4URAA

Crystal structure of human jmjd2a in complex with compound 14a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
349
structure length
349
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Optimisation of a triazolopyridine based histone demethylase inhibitor yields a potent and selective KDM2A (FBXL11) inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4uraA01
2OQ6A 5IVBA 5FYHA 3PU8A 4CCLA 4IGOA 3K3OA 5FZCA 3K3NA 2GP3A 5FPUA 5FV3A 5FZ1A 5FP8A 3PU3A 4IGPA 3KVBA 4LIUA 3ZPOA 5FZFA 2YBSA 3AL6A 4CCKA 5LWBA 4QWNA 5FUNA 4DIQA 3OPWA 4QX7A 5FYYA 5F5IA 5FY5A 4AI9A 5ISLA 4EZ4A 4XDPA 4D6SA 5E6HA 3PURA 5A7OA 5IW0A 2OS2A 5FYIA 4QXHA 4CCJA 4DO0A 5FP3A 2WWJA 3PUAA 5FP4A 5A1LA 4LXLA 3PDQA 5FYZA 3LDBA 5A7PA 2Q8CA 3KV9A 3LD8A 4Y33A 4LIVA 4EZHA 3PTRB 5FZEA 3RVHA 3N9OA 2Q8DA 5FY8A 3AL5A 4ASKA 3PUQA 4EYUA 5F37A 3AVSA 3KV4A 2XXZA 5FZBA 5FYBA 3DXTA 5F32A 4V2WA 5A7WB 5FZDA 5F2SA 4UF0A 1VRBA 5FPVA 5FY7A 3KVAA 4C8DA 5FY0A 5F3EA 5A3NA 5FWEA 2OX0A 5FZMA 3NJYA 5FZLA 5FWJA 5F3GA 3N9QA 5FBJA 4BISA 4Y4RA 2OQ7A 4GJZA 5A7QA 5A7SA 4XDOA 2P5BA 5FZ9A 5A80A 5FYVA 3U78A 5FP9A 2YU1A 5IVFA 3K2OA 5F3CA 2PXJA 5LY2A 3KV6A 4TN7A 2OT7A 3PUSA 3U4SA 3KV5A 4IGQA 5F39A 5FZKA 3N9LA 5FYSA 5A1FA 4Y3OA 5FJKA 4CCNA 3OPTA 2WWUA 5FZOA 5FZGA 4CCMA 4QXCA 4CSWA 4BXFA 4QX8A 3DXUA 5KR7A 5CEHA 5F3IA 5IWFA 5IVEA 4CUGA 2Q8EA 4NUBA 4URAA 2YU2A 5ANQA 2W2IA 2GP5A 4HOOA 5FXWA 5FXVA 5FYUA 3N9NA 3N9PA 5A3TA 5FXXA 5FZ7A 4E4HA 2YBPA 5LW9A 5FY4A 5IVYA 4CCOA 4D6RA 4UF0B 5FZIA 4HONA 4LITA 5F5AA 5F2WA 5IVVA 2VD7A 4AAPA 3ZLIA 5FZ8A 5IVCA 5FZ3A 5FYCA 5FY1A 2YBKA 2XDVA 5FY9A 4QXBA 5FUPA 4V2VA 5FZ6A 2XUEA 5IVJA 3UYJA 2XMLA 3N9MA 4QU1A 4BU2A 5FYMA 5A3PA 5FZ4A 5LY1A 5F5CA 2YPDA 5FPBA 5FYTA 5FPAA 4D6QA 5A3WA 4GJYA 5FXZA 5FPLA 5FZOB 4GAZA 5FZHA 5FZAA 5A7NA 5FJHA 5FZ0A 5A7WA 5K4LA 4GD4A 5FP7A 3AVRA
chains in the Genus database with same CATH superfamily
1ZYBA 2VNOA 3D82A 2ZHNA 4FQZA 4GMP1 5ANNA 1W2TA 3BTZA 1LESA 4ZS2A 1PO21 5DAQA 1QQP2 2A6VA 2BWCA 3RDIA 3I97A 2D6LX 4A41A 1S55A 1Y4WA 4AFCA 3KF3A 3T0AA 5AC92 3S5AA 4KWLA 4ZZ5A 1FXZA 2CAVA 1OFSA 1V9U2 2B9VA 2JE8A 3MV11 1VMJA 4EN6B 5C3SA 3V0BB 1QH7A 1QNYA 1CAVA 5L73A 1NQJA 2XKOA 1BEV1 3LEMA 4YVWB 4YZ1A 3QLQA 3V0AA 4DO0A 2FDIA 1VJ2A 4K9SA 1HRI3 5C3PA 3HNBM 4YW4A 3H1WA 4BH9A 3H1YA 5A6YA 5ACA1 1ALYA 4JRAA 3WNMA 5FO8B 2JG8B 2XQRA 4NOTA 1OPMA 4FPCA 3ROUA 3IZOA 4FQ4A 1MZEA 4EQVA 2A6WA 1HRI1 3T3YA 3L2YA 3D4KA 4V2WA 4AHXA 3C3VA 4Y1XA 1W8ZA 5C8WA 3MLLA 1CAXA 2QE3A 2R0HA 2W1UA 2X29A 1O8PA 5FWEA 1AR63 3BYWA 3T4HB 3P3PA 1RUD3 4Y4RA 3OPZA 2HJIA 1PZ7A 2HYKA 3AKSA 1NCQA 1JZ8A 1WMDA 1X50A 5GZDA 4CDXB 1NCRC 2D5HA 2OXBA 1R091 5KWRA 2XWBB 1VBC3 5C8CC 3JB4C 1PK6B 1G9CA 4Q4Y3 3PUSA 5BV6A 4B1MA 4NHMA 5F39A 1RUJ1 2J1VA 3N9LA 1FV2A 4GKYA 4IQPA 3VGIA 4CXXA 4TTGA 1UX6A 2ZGMA 1GR3A 3RYPA 3ZKUA 3HQRA 5IVCA 5C9AA 1OBNA 2X09A 2CDOA 3WCSA 4AQ6A 1ASJ2 1FNZA 4BXFA 1W9YA 5F3IA 4Q27A 1J83A 1HRV3 2P6HA 3SKJE 4Z2AA 1VBC1 4N8MA 3SH5A 1A78A 3HEIA 3SCFA 3Q8EA 5DAWA 4X8NA 1CAUA 4YW7A 5GM0A 1ZRFA 1V6KA 2RJLA 2ZGLA 2FZ2A 4RR3C 1SZBA 1PVC2 5FAXA 3OGSA 4Q4W3 3ZIXA 1SLAA 5FY4A 5EJ1B 4CUCA 4FOQA 4S2GA 2JG9A 1CVNA 5FZIA 4QX1A 3QD6A 4DXTA 2B46X 4Q8KA 1D7PM 2RG4A 3O1TA 1XE0A 5FY1A 1G86A 1AX1A 4Z1VA 3T1LA 4CP9B 1QDCA 1XYPA 1JUHA 1RUC1 3TBDA 4RS5C 5IVJA 1NOVA 3ECQA 4XUNA 5I8YA 3VKNA 2YY1A 4OHZA 1ZRRA 1ENSA 1AR71 1QY4A 5C33A 2HWD3 5FZ4A 4CU9A 4FFFA 1RUH3 1XC6A 2WSUA 2A71A 2LROA 4NR1A 3HAGA 4CDWA 5FPAA 5C3OA 2RMU3 2QQOA 1LHNA 3KMHA 4DQAA 4WVMB 2NM1A 5FZOB 2DF7A 2YYOA 1H8TB 1MEC3 2HWC2 3UGFA 4AVTA 1UCXA 1VBD3 1CPNA 1S0JA 5CFDA 2R16A 2BGPA 5BNOB 5JI9A 2HWD1 5BY5A 3VZJA 2QQVA 4HMZA 4KG8A 4MXVA 1BCXA 3SCGA 2B4KA 4XUPA 1F5JA 5K0UC 5LRRA 2J1SA 1LOAA 2AEYA 2RMU1 3AFGA 1CD3G 2EIBA 2WT1A 3GALA 3OUHA 2VZPA 2VMFA 4K1ZA 2P1BA 2DU1A 1ZRCA 1COV1 4YFWA 4CU7A 5SV5A 2C24A 3CHXA 1M06G 1SFPA 3I2FA 4PIXA 5FLIA 5ISLA 4D94A 2RS13 1D4M3 4ES9A 4M01A 1WA4A 3T4VA 1N1SA 1OMIA 1AYN2 4COWA 3H3LA 1YLLA 3CL1A 4O7XA 3M3OA 5B4NA 1UU6A 3S6PA 5JZGA 4SLIA 1NCQC 3FE5A 3LDBA 3MI8A 4ZPIA 2GMEA 1PVXA 3KV9A 5J3UA 5A3MA 1FV3A 4RGAA 1SBFA 3VHOA 2A6ZA 4OHVA 3POGA 5EYXA 5FZEA 4K8RB 1N1VA 3N9OA 3VD5A 2ID4A 2V09A 1DZQA 5D21A 1KITA 1JZ7A 5A7WB 4I0WB 4GA9A 1DQ1A 4C90A 4NHYA 2OPWA 5C9AC 1O4TA 2XJQA 1WD3A 1B09A 1HQWA 1MS1A 1ZA7A 2VC9A 3TNQA 3JD71 2NMOA 5FMBA 4DMIA 4XACA 2OKXA 2ENRA 3CQOA 1O4ZA 2IC1A 1GP6A 4FPGA 