9A 3WR0A 2R042 5E16A 5A7SA 4JX0A 2NQYA 1WCQA 3VZNA 2GH2A 3LAGA 2OKXA 5EIYB 2ZABA 4A6OA 2YBPA 4GJZA 4AVSA 4ET7A 5IK8A 5DAVA 2VULA 3AKTA 4CCKA 4DFSA 1LB2A 1Q3EA 2VH9A 2RVAA 1V9U2 1F4AA 3N7MA 3ITQA 1WLCA 4DRVA 5FOBB 3D0SA 4P00B 4Q4V3 1EV13 2UWCA 4Q29A 4JKMA 3GJAA 1ZBA1 2J42A 3SC7X 1NUKA 2VW2A 2FDHA 1QH7A 3HVDA 2R061 4NHMA 2VUDA 2E32A 3IMNA 3N3HA 2GP3A 3AKQA 4WVWA 1C28A 1PZ8A 2R1BA 2XWJB 4OQ8A 3ZVXA 5FCCA 3WF4A 3D3AA 4C1WA 2OUHA 5FXXA 2BGCA 3H1YA 3I8TA 3UT0A 1CAUA 2ZACA 1C8M3 4ARYA 1XPWA 1OUSA 2PN5A 4D0QA 5J3UA 1JW6A 1WZXA 3T1MA 3DV8A 3LSDA 4MGKE 4EYUA 1YLLA 1Q43A 1SQ4A 2RR13 4TXWA 5GLTA 4F3JA 3C7GA 4FPLA 2BTVC 2IXCA 2LW8A 1X9TA 1XYNA 1BEV2 1SCRA 1UMHA 1OH4A 4JHZA 4WZFA 3ZYPA 1JTZX 3B94A 1WMDA 1HRV2 2IXJA 1QDCA 3C2UA 3BCWA 1WW5A 2HBUA 4UW3A 3IT8A 3N36A 2X09A 4LQRA 1H9PA 3CJIB 5APAA 3ZX7A 4UOJA 5C70A 1PM4A 4HK8A 4QPGA 3WF3A 1DZRA 1GFF2 2ZMLA 4PF1A 2A6YA 3OUIA 5GALA 4LUKA 4QGMA 1GU3A 2HWE2 1VBE3 2W92A 5DXDA 3WUDA 1SFPA 3LE0A 5KXDA 5HXVA 1F31A 5I91A 1FATA 1JYCA 3EJKA 1WD3A 3D4KA 5BNPA 5BXXA 4NHLA 3I3DA 1ZBE3 5FDBA 5IFPA 4D7SA 1SLTA 2A5ZA 1JZ3A 3AXEA 3I97A 1BBT1 4BM8A 4E2GA 1J59A 3DKQA 2Y8KA 1RMU1 4NHXA 1UNBA 4IGPA 2PQQA 1VR3A 5GLUA 3UESA 3K4ZA 4L2NA 1YRZA 3RYPA 1J1TA 1I9RA 2P5BA 4CP0A 3PJQA 3DL3A 3AZYA 5DUUA 5IFTA 1KXGA 1NY72 1UOGA 2JKXA 3ZYJB 4CA9A 3C3VA 4S2FA 2JIGA 3VKOA 4ZHNA 5DUXA 5C5UA 2K9ZA 3ACHA 1JUIA 1W2OA 1CPMA 2XHNA 3BALA 1OD3A 2FDJA 2OT7A 1MPXA 3AMQA 2MEV2 2RS11 2WA4A 1BZWA 1IS4A 4GALA 1Y9GA 5FZHA 2NM1A 2B5HA 1H2LA 4GMP0 1S0EA 5FJKA 1NCRA 3UL2A 1KRIA 1ZX5A 2NMOA 3WP5A 2VCCA 3WHTA 1EYBA 4UW5A 2ZZQA 1JZ5A 3OYWB 3PUQA 1NOVA 3MF6A 3KV6A 1W6MA 1CQ9A 4NIAA 2YBKA 4YZ1A 2Y0OA 3FHQA 5FPZA 4M4RA 3HMYA 3POWA 5D8AB 3UETA 3ACLA 3PIGA 3O5SA 1DYOA 5F2WA 5GZCA 4Y22A 2ETEA 5F5QA 3AL5A 2P1BA 2RS51 1ALYA 1LHOA 3NJYA 3WCRA 2VNVA 3U14A 1W05A 4ZU4A 1MZ5A 2AH2A 2JDMA 2VNRA 2XXZA 4NRQA 1TME1 2J1UA 1UPSA 5DG2A 1S0DA 4OI2A 4I01A 4HVQA 4NWVA 4RHV1 1RUE2 3D5OA 1UYPA 3NV2A 2CGNA 3Q8EA 4FO9A 5FZ7A 2EIEA 4DIQA 1RUI2 1JBCA 1V6NA 3M70A 2OA2A 4INDA 3N7JA 4WM7C 2XPJA 1AX1A 3RG0A 5FY5A 3VD9A 5HCAA 3PUAA 1A3KA 1JMUB 2PMWB 1NZCA 2VZVA 4PLOA 4Y26A 5FJHA 3GXUA 3AP6A 3DPRC 3MYXA 4XURA 4XVHA 4AGRA 4MG2A 4WM8C 4Y1UA 2FZ1A 3POGA 4NRPA 2I45A 5FUNA 4XXPA 5F3EA 3K75B 5T50A 2HBTA 2HWD2 2RE9A 2XJUA 2XQRA 4NAOA 3FJSA 3VKLA 3LFMA 2A3YA 2VC9A 2DU1A 3EMRA 4RFRB 1ODNA 5KR7A 2BNNA 1MQTB 4MGQA 4IV3C 3ES4A 1VAMA 3U11A 3TAYA 2HWD1 3OGSA 3OPTA 1UQXA 5B4NA 5AVAA 5CFDB 2WNUB 3IZOA 1GMMA 2C1FA 2QFEA 4AEMA 4Q8LA 4GWNA 3ZYGA 4QX8A 4AFAA 1AYM3 2R063 4AQTA 5IW0A 3HR9A 3U4XA 2VECA 2HWB1 1D0HA 5FY9A 5CB7A 1HW5A 4QX1A 3BVCA 5BNPB 2YV8A 3OTFA 5DABA 3INAA 4NE9A 2GC2A 2X10A 4LE4A 4YW7A 4Y4YA 1QWRA 1SDDB 1JU3A 5ABJA 3CKHA 2Z2SB 2QE3A 3ZO0B 3TEXA 3OEBA 4O9GA 4JZRA 1CZSA 5IVYA 4YW5A 1US3A 5K0UA 2E7AA 3ZKUA 3I2FA 4BQ2A 2VCAA 4P9GA 1JOJA 5F5CA 1LGCA 2R0FA 1VBB3 3H50A 3LWCA 4MGYE 2VGDA 1FMD1 1SDWA 1IKPA 1Q5OA 2C4XA 4IV3A 3W21A 1W8NA 4CCEA 2GC0A 3T0BA 3V0BB 2DFBA 1MQTA 2R49A 4P9XA 1YCIA 1QJU3 3H1WA 4PBPA 3T2PA 1CAWA 1NXD1 4W6WA 4W4ZA 3U75A 2XG3A 4LO6B 3MGUA 3ZFGA 3AP4A 4AI1A 3KV4A 5CA6A 4E4ZA 3KSCA 4IEVA 4PDWB 3U78A 2IWGB 3MLKA 5G04L 5A33B 1VLNA 1OF3A 4AAXA 3PU3A 1VP6A 5EJZB 5A6QA 1C5HA 3F95A 3I2JA 2P3JA 3RMXA 4Z1VA 2VMIA 3VLBB 5C33A 5LZ6A 1H1IA 2LUWA 5E1RA 2AEZA 3V56A 2IXIA 3I7DA 1G6NA 2IVIB 4ASMB 2WWJA 4LPLA 2ZAAA 3LQCA 3EYPA 5FUPA 2ZHMA 5FO9B 3VHRA 1MZFA 1MZEA 1PIV3 2GNDA 1RUI1 3KT1A 3MLLA 5T5PA 1W06A 2CDOA 3B69A 4OHWA 4AGVA 2ZGOA 3HT1A 4XTMA 4JCKA 5C7GA 4CCDA 2H6CA 4QT6A 5LWBA 1OHFA 1MR5A 2V4AA 3POBA 1R093 3RWNA 5L73A 1H1MA 4XACA 2YC0A 1HRI1 2YXSA 4M0NA 1CAXA 4DOUA 1QU0A 3MDPA 3T30A 2IFRA 2RMU2 1ZRDA 1BK0A 3KCCA 1AR83 3ES1A 3O0WA 3VBUC 4CU7A 2VZTA 4AI8A 3WD5A 3ZIWA 2JKBA 5A7WB 2WKKA 2A7AA 5D2AA 5FPBA 3VBHC 2JG8C 4ISRA 2Q4SA 2BNOA 2LALA 4Y5TA 3LFIA 1BCXA 3A0KA 3WHUA 4J25A 4DXSA 1IHMA 4Y1YA 3E5QA 3CNAA 2OPWA 1MS4A 4GH4C 4RR3B 3ACIA 3B7MA 5I0UA 3MV11 4M4PA 5CFCA 1W2UA 2D6PA 2ES3A 2VPVA 2N7GA 4QKBA 4CDUA 1RUG2 2R073 3RWKX 4H3WA 5JOXA 2XBO3 4C90A 1HV0A 1WUVA 2NLRA 4X8NA 3HBKA 5FBZA 4E8CA 5GJ6A 2D44A 3ACFA 3NW4A 1DIWA 4EN7B 2JIJA 2KD7A 3AMNA 4QWNA 1BEV1 1LHWA 3HBZA 1UZ0A 4QAWA 3JCIA 3HN3A 4XF1A 2YZ4A 4J6GA 4SBVA 4XFFA 4YGCA 1WW4A 5GLVA 1CPNA 5KC5A 3RZLA 1JYTA 4QU2A 1COV3 4F83A 1KFUL 2EIGA 1REEA 1W6QA 3LCPA 2A73B 2UY8A 3KD4A 5FAXA 3ZFFA 2XVGA 3WDTA 4BDVB 4AVBA 4OUEA 2ZOEB 4PBOA 4Q4X3 3HN1A 1ZBE1 4KMQA 1MZ6A 4IEXA 4CRQA 2WZR1 5A3TA 1XNCA 1I5PA 3OBZA 2KA3A 1LHUA 5FQ0A 2WNVB 4P5YA 2IXHA 3MPBA 5DG1A 5FP7A 1RUE3 2OPKA 3M1HA 3MIEA 4IEWA 5JSOA 4H2AA 2VW0A 4FPCA 5DAXA 3JD71 4EQVA 5KXBA 1KS4A 2YB7A 1ZBE2 4FQ4A 2DUQA 1GQGA 2ADDA 2D98A 3DYOA 4JKKA 4MX3A 4ZZ5A 3ZN5A 1AR71 3MLJA 1BYHA 3MICA 4FAGA 2WO3A 3OBTA 5LA2A 2ZHNA 5A32A 1W9TA 4BISA 3AKRA 1K5MC 2QDNA 2NZ9A 2BOIA 4MXWB 1W0OA 2EXIA 2JG9A 2EALA 3AZVA 1STMA 3WNPA 1C57A 2C9KA 2RV9A 4OZXA 1UZVA 2W0XA 4W8JA 4META 3BOWA 4CCNA 1DYKA 5B2GB 3K3NA 4N43C 5K9YA 4S2HA 4PHZA 4GJYA 4AFDA 4L97A 2ARBA 3IIAA 1AJKA 2OUJA 1ULFA 3WXPA 3WSOA 2D6MA 3NO8A 4DPNA 1B35A 3KMHA 2D3SA 1NA1B 2WSUA 5I8TA 4GIQA 4JDMA 5L7OC 2XJTA 1LECA 4WVMA 1NA1A 3T08A 5CISA 3RJRA 4COVA 4XFHA 5IVBA 1CZTA 1UZWA 5HXMA 4GMP3 3WP4A 4CCJA 5IATA 3W5MA 3MUY1 5DDJ2 1Z7S1 5FKBA 1U12A 2BGPA 4W65A 5FZEA 1N3QA 3TEYA 1X9PA 3NJXA 3MW3A 5FFOC 1VAKA 3OEAA 2HH9A 3AP9A 2WNEA 3W20A 4CU8A 2XKOA 1D2SA 3EXUA 4IEQA 1LU1A 3NJZA 1QIQA 1NCRB 1WMEA 3VL8A 4FXGB 3PMSA 3RZJA 4I2OA 2I74A 4EN0A 4CP9A 4Q2FA 4PQ9A 2HYKA 2D6NA 4MHRA 4IEZA 4YZ3A 3WW1A 2VBBA 5LRSA 2K0GA 3VV1A 1OLQA 4GZ9A 3R05A 3CL1A 3CJXA 5H9RA 1JOPA 1TNRA 4IQPA 1IS3A 1KDKA 1QKQA 1OLRA 1YUDA 1ND2C 4FXKB 4OUSA 3QCWA 4CZSA 2WWUA 3PVBB 4MOAA 2JDAA 1NX9A 2R32A 2D3RA 1VBA2 2C5DA 2A6XA 1UW8A 5FV3A 3S7IA 2W1SA 1HN1A 5IK7A 2F17A 4LBQA 3S0MA 4FVVA 2NMNA 1T6GC 2VD7A 4UI9L 1GWLA 2XL7A 4JRAA 4LA2A 1PVC3 3TNQA 5F3IA 3T2TA 4M3CE 4O61A 2YDEA 1LOFC 1RJ7A 3CO2A 4YG3A 4QHBA 1W9SA 1ZRRA 3GHNA 1MS3A 4YW6A 4FOVA 4RHV3 4FQZA 4YLZA 4LLFA 2Q1FA 2GN7A 4LO7A 2UWBA 1DQ4A 1NE6A 1RVF1 1R1A1 2Y34A 1SLAA 3PDQA 2PHFA 2RS53 4CEYA 3WLUA 5A7WA 1JYXA 2BFUL 2L9LA 2MEV1 1Z7S3 1XE8A 3AZZA 1GZ9A 4AAPA 3WP6A 4KG0A 5CBLA 1CJDA 1UXZA 2KM2A 1JHNA 1R1ZA 2VAUA 3E5XA 2V4VA 3PVNA 3VZJA 2CWSA 5FPLA 3ZXKA 4NO4A 3RI8A 2BWCA 3ZR5A 2JG8B 4LKDA 1DF0A 1PMIA 2RR12 1UY3A 2AYHA 2BQPA 3LD8A 1FT9A 3QH7A 4AFMA 5JPNB 4LOSA 5FRAA 1BEV3 1AR72 4RR3A 1AXZA 1W3VA 5FLHA 1AVBA 2VZ1A 3PTRB 2W1WA 3ZFEC 1XYOA 2R041 3AJZA 1GLHA 4MSVA 2RS13 3R4DB 1OKQA 2WZEA 2JDYA 2A1XA 4YW4A 2W95A 1WCKA 1E5IA 4WM7B 4OUMA 1S0JA 1POV3 4UF0A 3ZIXA 3RYRA 3I2HA 2WSVA 2WNVC 2C26A 4A7YA 1W0PA 5C3PA 1DQ2A 3E6CC 1Q8VA 1XU2A 1AL0G 4EZ4A 3MIDA 4PDWA 1UX7A 1MVQA 1O5UA 4LJHA 5M0TA 4ZZ8A 3CU7A 4BCUA 3K4DA 3NV1A 1N3PA 1OVPA 3O7OA 1DBNA 4HT1T 5A7QA 2WAOA 1CZVA 3FC0A 2XMLA 3NNFA 4AFCA 3I2OA 4KL1A 1W8OA 1YIPA 2UURA 3V0BA 5ACA2 1OI6A 1CD3G 2C9AA 2D7FA 1OC1A 4AR2A 1A8DA 1IG3A 4YGEA 5CAZA 5EHDA 5J98B 2BPA2 4OULA 2E9QA 4Q4Y1 4BMBA 2B39A 5I93A 2CTVA 5DDJ1 3AMPA 4QU1A 2H6BA 3WCSA 5FTTC 3WV6A 5ABJB 1G9AA 5F6LB 1DZQA 2HWC3 2VMCA 1HX6A 4GH4A 3OPWA 4WBBA 3J7NA 5FZKA 4CPBD 5C8WA 5L36A 3EO6A 2X05A 1EUUA 1WLWA 3C7FA 3APBA 2VXRA 4N9HA 3ZXFA 4E27A 4NIDA 1QXJA 3WT3A 2DCZA 2W5FA 4ES9A 4UFIA 1VB4A 5L19A 2JE9A 5GZGA 2BWAA 4L9BA 5DPNA 3I2KA 3IWZA 3ROUA 2HLEA 2J1TA 2VQUA 4CUCA 1W6NA 2V5DA 1VRH3 5JDBA 5F5IA 2HEYF 2G19A 3J8F3 3HIFA 4FPFA 5EQUA 1W6NB 5FK8A 3SCHA 1W8ZA 2B7YA 1C8M1 1NAEA 2RM21 3VDDC 3ST7A 1GUIA 4QMAA 2VBDA 2R1DA 3VDDB 1WKYA 4K20A 4BXSV 3H0OA 1BK1A 1MS5A 3K51A 1DYPA 1HJGA 4Y1VA 1FMD3 1WA6X 3ALQA 4BQ5A 2P6CA 1YQCA 2IFWA 5A80A 3V0AB 4LT5A 4FOYA 1H6XA 1LHNA 4QPYA 4N53C 1V6KA 3WY6A 1WCDJ 3BPZA 5K8SA 1W2TA 2ZEXA 3MF9A 4IV3B 4AI2A 5IVFA 1UOJA 4B29A 3A21A 4ONUA 1G8WA 1W6PA 1ZNPA 1NXMA 4ZS2A 4HSLA 3VBRC 1H2MA 1OA2A 2DCKA 2DVAA 1GSLA 3NAPB 4LOTA 1OMIA 1ZZ9A 4YGDA 4V2WA 3U10A 1O6UA 1W8FA 1W8TA 4JTOA 4SLIA 3K48A 2YROA 4XUTA 3VZLA 1CWPA 2HWD3 1CESA 4HZFA 2DVGA 3LPFA 1W99A 5A6XA 4CUBA 1NCRC 2CDPA 1G9BA 1HQLA 1TEIA 1RUF2 2VY0A 2KR2A 1K12A 2EXHA 1PO11 3BTXA 3WP3A 5JWPA 2RHPA 3ECQA 2ET1A 4FAHA 2O1QA 1LTEA 4B7KA 1NCQA 1W3XA 1FXZA 2BERA 2WNUA 4HKWA 5EPAA 2CL2A 4IUGA 1O8SA 4XJ8A 3LDBA 3LDRA 4FP3A 4N53A 1K5MB 4CP1A 3WNOA 4DUVA 3ZYBA 1T2XA 4FPOB 5A7OA 1IGOA 1AR63 2RDNA 4CP2A 2SBAA 4E8DA 2GU9A 2QQPA 2ERFA 4XUOA 1NCQC 3POSA 1ND3B 4COYA 5F1RA 3VBRA 3O1SA 5L7OA 4MZUA 4UFMA 1NA1C 1SBEA 5LA0A 3KQRA 3JQWA 1PZ7A 2DYCA 4ITCA 4PCRA 3WOGA 1GOHA 1WMFA 4H7MA 2DV9A 4DUXA 2ZGTA 2SLIA 2W87A 5EYXA 3U1XA 4Z2WA 4HG6B 4URTA 4FTSA 1EAH2 1LCLA 4QQPA 1YQ2A 4WZCA 2IZWA 2VZSA 3I3QA 3LZZA 4PQQA 4L99A 4XDOA 3ETPA 5FUIA 5FZ6A 4LXLA 5FZ1A 3ZSKA 2ZBJA 3POYA 1Y9MA 4DRRA 2RS33 1DGWA 4JTNA 4CE8A 4OMCA 3CLPA 4DY3A 1ENSA 5LBBA 4PIZA 3KHCA 1BVP1 1RUJ1 4KG8A 4XJWA 3VBRB 3ZDSA 4KBBA 4BQ4A 2JJ6A 4LKEA 1AYM1 4HKLA 2YFUA 1D4M1 1Y7BA 3UKNA 1C8M2 1OFSA 4FT8A 4JVAA 1W8HA 3FHAA 4CDXC 5HI0A 1O91A 4Q4W2 4B8EA 3VN4A 4N53B 4QHZA 3NVCA 2E26A 2ZJCA 4GWIA 1DLCA 2ZS6B 2G1MA 4ATEA 2ORXA 4MGTA 2WO2A 3WDWA 1ND3C 1R083 3WF0A 3USUB 3S57A 3R6SA 1YFWA 2E6VA 2GC1A 4D3WA 1N1TA 3KLSA 4CDQA 2BVBA 4HXCA 1DGRN 4QXBA 2Q8EA 1WD4A 1ZYBA 2EIDA 1ZZCA 1PIV2 5FO7B 4IGQA 3SKJE 3ZM8A 3GCXA 4ZXEA 5FZBA 1IOAA 3VHNA 1C1LA 1NT0A 1KGYA 4HFSA 4QDQA 2YC4A 5GZEA 1KQRA 3N35A 3BYWA 4P9WA 4EN6B 2J7MA 3JB4C 4MGIE 3PLQA 3SNMA 1DQ6A 2CAUA 3HNBM 1VBE2 2K46A 1TQ5A 1N1SA 5CADA 1FPN2 2QZ2A 3CJIA 3UYJA 3IPVB 4E4HA 2Y33A 3SCFA 3VBHA 4I09A 2YU1A 2W1QA 4K6BA 4R9CA 4A42A 1UOBA 2VOWA 2ZAHA 3LF7A 3WG1A 3DXUA 1UWWA 2EF6A 2HWE3 1VBE1 4D7YA 1AR93 3FLTA 3ZDVA 4B4RA 5A3NA 1DDLA 2YYOA 3PTYA 5ERLA 1AL22 2Y0IA 3PMEA 3T4HB 3UGGA 2CSGA 2WR9A 4B1LA 3J7LA 3LEKA 4DEQA 1E5HA 5J36A 1OUXA 4AEDB 1V0AA 2WIIB 1XNBA 4PT6A 3WVJA 2FDFA 3OB8A 1K45A 4XJUA 4M0HA 1LEMA 4AHYA 4KWLA 1WA4A 3H3ZA 4RQPA 5C3SA 2XQXA 4D69A 1HJFA 3OSDA 2W94A 4DY5A 2WFPA 2VR4A 5FWJA 3MBWA 4WM7A 3VBUA 3WQ1A 2OW4A 2JE8A 4R9DA 5IVEA 1OOPA 3PVOA 4R4ZA 1X82A 4N7IA 3BIEA 3AFKA 5JOWA 5DAPA 3VHPA 3LIHA 3I59B 4QM9A 2E63A 4YRDA 3VZMA 3QD6A 4XEZA 4AG4A 2MPFA 2VVEA 1WBLA 4NRMA 1VBD1 4UBGA 1GP5A 3MIHA 4JGZC 4Q0UA 1RXGA 2Y6JA 3WEZA 1OQ1A 3FL7A 5FZGA 4A3ZA 1PGL2 3HNYM 2BGOA 4AEJA 1L7RA 1WBFA 2ZGNA 4YG6A 3HQXA 4OMDA 3ZSEA 3P3PA 5BNPC 1YFYA 4Q4W3 3ORJA 1C3HA 1CAVA 4DXTA 5A7PA 3BTZA 1PNFA 1MVEA 5FY4A 3BU0A 3MUZ1 2ARCA 5F32A 1BBT3 4QQLA 1KS5A 4D94A 4KGQA 2JDUA 3PL0A 5CKNA 1QQP2 2DU0A 1LEDA 1EAH1 2VMFA 5LA9A 4EWDA 1QJEA 1H4HA 1RUI3 4BXFA 3H1MA 5BPXA 4QQOA 4CUGA 1BVVA 3PURA 2Q1MA 5JPMB 2E53A 4FTEA 1B35B 3RYKA 1RTVA 3TN93 2HWC2 1OA3A 2QQMA 3ZN4A 3SLIA 1GZWB 4PLNA 1RHI3 5FYVA 3W9AA 2X5IA 5B4XA 5BNQA 4M3CF 3OOXA 4JAAA 5K0UC 1GBGA 1HIXA 2X5IB 2JEMA 1V00A 3CEWA 3NNLA 4EV0A 1WLTA 2QNKA 3CHXA 2XH6A 2DTWA 1UOFA 1YI9A 3J7MA 3KT7A 3GDBA 5JZGB 1J1LA 3LSEA 3HPNA 2ZX1A 2GSYA 2AREA 5JZGC 3N9MA 4EN8B 1YEWA 4JGZB 2WA3A 3N7KA 1EV12 5D8AC 1LR5A 3OUJA 3NKGA 5CIRA 1ENRA 3P3NA 3AKPA 1IPJA 4ISQA 5J09A 3IDCB 2P17A 1QJU1 4GKXA 4A3XA 2YG0A 1E57A 4NOTA 2OYZA 1A34A 2Z42A 4IE6A 5DDJ3 2P37A 3N9PA 5IAXA 4MGSA 1O8PA 2YFZA 2BVVA 3TN91 3B5LB 1GYKA 5FZ0A 3VDCA 2RS12 2ZGPA 3GM8A 4QKFA 1ZZ8A 2CYFA 2YBSA 1CN1A 1ZA4A 1HXS3 3GZTB 1XNTA 3ZYRA 4B4QA 1LRHA 4G3YC 1F5JA 2XLAA 1S0FA 4ZS3A 5JIAA 4QGLA 1S55A 4TTGA 5FYIA 1FAYA 1XQNA 4U2AA 5F8PA 2ZGKA 1EP0A 4Z07A 1UCXA 4S2GA 2VM9A 1O3SA 2YMZA 2AR6A 4LA3A 1ULOA 1UX6A 2AC1A 4HKOA 5FYTA 2KXLA 5BNNA 3H8XA 5LBEA 5CNAA 1HLCA 1J3QA 1H6YA 2VBPA 2BNMA 4QXKA 4A44A 5ABJC 5LEJA 4QX0A 3VB9A 1RUH2 1W2NA 3S7EA 4LBQB 2WINB 1CR7A 1UIJA 4UYBA 1G86A 1CX1A 2W39A 3HEIA 4FFHA 1O3TA 4DXZA 3KV5A 2NPIA 5LBFA 3URFA 3JU9A 1SBFA 2Q8CA 2DUPA 1US2A 4LIVA 5F37A 4RL7A 4CDUB 4QGNA 3I49A 2WWSA 3WW3A 1AX2A 1LOFA 4ZKTB 4Q27A 2XVKA 3D6EA 1BJQA 5FPAA 5T5OA 2ZCWA 2JD4A 3UK9A 1QOOA 5ACA1 4JGYA 2Q8DA 3RSJA 2ZKLA 2B9UA 2P2KA 3WINE 1R082 3BN6A 3S5QA 4W6YA 1IG0A 1NKGA 5E8AA 4XBLA 4CDUC 5C3OA 3A7QA 2ZX2A 1LAJA 1YWKA 3B3QE 5AC93 2EXJA 1H1AA 4HVOA 4LO5B 4LHLA 2JENA 2GAUA 3JXSA 4QB2A 5J37A 3TB0A 1H8VA 2VNOA 4Q4Y3 2OXBA 4M01A 1RHI2 2D5HA 2XWBB 3SH3A 5A3WA 3VBOA 1X8MA 1RVF3 1TME3 2X53S 2GH8A 3ILFA 4AQSA 1UKGA 4GWJA 3DYMA 4WVMB 5FYMA 1H4GA 3FMGA 1ODMA 2F4LA 2LS6A 3MIBA 4DXRA 3VDBA 5FZ8A 3M7AA 3ETQA 1MQTC 2F4PA 4XAEA 2IC1A 4I3GA 4DMIA 1DG6A 2FMYA 3M2MA 4AEDC 5L9RA 3PUSA 3VBUB 3J7HA 3OPZA 1RUJ2 5BNOB 2O0OA 1QNWA 1QEXA 1YQ8A 4HETA 5FZ9A 2VMGA 4AQ6A 1AYM2 2BUKA 1L7QA 2PTMA 1HRV1 1PVC2
chains in the Genus database with same CATH topology
5IVJA 2VD7A 3U4SA 4QX8A 5F39A 4QXHA 2PXJA 5FY8A 5F3IA 5FPUA 5IW0A 2Q8EA 4QXBA 3N9MA 5FZMA 2OQ6A 5FY9A 5FY1A 5FZAA 4IGQA 4HONA 5FPVA 5FYSA 5FZBA 5A80A 5FP8A 4QX7A 2YPDA 5FY0A 5A3TA 5FXVA 4V2VA 4GAZA 4IGOA 4AI9A 2XUEA 3N9PA 4NUBA 5FP7A 5FZOB 3PDQA 5IVFA 5FYUA 5FZFA 5IVYA 4IGPA 5FZDA 4Y33A 5A7WA 5FZ0A 5F5CA 5FXZA 2P5BA 3UYJA 4AAPA 2YBSA 2OS2A 4E4HA 2YU1A 3AVSA 4V2WA 5ANQA 3DXUA 5A3NA 5FPLA 4BISA 3KVBA 5FP3A 5FYIA 4DO0A 3AVRA 5FBJA 2OT7A 3LD8A 2XDVA 5A3PA 5F3GA 3KV4A 5FZCA 4CSWA 5FZHA 5FYTA 4LIUA 5FJKA 3U78A 5FYZA 3PTRB 4Y3OA 4GD4A 3PU3A 3PUQA 5FYHA 4CCLA 3KVAA 5F5AA 4CCNA 3KV6A 5FZIA 3N9NA 3K3NA 5FYYA 5F2SA 1VRBA 5FZ3A 5FWJA 3KV5A 2YBKA 3LDBA 4GJYA 5A7NA 5F3CA 4UF0A 2Q8CA 2WWJA 5IVEA 5FYBA 2OQ7A 4LIVA 3N9LA 5F37A 5A7SA 5F2WA 5FUPA 5A7OA 5FZLA 4EZ4A 3ZPOA 4HOOA 3AL5A 2YBPA 4GJZA 4D6RA 2OX0A 5FPAA 4CCKA 3NJYA 4CCOA 4TN7A 4EZHA 4XDPA 2Q8DA 5LWBA 2GP5A 2XXZA 5A1FA 4QXCA 5IVBA 5A7QA 5IVVA 3N9OA 5FYCA 2XMLA 5E6HA 4CCJA 5LY2A 5FZGA 4Y4RA 4ASKA 5FZ7A 3RVHA 3PU8A 4UF0B 5CEHA 2YU2A 3KV9A 4DIQA 2GP3A 4BU2A 5FZEA 5LW9A 5FY5A 2W2IA 5FXWA 5LY1A 3PUAA 4XDOA 5FP4A 5FXXA 5A7WB 5A7PA 5FZ6A 5FPBA 4LXLA 3K3OA 5FJHA 5FY4A 5F32A 5FZ1A 5FZOA 5ISLA 5A3WA 4QU1A 5FWEA 5FUNA 4EYUA 5K4LA 3OPWA 5F3EA 5FZ4A 5FZKA 5FYMA 4D6SA 4BXFA 5IWFA 4CUGA 3PURA 3N9QA 5FP9A 4URAA 5IVCA 5FZ8A 5KR7A 3DXTA 4LITA 3AL6A 4CCMA 4C8DA 3OPTA 3PUSA 4D6QA 5FYVA 2WWUA 5A1LA 5FV3A 4QWNA 5FZ9A 5F5IA 5FY7A 3K2OA 3ZLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVJ A;  2VD7 A;  3U4S A;  4QX8 A;  5F39 A;  4QXH A;  2PXJ A;  5FY8 A;  5F3I A;  5FPU A;  5IW0 A;  2Q8E A;  4QXB A;  3N9M A;  5FZM A;  2OQ6 A;  5FY9 A;  5FY1 A;  5FZA A;  4IGQ A;  4HON A;  5FPV A;  5FYS A;  5FZB A;  5A80 A;  5FP8 A;  4QX7 A;  2YPD A;  5FY0 A;  5A3T A;  5FXV A;  4V2V A;  4GAZ A;  4IGO A;  4AI9 A;  2XUE A;  3N9P A;  4NUB A;  5FP7 A;  5FZO B;  3PDQ A;  5IVF A;  5FYU A;  5FZF A;  5IVY A;  4IGP A;  5FZD A;  4Y33 A;  5A7W A;  5FZ0 A;  5F5C A;  5FXZ A;  2P5B A;  3UYJ A;  4AAP A;  