2QZ3A 1HXS2 2P5BA 2ARAA 2Y60A 3I3DA 4XFAA 5GLWA 5FO9B 1ULCA 4MO3M 3ZIWA 1PGW1 4MADA 5CVRA 5LB6A 2O1QA 1RL3A 4HPKB 3VBUA 1RUF3 2JG9C 1NAEA 3LDKA 5FYSA 5I0UA 3CLPA 4MGQA 2IXCA 4CA9A 4CXYA 3AXDA 1SPPB 2JENA 2YGLA 1W9FA 3R6SA 4N53A 1MACA 1Q8QA 1MZ5A 4GIQA 4CP1A 3IB3A 4AEDA 2VMCA 3AP7A 2AH2A 2OIIA 5I0SA 3ES4A 3ZN5A 4BQWA 2WN3A 4CDWC 4DUXA 4RA0A 1KDKA 5LW9A 4QAWA 2UWCA 2EAKA 3AZZA 4NRMA 5F5AA 3N35A 4AGGA 2A73B 1IKPA 1H4HA 1KFXL 2EIGA 1LKNA 4KGGA 5CFDC 2XLGA 5F6LB 2JIJA 1ZZ8A 4XHXA 1N47A 4DNYA 4BLIA 2YC2A 4P14A 2ZHMA 4Y4YA 1LECA 5J98B 2IVIB 3GBGA 1J3PA 5JPNB 4AQ2A 1OQEA 3CF6E 4OUSA 1NA1B 1O59A 5A33B 1WMXA 1REFA 5FYTA 4IEXA 1W06A 4EN7B 1DYOA 3IT8A 1QWRA 4Y22B 1QXJA 1IKQA 3H8RA 4CEYB 3DYMA 1NLRA 3TN92 1MZFA 3MFCA 2NQYA 5J1XA 4B4RA 5FP7A 4LA3A 2VUDA 2EXIA 4COUA 4MXWB 5BUVA 5JZGC 4CCLA 2WZR2 2BBVA 1EV11 4Q26A 3WDYA 1HKDA 2HWF3 5FQ0A 4HANA 4UFLA 1FX5A 1U12A 2GC2A 4QKDA 4AQSA 4GWIA 3EYPA 4WVVA 3H1MA 4J1XA 5FREA 5BPXA 1QJY1 4RN5A 4J1WA 1UF2C 3JQXA 2XJRA 2OA2A 2ORXA 3OPWA 4IERA 1WZXA 4XBQA 5FYYA 1G7YA 1OXCA 1S2EA 2RJKA 4C1XA 5BXXA 1JH5A 1OLQA 1CZVA 1HQLA 2YC4A 2HWF1 4XTMA 5E6HA 2WQZC 3WF1A 1W6QB 3ES1A 4NAMA 1W9SA 2NPIA 2EXJA 4R9AA 4AGRA 5KHKA 4XBNA 5D1IA 2JICA 2WRAA 1TME2 4YG3A 2WO2A 4ZS3A 2PA7A 2ZPXA 5FMCA 4ZKTB 3FHAA 5A1LA 2JDPA 4L92A 2CDPA 4IE5A 1YC61 3AX4A 1O5LA 2WNUA 4PBPA 3UGHA 2VMDA 5JPMB 1ZREA 1UXXX 4QHBA 2WNOA 4XIOA 2PHXA 3HOBA 3WDTA 3TEWA 2C0ZA 3VBSA 3E6DA 2CWSA 1IQAA 3FX3A 4FXGB 3WW4A 4BQYA 1J1LA 3Q9OA 2NYYA 3RQ0A 3AL5A 3VBUC 4XUOA 4XIKA 4EWDA 2VU9A 2W92A 5GZFA 1OVSA 3T2QA 5LBBA 4DXZA 2DUOA 5DG1A 1PO22 1VP6A 4QQPA 2W3JA 2RR11 4YG0A 2BYVE 3K4DA 2VUAA 1W8UA 4N53C 4XFIA 4Z92B 4LLFA 5A7SA 4AEDC 1W8OA 4H7LA 2WL1A 3PUHA 4FPHA 3TB0A 2ZA9A 3ZYBA 4LKFA 4YW2A 2G4IA 5LY2A 2PLV3 1BEV2 5EPAA 2GC0A 3WP6A 1O91A 5DAXA 2X10A 4G4FA 1LU2A 3MIDA 1ULPA 2XJUA 2NP0A 1N3QA 2AYHA 4QX8A 5ACA2 3BKZA 2ZGRA 3FFZA 5IVEA 4PLMA 1DQ0A 2PLV1 4PIZA 1I1EA 2VW1A 1OQDA 4MGSA 1S2BA 4MZUA 1HRI2 4HOOA 2DVFA 5FXWA 3ZFGC 3IPVA 4Z2WA 3O1PA 2QDNA 3FBYA 5FMDA 3FZ3A 4MGKE 4W65A 1UY1A 1GOGA 1ZA4A 2VZ1A 3SLIA 2PN5A 3ASIA 3U37A 4CZSA 3NV4A 2HWE1 3VZMA 4YWAA 3RZMA 1NCRB 3I2DA 5A3UA 1R092 1BHGA 2QBXA 4WM8B 4HSLA 2VM9A 4CP2A 1ODMA 4Q0VA 3KS7A 4QU1A 1EPZA 3VL8A 5JMOA 3LAGA 5DZFA 1RUJ2 1X9TA 2W0XA 3U75A 4CUBA 1F4HA 3VKFC 3PVOA 2W87A 2W5FA 1UPSA 2DVAA 2WFF3 2ZX1A 2BBAA 3ZSJA 3USUB 3WDXA 4P9GA 2DCYA 3H3UA 4ET7A 1ND2B 4AI8A 4QB1A 1VBC2 4YM3A 2G9GA 3MHZA 4RSUA 5DDJ3 5I8SA 4U2AA 5FZHA 2BPA2 1JZ6A 1J84A 2WABA 5FP8A 1XU1A 1MQTA 1OD5A 2CU5A 1VB4A 1RMU3 4CCEA 4O65A 3SHRA 3WP4A 5I0RA 1TNRA 2WFF1 4CPBD 5IHRA 2UWBA 3N4MA 2FBEA 1V6MA 3K3NA 3I3QA 2DCZA 1REDA 3M7AA 2VVEA 5IK5A 2QCSB 3QOPA 4NHXA 2QTWB 5DDJ1 2RS53 3MF9A 3VBSC 1BLZA 4E2SA 1CR7A 3C7HA 1UZZA 4A6SA 3I3BA 1OLME 3V56A 4YPJA 5L7OA 1UOBA 1RUC2 4N9HA 1JMUB 4RS5B 2VQ0A 3ALQA 1T6GC 2DCTA 4EZ4A 3PNAA 2VCCA 3AK0A 4DPNA 1AR72 4M4RA 1C1FA 1JBCA 2JEMA 4OZOA 3WF0A 5IFTA 1GZ9A 1UWWA 4UWDA 3DF0A 3C8XA 2VW2A 3RZGA 1Y9QA 3H9AA 3Q8FA 2C4XA 1RVF3 2BGCA 1NE6A 5T5LA 3CDZB 1K5MA 2D3PA 3HN3A 2HWD2 3THTA 3E5XA 5K0UB 5F32A 1W6MB 3BVCA 1GSLA 3ZN4A 3ZFEA 2RMU2 2GC3A 2VMIA 3IAPA 3WLUA 5GJ6A 1YFYA 3ACGA 4AHYA 2P3IA 1SDWA 4W6XA 2W94A 1COV2 3V64A 5JXHA 4R9BA 2BZDA 4AAXA 3MBWA 2ZMKA 4WM7C 3BI3A 2D3SA 1LOGA 5F3CA 2AGSA 2R1BA 2Z42A 2JXAA 2BU9A 1XQNA 3F95A 4IGQA 2HWB3 2VUCA 3A0KA 3FWEA 3KSCA 5JOWA 3ZXLA 3R4SA 3MGUA 4MGYE 3UKNA 5GLUA 1NX9A 2DFCA 2W1WA 3DKWA 3OGRA 3ZMOA 2XPJA 1CAWB 5EHDA 4CSWA 1LGNA 1WCQA 3WZ1A 4I2OA 5FDBA 3E6CC 3VL9A 4CUGA 2GZWA 1RUE3 2Q8EA 1UW8A 3M70A 1NKGA 1HB3A 2HEVF 2HWB1 5FUIA 1DYPA 4OQ8A 4GZ9A 5L9BA 3VDDC 2CNAA 4ORFA 2ET7A 2OW4A 3QBQA 3JD72 2ZAAA 2FMDA 1AYM3 4XXPA 3O5SA 4I0AA 4HONA 5CADA 4JGZA 5GZCA 1E5IA 3IDBB 3NJXA 2R0FA 4YVSA 3VDAA 3ZO0B 1W99A 3ZLIA 3AMMA 4RQPA 2YBKA 1MS0A 5HXMA 2WT0A 1MQTC 1PGW2 4IV3B 1C8NA 4JGYA 4MGIE 1IS5A 4V2VA 4DXRA 3AMPA 4XQWA 1FNYA 1ENRA 4FOYA 3THPA 5A6QA 1G9BA 3A21A 4BU2A 4JVAA 1J3RA 2WN2A 3POYA 3BN6A 1W3XA 2B7YA 2GMPA 3J7NA 2YPDA 2D44A 1MVQA 2AEZA 2WNVB 1C57A 3FN9A 3F2ZA 4LHKA 4MX3A 5EWSA 5L7OC 5GZEA 1R083 3HQUA 3PIGA 2Z69A 4FVVA 5FXZA 4AFAA 1AZDA 3VHPA 1GLHA 1QXPA 1WCKA 4GAZA 3VZKA 1KJLA 1JZ4A 4BPZA 4P00B 1O7FA 2OQ6A 2BWAA 3I4IA 3OF1A 2YHJA 1DGWA 3T0BA 2X53S 1UZVA 4YW5A 3OY8A 4ONUA 5FZCA 1R081 1IS6A 1LNSA 4LBKA 4HVQA 4V1PA 3GZAA 4LUMA 5CFDB 3AL6A 1GZWA 1LGBA 3ETQA 5FBZA 4PIYA 3E5UA 4PLOA 4LPLA 4SBVA 3ME2A 3RRDA 1VE0A 2WO1A 3GZUC 1ULDA 1JYIA 4LOTA 3ZFEC 1XB9A 2K2SA 1POV1 1V00A 1AJOA 2Z79A 3M1HA 5T54A 1UMZA 3AJYA 4QXHA 2FCUA 2WLQA 5G04L 5H9QA 5B4XA 1PIV1 2WNEA 5FCCA 5CNAA 5EJZB 1CQ9A 2PMWB 1Z7S3 3VBHA 5DPNA 5KXBA 4YGEA 1BJQA 1WBFA 2D6OX 2VQTA 2Y6FA 4LBJA 5ERLA 4Y20B 3PTRB 2ZTNA 1HN0A 2J1TA 1PMHX 2VZTA 1AF9A 4NO4A 3WNLA 2ZXQA 3BOWA 4CCDA 1H6XA 2PQSA 3PUQA 5HCFA 3ZSEA 5F37A 4ARYA 1LEDA 4HETA 1EV12 2KM2A 2OVUA 1RHI3 3UKTA 3A0NA 1PO13 4AZZA 1S2KA 1JU4A 1ST8A 3ZMNA 4C8DA 3K4AA 1LHWA 2WAOA 4EN9B 2ZEWA 4BQ3A 5FWJA 1QJU3 1X7NA 4M00A 4QQLA 2SLIA 5I0DA 3GBFA 2QQKA 3ELNA 5E8AA 4HKLA 1QJY2 2LRPA 2AUYA 4Y26A 1TQ5A 1JN2P 2HBTA 3E5QA 2HWF2 1ZBE1 3UL2A 2JDMA 4NHKA 4PI0A 1VBE1 3BALA 1GV9A 3AC0A 3KGLA 4JGZC 5T5PA 1VAMA 4LBNA 5GLZA 3OPTA 1W8NA 4YVSC 3VD4A 3HR9A 4RQPC 4XZUG 2DBNA 2C1FA 1HJGA 4JGYC 2ZX4A 3CIHA 5L36A 3POSA 5LA1A 4LE3A 1ODNA 4HXCA 2ZACA 5FYUA 4ZXEA 5LK5A 1JOJA 4CRQA 1NQDA 4AXOA 1HB1A 5AFEA 2RR12 4AEMA 4C91A 3VZOA 5IVYA 1YI9A 1YWKA 3HPNA 3OEBA 3TYJA 4ZU4A 2A70A 3L2HA 4YW3A 4CP0A 3DCQA 4XXAA 5JDBA 3ACLA 3PHMA 1LU1A 3FMGA 1VAVA 2XMLA 3UYJA 2KR2A 2BVVA 3LQCA 5DZEA 3VBFB 4Q4V1 1OUXA 3SH3A 2WS93 2NZ9A 2R073 1UPIA 1W9WA 5F5CA 4M4PA 4IL7A 3C7GA 2QDRA 3C7EA 5IFPA 5FMOS 5FTTC 3TOJA 4EJRA 2VW0A 2Y0OA 2ZGTA 3BB6A 2PLV2 5T55A 4P02B 4FCAA 2IXJA 1Z78A 3ZFGB 1B35B 2VZUA 5CFCC 1W6NA 1VALA 3WW1A 3JZVA 3RMXA 1RITA 3I2GA 3MIHA 3H7YA 3VBHC 1JODA 2ILMA 5GALA 4YG6A 4JV4A 2XVKA 3FJSA 4IV1A 2HWE2 4XFHA 1ZRDA 4P5YA 4FFHA 3GBWA 4QX0A 4R4XA 4S2DA 3U1XA 3HWJA 3V65A 5FY5A 1LR5A 4AI2A 2D40A 3J7LA 3VHNA 3CZJA 5A7OA 2UY8A 1OLRA 2E51A 2HLEA 3BPZA 3ZFFB 1DG6A 1XYOA 5K7PA 1WUVA 1Y7BA 3K4ZA 3U10A 4S2FA 1CGPA 2Q8CA 1FOD3 1TE1B 3J4UH 1RUI3 3GJBA 5H9RA 3ZSLA 1AUYA 5CISA 1QJFA 3AKQA 3LDRA 4YM2A 3HNYM 4K3UA 2GALA 3WF4A 2TUNA 2VCAA 3AFKA 3FLPA 5IAXA 3EHKA 2WFF2 5D8AB 5FY7A 2VR4A 4Q4X1 5FPVA 5FZDA 2JD4A 3WP5A 3WT3A 3W21A 1STMA 3WW3A 1J1TA 1AVBA 1FOD1 2CGNA 5F3EA 3TRSB 3RJRA 5A32A 5DDJ2 3ACFA 2BVBA 3N9QA 1TVGA 2XGXA 4IEZA 3USSA 3VZNA 3NJZA 2R043 5FK8A 4CDQA 2VCBA 3OUIA 4UFKA 1S0IA 5FP9A 3OTFA 3VBOA 3ZKYA 1UU5A 3URFA 2CWMA 4NIIA 1ULOA 1IS4A 4JTNA 2GNDA 5DAPA 2BFUS 2BOJA 3A22A 2Z5WA 5FZKA 1ULFA 2R063 1DBNA 3D5OA 2BDRA 1WCUA 4NPLA 4XMIA 2JDHA 2MEV3 1OF4A 2R041 1DQ5A 1C8M3 2AR6A 4K1YA 5IYYA 5CB7A 4FAGA 4K20A 1K42A 3SC7X 3ZN6A 4A4AA 2WA4A 4JAAA 1JZ5A 2EICA 5H9PA 4URAA 2R061 2VZSA 4IXLA 1Q56A 3AZWA 3GDBA 2H6BA 2MEV1 1Q8OA 1CN1A 1GNYA 2PHLA 3BGAA 2WWSA 1NUKA 1R1A3 3ZXAC 5FR3A 1UYYA 1C8M1 4IDZA 4PLNA 4AOCA 2LM3A 3C7FA 4D6RA 1U5YA 1CX4A 2ZOEB 5FRAA 4J6GA 3OYWA 1VRH3 2PHWA 1OUSA 3W5NA 2WINB 1V6IA 1L3JA 3AYAA 4QPIA 4J25A 1OOPA 4I01A 5G05L 1AR61 2V4VA 4WM7B 5T5OA 1RUD1 4CDUA 3AYDA 2VL4A 4BK5A 2FQPA 3KB5A 4P9IA 1ND3A 1OFNA 2OZ6A 2B42B 4XCBA 4QX3A 4OLLA 4D7TA 1CZSA 2IVJA 4ZU5A 4IV1C 1VRH1 1HX6A 1UQXA 2BNNA 2VXRA 4Q4Y1 3BODA 3DPRA 4ASLA 3NKTA 4GB33 4P5HA 1J58A 1VBB3 1EP0A 1G8WA 2VMGA 2ZGUA 3GZTB 2HWB2 3LA7A 2Q1MA 4GH4B 5FZ0A 1EAH3 1K45A 3VDDB 1ZZ7A 1HRV1 1LOFA 2DBIA 1H4GA 4MVTA 5HCBA 4CU8A 3PJQA 2GH2A 1KXGA 3NAPB 5BNPB 2DCKA 2D93A 5FV3A 4M3CB 4Q4W1 2F4PA 4YYOA 4TYSA 1QNWA 5LWBA 1IOAA 3A7QA 2KD7A 1I6XA 2P34A 1DGRA 2PHRA 4EE2A 3OD0A 5EXOA 3O1MA 4ASMB 4NVPA 3H50A 2K46A 3N7MA 2PELA 5JAXA 1KDMA 1PMJX 3VD3A 4JRLA 1UN1A 2DUQA 2ZGQA 3EQEA 3N3HA 1A34A 1CZTA 1GUIA 1CONA 1WW7A 4LBQA 2PHFA 4PJYA 4CDQC 4D69A 2V72A 3D6EA 1U5ZA 3D0JA 4UFIA 2ZGPA 4XUTA 5C4WB 1RUH1 4QXKA 2VOXA 4LHSA 4A7KA 1GOFA 1ZZ9A 5FYBA 1MEC1 5T3NA 2GN3A 2XL7A 1Q5OA 1VRBA 1VBD1 1QKQA 4Q5OA 4ZONA 1O4YA 4AI3A 5CFCA 1R082 5JMCA 2IUWA 3CJIA 1OKQA 2WO3A 2C9AA 2CY6A 3H3ZA 1W8FA 3I7DA 3NJYA 1UO9A 1BK1A 3CMGA 2W68A 3T30A 2VOKA 3LOBA 2XBO2 2P17A 5ABJB 2YU1A 1GYKA 4LHLA 3ZVXA 4YFZA 4FT8A 2DTWA 4BQ4A 2O8QA 4XYXA 2VECA 3KV6A 2XWJB 4GKXA 4GULA 2Y6KA 4Q2FA 4CEWB 4E8CA 4Q0UA 4K6BA 1VIWB 5JR7B 2RS11 4LLOA 1D4M1 1PIV2 4CCNA 2A3YA 4DUVA 4QPIC 5CZKA 1OOPC 1YIFA 4QXCA 1TEIA 3WVJA 3W58A 1RB8G 4CDUC 3POJA 1PGSA 1ND3C 4L97A 5KHIA 4C0BA 2D98A 1K3IA 3VBRB 2GDFA 2GP5A 4NJ4A 1OT5A 2Q0AA 3I54A 3ZSKA 3KD4A 3NV3A 5A6XA 3N9PA 3DPRC 2DVDA 2QUOA 3SXWA 5KXDA 5K9YA 2JB4A 4PT6A 1MPXA 1SMVA 5EJ3A 3M3QA 3DECA 3FUOA 2K0GA 2CSGA 1LOFC 4HG6B 3WX5A 2VTXA 4HVOA 4AGVA 4W50A 4EN0A 1QU0A 4YZ4A 1ZBE2 1ZZCA 3VDCA 3OJBA 4QPGA 4P9JA 1VBE2 4E9KA 1JI6A 1WW6A 4M0HA 5CG9A 1SQ4A 3JB8A 2A75A 2EIEA 5EYYA 1MS3A 5HCHA 1RUF1 3KQRA 2E63A 2WAAA 