2YBS A;  2OS2 A;  4E4H A;  2YU1 A;  3AVS A;  4V2W A;  5ANQ A;  3DXU A;  5A3N A;  5FPL A;  4BIS A;  3KVB A;  5FP3 A;  5FYI A;  4DO0 A;  3AVR A;  5FBJ A;  2OT7 A;  3LD8 A;  2XDV A;  5A3P A;  5F3G A;  3KV4 A;  5FZC A;  4CSW A;  5FZH A;  5FYT A;  4LIU A;  5FJK A;  3U78 A;  5FYZ A;  3PTR B;  4Y3O A;  4GD4 A;  3PU3 A;  3PUQ A;  5FYH A;  4CCL A;  3KVA A;  5F5A A;  4CCN A;  3KV6 A;  5FZI A;  3N9N A;  3K3N A;  5FYY A;  5F2S A;  1VRB A;  5FZ3 A;  5FWJ A;  3KV5 A;  2YBK A;  3LDB A;  4GJY A;  5A7N A;  5F3C A;  4UF0 A;  2Q8C A;  2WWJ A;  5IVE A;  5FYB A;  2OQ7 A;  4LIV A;  3N9L A;  5F37 A;  5A7S A;  5F2W A;  5FUP A;  5A7O A;  5FZL A;  4EZ4 A;  3ZPO A;  4HOO A;  3AL5 A;  2YBP A;  4GJZ A;  4D6R A;  2OX0 A;  5FPA A;  4CCK A;  3NJY A;  4CCO A;  4TN7 A;  4EZH A;  4XDP A;  2Q8D A;  5LWB A;  2GP5 A;  2XXZ A;  5A1F A;  4QXC A;  5IVB A;  5A7Q A;  5IVV A;  3N9O A;  5FYC A;  2XML A;  5E6H A;  4CCJ A;  5LY2 A;  5FZG A;  4Y4R A;  4ASK A;  5FZ7 A;  3RVH A;  3PU8 A;  4UF0 B;  5CEH A;  2YU2 A;  3KV9 A;  4DIQ A;  2GP3 A;  4BU2 A;  5FZE A;  5LW9 A;  5FY5 A;  2W2I A;  5FXW A;  5LY1 A;  3PUA A;  4XDO A;  5FP4 A;  5FXX A;  5A7W B;  5A7P A;  5FZ6 A;  5FPB A;  4LXL A;  3K3O A;  5FJH A;  5FY4 A;  5F32 A;  5FZ1 A;  5FZO A;  5ISL A;  5A3W A;  4QU1 A;  5FWE A;  5FUN A;  4EYU A;  5K4L A;  3OPW A;  5F3E A;  5FZ4 A;  5FZK A;  5FYM A;  4D6S A;  4BXF A;  5IWF A;  4CUG A;  3PUR A;  3N9Q A;  5FP9 A;  4URA A;  5IVC A;  5FZ8 A;  5KR7 A;  3DXT A;  4LIT A;  3AL6 A;  4CCM A;  4C8D A;  3OPT A;  3PUS A;  4D6Q A;  5FYV A;  2WWU A;  5A1L A;  5FV3 A;  4QWN A;  5FZ9 A;  5F5I A;  5FY7 A;  3K2O A;  3ZLI A; 
#chains in the Genus database with same CATH topology
 3GBF A;  1QJX 3;  1RUG 1;  2B46 X;  3GGL A;  4I0W B;  5FY8 A;  5JOY A;  2OZ6 A;  2WUH A;  4A6S A;  5CVR A;  1AXK A;  1OPO A;  4XZP A;  2P3I A;  4AOC A;  1HXS 2;  3KQ4 B;  4LE3 A;  1HB2 A;  1S0G A;  4MLO A;  5JI7 A;  4QX7 A;  4BWO A;  1HKD A;  2RJK A;  2R04 3;  1PM7 A;  2YPD A;  3GF6 A;  2VG9 A;  2FD8 A;  1UY0 A;  4CDQ B;  2VTX A;  3I2I A;  1TMF 2;  5T5J A;  5C6C A;  4QX5 A;  1EV1 1;  3IPV A;  1XXN A;  3IKW A;  1SPP A;  4QD2 A;  4R8H A;  1UPI A;  2A70 A;  5K0U B;  2X8K A;  2CY6 A;  1QJU 2;  4GWM A;  5FO8 B;  2RS3 1;  3O1P A;  4NVP A;  1DP0 A;  2PHD A;  4C0H A;  1FV2 A;  2DFC A;  3UGF A;  4M3C A;  1OT5 A;  4EN9 B;  2RG4 A;  3SQO A;  3CF6 E;  3SH4 A;  4DO0 A;  4JQT A;  3EHK A;  3A0N A;  1O3Q A;  2WZP P;  3KGZ A;  1XYP A;  1NQD A;  2ZTN A;  3BGA A;  3VDA A;  2UWA A;  2WBK A;  1IQD C;  4G9S B;  4QDR A;  4QDS A;  3ZXE A;  4TLF A;  2A3W A;  1QJY 3;  1T6B X;  3T4V A;  3N9N A;  1J58 A;  4JHT A;  4K9S A;  2QKD A;  1VBC 2;  1POV 0;  4ZON A;  3ON7 A;  1HB3 A;  1RUF 1;  1VRH 1;  1NCQ B;  3O1U A;  5CG9 A;  2CGO A;  3OYW A;  1PK6 C;  2QQV A;  5FZL A;  3ZPO A;  3THP A;  1D4V B;  4QB1 A;  4QPG C;  1LOE A;  3VGI A;  4AF9 A;  4Y5S A;  2VMH A;  1NE4 A;  5LB6 A;  1CX4 A;  5K7P A;  1F15 A;  4HBN A;  2JD9 A;  1RUF 3;  5E6H A;  1RHI 1;  5LY2 A;  3S30 A;  2FHR A;  1Q8O A;  3PU8 A;  2YU2 A;  2Q1Z B;  3NAP A;  1Q8Q A;  4RGA A;  4W6X A;  4N43 A;  3IM0 A;  2XJV A;  2WNU C;  1K42 A;  3RS6 A;  3FBM A;  1W6P B;  1H0B A;  2B4K A;  1A6C A;  1FV3 A;  1UAI A;  5EXO A;  5DMY A;  1F35 A;  5FLJ A;  4LBK A;  2YY1 A;  5FIX A;  3O1V A;  1OUR A;  2RDQ A;  4FPJ A;  5K4L A;  2YC2 A;  2WFF 1;  3ACG A;  3VUO A;  5JSR A;  1JZ4 A;  4X6R B;  5DZE A;  1QH6 A;  2UYB A;  2GNB A;  1BLZ A;  4URA A;  4U36 A;  3IMM A;  1SG3 A;  1COV 1;  2BBA A;  4LKS A;  4P9Y A;  1BXH A;  2ZX3 A;  2O8Q A;  1YHF A;  5FK7 A;  4OHX A;  4FCA A;  1JYI A;  4L92 A;  4CEY C;  5FY7 A;  4XAA A;  5LAT A;  1PHM A;  2WT1 A;  1OF4 A;  5JSP A;  2RM2 3;  3AP7 A;  2ZGU A;  4UFJ A;  1TZO A;  2ZEY A;  5LRR A;  1JUH A;  1HQW A;  2OVU A;  4HPK A;  4NII A;  3SIS A;  3K77 A;  1WW6 A;  1S4C A;  4ARX A;  1AXY A;  3BPS A;  3IDE A;  2A3X A;  2GNT A;  2D6K A;  4HPK B;  4A2U A;  3DCQ A;  1UZZ A;  1GOG A;  1WWY A;  1CGP A;  1K5J A;  3OJB A;  4AI9 A;  1RUN A;  3LEG A;  1XE7 A;  4XF0 A;  2HWB 2;  2B42 B;  1CAU B;  4Q0P A;  3O14 A;  4Y33 A;  4CVU A;  5HBA A;  1OKO A;  1X50 A;  2X29 A;  5FXZ A;  1L7L A;  2WT2 A;  5JXH A;  3AZW A;  5LK7 B;  3PVE A;  4NWW A;  1ZRF A;  1CON A;  3WNL A;  5C8C B;  3TRS B;  3C8X A;  1Q8P A;  2GME A;  1IS6 A;  1RUD 2;  4B1M A;  1AR9 1;  3MHZ A;  1DQ0 A;  2VOV A;  1W39 A;  5A3U A;  3V0A A;  3FWE A;  2VUC A;  3AP5 A;  4HVR A;  2XUM A;  4YM0 A;  1ZZ6 A;  5AFE A;  3CZU A;  1RUC 2;  1SLC A;  1W8U A;  2E31 A;  4K1Z A;  3T1L A;  5BNN C;  2XJQ A;  3WG3 A;  5FYZ A;  4HSJ A;  5F9T A;  4GB3 3;  1ZRE A;  1ND2 A;  3N7L A;  2W46 A;  3SHR A;  2WL1 A;  2O8O A;  4E2S A;  5FZ3 A;  5I0T A;  3P6B A;  3ZR6 A;  3R4U A;  2ZX0 A;  4XXA A;  2GC3 A;  1DU3 D;  1TNF A;  1W6M B;  3K4A A;  3ZYF A;  3EB7 A;  4L8Q A;  1QNY A;  4BLJ A;  3GBW A;  3HQU A;  1WCU A;  3MW4 A;  3WDY A;  2Y6L A;  1S0B A;  1XRU A;  4IEO A;  4CXW A;  4RGK A;  2LRP A;  2HYX A;  1CVN A;  3PHM A;  1QOS A;  1NLR A;  4XFC A;  5HPO A;  2FCT A;  1QJX 2;  1ZM1 A;  1QDO A;  2R07 1;  3I2D A;  2VZ3 A;  1N47 A;  1NLS A;  1LGN A;  3U0Z A;  2E7T A;  2R30 A;  3K46 A;  3BUC A;  2R0H A;  1PMH X;  3QH6 A;  4Y4R A;  1NQJ A;  3BOD A;  3DYP A;  4IET A;  1SFN A;  2PHR A;  2WYS A;  4NPM A;  1FNZ A;  4W50 A;  2ZA9 A;  1V9U 1;  3FE5 A;  4XIK A;  3G7D A;  4CDW C;  4GB3 2;  1IKQ A;  1ND2 B;  1JU4 A;  4COU A;  1MS0 A;  1GWK A;  3M3O A;  1QF3 A;  3B02 A;  3I3M A;  1D0G A;  4YVW A;  1U5Y A;  4GMP 1;  1PO2 1;  2RMU 1;  1DZT A;  3A23 A;  4ES8 A;  1GIC A;  1W2A X;  4HAN A;  4A41 A;  1IPS A;  3KS7 A;  3CMG A;  4N90 A;  4YVS C;  2BEO A;  4XE9 A;  3P1I A;  5ANN A;  2UY9 A;  2Z69 A;  4X8P A;  1JI6 A;  1HB1 A;  4XOG A;  4AQ2 A;  1LHV A;  3AL6 A;  4AHX A;  2JDZ A;  5KHK A;  3WG4 A;  2DVD A;  3J9S A;  4RQP C;  3U07 A;  5JOZ A;  4P9I A;  2XON A;  1GP6 A;  2QBX A;  4J1W A;  1JYW A;  1PIV 1;  1UYX A;  2WO7 A;  3HNM A;  3CQO A;  5FMB A;  5CG8 A;  2J1A A;  1H2K A;  4XQW A;  2BU9 A;  1SPP B;  4MHU A;  3LOI A;  1AJO A;  4FPG A;  1E5S A;  2VVF A;  3T2O A;  1OQE A;  4IE0 A;  4BQY A;  4TZD A;  4ZPI A;  4BME A;  5FZM A;  3WX5 A;  2OQ6 A;  1VB2 A;  3DEM A;  1OVS A;  4TWT A;  3SIT A;  4K40 A;  4M00 A;  1AUY A;  4XTP A;  3L2H A;  2K2S A;  1FPN 1;  2VME A;  3D0J A;  3MI8 A;  5CZK A;  3AZX A;  4XIO A;  2FDK A;  2DBN A;  2VOX A;  3O1M A;  1WLD A;  5DQ0 A;  3ZMN A;  5JAX A;  3GHM A;  1OH3 A;  1RED A;  4FP2 A;  1QJZ A;  1S0I A;  4Q0Q A;  1B09 A;  3GZU C;  1PNG A;  5FZD A;  4ASL A;  4RN5 A;  4OVE A;  1AL2 1;  1KDM A;  2W3J A;  1UKR A;  4CEY B;  5IT6 A;  3JBG 1;  2JXA A;  4L0P A;  2OS2 A;  1H30 A;  2VCM A;  5IUQ A;  2QZ3 A;  5C9A B;  1BBT 2;  5HCB A;  3NV3 A;  1C4R A;  2D5F A;  4BHP A;  3NAP C;  2UYA A;  4NHY A;  5E89 A;  5F3G A;  4LBL A;  3RZK A;  3ZSM A;  3M3C A;  2V09 A;  1YI7 A;  4YNI A;  5DZF A;  3THD A;  4XFI A;  4AW7 A;  4Y3O A;  3B00 A;  4Q0V A;  4AVA A;  2IUW A;  5IK4 A;  4Q1P A;  4IV1 C;  4FPK A;  1E5R A;  5FZI A;  4AVT A;  3O0V A;  2WNO A;  1O7F A;  2TEP A;  4CEW C;  4FTB A;  2WZ8 A;  5AVP A;  1KIT A;  1OOP C;  3W58 A;  1PX3 A;  2VUA A;  1LKN A;  1F9K A;  4RGG A;  5FYB A;  1PO1 2;  3X29 B;  3POJ A;  4B3N A;  1VBD 3;  1DGR A;  2PLV 3;  4RHV 2;  3WNN A;  3WNK A;  1ASJ 3;  4AHZ A;  4DZG A;  2JDH A;  5EJ3 A;  5HV4 A;  4TLG A;  1KJL A;  3ZMO A;  2G9Z A;  4IEY A;  2RJ2 A;  1EY2 A;  4P08 A;  4CCO A;  3LB9 A;  5C4W C;  3C7H A;  3J8F 1;  4YM3 A;  4YWA A;  5L9V A;  2CU5 A;  3SKV A;  1X33 A;  2ADE A;  5D1I A;  1MS8 A;  2WAA A;  2VQT A;  2WS9 1;  5A32 B;  3ZFF C;  1W6O A;  3IB3 A;  4Q1R A;  4QQH A;  2VTX J;  5T54 A;  3D82 A;  3RVH A;  1QQP 1;  1SFY A;  4Q4V 2;  4RD7 A;  1HV1 A;  5I0S A;  3KCY A;  2PAM A;  1GAN A;  1S1A A;  4KBZ A;  5FXW A;  4AWD A;  3LDK A;  4IEU A;  4Y24 A;  1GWM A;  5FMO L;  5FZO A;  2P6H A;  2WS9 2;  1AR7 3;  3I3E A;  1HRI 2;  4YYO A;  2HWC 1;  4I0A A;  5FQ0 B;  1A8M A;  1ACC A;  1ZZB A;  3TYJ A;  3TEZ A;  2W1U A;  3JD7 3;  1ULD A;  3AMM A;  4FFG A;  3T3Y A;  3WQ7 A;  3H9A A;  2EXK A;  2JG9 B;  1RL3 A;  1V6J A;  1W6Q B;  4G4F A;  1DQ1 A;  2GNM A;  3KF3 A;  2PHL A;  1W9F A;  3OBR A;  4UT5 A;  1SBD A;  1ZA7 A;  5C3Q A;  1TVG A;  3JZV A;  4LK6 A;  2RDS A;  1ONA A;  1VMH A;  1LES A;  1UY2 A;  1PGS A;  4DNY A;  2OII A;  2R7E B;  2H0B A;  2PQS A;  4Z2A A;  4CTE A;  2VOT A;  2VNG A;  4Q4X 1;  1LGB A;  1RUO A;  4CU6 A;  3ME2 A;  1LOA A;  5FPU A;  2R16 A;  4YAR A;  5KHJ A;  3PUI A;  4OI0 A;  4BPZ A;  3JQX A;  4BQ3 A;  1RB8 G;  4HON A;  4XHB A;  3ZXG A;  3ZXL A;  4CXX A;  1RIN A;  3MV0 1;  1NZI A;  1XSQ A;  4OYU A;  4JKL A;  3AYD A;  1AR8 2;  1KFX L;  4XMI A;  3ZFF B;  1DQ5 A;  3ENR A;  5ACA 3;  1PK6 B;  3B01 A;  4QX3 A;  5JR2 A;  1FX5 A;  2GMM A;  3DGT A;  3M3Q A;  2JWP A;  5FZF A;  3USU A;  4N8M A;  3KGL A;  2P34 A;  2VZU A;  2ZGR A;  4XF4 A;  1Z0H A;  4DEV A;  1RIR A;  4JQR A;  2PEL A;  1QJY 2;  3ZFG C;  1PGW 1;  1AYN 2;  4XJZ A;  2WLQ A;  2PAE A;  2MNG A;  4LR4 A;  4KNC A;  3AVS A;  1BHG A;  2E33 A;  2ZGM A;  4YW3 A;  3FBY A;  5H9Q A;  4FBF A;  2ZZJ A;  3A22 A;  2ZXQ A;  4KWJ A;  5HV0 A;  4XZU G;  5A1A A;  5CFC B;  2VUJ A;  3WF1 A;  2HEW F;  3FFZ A;  3ZN6 B;  4XCB A;  1HB4 A;  1F4H A;  1GQH A;  3VBF A;  1NY7 1;  3UGH A;  3FHI B;  1VRH 2;  2MEV 3;  4XCA A;  5DZG A;  2DCJ A;  4E4S A;  2BYV E;  4CDW B;  2DTY A;  1YO8 A;  2WJS A;  1R1A 3;  3R4S A;  5IJR A;  4AZZ A;  4LO4 B;  3IBM A;  4YVS A;  1OLM E;  5I0R A;  3RQ0 A;  1CAX B;  4CDQ C;  3TWI A;  3O1R A;  2VQA A;  2ORZ A;  2IXL A;  1W0N A;  3I54 A;  1VBA 3;  3G6J B;  3DKW A;  4JGY C;  3OF1 A;  5A6Z A;  4K7J A;  1FI2 A;  1VBC 1;  1XND A;  4GA9 A;  1YJL A;  2QQJ A;  4LK7 A;  4Z8B A;  2VOK A;  1H8T B;  5L7O B;  2GP5 A;  1ND3 A;  2PHX A;  1QHD A;  4QXC A;  1CAW B;  2XLG A;  5L9B A;  3LPG A;  3MPP G;  3UKT A;  1TMF 3;  4ASK A;  5A3O A;  5LCW L;  5AFB A;  1UU6 A;  3KV9 A;  3TEW A;  5FR3 A;  1K5M A;  3HT2 A;  4BU2 A;  4DUW A;  5LW9 A;  1C1F A;  3H8U A;  4BQW A;  2W2I A;  3IAQ A;  4BE3 A;  4H55 A;  2VCB A;  1VBC 3;  5CFC C;  5CKQ A;  5C4W A;  4O9E A;  3T0A A;  1Y43 B;  2ZHL A;  2JE7 A;  4GUL A;  1Y3T A;  5FMO S;  2WC2 A;  3W59 A;  2ILM A;  4KU7 A;  3ZFE B;  2V5Y A;  5BNN B;  2EA7 A;  3C7O A;  2WDB A;  3MIF A;  3ZN6 A;  4D6S A;  3OG2 A;  4HLT A;  3DEC A;  2JG8 A;  1VBB 1;  1DFQ A;  1QXP A;  4HL0 A;  1DGL A;  1G7Y A;  5IAV A;  4BQ1 A;  3OGV A;  3RZH A;  4R52 A;  2QQU A;  3JUU A;  4XFA A;  2PFW A;  5A1L A;  1V70 A;  1UZY A;  5EFU A;  2HWB 3;  1GNZ A;  3VD5 A;  1YFU A;  4F8A A;  1JZ8 A;  3NNG A;  3RI9 A;  4TYS A;  3TNP B;  1XNA A;  4LOR A;  3U4S A;  3KHB A;  1LUL A;  3O1T A;  2PXJ A;  2I07 B;  4L11 A;  1LOG A;  4UW4 A;  1U0A A;  1AZD A;  2NN8 A;  2VMD A;  4XFG A;  3ZOI A;  1NYW A;  1GZT A;  2E51 A;  4BOW A;  2JB4 A;  5E88 A;  4C0B A;  1C5I A;  4XDQ A;  4BIO A;  2UU8 A;  3B9C A;  5CFD C;  2ZX4 A;  4JGZ A;  5FP8 A;  3I3B A;  2ARX A;  5KWR A;  3SEP A;  5FY0 A;  4KQ7 A;  3VDD A;  4GAZ A;  4XHX A;  3WG2 A;  1RUC 3;  2J22 A;  2XHK A;  3ZYH A;  1ASJ 2;  2DF7 A;  1RC6 A;  3S5A A;  2HJI A;  3AYC A;  3B9I A;  3MW2 A;  3OY8 A;  3WW2 A;  2XVL A;  2X5I C;  3III A;  3LGR A;  2JG9 C;  4UFK A;  3WUC A;  1WW7 A;  4C91 A;  3GZA A;  2AUY A;  4KH9 A;  4NPR A;  4EWE A;  1RJ8 A;  1EPZ A;  1MEC 2;  1SEF A;  3H7J A;  5T52 A;  4XBQ A;  3THC A;  1I6X A;  1RMU 3;  5EV7 A;  1R1A 2;  3JB8 A;  3AM2 A;  1PK6 A;  1Q56 A;  1GP4 A;  3KWV A;  1J3P A;  3OGJ A;  4YM1 A;  3AB0 A;  1GZC A;  3HD8 B;  1XBF A;  2XDV A;  5CYY A;  4CP9 B;  1SLI A;  5C5T A;  3E1F 1;  2DWR A;  3SXW A;  3MZH A;  2FCV A;  2VZQ A;  1J84 A;  1FNY A;  1RXF A;  3AK0 A;  3PJY A;  4J1X A;  3SCG A;  4YFZ A;  1JZ6 A;  2PA7 A;  3RMY A;  1ZVF A;  3BOP A;  3KT4 A;  4OLL A;  2A6W A;  5GZD A;  5CFD A;  3QBQ A;  2VU9 A;  5T5L A;  1UYZ A;  4QKD A;  4RYD A;  5BY5 A;  5F3C A;  4FPY A;  5I8S A;  4UW6 A;  4XIL A;  1SHW B;  1L3J A;  2CHH A;  3VBS C;  2OQ7 A;  2EAK A;  2WQ4 A;  1SCS A;  5F6K A;  1VJ2 A;  4BK4 A;  5AC9 1;  4EWA A;  1OLM A;  4RSU A;  5GM0 A;  4HOO A;  4B7E A;  3SMH A;  3HJR A;  4NR1 A;  4EZH A;  1LU2 A;  4XDP A;  4UAP A;  3I59 A;  2GDF A;  3HQR A;  2BDR A;  4XBN A;  5JLV A;  1NG0 A;  4CXY A;  3FFQ A;  4YPJ A;  5BYN A;  5FYC A;  2DBI A;  2Y38 A;  1XE0 A;  3CBN A;  2DUO A;  3OBA A;  2W9X A;  4XW3 A;  3AYA A;  5EYY A;  5KXE A;  1LOB A;  4LLO A;  2B9V A;  1I5Z A;  1PO2 2;  2E7Q A;  2YHJ A;  3VKM A;  1R64 A;  2OZJ A;  4FPH A;  4NRO A;  2P4E A;  1W6O B;  3HWJ A;  2CAV A;  4B4P A;  3K3O A;  4I3P A;  4C1X A;  3VL9 A;  1ULC A;  3NL1 A;  5ISL A;  1YQ5 A;  4HMZ A;  1GQP A;  2CV6 A;  2GN3 A;  2R06 2;  2PLV 1;  4NAM A;  5SV8 A;  4Z92 B;  3Q9O A;  1XJA A;  4Q4V 1;  4LBM A;  2QQW A;  5FZ4 A;  1NLQ A;  3H8R A;  1KEX A;  3H8O A;  2MHF A;  3MFC A;  3QOP A;  2QDR A;  5IWF A;  4BZ4 A;  4BH9 A;  1XB9 A;  5IVC A;  3WDV A;  4AE2 A;  2WQ8 A;  1O4Z A;  4Y1Z A;  2PHU A;  1YYN A;  3AMH A;  2VTF A;  3IN9 A;  4N7U A;  2Y6K A;  1OA4 A;  2D3P A;  2W08 A;  3B93 A;  5LAS A;  3VZO A;  4DS0 A;  1YFX A;  3RPQ A;  4NIH A;  1VMF A;  4RS5 B;  3O1O A;  1YC6 1;  3BKZ A;  1HXS 1;  1ZRC A;  4AVV A;  3GJB A;  3KCX A;  1VBB 2;  4DQA A;  3M8L A;  3VBF C;  3K2O A;  2YGM A;  4RS5 A;  1OQD A;  3E97 A;  4LHS A;  2BFU S;  2BJS A;  3J26 N;  3VBO C;  1N1V A;  2P3K A;  2GZW A;  1VE0 A;  3HAG A;  1RVF 2;  1HQN A;  1WCS A;  3OGR A;  4XMA A;  1CJP A;  1PMJ X;  4OHZ A;  2DDU A;  3LA7 A;  3VKF C;  1LEN A;  2ARA A;  1MEC 3;  2PHT A;  5LBC A;  5FYS A;  1W04 A;  2Q5T A;  3IDB B;  4NMI A;  4LHK A;  4UXA A;  4ZY9 A;  2AZ5 A;  5JXJ A;  1PVC 1;  4JRL A;  4BYY A;  3CJI C;  1JXN A;  3E6B A;  2GAL A;  5FXV A;  3O12 A;  5DUV A;  2A6Z A;  2GMP A;  3OGG A;  1UU5 A;  5C9A A;  4ZXK A;  1G9D A;  1APN A;  1AR6 1;  3FN9 A;  2ZMK A;  4NUB A;  4D8M A;  5C71 A;  1JHJ A;  1FOD 1;  4MAD A;  2RR1 1;  5FRE A;  3V64 A;  1S2E A;  4QPG B;  5FLI A;  2D93 A;  1QQP 3;  1MAC A;  2A71 A;  1RUC 1;  3POF A;  3ASI A;  1UMZ A;  1Y4W A;  3OCP A;  4F7Z A;  3VBS B;  3ZSL A;  2TUN A;  3VD3 A;  5C9A C;  1PO1 3;  5FBJ A;  1REF A;  1QJY 1;  4A7K A;  3JBG 2;  3BB6 A;  4KWK A;  3GAL A;  3Q8A A;  2W68 A;  4X6Q B;  2Z79 A;  2QTW B;  2TNF A;  4P02 B;  4YVW B;  1IQA A;  2Z4F A;  3DF0 A;  2XJS A;  2TBV A;  4GXL A;  4KGG A;  1UY4 A;  4AI0 A;  2F6B A;  1QJF A;  1AR9 2;  2A75 A;  2QJV A;  1CAV B;  3CDZ B;  4FSJ A;  5F5A A;  2G4I A;  1W9Y A;  