3NV2A 1YRZA 4FPYA 3UK9A 2QQNA 3DUIA 4UFHA 1UU4A 1Q3EA 2IFWA 2HYXA 1HIXA 2IXKA 2UURA 3AVRA 1XSRA 5DZGA 3TEYA 5FYHA 1YFXA 1Q8SA 1K5JA 4M0NA 4M3CF 4YM1A 4LNVA 4OI0A 3J8F3 3GNEA 3IN9A 5DG2A 2VUJA 2GP3A 4O61A 4B4QA 1SLIA 3BPSA 1W6PA 3KHBA 4UW5A 1PNFA 2GNTA 3PU3A 5EV7A 2RDSA 4ITCA 2Y64A 4OVEA 3VV1A 4FPFA 4TWTA 2E33A 4BQ5A 5GLTA 2E6VA 1I5ZA 2X5IA 4RL7A 3OUJA 4XF4A 1CJDA 3I3EA 3B3QE 1OURA 4KH9A 4Q4V2 3CJIC 4CCJA 3WG2A 4ZZ8A 2OPKA 1V6NA 2IXIA 2PYTA 4OUEA 4ZU7A 2P3YA 3OEAA 3Q8BA 3LPFA 3W9AA 2GC1A 4DY3A 2VOWA 1GNZA 4Z8BA 3KF5A 1O3RA 2IXHA 3WD5A 1SLLA 2G9ZA 4BYYA 3JUUA 1BK0A 4IEYA 4A7ZA 4XABA 5FY8A 2UYBA 4DUWA 4N43B 2QQLA 4H3WA 3TWIA 2P4EA 3NV1A 4OHYA 4A42A 5F8PA 4BHPA 1UY2A 1VBA3 1GP4A 1AL0G 1LOCA 2QKDA 2E31A 2V73A 3DGTA 1YNAA 3MW2A 1O3SA 1BXHA 3EJKA 3NW4A 4AW7A 2OQ7A 3WNKA 1GICA 4BA6A 5T5JA 4XDOA 2VMHA 1YCIA 5FZ9A 4D3WA 3O1RA 1S4CA 3I59B 3NJVA 1A8MA 2BUKA 2XJVA 3I2JA 4RYDA 4KMQA 1QGLA 4LJHA 3BCWA 4I09A 2VQUA 1E5RA 4IEPA 3JQWA 1BBT3 2XUMA 3AXEA 4RGGA 2FZ1A 4XE9A 2Q30A 4BWOA 4OUMA 5CKQA 3SEPA 4PDWA 4D0QA 3DXUA 2W9XA 5C71A 3BTXA 2W91A 5IWFA 2P6CA 5HV0A 1IPKA 1FMD3 4QPGC 3WNXA 1QIQA 4HT1T 2YROA 1O3QA 2K9ZA 1NLQA 1GP5A 2A6YA 1SCRA 4JCKA 1JOBA 3KLSA 2WJSA 3EO6A 3FLRA 4Q4X2 1DGRN 5E88A 3U07A 5JSPA 3GGLA 1URXA 4LMFA 3UNPA 2YBPA 3FC0A 1FOD2 1XNKA 1MS8A 2JE9A 3J7HA 5HV4A 4UF0B 1IS3A 1FMD1 1W8HA 1LENA 3HMYA 4F8AA 3V0BA 2HBUA 5FZ3A 1DQ4A 4XQDA 1XNCA 1W03A 2W1QA 4YVWA 3SISA 1E57A 1X36A 5EQUA 3JU9A 3AMQA 5EP9A 1N1YA 1GZCA 2P2KA 3RZZA 3I2OA 5DMYA 4QQOA 4BCUA 5A3PA 4GALA 1US3A 3B02A 1XPWA 4Y1YA 5DUWA 2R042 4QDQA 5LY1A 5LEKA 1QDOA 4OHWA 2QZ2A 5FPBA 1F2NA 2JG8A 3HBKA 4R9DA 5T50A 4Q1PA 5A3WA 2ET1A 4B8EA 1AR83 1C1LA 2X5IC 1OLMA 3APBA 3M2MA 3U4XA 2GU9A 2R062 4H55A 2FD8A 1WW5A 2MEV2 2VY0A 4LORA 1DGLA 1C8M2 3MPPG 1F5FA 1AX0A 2XVLA 1ULEA 4CXWA 4DXSA 1ENQA 1S1AA 1AR93 3G7DA 4IEOA 5A6ZA 1QH6A 2WIIB 5C8CB 5FZ1A 2ERFA 4CDXA 2YBSA 1TNFA 4QWNA 4XJUA 1AR62 3O14A 1PK6A 1RUD2 4FPKA 4QGLA 4HFSA 3A4UA 5F5IA 2DWRA 4LUKA 5IW0A 1AR91 3DN7A 1W6OB 4IV1B 1VRH2 3WSOA 5FP3A 4Q4Y2 1W2AX 2PHTA 4GMP0 4ZXKA 4DFSA 5BNNA 4FO9A 4CCCA 4KGQA 1V70A 4FPEA 4RR3B 2ZX2A 3I2KA 1UKRA 3ITQA 3L9JT 1ONAA 4OFGA 2B9UA 3RVHA 5IT6A 2B8MA 2WNUC 5JOZA 1UAIA 3MIFA 4MUVA 2E7AA 1HRV2 2VXJA 3AVSA 2XXZA 3D8CA 4E4DX 2NN8A 2YPJA 4K21A 4JTOA 5FPXA 3FUQA 1YQ5A 1RMU1 1V9U3 3WF3A 2NLRA 2ZHKA 4Q4W2 1LGCA 5F3GA 4FBFA 4CP9A 2B5HA 4XF3A 3ZXGA 2ZEYA 3H8UA 3QCWA 1Y3TA 1DQ2A 2ZKNA 2BV4A 4Y5Z0 4IE4A 3RMYA 4YLZA 2RS51 5C6CA 4AVSA 1SLCA 4LT5A 3M4FA 1V0AA 2VZVA 3GJAA 1F9KA 2OZJA 4JDNA 2JDAA 4N7IA 3O1SA 3ZYGA 1CAVB 5A1FA 1PX3A 5CKNA 4Y3OA 4WVMA 5FZOA 5FZGA 5KHJA 3N36A 1H8TA 2JDNA 3V0AB 2QQIA 2QJVA 4LBOA 2XQXA 3DYPA 3TNPB 2F4LA 2XR4A 4YVWC 1RUH2 5A1AA 5BNOA 5FFOC 2DUPA 4NUBA 1PM7A 2W39A 3ETPA 1NXMA 4KG0A 1MEC2 4WVWA 1UY0A 4D7SA 1RVF1 1VBD2 3IDEA 4I3GA 5FXXA 2WZEA 3ZXKA 3T0DA 2BJSA 2JG8C 4NRPA 3RJ2X 1ZBA3 2UYAA 1V6LA 1GWMA 1A6CA 2P3JA 3UKVA 5FLJA 3WNPA 3ON7A 2IXLA 2VD7A 1CAXB 4AAPA 1GKBA 4LO8A 3POBA 1PHMA 3ABZA 5FKBA 3ZYRA 5L9VA 1NCQB 4YZ5A 1RGSA 5JXGA 3TEXA 3LE0A 4I02A 5T52A 1ZBA1 3LZZA 4P08A 4P9WA 3IMMA 2RS12 1ASJ3 1D4M2 3P5BA 2ZBJA 4CDXC 1QOOA 2RDRA 1DYKA 4D6QA 5LRSA 1PK6C 5JOYA 3SCHA 3AMHA 1GMMA 5FPLA 3B01A 5DXDA 5C5TA 5C9AB 1K12A 1UYZA 3AZYA 4ZHNA 3IIAA 5A7WA 4AFBA 3LFIA 1CIYA 2XLFA 1JU3A 2YB7A 4XJZA 1RUE1 4IGOA 1CAUB 4DY5A 5BNNC 3GCXA 1W3VA 2E26A 2L9LA 4ISQA 3H8XA 4LA2A 1N1TA 1KD7A 1OHFA 1O6UA 4XW3A 4FOWA 4QKBA 3OSDA 3O12A 4IEWA 3FFQA 1SG3A 2JG9B 2ES3A 4NWWA 1AYM1 2Z4FA 1H30A 4HPKA 4IEQA 4H7MA 5AVPA 5HI0A 1I9RA 3PJYA 4HBNA 3O7OA 4L9BA 2YMZA 5E16A 3WXPA 4ZY9A 2PHUA 1OKOA 1DU3D 4X6QB 3LWCA 1XXNA 1HV1A 1C4RA 4Q29A 2IZWA 3S30A 3ZYIB 1SPPA 2TBVA 4KWUA 1H6YA 4FPLA 1RUF2 1ZZBA 2HWC3 3MIEA 4JHZA 4LKDA 4NPMA 5JWPA 2VBDA 2FMYA 1S0CA 3HIFA 3CEWA 2FCVA 4CDWB 4LIVA 3PTYA 5FIXA 3JCIA 4NAOA 3T1MA 4ASKA 4L8QA 4COVA 1SHWB 2WO7A 4NHLA 2JDUA 2Y6GA 3SITA 4AHZA 5F2SA 1XSQA 1H8TC 2A6XA 4YARA 1K5MC 1HJFA 2V5DA 3WG4A 5EIYB 1W04A 2ZEZA 5FZLA 5BNOC 1NYWA 5A7QA 5C70A 5KXCA 3IMNA 3S7EA 2RS33 1AYN3 2XJSA 1PM4A 4XTPA 3AP4A 3WNNA 3RYKA 4PF1A 4AQTA 3RI8A 1JXNA 4BOWA 2ZS6B 1NA1A 5A33A 2MHFA 2D5FA 1OI6A 3POWA 4OZXA 3WDVA 1WGPA 3NNGA 1YEWA 2QQMA 4K40A 1C28A 2BP6A 4Y22A 5CIRA 1JTZX 2JDZA 3UJOA 3MICA 4B4PA 1ZNPA 5L19A 2RS31 1R1ZA 3EXUA 3SNMA 2JE7A 3I3MA 3D0SA 1POQA 2R6QA 3HVDA 4A3XA 2Y8KA 3NVCA 1JHJA 5A3OA 4CEYA 2CYFA 