2RMU 3;  4I02 A;  2Z5W A;  4LO8 A;  5HCF A;  1UD1 A;  5FMD A;  4LBQ D;  1VPH A;  1RGS A;  1JOB A;  3Q8F A;  1Q8S A;  3DN7 A;  4MO3 M;  1H2N A;  1PO2 3;  1G9F A;  4AI3 A;  2AGS A;  1U5X A;  2J1E A;  1EPW A;  4XJ9 A;  4IES A;  2QQI A;  3M3I A;  4ZU7 A;  3L2Y A;  4JGY B;  1ULE A;  3J4U H;  2I2S A;  5I8Y A;  3CZJ A;  4JV4 A;  4AL9 A;  5IVV A;  5JMO A;  4NJ4 A;  4XET A;  5AC9 2;  4XUP A;  3RDI A;  3WNM A;  3RZZ A;  2P3Y A;  1UU4 A;  1AHS A;  4LMF A;  3VBS A;  4AHW A;  5KC6 A;  1XNK A;  1VMJ A;  4R9B A;  3JBG 3;  2D40 A;  3NJV A;  4UWD A;  3WDX A;  3QAC A;  4COW A;  1LOD A;  1IZ3 A;  1XC6 A;  4ORF A;  2Y6F A;  5LY1 A;  5FP4 A;  1OFN A;  1TME 2;  4OHV A;  3OY8 B;  4RFT 0;  1QJX 1;  1RUG 3;  2R07 2;  4RQP B;  2Y26 A;  4BK5 A;  4LBJ A;  4P9J A;  4Q26 A;  1D4M 2;  3FLP A;  5J1X A;  3DPR A;  5FWE A;  3AKS A;  1Z7S 2;  1GR3 A;  2JEC A;  1W9W A;  1FPN 3;  2WO1 A;  4A7Z A;  3NWK A;  2Y60 A;  3U37 A;  2WN3 A;  1GNH A;  4K3U A;  1QY4 A;  4P14 A;  2D6L X;  1JH5 A;  1VBA 1;  4GB3 1;  4QHO A;  3A4U A;  3N9Q A;  2W47 A;  4JDO A;  1KD7 A;  5BV6 A;  4OHY A;  1X7N A;  4QX2 A;  4HK9 A;  5C8C A;  1TG7 A;  3VKN A;  3Q8C A;  4CCC A;  4IEP A;  4C8D A;  2HWE 1;  3LEI A;  4EJR A;  2XL9 A;  2VQ0 A;  1DLL A;  1YNA A;  5JI9 A;  2ZMN A;  4XAB A;  2DCY A;  2J1S A;  3NV4 A;  5JVV A;  3NQH A;  1HN0 A;  1DCS A;  4MYE A;  5IVJ A;  2DUR A;  5F39 A;  4QXH A;  4BB3 A;  2FCU A;  2PHW A;  2ET7 A;  4O65 A;  3SEE A;  4BLI A;  1K3I A;  3O0X A;  4GQ7 A;  3C7E A;  3RFR A;  2VZP A;  2NP0 A;  2FZ2 A;  3HOB A;  2ZKN A;  3VD4 A;  2WYF A;  2ZPX A;  3BU7 A;  3PIJ A;  3FX3 A;  4IXL A;  4K8R B;  1GKB A;  5GLW A;  3RJ2 X;  4Q8K A;  1CIW A;  1RIT A;  2XUE A;  4FFI A;  4YZ2 A;  2B8M A;  1G9C A;  1DHK B;  4KI5 M;  1PZ9 A;  4P5H A;  5FYU A;  3VD7 A;  1W03 A;  3ABZ A;  1YQ6 A;  2QVS B;  5J48 A;  3T2Q A;  4LKF A;  4IE5 A;  3POI A;  3FUQ A;  3MEP A;  3NMB A;  4FPE A;  3WZ1 A;  1POV 1;  4UBH A;  1O5L A;  2Q30 A;  1SAC A;  2BW8 A;  3LA2 A;  1B35 C;  1JN2 P;  1ASJ 1;  1UN1 A;  1LJ7 A;  2VZO A;  1JS9 A;  4MH0 E;  5FP3 A;  5LEK A;  3JD7 2;  2BV4 A;  4H7L A;  1F5F A;  1H8T A;  1QMJ A;  2JX9 A;  5A3P A;  1I1E A;  1SLB A;  2B45 X;  5DAQ A;  3NNJ A;  1PX4 A;  4LIU A;  1RUJ 3;  3GYD A;  4CUA A;  2D6O X;  3AJY A;  1JZ7 A;  1RUD 1;  3ATG A;  4E4D X;  4KWU A;  3NNM A;  2V73 A;  4Y20 B;  3KVA A;  3WQB A;  4YM2 A;  5FYY A;  1O4Y A;  2RS5 2;  4AYU A;  1URX A;  1VRB A;  4QM8 A;  4XJA A;  5IHR A;  1VAL A;  3LIG A;  3W5N A;  4WVV A;  5A7N A;  5IK5 A;  1R09 1;  4OCT A;  5TSW A;  1VBD 2;  5HCH A;  1ZRI A;  3OD0 A;  4OI4 A;  5F7U A;  3N9L A;  4OZO A;  2AAC A;  1GOF A;  1YXW A;  2VE1 A;  3KF5 A;  4HN0 A;  5LA1 A;  2ZEZ A;  4K8F A;  2EAA A;  5LK5 A;  1BKZ A;  4QQ2 A;  2FDG A;  4D6R A;  5EJ1 B;  1OSG A;  2OX0 A;  4QB6 A;  3WW4 A;  1EUT A;  1SMV A;  3F2Z A;  3AC0 A;  1JYV A;  3GCW A;  4K1Y A;  4OFG A;  4Y22 B;  4RS5 C;  1POQ A;  4AXO A;  4Y5Z 0;  1C8N A;  4I30 A;  4M3C B;  3ZXJ A;  3UJQ A;  5D8A A;  2CNA A;  1OOP B;  1H8T C;  4UF0 B;  2ZGS A;  3FZ3 A;  5CEH A;  2D43 A;  3VHO A;  4V1P A;  3QLQ A;  4N43 B;  1SLL A;  3MIG A;  5JR7 B;  2XJR A;  5GKA C;  3UKV A;  4BIF A;  5A70 A;  1FOD 3;  1U5I A;  2DVB A;  5KHG A;  2WS9 3;  2BZD A;  3H3L A;  3THT A;  4LBN A;  4A45 A;  4E2Q A;  1PGL 1;  4XQD A;  3R0R A;  5JIU A;  2XKP A;  4UFL A;  4FI9 A;  4JDN A;  4AED A;  4GKY A;  4LEJ A;  3RNS A;  4QPI A;  1M4W A;  2ZEW A;  4CYD A;  2Q8O A;  3H3U A;  5BUV A;  4MXW A;  2HWF 1;  2BRT A;  3DXT A;  4Q4Y 2;  3BTY A;  2XJP A;  2ZGQ A;  4LIT A;  5KBF A;  1JOD A;  2JDP A;  4CCM A;  1PVX A;  1W8W A;  2VO5 A;  2ZHK A;  4YVS B;  2BOJ A;  5D21 A;  3VBH B;  1LOC A;  5KHI A;  1ZBA 3;  4EE2 A;  1D7P M;  4IE4 A;  4QPI C;  3AXD A;  5JMC A;  1XU1 A;  4CDW A;  3FUO A;  4NN0 A;  3LKJ A;  3VZK A;  1OPM A;  4Q4W 1;  2QQO A;  1RUD 3;  2VL4 A;  2WNV A;  1X36 A;  3LOB A;  5J7M A;  1V6M A;  1RMU 2;  2Q0A A;  5FY1 A;  3SH5 A;  2VZR A;  5FPV A;  2JDN A;  1FOD 2;  4CPB A;  1J3R A;  1V9U 3;  2WFF 3;  2XR4 A;  4QPI B;  4XC9 A;  1OD5 A;  1AYN 1;  4LUL A;  4Q4X 2;  2LM3 A;  4O7X A;  1FMD 2;  3L9J T;  2Y64 A;  3ZFE A;  4IGO A;  2HWF 3;  2ATF A;  2HKX A;  3VBO B;  1UIK A;  5FZO B;  4NIG A;  1VIW B;  1SZB A;  4IW3 A;  5C4W B;  4OI1 A;  1H9W A;  1W90 A;  3ILR A;  1AL2 3;  1D2Q A;  2C0Z A;  2EIB A;  2IXK A;  4FFF A;  4LBO A;  3RZM A;  3LA3 A;  4XYX A;  3EQE A;  2WT0 A;  1OXC A;  2C24 A;  5H9S A;  5C3R A;  2FDI A;  2WZR 2;  2RDR A;  5CKM A;  4AVC A;  4XUN A;  1HRV 3;  2IVJ A;  5SV5 A;  4IL7 A;  5ANQ A;  3MO4 A;  5EZW A;  5FKC A;  3N4M A;  1GV9 A;  1O59 A;  1UMI A;  1QXR A;  4KU8 A;  4YFW A;  5G05 L;  1RUH 1;  4CU9 A;  4MUV A;  3AVR A;  1VAV A;  5T55 A;  3TN9 2;  2AEY A;  4I0B A;  1N3O A;  1ZZ7 A;  3MFA A;  4FOW A;  3ELN A;  5A3L A;  5BNO C;  3BI3 A;  4Q5O A;  2BP6 A;  2RS3 2;  3I4I A;  4S2D A;  3E6D A;  3TBD A;  4CSW A;  5A6Y A;  2ENR A;  1R09 2;  1S0C A;  3H7Y A;  2FQP A;  1YIF A;  3UV9 A;  1DGW X;  4YVW C;  4RA0 A;  1XOY A;  2CWM A;  4CCL A;  5FYH A;  3GZE A;  1IS5 A;  2G9F A;  4YGB A;  3LEM A;  1LNS A;  3T09 A;  1AX0 A;  2QQL A;  5F2S A;  4PIX A;  1I3H A;  4QPW A;  5BNO A;  3P5B A;  1MS1 A;  4IE7 A;  4YG0 A;  1JYN A;  2G9G A;  3V65 A;  3KM5 A;  3NRU A;  5GLZ A;  1KJR A;  2YGL A;  1AF9 A;  2WLP A;  3ZPY A;  3RZG A;  2JB8 A;  4TSV A;  1O3R A;  1BMV 2;  4AFB A;  3AX4 A;  4OQ9 A;  1RUE 1;  2WAB A;  4IDZ A;  3FLR A;  4XQ4 A;  1N1Y A;  2NYY A;  3AYE A;  4XF3 A;  2WQZ C;  3UNP A;  3PUH A;  3VBF B;  2QQK A;  4Y1X A;  2WZR 3;  4TN7 A;  2LRO A;  5FOJ B;  3NKT A;  3OUH A;  1UXX X;  2LTN A;  5A1F A;  2XBO 2;  1X8E A;  1BMV 1;  3N9O A;  4ZU5 A;  5T3N A;  3WNX A;  3DUI A;  4XUQ A;  5EWS A;  2W91 A;  1UF2 C;  5FMC A;  2PLV 2;  2Y6H A;  3GBG A;  4NPL A;  3EBR A;  3ZSJ A;  1ENQ A;  4ERO A;  5FPX A;  2VXJ A;  2O14 A;  3AFG A;  4WVZ A;  2H0V A;  3POE A;  3TOJ A;  2WRA A;  3J8F 2;  4AGG A;  3WDU A;  2XBO 1;  1ENX A;  1OBN A;  1F2N A;  1R08 1;  4LHN A;  5EP9 A;  2YPJ A;  4Y20 A;  1ZBA 2;  2VVD A;  1COV 2;  4WM8 A;  2AEN A;  4AK3 A;  1W28 A;  4PDW C;  5A33 A;  2CGP A;  2EIC A;  1WMX A;  4YW1 A;  1IPK A;  1S2B A;  2JDK A;  5KXC A;  2R6Q A;  4UFH A;  3BIW E;  2QQN A;  3CIH A;  3D8C A;  3ZYI B;  4COZ A;  2VJX A;  1M06 G;  3ZFG B;  4H14 A;  4YW2 A;  4NHK A;  5FP9 A;  2BBV A;  1D4M 3;  3ZKY A;  4XPV A;  1RYY A;  1P8J A;  2W52 A;  2YUE A;  4CDX B;  4DB5 A;  5C8C C;  5JUV A;  1FYU A;  4IV1 A;  4CEW A;  4XF9 A;  2A6V A;  4XFB A;  2WFF 2;  4MGZ E;  1QOT A;  1CIY A;  1TE1 B;  5DUW A;  3IDA A;  4D6Q A;  2ZGL A;  2XB6 C;  3I2G A;  2HWF 2;  1J83 A;  3ZLI A;  1AR8 1;  3USS A;  4R9A A;  3S6P A;  5DAW A;  4PF5 A;  4BJ0 A;  1HRI 3;  4N9I A;  4BA6 A;  5IYY A;  1S2K A;  4LTA A;  4A4A A;  2DVF A;  1UO9 A;  2FMD A;  5FZA A;  3UJO A;  1V6I A;  4AEK A;  4MXV A;  4LNV A;  3ILN A;  3OD4 A;  4YZ5 A;  1BQP A;  3ZXD A;  2J1R A;  1PGW 2;  4PI2 A;  5I0D A;  2V72 A;  1HDK A;  2QCS B;  2RM2 2;  5KHH A;  3ZXA C;  4DIN B;  1Y9Q A;  3H42 B;  4MVT A;  4V2V A;  5JZG A;  5JCT A;  2JIC A;  1V6L A;  4P9L A;  4BQX A;  1ULG A;  1JZ2 A;  1XSR A;  4D7T A;  3KB5 A;  3M3E A;  4K21 A;  2FBE A;  2XGX A;  2DCT A;  2RJL A;  