4DEVA 2PAEA 1Q8PA 2BEOA 4HN0A 4XUQA 1Z7S1 5IK4A 2MNGA 1DHKB 3HNMA 2Y33A 5LA9A 2WBKA 3ZDSA 3P3NA 1KJRA 1LRHA 2RHPA 4FFGA 2XH6A 5JSRA 3RNSA 1UKGA 2YV8A 2JKXA 4D8MA 1G9AA 3WDWA 3WHTA 1RHI1 1I3HA 5F2WA 1PO11 3G6JB 2ZMLA 4KWKA 2TNFA 2ZGSA 4E4SA 5L9RA 3T2PA 3DYOA 2BTVC 4NMIA 1QJU1 1W6QA 2WT2A 3HN1A 2X8KA 2YFZA 2Y34A 4DOUA 4QU2A 4UI9L 2Y38A 2VG9A 3K51A 1LOEA 1F15A 1MS4A 2WKKA 3NNFA 4IE0A 3S5QA 4Q0QA 3VBUB 4DB5A 1D2SA 1YUDA 5BNQA 3U14A 3LSDA 3WQ0A 4F7ZA 3M3IA 4XHBA 5J09A 3ZXDA 1H2NA 4KU8A 3LB9A 4N53B 4BQXA 5IVBA 2WQ4A 3OGGA 1E5HA 2CTVA 4AEDB 1IG0A 1BYHA 1XE7A 5I0TA 3ZDVA 2QQPA 1OD3A 1FMD2 3KCYA 5M0TA 5B2GB 1LHUA 1C3HA 3ZPOA 3O0WA 4YM0A 2BNMA 2ZGKA 3WV6A 3WF2A 4QM9A 5FUNA 5LA2A 3AM2A 1LTEA 4XF0A 5E89A 1IG3A 3EBRA 2ZKLA 3AZXA 2H6CA 2OS2A 3NKGA 2WA3A 3AP6A 2QQUA 3VHRA 5IATA 2FHRA 4XILA 3RS6A 5FP4A 3ZR6A 2D6MA 2WS91 1DIWA 1WA6X 1YQ2A 3MIBA 1SBEA 2R071 3OBAA 4L2NA 4XMAA 3VD9A 4MG2A 2CGOA 3B00A 1H2LA 4AFMA 1NA1C 1LODA 2WZR3 1BVP1 4QHOA 3SMHA 1PX4A 3VKMA 4K7JA 5FZBA 1WKYA 1H9PA 5J36A 4QX5A 1V6OA 3LSEA 2FDHA 4UFJA 1W2OA 4CEYC 2RM23 4Y24A 3MPBA 1GNHA 1NCRA 2PAMA 5FQ0B 1X8EA 4NIGA 2VPVA 1O8SA 3PVBB 3ZYJB 1QHDA 4WM8A 3ZXJA 1LAJA 1OA3A 1NZIA 3ILFA 5TSWA 1PGL1 4F3JA 4HLTA 2PXJA 4X6RB 3EB7A 1AR92 2R1DA 5IAVA 4Q0PA 3KV5A 2RM21 3HT1A 4XJ8A 2YZ4A 3USUA 5H9SA 2WWUA 1ND2A 4CCMA 1TMF3 1S0BA 4RFT0 3H8OA 1OSGA 1US2A 3R0RA 3LOIA 3QH6A 1GFF2 4HK9A 4QMAA 1F4AA 4CE8A 1EY2A 2O14A 1RC6A 3IM0A 2WNUB 1QJX3 2W08A 4H2AA 1HV0A 4XVHA 1SEFA 3R05A 3FHIB 1PO23 1HQNA 4U36A 3UETA 2W2IA 1RUI1 3VBSB 3IDAA 3ZXFA 3GCWA 3SH4A 3N9NA 1TMF1 4YRDA 4E4HA 3THCA 3AKTA 5FK7A 4W8JA 3J7MA 1RMU2 1Q8VA 1XNTA 4NIAA 1J59A 4LE4A 2XJPA 1QJX1 3KT1A 3RFRA 5IVVA 1YFWA 4RS5A 3WCRA 3OCPA 5FZ8A 2BGOA 3E97A 3DV8A 3K75B 4CYDA 1BEV3 1ZVFA 2RS52 3E1F1 2EVXA 3RZLA 1REEA 2DYCA 4QKFA 2QFEA 3MDPA 2XKPA 1Y9MA 2XVGA 1DF0A 3QH7A 4QKNA 1YJKA 4GWNA 2XHNA 5KC5A 1VMHA 5ACA3 3SKVA 3WQ1A 2GMMA 3AMNA 4CUAA 4LK6A 1JS9A 1XOYA 1XJAA 4XFBA 3RGBA 1L7LA 4BK4A 3MFAA 3BU7A 1NY71 1NLSA 5LBEA 2X05A 2O0OA 1WW4A 4MYEA 1EPWA 4Z07A 3LPGA 5K0UA 1W6MA 1RINA 4BB3A 1IHMA 1T2XA 3O1UA 1QJZA 4K8FA 4Y5TA 2DURA 3WQBA 3K77A 3KHCA 2VGDA 4YW1A 1JYNA 1ZZ6A 1RVF2 4AEKA 3GM8A 4UBHA 4IUGA 2DCJA 5J48A 1YQ8A 3JXSA 4YZ3A 1VLNA 3BTAA 3IPVB 4XF1A 3RWKX 1SACA 2E7TA 3T08A 4HN1A 3A23A 1R1A1 2O8OA 3KVBA 1R093 3P1IA 5FOJB 4NWVA 4XBLA 3AZVA 4JKMA 1C5IA 3ZFFA 4INDA 4JQTA 1JYXA 1RUJ3 4QGMA 1RIRA 4PI2A 3T2TA 3LF7A 4IETA 2BRTA 1ZBA2 4XDPA 3VD7A 2CGPA 3M3EA 4QM8A 3RZJA 3THDA 5FYIA 2E53A 4FPOB 1SCSA 2PHDA 2P37A 2YXSA 1CAWA 3I8TA 4JC1A 2WC2A 1AHSA 1CESA 1LOBA 4WM8C 4Z82A 1IPSA 4FI9A 3RWNA 4HZFA 1QMJA 1RUG3 5D2AA 3CJXA 1MS9A 4EZHA 1WMFA 1SDDB 4GB31 4NE9A 3WEZA 2YGMA 3GZEA 3WUDA 4P9XA 2EAAA 3DXTA 3WP3A 1RUE2 5BNNB 1VBB1 3WUCA 1ND2C 4B7EA 3B9IA 1JYWA 5J7MA 5EFUA 4KL1A 1EAH1 2AREA 4JX0A 4RGKA 1MQTB 2ORZA 4W6YA 1W2NA 3NNJA 4LO4B 1RUG1 4NN0A 4KBZA 4LR4A 3ZYHA 1RUC3 4BIOA 4IV3A 3ZXEA 1AYM2 4I30A 3C2UA 5FYVA 1O5UA 1F35A 4TLGA 1ENXA 5IVFA 3R4DB 1OVPA 1AR73 1NE4A 1XNAA 2GN7A 1FPN3 2RVAA 1KQRA 4KQ7A 4W4ZA 5E1RA 1FI2A 5L7OB 2ETEA 2OT7A 2UU8A 2R32A 3U4SA 3ZYPA 5A70A 1QEXA 2WNVA 4JDMA 3VBOC 1F8VA 3MF6A 1NZCA 2ZEXA 2I2SA 2D43A 2J1RA 1OH3A 4DEQA 2GNMA 4YZ2A 2VJXA 1W8TA 4LKEA 5KR7A 5CEHA 4G9SB 1FPN1 3LIHA 2XOMA 2HEWF 1V6JA 3POFA 1HN1A 2BERA 2PFWA 2YU2A 1CX1A 4NRQA 3R4UA 3OBZA 4W6WA 3ST7A 1JUIA 4BMBA 3B9CA 1COV3 1K5MB 2VCMA 2RJ2A 3ACIA 1GBGA 4KNCA 5CA6A 2VO5A 1WLTA 2EIDA 5F6KA 2J1UA 2VTXJ 3ZFEB 4BXSV 2VNRA 4E2GA 2DVBA 5JSOA 4LBLA 1X9PA 4LHNA 4DINB 1VAKA 4FTBA 2HEYF 3HT2A 4IEVA 4QXBA 4YGDA 1U5IA 5GZGA 2G19A 2ZZQA 3I49A 5JUVA 1P8JA 4R52A 1RYYA 4RHV3 2PTMA 2RS32 4OMDA 4Y20A 2JDKA 1LCLA 1F31A 5IJRA 2BQPA 3OGJA 1XE8A 1W90A 2RV9A 1Z7S2 4MSVA 2VTFA 4XDQA 2WQ8A 5KXEA 1DDLA 3KCXA 1AL23 1FATA 3NQHA 1ZM1A 3JD73 2XONA 4HKOA 4XFGA 4LK7A 4RHV1 2ADEA 5CAZA 4OYUA 3WDUA 5C3QA 3JBG3 4L99A 4AL9A 2JB8A 5F1RA 2LW8A 3N7JA 2J42A 3NSTA 1H1AA 3O0VA 3PMEA 1RHI2 4XPVA 4XQ4A 1PO12 2ZX3A 2Y0IA 2YG0A 1YYNA 1WD4A 1AL21 1YFUA 3IBMA 1QJU2 4JGZB 4DIQA 3POIA 1LJ7A 4YVSB 2A1XA 3WW2A 3ZR5A 2J1EA 3JBG1 4OMCA 4RQPB 4UFMA 3PURA 3RI9A 1XNDA 4JGYB 4KBBA 3FLTA 4FP2A 4BLJA 4IV3C 1SLTA 5FYZA 1D0GA 1E5SA 3PLQA 2A7AA 2VNGA 2Q8OA 3B7MA 2AZ5A 4Y1UA 2GSYA 4Y33A 2XLAA 2HH9A 4N7UA 4AVVA 5I93A 2WNVC 5LA0A 5LCWL 2D6KA 4UOJA 2G1MA 5F5QA 3BTYA 1KRIA 4CTEA 4EWAA 5HXVA 3UT0A 1DZTA 1DFQA 2JWPA 1D4VB 3KVAA 2YUEA 3Q8AA 1POV0 4XURA 4A44A 2ADDA 2OUHA 5FBJA 1ZX5A 2VOVA 3OY8B 3J8F1 5LBCA 2W95A 3KM5A 4Q8LA 1PNGA 4R8HA 1JYTA 1TG7A 2OUJA 3VBFA 1GZWB 2ZX0A 3I2IA 1OQ1A 4NROA 2W1SA 1W28A 1H1MA 3LCPA 4FSJA 1OF3A 1JHNA 3OG2A 5FJKA 3H0OA 2C9KA 2D7FA 4AR2A 4WVZA 5LBFA 2WS92 1S0EA 4WBBA 2R072 3WHUA 1X33A 2VAUA 1NXD1 4P9LA 1KEXA 4HSJA 2MPFA 1RJ7A 3VBHB 3ZFGA 5HPOA 1B35A 2AC1A 2NMNA 2VULA 1EV13 5DUVA 5JXIA 1JW6A 5ANQA 1RUOA 2R7EB 3MLJA 2E32A 1GU3A 1JYCA 3J9SA 4LO6B 3IWZA 4BQ2A 4FXKB 3OB8A 2ARBA 5F7UA 1JZ2A 3TEZA 4OHXA 4NIHA 3J26N 5A3TA 2I45A 3W5MA 5FZ7A 1DLLA 1LHVA 4XJWA 1ACCA 3RZKA 2ZMNA 1UD1A 2ZGOA 2JJ6A 4GWJA 4Q0SA 1QJY3 1OH4A 1DP0A 1UY4A 4G3YC 4LITA 4OQ9A 3AP9A 4CU6A 1VBA1 1BKZA 3GHMA 4PQ9A 4C1WA 1OA2A 2H0VA 4UYBA 5DUUA 5FY9A 1PGL2 2LTNA 1J3QA 1LEMA 2JDYA 3S7IA 4QT6A 2B39A 3AYCA 2XUEA 2D6PA 1BVVA 1QXRA 1U0AA 1VB2A 1XRUA 1YI7A 1R64A 2QQWA 2TEPA 2RM22 3KQ4B 3MW4A 3N9MA 4Y5SA 4YGBA 1VPHA 3NO8A 1A3KA 2D97A 4F83A 4XC9A 2YDEA 3OGVA 4LO5B 5GLVA 4A3ZA 5C5UA 4OI4A 5CU1A 4OI1A 3GHNA 5J37A 1UNBA 4QD2A 4GJYA 1TZOA 4WV8A 1BBT1 3MUZ1 3S57A 1UZWA 5D8AA 1W0PA 2Y6JA 4NPRA 5K4LA 1RUI2 1G9DA 2RR13 4ATFA 1X82A 5JR2A 2GAUA 3WG1A 1TMF2 4RD7A 3W20A 2GH8A 4QHZA 3NNMA 4JHTA 4QDSA 2BW8A 1QJX2 2KA3A 4QPYA 2Y6HA 3T09A 5EZWA 1OC1A 5JOXA 2ZHLA 4QQHA 1BQPA 1Q43A 4AVBA 1UL9A 4UXAA 1SLBA 4DRRA 2UY9A 5KC6A 3HD8B 3N7KA 2VZOA 3B94A 4GXLA 3WOGA 4D6SA 2Y26A 2WYFA 1VR3A 3CBNA 4LQRA 5APAA 4AHWA 4ARXA 1OPOA 3PUAA 1SFNA 3LFMA 4LKSA 3PDQA 1W05A 4LXLA 4TSVA 4COZA 2ATFA 4EV0A 4FTEA 1WLCA 3KGZA 5JVVA 3VBFC 2RDNA 2VQAA 1NY72 1AXKA 1DZRA 3LEKA 4IE7A 4JKLA 4AF9A 1HB2A 4TZDA 5FMOL 1DGWX 2EALA 4LULA 2Q1FA 3ATGA 1AR81 3GXUA 5AVAA 2G9FA 2FCTA 1I5PA 4PHZA 4Q1RA 4XZPA 4IESA 1GZTA 1RTVA 2HWE3 3EMRA 1W6NB 2EA7A 2VZRA 2ZGNA 1R1A2 2AENA 4I0BA 4QX2A 1B35C 4WM7A 2A3XA 4GJZA 1S0FA 5JCTA 2VMEA 3ZM8A 1WLDA 4FPJA 3S0MA 2UWAA 4BDVB 3U78A 4QB6A 2C26A 3K2OA 5JLVA 1W0OA 2DFBA 5I8TA 2VZQA 1HLCA 1W39A 3FL7A 1YO8A 4I3PA 1CWPA 1RUNA 2ARXA 3LIGA 3WQ7A 2N7GA 5C7GA 4WZCA 1UOFA 3VN4A 2A3WA 1BZWA 1DLCA 3RSJA 1AXYA 4XAEA 5GKAC 2I07B 4MHRA 5LATA 1QQP3 4CVUA 1BMV1 1W8WA 4GH4A 1Z0HA 3DEMA 3VDDA 4PQQA 4GB32 3ZFFC 1MR5A 5AC93 4PDWC 4AYUA 2P3KA 3NAPA 1VBB2 3K46A 4JKKA 5FXVA 5BNPA 3M8LA 5CG8A 1EAH2 1GOHA 1WCDJ 3B93A 2YFUA 3LGRA 4M3CA 5KHGA 1QQP1 1UOJA 1H8VA 1RUG2 1UX7A 3GYDA 4QB2A 4EROA 4XETA 4BMEA 2LALA 3O1VA 3AJZA 2J1AA 4AFDA 2IWGB 5AC91 1IPJA 4PCRA 5D8AC 5A32B 3SQOA 5DQ0A 2YC0A 2XB6C 5IK8A 1QOSA 1V9U1 2XDVA 4HKWA 5DN2A 5FUPA 3ZSMA 1EYBA 3POEA 2JKBA 4CDQB 2J22A 2HKXA 1DQ6A 1UIKA 4FOVA 3VBOB 1MVEA 3U0ZA 4MGTA 2XG3A 1JZ3A 4UAPA 1RXFA 2BFUL 5C4WA 2WUHA 1UYXA 3VKOA 3WINE 1SBDA 1W9TA 1FPN2 4XJ9A 1LHOA 1MS5A 4B29A 1AX2A 1WBLA 2ARCA 4GD4A 2JECA 3ZN6B 4AE2A 1T6BX 3NNLA 4YGCA 4BM8A 4QGNA 3KZ4C 4A2UA 3K3OA 1N3OA 3WY6A 1WMEA 3WG3A 4XF9A 2VBBA 3TAYA 1AXZA 1YHFA 3UESA 3ZX7A 4B3NA 5ABJA 5FZFA 1KGYA 2A5ZA 3BIWE 4LEJA 3RYRA 3KWVA 4KWJA 1GANA 1H1IA 3OYWB 3T2OA 4DS0A 4CEWA 4AI1A 4M3CE 4DRVA 5CBLA 4QPIB 3NMBA 1OOPB 1W0NA 2F6BA 3CZUA 1FT9A 3ZPYA 1Y43B 2XJTA 4CDUB 3K48A 1JOPA 2GNBA 4ISRA 1SFYA 1QJEA 1GWKA 5I91A 3OD4A 1ND3B 1S0GA 2VVDA 1PZ8A 4YNIA 1PVC3 1NT0A 4XJAA 1FYUA 3VLBB 3CKHA 1ASJ1 4MH0E 2Y6LA 3N7LA 2VNVA 3DPRB 4BQ1A 4O9EA 3VBRA 2CAUA 1Y9GA 3PMSA 5JZGB 2VVFA 4XCAA 2Q8DA 5HCAA 4UW4A 4PF5A 1NG0A 1PZ9A 1YIPA 3B5LB 3MLKA 5SV8A 4H14A 1H9WA 4RHV2 3OBTA 3BUCA 1CJPA 3VKLA 1PVC1 4QQ2A 4LOSA 5DABA 2WDBA 5CYYA 2QVSB 2PQQA 4XFFA 1XNBA 1JYVA 3CO2A 4GH4C 2E7QA 2VE1A 4Y1VA 1KS5A 2OX0A 4XOGA 5LZ6A 3VDBA 2WFPA 1U5XA 2I74A 3E6BA 3IAQA 3MW3A 3WNOA 3BU0A 1AL22 2AACA 4E27A 1ZRIA 3MIGA 3LEGA 4PBOA 3NAPC 5LEJA 3BIEA 2QQJA 3ZOIA 4AI0A 1WCSA 5BNPC 4RFRB 1D0HA 4N90A 2W52A 3ACHA 3AKPA 3JBG2 5KBFA 1LB2A 4OCTA 3M3CA 1GQGA 2RDQA 3IKWA 2BOIA 3VZLA 4L0PA 4EN8B 2WLPA 2ZAHA 1QOTA 2ZZJA 2VH9A 2IFRA 3HQXA 2RE9A 4LBQB 3FHQA 1YJLA 3MUY1 3NL1A 1CPMA 4B1LA 2D6NA 4FAHA 2HWC1 5DAVA 3OBRA 4R4ZA 5FKCA 3BOPA 3H42B 4AK3A 2B45X 4ES8A 4R9CA 4QPWA 5C4WC 1QF3A 2QNKA 4JZRA 1VMFA 3P6BA 2DV9A 3HBZA 2EXHA 5HBAA 3KCCA 4IEUA 4UW6A 4CPBA 1UMIA 3U11A 5CFCB 2XBO3 3J8F2 1UMHA 1WWYA 3CJIB 4FFIA 1YQCA 3I2HA 1GWLA 1POV3 1H2KA 4X8PA 5FYCA 4COYA 3LKJA 4MLOA 2Q5TA 1EUUA 3NRUA 3LA3A 5FZ6A 1N3PA 3ORJA 3CNAA 2ZJCA 4XAAA 1W2UA 1PIV3 5J96B 1IQDC 1AYN1 1L7RA 4BJ0A 3D3AA 4E2QA 3RG0A 3VB9A 2XBO1 3W59A 5ABJC 1UZYA 4MXWA 3RZHA 2JD9A 2FDGA 4HK8A 1AJKA 4NIDA 1MZ6A 4IW3A 