3PNA A;  4HN1 A;  2XLF A;  5CU1 A;  3E5U A;  1UL9 A;  4YSF A;  2PAK A;  1F8V A;  1A78 A;  2PYT A;  4PI0 A;  3Q8B A;  4ATF A;  2EVX A;  3BTA A;  3KZ4 C;  4IV1 B;  1UYY A;  4CEW B;  3WF2 A;  4PLM A;  4CDX A;  1TMF 1;  1AR6 2;  1RUH 3;  3NST A;  3KVB A;  5GZF A;  5H9P A;  4WV8 A;  2C6S A;  4PJY A;  3RRD A;  1GNY A;  2QUO A;  1U5Z A;  2HEV F;  2VW1 A;  2WN2 A;  1YJK A;  4MV2 A;  4PIY A;  1MEC 1;  1Z78 A;  5FZC A;  3RGB A;  4LUM A;  1ULP A;  4E9K A;  2ID4 A;  1O4T A;  4GH4 B;  4RR3 C;  5A3M A;  4WM8 B;  3M4F A;  3IAP A;  2Y6G A;  1ST8 A;  3DPR B;  4GD4 A;  1WGP A;  3WQ0 A;  4R4X A;  2J1V A;  4QKN A;  4JC1 A;  4FOQ A;  1QGL A;  1EAH 3;  2XOM A;  5JXG A;  1UY1 A;  4YZ4 A;  5J96 B;  4IER A;  1GZW A;  1AYN 3;  2D97 A;  4Z82 A;  3T0D A;  1V6O A;  5DN2 A;  4Q0S A;  3GNE A;  5JXI A;  1MS9 A;  3WR0 A;  2R04 2;  5E16 A;  5A7S A;  4JX0 A;  2NQY A;  1WCQ A;  3VZN A;  2GH2 A;  3LAG A;  2OKX A;  5EIY B;  2ZAB A;  4A6O A;  2YBP A;  4GJZ A;  4AVS A;  4ET7 A;  5IK8 A;  5DAV A;  2VUL A;  3AKT A;  4CCK A;  4DFS A;  1LB2 A;  1Q3E A;  2VH9 A;  2RVA A;  1V9U 2;  1F4A A;  3N7M A;  3ITQ A;  1WLC A;  4DRV A;  5FOB B;  3D0S A;  4P00 B;  4Q4V 3;  1EV1 3;  2UWC A;  4Q29 A;  4JKM A;  3GJA A;  1ZBA 1;  2J42 A;  3SC7 X;  1NUK A;  2VW2 A;  2FDH A;  1QH7 A;  3HVD A;  2R06 1;  4NHM A;  2VUD A;  2E32 A;  3IMN A;  3N3H A;  2GP3 A;  3AKQ A;  4WVW A;  1C28 A;  1PZ8 A;  2R1B A;  2XWJ B;  4OQ8 A;  3ZVX A;  5FCC A;  3WF4 A;  3D3A A;  4C1W A;  2OUH A;  5FXX A;  2BGC A;  3H1Y A;  3I8T A;  3UT0 A;  1CAU A;  2ZAC A;  1C8M 3;  4ARY A;  1XPW A;  1OUS A;  2PN5 A;  4D0Q A;  5J3U A;  1JW6 A;  1WZX A;  3T1M A;  3DV8 A;  3LSD A;  4MGK E;  4EYU A;  1YLL A;  1Q43 A;  1SQ4 A;  2RR1 3;  4TXW A;  5GLT A;  4F3J A;  3C7G A;  4FPL A;  2BTV C;  2IXC A;  2LW8 A;  1X9T A;  1XYN A;  1BEV 2;  1SCR A;  1UMH A;  1OH4 A;  4JHZ A;  4WZF A;  3ZYP A;  1JTZ X;  3B94 A;  1WMD A;  1HRV 2;  2IXJ A;  1QDC A;  3C2U A;  3BCW A;  1WW5 A;  2HBU A;  4UW3 A;  3IT8 A;  3N36 A;  2X09 A;  4LQR A;  1H9P A;  3CJI B;  5APA A;  3ZX7 A;  4UOJ A;  5C70 A;  1PM4 A;  4HK8 A;  4QPG A;  3WF3 A;  1DZR A;  1GFF 2;  2ZML A;  4PF1 A;  2A6Y A;  3OUI A;  5GAL A;  4LUK A;  4QGM A;  1GU3 A;  2HWE 2;  1VBE 3;  2W92 A;  5DXD A;  3WUD A;  1SFP A;  3LE0 A;  5KXD A;  5HXV A;  1F31 A;  5I91 A;  1FAT A;  1JYC A;  3EJK A;  1WD3 A;  3D4K A;  5BNP A;  5BXX A;  4NHL A;  3I3D A;  1ZBE 3;  5FDB A;  5IFP A;  4D7S A;  1SLT A;  2A5Z A;  1JZ3 A;  3AXE A;  3I97 A;  1BBT 1;  4BM8 A;  4E2G A;  1J59 A;  3DKQ A;  2Y8K A;  1RMU 1;  4NHX A;  1UNB A;  4IGP A;  2PQQ A;  1VR3 A;  5GLU A;  3UES A;  3K4Z A;  4L2N A;  1YRZ A;  3RYP A;  1J1T A;  1I9R A;  2P5B A;  4CP0 A;  3PJQ A;  3DL3 A;  3AZY A;  5DUU A;  5IFT A;  1KXG A;  1NY7 2;  1UOG A;  2JKX A;  3ZYJ B;  4CA9 A;  3C3V A;  4S2F A;  2JIG A;  3VKO A;  4ZHN A;  5DUX A;  5C5U A;  2K9Z A;  3ACH A;  1JUI A;  1W2O A;  1CPM A;  2XHN A;  3BAL A;  1OD3 A;  2FDJ A;  2OT7 A;  1MPX A;  3AMQ A;  2MEV 2;  2RS1 1;  2WA4 A;  1BZW A;  1IS4 A;  4GAL A;  1Y9G A;  5FZH A;  2NM1 A;  2B5H A;  1H2L A;  4GMP 0;  1S0E A;  5FJK A;  1NCR A;  3UL2 A;  1KRI A;  1ZX5 A;  2NMO A;  3WP5 A;  2VCC A;  3WHT A;  1EYB A;  4UW5 A;  2ZZQ A;  1JZ5 A;  3OYW B;  3PUQ A;  1NOV A;  3MF6 A;  3KV6 A;  1W6M A;  1CQ9 A;  4NIA A;  2YBK A;  4YZ1 A;  2Y0O A;  3FHQ A;  5FPZ A;  4M4R A;  3HMY A;  3POW A;  5D8A B;  3UET A;  3ACL A;  3PIG A;  3O5S A;  1DYO A;  5F2W A;  5GZC A;  4Y22 A;  2ETE A;  5F5Q A;  3AL5 A;  2P1B A;  2RS5 1;  1ALY A;  1LHO A;  3NJY A;  3WCR A;  2VNV A;  3U14 A;  1W05 A;  4ZU4 A;  1MZ5 A;  2AH2 A;  2JDM A;  2VNR A;  2XXZ A;  4NRQ A;  1TME 1;  2J1U A;  1UPS A;  5DG2 A;  1S0D A;  4OI2 A;  4I01 A;  4HVQ A;  4NWV A;  4RHV 1;  1RUE 2;  3D5O A;  1UYP A;  3NV2 A;  2CGN A;  3Q8E A;  4FO9 A;  5FZ7 A;  2EIE A;  4DIQ A;  1RUI 2;  1JBC A;  1V6N A;  3M70 A;  2OA2 A;  4IND A;  3N7J A;  4WM7 C;  2XPJ A;  1AX1 A;  3RG0 A;  5FY5 A;  3VD9 A;  5HCA A;  3PUA A;  1A3K A;  1JMU B;  2PMW B;  1NZC A;  2VZV A;  4PLO A;  4Y26 A;  5FJH A;  3GXU A;  3AP6 A;  3DPR C;  3MYX A;  4XUR A;  4XVH A;  4AGR A;  4MG2 A;  4WM8 C;  4Y1U A;  2FZ1 A;  3POG A;  4NRP A;  2I45 A;  5FUN A;  4XXP A;  5F3E A;  3K75 B;  5T50 A;  2HBT A;  2HWD 2;  2RE9 A;  2XJU A;  2XQR A;  4NAO A;  3FJS A;  3VKL A;  3LFM A;  2A3Y A;  2VC9 A;  2DU1 A;  3EMR A;  4RFR B;  1ODN A;  5KR7 A;  2BNN A;  1MQT B;  4MGQ A;  4IV3 C;  3ES4 A;  1VAM A;  3U11 A;  3TAY A;  2HWD 1;  3OGS A;  3OPT A;  1UQX A;  5B4N A;  5AVA A;  5CFD B;  2WNU B;  3IZO A;  1GMM A;  2C1F A;  2QFE A;  4AEM A;  4Q8L A;  4GWN A;  3ZYG A;  4QX8 A;  4AFA A;  1AYM 3;  2R06 3;  4AQT A;  5IW0 A;  3HR9 A;  3U4X A;  2VEC A;  2HWB 1;  1D0H A;  5FY9 A;  5CB7 A;  1HW5 A;  4QX1 A;  3BVC A;  5BNP B;  2YV8 A;  3OTF A;  5DAB A;  3INA A;  4NE9 A;  2GC2 A;  2X10 A;  4LE4 A;  4YW7 A;  4Y4Y A;  1QWR A;  1SDD B;  1JU3 A;  5ABJ A;  3CKH A;  2Z2S B;  2QE3 A;  3ZO0 B;  3TEX A;  3OEB A;  4O9G A;  4JZR A;  1CZS A;  5IVY A;  4YW5 A;  1US3 A;  5K0U A;  2E7A A;  3ZKU A;  3I2F A;  4BQ2 A;  2VCA A;  4P9G A;  1JOJ A;  5F5C A;  1LGC A;  2R0F A;  1VBB 3;  3H50 A;  3LWC A;  4MGY E;  2VGD A;  1FMD 1;  1SDW A;  1IKP A;  1Q5O A;  2C4X A;  4IV3 A;  3W21 A;  1W8N A;  4CCE A;  2GC0 A;  3T0B A;  3V0B B;  2DFB A;  1MQT A;  2R49 A;  4P9X A;  1YCI A;  1QJU 3;  3H1W A;  4PBP A;  3T2P A;  1CAW A;  1NXD 1;  4W6W A;  4W4Z A;  3U75 A;  2XG3 A;  4LO6 B;  3MGU A;  3ZFG A;  3AP4 A;  4AI1 A;  3KV4 A;  5CA6 A;  4E4Z A;  3KSC A;  4IEV A;  4PDW B;  3U78 A;  2IWG B;  3MLK A;  5G04 L;  5A33 B;  1VLN A;  1OF3 A;  4AAX A;  3PU3 A;  1VP6 A;  5EJZ B;  5A6Q A;  1C5H A;  3F95 A;  3I2J A;  2P3J A;  3RMX A;  4Z1V A;  2VMI A;  3VLB B;  5C33 A;  5LZ6 A;  1H1I A;  2LUW A;  5E1R A;  2AEZ A;  3V56 A;  2IXI A;  3I7D A;  1G6N A;  2IVI B;  4ASM B;  2WWJ A;  4LPL A;  2ZAA A;  3LQC A;  3EYP A;  5FUP A;  2ZHM A;  5FO9 B;  3VHR A;  1MZF A;  1MZE A;  1PIV 3;  2GND A;  1RUI 1;  3KT1 A;  3MLL A;  5T5P A;  1W06 A;  2CDO A;  3B69 A;  4OHW A;  4AGV A;  2ZGO A;  3HT1 A;  4XTM A;  4JCK A;  5C7G A;  4CCD A;  2H6C A;  4QT6 A;  5LWB A;  1OHF A;  1MR5 A;  2V4A A;  3POB A;  1R09 3;  3RWN A;  5L73 A;  1H1M A;  4XAC A;  2YC0 A;  1HRI 1;  2YXS A;  4M0N A;  1CAX A;  4DOU A;  1QU0 A;  3MDP A;  3T30 A;  2IFR A;  2RMU 2;  1ZRD A;  1BK0 A;  3KCC A;  1AR8 3;  3ES1 A;  3O0W A;  3VBU C;  4CU7 A;  2VZT A;  4AI8 A;  3WD5 A;  3ZIW A;  2JKB A;  5A7W B;  2WKK A;  2A7A A;  5D2A A;  5FPB A;  3VBH C;  2JG8 C;  4ISR A;  2Q4S A;  2BNO A;  2LAL A;  4Y5T A;  3LFI A;  1BCX A;  3A0K A;  3WHU A;  4J25 A;  4DXS A;  1IHM A;  4Y1Y A;  3E5Q A;  3CNA A;  2OPW A;  1MS4 A;  4GH4 C;  4RR3 B;  3ACI A;  3B7M A;  5I0U A;  3MV1 1;  4M4P A;  5CFC A;  1W2U A;  2D6P A;  2ES3 A;  2VPV A;  2N7G A;  4QKB A;  4CDU A;  1RUG 2;  2R07 3;  3RWK X;  4H3W A;  5JOX A;  2XBO 3;  4C90 A;  1HV0 A;  1WUV A;  2NLR A;  4X8N A;  3HBK A;  5FBZ A;  4E8C A;  5GJ6 A;  2D44 A;  3ACF A;  3NW4 A;  1DIW A;  4EN7 B;  2JIJ A;  2KD7 A;  3AMN A;  4QWN A;  1BEV 1;  1LHW A;  3HBZ A;  1UZ0 A;  4QAW A;  3JCI A;  3HN3 A;  4XF1 A;  2YZ4 A;  4J6G A;  4SBV A;  4XFF A;  4YGC A;  1WW4 A;  5GLV A;  1CPN A;  5KC5 A;  3RZL A;  1JYT A;  4QU2 A;  1COV 3;  4F83 A;  1KFU L;  2EIG A;  1REE A;  1W6Q A;  3LCP A;  2A73 B;  2UY8 A;  3KD4 A;  5FAX A;  3ZFF A;  2XVG A;  3WDT A;  4BDV B;  4AVB A;  4OUE A;  2ZOE B;  4PBO A;  4Q4X 3;  3HN1 A;  1ZBE 1;  4KMQ A;  1MZ6 A;  4IEX A;  4CRQ A;  2WZR 1;  5A3T A;  1XNC A;  1I5P A;  3OBZ A;  2KA3 A;  1LHU A;  5FQ0 A;  2WNV B;  4P5Y A;  2IXH A;  3MPB A;  5DG1 A;  5FP7 A;  1RUE 3;  2OPK A;  3M1H A;  3MIE A;  4IEW A;  5JSO A;  4H2A A;  2VW0 A;  4FPC A;  5DAX A;  3JD7 1;  4EQV A;  5KXB A;  1KS4 A;  2YB7 A;  1ZBE 2;  4FQ4 A;  2DUQ A;  1GQG A;  2ADD A;  2D98 A;  3DYO A;  4JKK A;  4MX3 A;  4ZZ5 A;  3ZN5 A;  1AR7 1;  3MLJ A;  1BYH A;  3MIC A;  4FAG A;  2WO3 A;  3OBT A;  5LA2 A;  2ZHN A;  5A32 A;  1W9T A;  4BIS A;  3AKR A;  1K5M C;  2QDN A;  2NZ9 A;  2BOI A;  4MXW B;  1W0O A;  2EXI A;  2JG9 A;  2EAL A;  3AZV A;  1STM A;  3WNP A;  1C57 A;  2C9K A;  2RV9 A;  4OZX A;  1UZV A;  2W0X A;  4W8J A;  4MET A;  3BOW A;  4CCN A;  1DYK A;  5B2G B;  3K3N A;  4N43 C;  5K9Y A;  4S2H A;  4PHZ A;  4GJY A;  4AFD A;  4L97 A;  2ARB A;  3IIA A;  1AJK A;  2OUJ A;  1ULF A;  3WXP A;  3WSO A;  2D6M A;  3NO8 A;  4DPN A;  1B35 A;  3KMH A;  2D3S A;  1NA1 B;  2WSU A;  5I8T A;  4GIQ A;  4JDM A;  5L7O C;  2XJT A;  1LEC A;  4WVM A;  1NA1 A;  3T08 A;  5CIS A;  3RJR A;  4COV A;  4XFH A;  5IVB A;  1CZT A;  1UZW A;  5HXM A;  4GMP 3;  3WP4 A;  4CCJ A;  5IAT A;  3W5M A;  3MUY 1;  5DDJ 2;  1Z7S 1;  5FKB A;  1U12 A;  2BGP A;  4W65 A;  5FZE A;  1N3Q A;  3TEY A;  1X9P A;  3NJX A;  3MW3 A;  5FFO C;  1VAK A;  3OEA A;  2HH9 A;  3AP9 A;  2WNE A;  3W20 A;  4CU8 A;  2XKO A;  1D2S A;  3EXU A;  4IEQ A;  1LU1 A;  3NJZ A;  1QIQ A;  1NCR B;  1WME A;  3VL8 A;  4FXG B;  3PMS A;  3RZJ A;  4I2O A;  2I74 A;  4EN0 A;  4CP9 A;  4Q2F A;  4PQ9 A;  2HYK A;  2D6N A;  4MHR A;  4IEZ A;  4YZ3 A;  3WW1 A;  2VBB A;  5LRS A;  2K0G A;  3VV1 A;  1OLQ A;  4GZ9 A;  3R05 A;  3CL1 A;  3CJX A;  5H9R A;  1JOP A;  1TNR A;  4IQP A;  1IS3 A;  1KDK A;  1QKQ A;  1OLR A;  1YUD A;  1ND2 C;  4FXK B;  4OUS A;  3QCW A;  4CZS A;  2WWU A;  3PVB B;  4MOA A;  2JDA A;  1NX9 A;  2R32 A;  2D3R A;  1VBA 2;  2C5D A;  2A6X A;  1UW8 A;  5FV3 A;  3S7I A;  2W1S A;  1HN1 A;  5IK7 A;  2F17 A;  4LBQ A;  3S0M A;  4FVV A;  2NMN A;  1T6G C;  2VD7 A;  4UI9 L;  1GWL A;  2XL7 A;  4JRA A;  4LA2 A;  1PVC 3;  3TNQ A;  5F3I A;  3T2T A;  4M3C E;  4O61 A;  2YDE A;  1LOF C;  1RJ7 A;  3CO2 A;  4YG3 A;  4QHB A;  1W9S A;  1ZRR A;  3GHN A;  1MS3 A;  4YW6 A;  4FOV A;  4RHV 3;  4FQZ A;  4YLZ A;  4LLF A;  2Q1F A;  2GN7 A;  4LO7 A;  2UWB A;  1DQ4 A;  1NE6 A;  1RVF 1;  1R1A 1;  2Y34 A;  1SLA A;  3PDQ A;  2PHF A;  2RS5 3;  4CEY A;  3WLU A;  5A7W A;  1JYX A;  2BFU L;  2L9L A;  2MEV 1;  1Z7S 3;  1XE8 A;  3AZZ A;  1GZ9 A;  4AAP A;  3WP6 A;  4KG0 A;  5CBL A;  1CJD A;  1UXZ A;  2KM2 A;  1JHN A;  1R1Z A;  2VAU A;  3E5X A;  2V4V A;  3PVN A;  3VZJ A;  2CWS A;  5FPL A;  3ZXK A;  4NO4 A;  3RI8 A;  2BWC A;  3ZR5 A;  2JG8 B;  4LKD A;  1DF0 A;  1PMI A;  2RR1 2;  1UY3 A;  2AYH A;  2BQP A;  3LD8 A;  1FT9 A;  3QH7 A;  4AFM A;  5JPN B;  4LOS A;  5FRA A;  1BEV 3;  1AR7 2;  4RR3 A;  1AXZ A;  1W3V A;  5FLH A;  1AVB A;  2VZ1 A;  3PTR B;  2W1W A;  3ZFE C;  1XYO A;  2R04 1;  3AJZ A;  1GLH A;  4MSV A;  2RS1 3;  3R4D B;  1OKQ A;  2WZE A;  2JDY A;  2A1X A;  4YW4 A;  2W95 A;  1WCK A;  1E5I A;  4WM7 B;  4OUM A;  1S0J A;  1POV 3;  4UF0 A;  3ZIX A;  3RYR A;  3I2H A;  2WSV A;  2WNV C;  2C26 A;  4A7Y A;  1W0P A;  5C3P A;  1DQ2 A;  3E6C C;  1Q8V A;  1XU2 A;  1AL0 G;  4EZ4 A;  3MID A;  4PDW A;  1UX7 A;  1MVQ A;  1O5U A;  4LJH A;  5M0T A;  4ZZ8 A;  3CU7 A;  4BCU A;  3K4D A;  3NV1 A;  1N3P A;  1OVP A;  3O7O A;  1DBN A;  4HT1 T;  5A7Q A;  2WAO A;  1CZV A;  3FC0 A;  2XML A;  3NNF A;  4AFC A;  3I2O A;  4KL1 A;  1W8O A;  1YIP A;  2UUR A;  3V0B A;  5ACA 2;  1OI6 A;  1CD3 G;  2C9A A;  2D7F A;  1OC1 A;  4AR2 A;  1A8D A;  1IG3 A;  4YGE A;  5CAZ A;  5EHD A;  5J98 B;  2BPA 2;  4OUL A;  2E9Q A;  4Q4Y 1;  4BMB A;  2B39 A;  5I93 A;  2CTV A;  5DDJ 1;  3AMP A;  4QU1 A;  2H6B A;  3WCS A;  5FTT C;  3WV6 A;  5ABJ B;  1G9A A;  5F6L B;  1DZQ A;  2HWC 3;  2VMC A;  1HX6 A;  4GH4 A;  3OPW A;  4WBB A;  3J7N A;  5FZK A;  4CPB D;  5C8W A;  5L36 A;  3EO6 A;  2X05 A;  1EUU A;  1WLW A;  3C7F A;  3APB A;  2VXR A;  4N9H A;  3ZXF A;  4E27 A;  4NID A;  1QXJ A;  3WT3 A;  2DCZ A;  2W5F A;  4ES9 A;  4UFI A;  1VB4 A;  5L19 A;  2JE9 A;  5GZG A;  2BWA A;  4L9B A;  5DPN A;  3I2K A;  3IWZ A;  3ROU A;  2HLE A;  2J1T A;  2VQU A;  4CUC A;  1W6N A;  2V5D A;  1VRH 3;  5JDB A;  5F5I A;  2HEY F;  2G19 A;  3J8F 3;  3HIF A;  4FPF A;  5EQU A;  1W6N B;  5FK8 A;  3SCH A;  1W8Z A;  2B7Y A;  1C8M 1;  1NAE A;  2RM2 1;  3VDD C;  3ST7 A;  1GUI A;  4QMA A;  2VBD A;  2R1D A;  3VDD B;  1WKY A;  4K20 A;  4BXS V;  3H0O A;  1BK1 A;  1MS5 A;  3K51 A;  1DYP A;  1HJG A;  4Y1V A;  1FMD 3;  1WA6 X;  3ALQ A;  4BQ5 A;  2P6C A;  1YQC A;  2IFW A;  5A80 A;  3V0A B;  4LT5 A;  4FOY A;  1H6X A;  1LHN A;  4QPY A;  4N53 C;  1V6K A;  3WY6 A;  1WCD J;  3BPZ A;  5K8S A;  1W2T A;  2ZEX A;  3MF9 A;  4IV3 B;  4AI2 A;  5IVF A;  1UOJ A;  4B29 A;  3A21 A;  4ONU A;  1G8W A;  1W6P A;  1ZNP A;  1NXM A;  4ZS2 A;  4HSL A;  3VBR C;  1H2M A;  1OA2 A;  2DCK A;  2DVA A;  1GSL A;  3NAP B;  4LOT A;  1OMI A;  1ZZ9 A;  4YGD A;  4V2W A;  3U10 A;  1O6U A;  1W8F A;  1W8T A;  4JTO A;  4SLI A;  3K48 A;  2YRO A;  4XUT A;  3VZL A;  1CWP A;  2HWD 3;  1CES A;  4HZF A;  2DVG A;  3LPF A;  1W99 A;  5A6X A;  4CUB A;  1NCR C;  2CDP A;  1G9B A;  1HQL A;  1TEI A;  1RUF 2;  2VY0 A;  2KR2 A;  1K12 A;  2EXH A;  1PO1 1;  3BTX A;  3WP3 A;  5JWP A;  2RHP A;  3ECQ A;  2ET1 A;  4FAH A;  2O1Q A;  1LTE A;  4B7K A;  1NCQ A;  1W3X A;  1FXZ A;  2BER A;  2WNU A;  4HKW A;  5EPA A;  2CL2 A;  4IUG A;  1O8S A;  4XJ8 A;  3LDB A;  3LDR A;  4FP3 A;  4N53 A;  1K5M B;  4CP1 A;  3WNO A;  4DUV A;  3ZYB A;  1T2X A;  4FPO B;  5A7O A;  1IGO A;  1AR6 3;  2RDN A;  4CP2 A;  2SBA A;  4E8D A;  2GU9 A;  2QQP A;  2ERF A;  4XUO A;  1NCQ C;  3POS A;  1ND3 B;  4COY A;  5F1R A;  3VBR A;  3O1S A;  5L7O A;  4MZU A;  4UFM A;  1NA1 C;  1SBE A;  5LA0 A;  3KQR A;  3JQW A;  1PZ7 A;  2DYC A;  4ITC A;  4PCR A;  3WOG A;  1GOH A;  1WMF A;  4H7M A;  2DV9 A;  4DUX A;  2ZGT A;  2SLI A;  2W87 A;  5EYX A;  3U1X A;  4Z2W A;  4HG6 B;  4URT A;  4FTS A;  1EAH 2;  1LCL A;  4QQP A;  1YQ2 A;  4WZC A;  2IZW A;  2VZS A;  3I3Q A;  3LZZ A;  4PQQ A;  4L99 A;  4XDO A;  3ETP A;  5FUI A;  5FZ6 A;  4LXL A;  5FZ1 A;  3ZSK A;  2ZBJ A;  3POY A;  1Y9M A;  4DRR A;  2RS3 3;  1DGW A;  4JTN A;  4CE8 A;  4OMC A;  3CLP A;  4DY3 A;  1ENS A;  5LBB A;  4PIZ A;  3KHC A;  1BVP 1;  1RUJ 1;  4KG8 A;  4XJW A;  3VBR B;  3ZDS A;  4KBB A;  4BQ4 A;  2JJ6 A;  4LKE A;  1AYM 1;  4HKL A;  2YFU A;  1D4M 1;  1Y7B A;  3UKN A;  1C8M 2;  1OFS A;  4FT8 A;  4JVA A;  1W8H A;  3FHA A;  4CDX C;  5HI0 A;  1O91 A;  4Q4W 2;  4B8E A;  3VN4 A;  4N53 B;  4QHZ A;  3NVC A;  2E26 A;  2ZJC A;  4GWI A;  1DLC A;  2ZS6 B;  2G1M A;  4ATE A;  2ORX A;  4MGT A;  2WO2 A;  3WDW A;  1ND3 C;  1R08 3;  3WF0 A;  3USU B;  3S57 A;  3R6S A;  1YFW A;  2E6V A;  2GC1 A;  4D3W A;  1N1T A;  