4CEWC 1RJ8A 1HDKA 2FDJA 5FZAA 4N43A 5A7NA 5FJHA 4DZGA 3NWKA 3C7OA 4UBGA 2WR9A 3O0XA 1HXS3 4TXWA 4MGZE 2VBPA 5FO7B 3MZHA 1UY3A 3PU8A 1HB4A 2EF6A 3IIIA 4L11A 1PMIA 4MHUA 1RXGA 4JQRA 4YW6A 5FPUA 2E9QA 4GWMA 3VBRC 5FPZA 1VBA2 1KS4A 4IGPA 1UZ0A 4LIUA 4CCKA 3I59A 4AVAA 3KT7A 1ZBE3 1LULA 1S0DA 1VBE3 1HXS1 5IUQA 2DU0A 3UGGA 4QX7A 4A6OA 4AG4A 4FTSA 4AI9A 4TLFA 1M4WA 1GQHA 1X8MA 1ULGA 2EXKA 4P9YA 1C5HA 5LASA 4A7YA 4YSFA 1GQPA 4QDRA 4QPGB 5F9TA 2C6SA 2SBAA 2WWJA 3GF6A 1WLWA 3HJRA 4A45A 4B7KA 4E4ZA 2R49A 1YQ6A 5JXJA 2OYZA 3DL3A 3PUIA 2WZ8A 5A7PA 3KT4A 2FDKA 3VUOA 1BBT2 1XYNA 3LD8A 4Y1ZA 3ZYFA 2VOTA 2XL9A 2W47A 4OULA 5KHHA 3DKQA 3OOXA 4S2HA 4EYUA 1UOGA 3KV4A 2W46A 4C0HA 2R30A 3AYEA 1H2MA 5C3RA 3QACA 4FP3A 4OI2A 4UF0A 2LS6A 5A3LA 2JIGA 1L7QA 5FY0A 5A3NA 4LTAA 1H0BA 5FZMA 2CHHA 4KU7A 4BISA 4BE3A 4BIFA 2D3RA 4XEZA 1W6PB 3UJQA 5A80A 4Q4V3 2VZ3A 3ENRA 3ILRA 4JDOA 4O9GA 2LUWA 2PAKA 2FDFA 2H0BA 3CU7A 4TN7A 3IDCB 2ZCWA 1KFUL 3B69A 3MV01 4URTA 3TN93 1A8DA 1G9FA 2X5IB 4EWEA 2Q4SA 2WSVA 5IK7A 2Q1ZB 1APNA 3MEPA 4IE6A 3PVEA 4UW3A 3O1OA 1UIJA 1DCSA 3X29B 5DUXA 4LBMA 2DVGA 2JX9A 1UYPA 2Z2SB 4N9IA 1YXWA 2J7MA 1AR82 4KI5M 5FLHA 3TN91 2ZABA 5CKMA 1OA4A 2DTYA 2WZR1 3RPQA 3PVNA 5C8CA 4CCOA 1EUTA 3LEIA 4HL0A 4AVCA 2XHKA 3AB0A 3FBMA 2DDUA 3SEEA 4AEJA 4N43C 5JIUA 3PIJA 1TME3 2V5YA 2CV6A 3PL0A 1D2QA 5JI7A 4E8DA 1XU2A 1XBFA 3MO4A 2WYSA 2CL2A 4LBQD 1UXZA 3ILNA 4WZFA 4UT5A 5K8SA 1W6OA 3H7JA 4XFCA 4AWDA 2KXLA 4HVRA 2V4AA 3AP5A 4GQ7A 1O3TA 4MOAA 4ATEA 5FYMA 4GMP3 3UV9A 4RR3A 1TME1 4LO7A 5JIAA 1IZ3A 3INAA 3LA2A 5FOBB 5LK7B 1BMV2 3Q8CA 1HW5A 3AKRA 3WR0A 3MYXA 2BNOA 1IGOA 1FAYA 2WZPP 4BZ4A 4D7YA 1CIWA 4PDWB 4META 1G6NA 4Q4X3 5AFBA 4MV2A 2C5DA 2F17A 5BYNA
chains in the Genus database with same CATH topology
2OQ6A 5IVBA 5FYHA 3PU8A 4CCLA 4IGOA 3K3OA 5FZCA 3K3NA 2GP3A 5FPUA 5FV3A 5FZ1A 5FP8A 3PU3A 4IGPA 3KVBA 4LIUA 3ZPOA 5FZFA 2YBSA 3AL6A 4CCKA 5LWBA 4QWNA 5FUNA 4DIQA 3OPWA 4QX7A 5FYYA 5F5IA 5FY5A 4AI9A 5ISLA 4EZ4A 4XDPA 4D6SA 5E6HA 3PURA 5A7OA 5IW0A 2OS2A 5FYIA 4QXHA 4CCJA 4DO0A 5FP3A 2WWJA 3PUAA 5FP4A 5A1LA 4LXLA 3PDQA 5FYZA 3LDBA 5A7PA 2Q8CA 3KV9A 3LD8A 4Y33A 4LIVA 4EZHA 3PTRB 5FZEA 3RVHA 3N9OA 2Q8DA 5FY8A 3AL5A 4ASKA 3PUQA 4EYUA 5F37A 3AVSA 3KV4A 2XXZA 5FZBA 5FYBA 3DXTA 5F32A 4V2WA 5A7WB 5FZDA 5F2SA 4UF0A 1VRBA 5FPVA 5FY7A 3KVAA 4C8DA 5FY0A 5F3EA 5A3NA 5FWEA 2OX0A 5FZMA 3NJYA 5FZLA 5FWJA 5F3GA 3N9QA 5FBJA 4BISA 4Y4RA 2OQ7A 4GJZA 5A7QA 5A7SA 4XDOA 2P5BA 5FZ9A 5A80A 5FYVA 3U78A 5FP9A 2YU1A 5IVFA 3K2OA 5F3CA 2PXJA 5LY2A 3KV6A 4TN7A 2OT7A 3PUSA 3U4SA 3KV5A 4IGQA 5F39A 5FZKA 3N9LA 5FYSA 5A1FA 4Y3OA 5FJKA 4CCNA 3OPTA 2WWUA 5FZOA 5FZGA 4CCMA 4QXCA 4CSWA 4BXFA 4QX8A 3DXUA 5KR7A 5CEHA 5F3IA 5IWFA 5IVEA 4CUGA 2Q8EA 4NUBA 4URAA 2YU2A 5ANQA 2W2IA 2GP5A 4HOOA 5FXWA 5FXVA 5FYUA 3N9NA 3N9PA 5A3TA 5FXXA 5FZ7A 4E4HA 2YBPA 5LW9A 5FY4A 5IVYA 4CCOA 4D6RA 4UF0B 5FZIA 4HONA 4LITA 5F5AA 5F2WA 5IVVA 2VD7A 4AAPA 3ZLIA 5FZ8A 5IVCA 5FZ3A 5FYCA 5FY1A 2YBKA 2XDVA 5FY9A 4QXBA 5FUPA 4V2VA 5FZ6A 2XUEA 5IVJA 3UYJA 2XMLA 3N9MA 4QU1A 4BU2A 5FYMA 5A3PA 5FZ4A 5LY1A 5F5CA 2YPDA 5FPBA 5FYTA 5FPAA 4D6QA 5A3WA 4GJYA 5FXZA 5FPLA 5FZOB 4GAZA 5FZHA 5FZAA 5A7NA 5FJHA 5FZ0A 5A7WA 5K4LA 4GD4A 5FP7A 3AVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ6 A;  5IVB A;  5FYH A;  3PU8 A;  4CCL A;  4IGO A;  3K3O A;  5FZC A;  3K3N A;  2GP3 A;  5FPU A;  5FV3 A;  5FZ1 A;  5FP8 A;  3PU3 A;  4IGP A;  3KVB A;  4LIU A;  3ZPO A;  5FZF A;  2YBS A;  3AL6 A;  4CCK A;  5LWB A;  4QWN A;  5FUN A;  4DIQ A;  3OPW A;  4QX7 A;  5FYY A;  5F5I A;  5FY5 A;  4AI9 A;  5ISL A;  4EZ4 A;  4XDP A;  4D6S A;  5E6H A;  3PUR A;  5A7O A;  5IW0 A;  2OS2 A;  5FYI A;  4QXH A;  4CCJ A;  4DO0 A;  5FP3 A;  2WWJ A;  3PUA A;  5FP4 A;  5A1L A;  4LXL A;  3PDQ A;  5FYZ A;  3LDB A;  5A7P A;  2Q8C A;  3KV9 A;  3LD8 A;  4Y33 A;  4LIV A;  4EZH A;  3PTR B;  5FZE A;  3RVH A;  3N9O A;  2Q8D A;  5FY8 A;  3AL5 A;  4ASK A;  3PUQ A;  4EYU A;  5F37 A;  3AVS A;  3KV4 A;  2XXZ A;  5FZB A;  5FYB A;  3DXT A;  5F32 A;  4V2W A;  5A7W B;  5FZD A;  5F2S A;  4UF0 A;  1VRB A;  5FPV A;  5FY7 A;  3KVA A;  4C8D A;  5FY0 A;  5F3E A;  5A3N A;  5FWE A;  2OX0 A;  5FZM A;  3NJY A;  5FZL A;  5FWJ A;  5F3G A;  3N9Q A;  5FBJ A;  4BIS A;  4Y4R A;  2OQ7 A;  4GJZ A;  5A7Q A;  5A7S A;  4XDO A;  2P5B A;  5FZ9 A;  5A80 A;  5FYV A;  3U78 A;  5FP9 A;  2YU1 A;  