3KLS A;  4CDQ A;  2BVB A;  4HXC A;  1DGR N;  4QXB A;  2Q8E A;  1WD4 A;  1ZYB A;  2EID A;  1ZZC A;  1PIV 2;  5FO7 B;  4IGQ A;  3SKJ E;  3ZM8 A;  3GCX A;  4ZXE A;  5FZB A;  1IOA A;  3VHN A;  1C1L A;  1NT0 A;  1KGY A;  4HFS A;  4QDQ A;  2YC4 A;  5GZE A;  1KQR A;  3N35 A;  3BYW A;  4P9W A;  4EN6 B;  2J7M A;  3JB4 C;  4MGI E;  3PLQ A;  3SNM A;  1DQ6 A;  2CAU A;  3HNB M;  1VBE 2;  2K46 A;  1TQ5 A;  1N1S A;  5CAD A;  1FPN 2;  2QZ2 A;  3CJI A;  3UYJ A;  3IPV B;  4E4H A;  2Y33 A;  3SCF A;  3VBH A;  4I09 A;  2YU1 A;  2W1Q A;  4K6B A;  4R9C A;  4A42 A;  1UOB A;  2VOW A;  2ZAH A;  3LF7 A;  3WG1 A;  3DXU A;  1UWW A;  2EF6 A;  2HWE 3;  1VBE 1;  4D7Y A;  1AR9 3;  3FLT A;  3ZDV A;  4B4R A;  5A3N A;  1DDL A;  2YYO A;  3PTY A;  5ERL A;  1AL2 2;  2Y0I A;  3PME A;  3T4H B;  3UGG A;  2CSG A;  2WR9 A;  4B1L A;  3J7L A;  3LEK A;  4DEQ A;  1E5H A;  5J36 A;  1OUX A;  4AED B;  1V0A A;  2WII B;  1XNB A;  4PT6 A;  3WVJ A;  2FDF A;  3OB8 A;  1K45 A;  4XJU A;  4M0H A;  1LEM A;  4AHY A;  4KWL A;  1WA4 A;  3H3Z A;  4RQP A;  5C3S A;  2XQX A;  4D69 A;  1HJF A;  3OSD A;  2W94 A;  4DY5 A;  2WFP A;  2VR4 A;  5FWJ A;  3MBW A;  4WM7 A;  3VBU A;  3WQ1 A;  2OW4 A;  2JE8 A;  4R9D A;  5IVE A;  1OOP A;  3PVO A;  4R4Z A;  1X82 A;  4N7I A;  3BIE A;  3AFK A;  5JOW A;  5DAP A;  3VHP A;  3LIH A;  3I59 B;  4QM9 A;  2E63 A;  4YRD A;  3VZM A;  3QD6 A;  4XEZ A;  4AG4 A;  2MPF A;  2VVE A;  1WBL A;  4NRM A;  1VBD 1;  4UBG A;  1GP5 A;  3MIH A;  4JGZ C;  4Q0U A;  1RXG A;  2Y6J A;  3WEZ A;  1OQ1 A;  3FL7 A;  5FZG A;  4A3Z A;  1PGL 2;  3HNY M;  2BGO A;  4AEJ A;  1L7R A;  1WBF A;  2ZGN A;  4YG6 A;  3HQX A;  4OMD A;  3ZSE A;  3P3P A;  5BNP C;  1YFY A;  4Q4W 3;  3ORJ A;  1C3H A;  1CAV A;  4DXT A;  5A7P A;  3BTZ A;  1PNF A;  1MVE A;  5FY4 A;  3BU0 A;  3MUZ 1;  2ARC A;  5F32 A;  1BBT 3;  4QQL A;  1KS5 A;  4D94 A;  4KGQ A;  2JDU A;  3PL0 A;  5CKN A;  1QQP 2;  2DU0 A;  1LED A;  1EAH 1;  2VMF A;  5LA9 A;  4EWD A;  1QJE A;  1H4H A;  1RUI 3;  4BXF A;  3H1M A;  5BPX A;  4QQO A;  4CUG A;  1BVV A;  3PUR A;  2Q1M A;  5JPM B;  2E53 A;  4FTE A;  1B35 B;  3RYK A;  1RTV A;  3TN9 3;  2HWC 2;  1OA3 A;  2QQM A;  3ZN4 A;  3SLI A;  1GZW B;  4PLN A;  1RHI 3;  5FYV A;  3W9A A;  2X5I A;  5B4X A;  5BNQ A;  4M3C F;  3OOX A;  4JAA A;  5K0U C;  1GBG A;  1HIX A;  2X5I B;  2JEM A;  1V00 A;  3CEW A;  3NNL A;  4EV0 A;  1WLT A;  2QNK A;  3CHX A;  2XH6 A;  2DTW A;  1UOF A;  1YI9 A;  3J7M A;  3KT7 A;  3GDB A;  5JZG B;  1J1L A;  3LSE A;  3HPN A;  2ZX1 A;  2GSY A;  2ARE A;  5JZG C;  3N9M A;  4EN8 B;  1YEW A;  4JGZ B;  2WA3 A;  3N7K A;  1EV1 2;  5D8A C;  1LR5 A;  3OUJ A;  3NKG A;  5CIR A;  1ENR A;  3P3N A;  3AKP A;  1IPJ A;  4ISQ A;  5J09 A;  3IDC B;  2P17 A;  1QJU 1;  4GKX A;  4A3X A;  2YG0 A;  1E57 A;  4NOT A;  2OYZ A;  1A34 A;  2Z42 A;  4IE6 A;  5DDJ 3;  2P37 A;  3N9P A;  5IAX A;  4MGS A;  1O8P A;  2YFZ A;  2BVV A;  3TN9 1;  3B5L B;  1GYK A;  5FZ0 A;  3VDC A;  2RS1 2;  2ZGP A;  3GM8 A;  4QKF A;  1ZZ8 A;  2CYF A;  2YBS A;  1CN1 A;  1ZA4 A;  1HXS 3;  3GZT B;  1XNT A;  3ZYR A;  4B4Q A;  1LRH A;  4G3Y C;  1F5J A;  2XLA A;  1S0F A;  4ZS3 A;  5JIA A;  4QGL A;  1S55 A;  4TTG A;  5FYI A;  1FAY A;  1XQN A;  4U2A A;  5F8P A;  2ZGK A;  1EP0 A;  4Z07 A;  1UCX A;  4S2G A;  2VM9 A;  1O3S A;  2YMZ A;  2AR6 A;  4LA3 A;  1ULO A;  1UX6 A;  2AC1 A;  4HKO A;  5FYT A;  2KXL A;  5BNN A;  3H8X A;  5LBE A;  5CNA A;  1HLC A;  1J3Q A;  1H6Y A;  2VBP A;  2BNM A;  4QXK A;  4A44 A;  5ABJ C;  5LEJ A;  4QX0 A;  3VB9 A;  1RUH 2;  1W2N A;  3S7E A;  4LBQ B;  2WIN B;  1CR7 A;  1UIJ A;  4UYB A;  1G86 A;  1CX1 A;  2W39 A;  3HEI A;  4FFH A;  1O3T A;  4DXZ A;  3KV5 A;  2NPI A;  5LBF A;  3URF A;  3JU9 A;  1SBF A;  2Q8C A;  2DUP A;  1US2 A;  4LIV A;  5F37 A;  4RL7 A;  4CDU B;  4QGN A;  3I49 A;  2WWS A;  3WW3 A;  1AX2 A;  1LOF A;  4ZKT B;  4Q27 A;  2XVK A;  3D6E A;  1BJQ A;  5FPA A;  5T5O A;  2ZCW A;  2JD4 A;  3UK9 A;  1QOO A;  5ACA 1;  4JGY A;  2Q8D A;  3RSJ A;  2ZKL A;  2B9U A;  2P2K A;  3WIN E;  1R08 2;  3BN6 A;  3S5Q A;  4W6Y A;  1IG0 A;  1NKG A;  5E8A A;  4XBL A;  4CDU C;  5C3O A;  3A7Q A;  2ZX2 A;  1LAJ A;  1YWK A;  3B3Q E;  5AC9 3;  2EXJ A;  1H1A A;  4HVO A;  4LO5 B;  4LHL A;  2JEN A;  2GAU A;  3JXS A;  4QB2 A;  5J37 A;  3TB0 A;  1H8V A;  2VNO A;  4Q4Y 3;  2OXB A;  4M01 A;  1RHI 2;  2D5H A;  2XWB B;  3SH3 A;  5A3W A;  3VBO A;  1X8M A;  1RVF 3;  1TME 3;  2X53 S;  2GH8 A;  3ILF A;  4AQS A;  1UKG A;  4GWJ A;  3DYM A;  4WVM B;  5FYM A;  1H4G A;  3FMG A;  1ODM A;  2F4L A;  2LS6 A;  3MIB A;  4DXR A;  3VDB A;  5FZ8 A;  3M7A A;  3ETQ A;  1MQT C;  2F4P A;  4XAE A;  2IC1 A;  4I3G A;  4DMI A;  1DG6 A;  2FMY A;  3M2M A;  4AED C;  5L9R A;  3PUS A;  3VBU B;  3J7H A;  3OPZ A;  1RUJ 2;  5BNO B;  2O0O A;  1QNW A;  1QEX A;  1YQ8 A;  4HET A;  5FZ9 A;  2VMG A;  4AQ6 A;  1AYM 2;  2BUK A;  1L7Q A;  2PTM A;  1HRV 1;  1PVC 2; 
#chains in the Genus database with same CATH homology
 5IVJ A;  2VD7 A;  3U4S A;  4QX8 A;  5F39 A;  4QXH A;  2PXJ A;  5FY8 A;  5F3I A;  5FPU A;  5IW0 A;  2Q8E A;  4QXB A;  3N9M A;  5FZM A;  2OQ6 A;  5FY9 A;  5FY1 A;  5FZA A;  4IGQ A;  4HON A;  5FPV A;  5FYS A;  5FZB A;  5A80 A;  5FP8 A;  4QX7 A;  2YPD A;  5FY0 A;  5A3T A;  5FXV A;  4V2V A;  4GAZ A;  4IGO A;  4AI9 A;  2XUE A;  3N9P A;  4NUB A;  5FP7 A;  5FZO B;  3PDQ A;  5IVF A;  5FYU A;  5FZF A;  5IVY A;  4IGP A;  5FZD A;  4Y33 A;  5A7W A;  5FZ0 A;  5F5C A;  5FXZ A;  2P5B A;  3UYJ A;  4AAP A;  2YBS A;  2OS2 A;  4E4H A;  2YU1 A;  3AVS A;  4V2W A;  5ANQ A;  3DXU A;  5A3N A;  5FPL A;  4BIS A;  3KVB A;  5FP3 A;  5FYI A;  4DO0 A;  3AVR A;  5FBJ A;  2OT7 A;  3LD8 A;  2XDV A;  5A3P A;  5F3G A;  3KV4 A;  5FZC A;  4CSW A;  5FZH A;  5FYT A;  4LIU A;  5FJK A;  3U78 A;  5FYZ A;  3PTR B;  4Y3O A;  4GD4 A;  3PU3 A;  3PUQ A;  5FYH A;  4CCL A;  3KVA A;  5F5A A;  4CCN A;  3KV6 A;  5FZI A;  3N9N A;  3K3N A;  5FYY A;  5F2S A;  1VRB A;  5FZ3 A;  5FWJ A;  3KV5 A;  2YBK A;  3LDB A;  4GJY A;  5A7N A;  5F3C A;  4UF0 A;  2Q8C A;  2WWJ A;  5IVE A;  5FYB A;  2OQ7 A;  4LIV A;  3N9L A;  5F37 A;  5A7S A;  5F2W A;  5FUP A;  5A7O A;  5FZL A;  4EZ4 A;  3ZPO A;  4HOO A;  3AL5 A;  2YBP A;  4GJZ A;  4D6R A;  2OX0 A;  5FPA A;  4CCK A;  3NJY A;  4CCO A;  4TN7 A;  4EZH A;  4XDP A;  2Q8D A;  5LWB A;  2GP5 A;  2XXZ A;  5A1F A;  4QXC A;  5IVB A;  5A7Q A;  5IVV A;  3N9O A;  5FYC A;  2XML A;  5E6H A;  4CCJ A;  5LY2 A;  5FZG A;  4Y4R A;  4ASK A;  5FZ7 A;  3RVH A;  3PU8 A;  4UF0 B;  5CEH A;  2YU2 A;  3KV9 A;  4DIQ A;  2GP3 A;  4BU2 A;  5FZE A;  5LW9 A;  5FY5 A;  2W2I A;  5FXW A;  5LY1 A;  3PUA A;  4XDO A;  5FP4 A;  5FXX A;  5A7W B;  5A7P A;  5FZ6 A;  5FPB A;  4LXL A;  3K3O A;  5FJH A;  5FY4 A;  5F32 A;  5FZ1 A;  5FZO A;  5ISL A;  5A3W A;  4QU1 A;  5FWE A;  5FUN A;  4EYU A;  5K4L A;  3OPW A;  5F3E A;  5FZ4 A;  5FZK A;  5FYM A;  4D6S A;  4BXF A;  5IWF A;  4CUG A;  3PUR A;  3N9Q A;  5FP9 A;  4URA A;  5IVC A;  5FZ8 A;  5KR7 A;  3DXT A;  4LIT A;  3AL6 A;  4CCM A;  4C8D A;  3OPT A;  3PUS A;  4D6Q A;  5FYV A;  2WWU A;  5A1L A;  5FV3 A;  4QWN A;  5FZ9 A;  5F5I A;  5FY7 A;  3K2O A;  3ZLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...