5IVF A;  3K2O A;  5F3C A;  2PXJ A;  5LY2 A;  3KV6 A;  4TN7 A;  2OT7 A;  3PUS A;  3U4S A;  3KV5 A;  4IGQ A;  5F39 A;  5FZK A;  3N9L A;  5FYS A;  5A1F A;  4Y3O A;  5FJK A;  4CCN A;  3OPT A;  2WWU A;  5FZO A;  5FZG A;  4CCM A;  4QXC A;  4CSW A;  4BXF A;  4QX8 A;  3DXU A;  5KR7 A;  5CEH A;  5F3I A;  5IWF A;  5IVE A;  4CUG A;  2Q8E A;  4NUB A;  4URA A;  2YU2 A;  5ANQ A;  2W2I A;  2GP5 A;  4HOO A;  5FXW A;  5FXV A;  5FYU A;  3N9N A;  3N9P A;  5A3T A;  5FXX A;  5FZ7 A;  4E4H A;  2YBP A;  5LW9 A;  5FY4 A;  5IVY A;  4CCO A;  4D6R A;  4UF0 B;  5FZI A;  4HON A;  4LIT A;  5F5A A;  5F2W A;  5IVV A;  2VD7 A;  4AAP A;  3ZLI A;  5FZ8 A;  5IVC A;  5FZ3 A;  5FYC A;  5FY1 A;  2YBK A;  2XDV A;  5FY9 A;  4QXB A;  5FUP A;  4V2V A;  5FZ6 A;  2XUE A;  5IVJ A;  3UYJ A;  2XML A;  3N9M A;  4QU1 A;  4BU2 A;  5FYM A;  5A3P A;  5FZ4 A;  5LY1 A;  5F5C A;  2YPD A;  5FPB A;  5FYT A;  5FPA A;  4D6Q A;  5A3W A;  4GJY A;  5FXZ A;  5FPL A;  5FZO B;  4GAZ A;  5FZH A;  5FZA A;  5A7N A;  5FJH A;  5FZ0 A;  5A7W A;  5K4L A;  4GD4 A;  5FP7 A;  3AVR A; 
#chains in the Genus database with same CATH topology
 1ZYB A;  2VNO A;  3D82 A;  2ZHN A;  4FQZ A;  4GMP 1;  5ANN A;  1W2T A;  3BTZ A;  1LES A;  4ZS2 A;  1PO2 1;  5DAQ A;  1QQP 2;  2A6V A;  2BWC A;  3RDI A;  3I97 A;  2D6L X;  4A41 A;  1S55 A;  1Y4W A;  4AFC A;  3KF3 A;  3T0A A;  5AC9 2;  3S5A A;  4KWL A;  4ZZ5 A;  1FXZ A;  2CAV A;  1OFS A;  1V9U 2;  2B9V A;  2JE8 A;  3MV1 1;  1VMJ A;  4EN6 B;  5C3S A;  3V0B B;  1QH7 A;  1QNY A;  1CAV A;  5L73 A;  1NQJ A;  2XKO A;  1BEV 1;  3LEM A;  4YVW B;  4YZ1 A;  3QLQ A;  3V0A A;  4DO0 A;  2FDI A;  1VJ2 A;  4K9S A;  1HRI 3;  5C3P A;  3HNB M;  4YW4 A;  3H1W A;  4BH9 A;  3H1Y A;  5A6Y A;  5ACA 1;  1ALY A;  4JRA A;  3WNM A;  5FO8 B;  2JG8 B;  2XQR A;  4NOT A;  1OPM A;  4FPC A;  3ROU A;  3IZO A;  4FQ4 A;  1MZE A;  4EQV A;  2A6W A;  1HRI 1;  3T3Y A;  3L2Y A;  3D4K A;  4V2W A;  4AHX A;  3C3V A;  4Y1X A;  1W8Z A;  5C8W A;  3MLL A;  1CAX A;  2QE3 A;  2R0H A;  2W1U A;  2X29 A;  1O8P A;  5FWE A;  1AR6 3;  3BYW A;  3T4H B;  3P3P A;  1RUD 3;  4Y4R A;  3OPZ A;  2HJI A;  1PZ7 A;  2HYK A;  3AKS A;  1NCQ A;  1JZ8 A;  1WMD A;  1X50 A;  5GZD A;  4CDX B;  1NCR C;  2D5H A;  2OXB A;  1R09 1;  5KWR A;  2XWB B;  1VBC 3;  5C8C C;  3JB4 C;  1PK6 B;  1G9C A;  4Q4Y 3;  3PUS A;  5BV6 A;  4B1M A;  4NHM A;  5F39 A;  1RUJ 1;  2J1V A;  3N9L A;  1FV2 A;  4GKY A;  4IQP A;  3VGI A;  4CXX A;  4TTG A;  1UX6 A;  2ZGM A;  1GR3 A;  3RYP A;  3ZKU A;  3HQR A;  5IVC A;  5C9A A;  1OBN A;  2X09 A;  2CDO A;  3WCS A;  4AQ6 A;  1ASJ 2;  1FNZ A;  4BXF A;  1W9Y A;  5F3I A;  4Q27 A;  1J83 A;  1HRV 3;  2P6H A;  3SKJ E;  4Z2A A;  1VBC 1;  4N8M A;  3SH5 A;  1A78 A;  3HEI A;  3SCF A;  3Q8E A;  5DAW A;  4X8N A;  1CAU A;  4YW7 A;  5GM0 A;  1ZRF A;  1V6K A;  2RJL A;  2ZGL A;  2FZ2 A;  4RR3 C;  1SZB A;  1PVC 2;  5FAX A;  3OGS A;  4Q4W 3;  3ZIX A;  1SLA A;  5FY4 A;  5EJ1 B;  4CUC A;  4FOQ A;  4S2G A;  2JG9 A;  1CVN A;  5FZI A;  4QX1 A;  3QD6 A;  4DXT A;  2B46 X;  4Q8K A;  1D7P M;  2RG4 A;  3O1T A;  1XE0 A;  5FY1 A;  1G86 A;  1AX1 A;  4Z1V A;  3T1L A;  4CP9 B;  1QDC A;  1XYP A;  1JUH A;  1RUC 1;  3TBD A;  4RS5 C;  5IVJ A;  1NOV A;  3ECQ A;  4XUN A;  5I8Y A;  3VKN A;  2YY1 A;  4OHZ A;  1ZRR A;  1ENS A;  1AR7 1;  1QY4 A;  5C33 A;  2HWD 3;  5FZ4 A;  4CU9 A;  4FFF A;  1RUH 3;  1XC6 A;  2WSU A;  2A71 A;  2LRO A;  4NR1 A;  3HAG A;  4CDW A;  5FPA A;  5C3O A;  2RMU 3;  2QQO A;  1LHN A;  3KMH A;  4DQA A;  4WVM B;  2NM1 A;  5FZO B;  2DF7 A;  2YYO A;  1H8T B;  1MEC 3;  2HWC 2;  3UGF A;  4AVT A;  1UCX A;  1VBD 3;  1CPN A;  1S0J A;  5CFD A;  2R16 A;  2BGP A;  5BNO B;  5JI9 A;  2HWD 1;  5BY5 A;  3VZJ A;  2QQV A;  4HMZ A;  4KG8 A;  4MXV A;  1BCX A;  3SCG A;  2B4K A;  4XUP A;  1F5J A;  5K0U C;  5LRR A;  2J1S A;  1LOA A;  2AEY A;  2RMU 1;  3AFG A;  1CD3 G;  2EIB A;  2WT1 A;  3GAL A;  3OUH A;  2VZP A;  2VMF A;  4K1Z A;  2P1B A;  2DU1 A;  1ZRC A;  1COV 1;  4YFW A;  4CU7 A;  5SV5 A;  2C24 A;  3CHX A;  1M06 G;  1SFP A;  3I2F A;  4PIX A;  5FLI A;  5ISL A;  4D94 A;  2RS1 3;  1D4M 3;  4ES9 A;  4M01 A;  1WA4 A;  3T4V A;  1N1S A;  1OMI A;  1AYN 2;  4COW A;  3H3L A;  1YLL A;  3CL1 A;  4O7X A;  3M3O A;  5B4N A;  1UU6 A;  3S6P A;  5JZG A;  4SLI A;  1NCQ C;  3FE5 A;  3LDB A;  3MI8 A;  4ZPI A;  2GME A;  1PVX A;  3KV9 A;  5J3U A;  5A3M A;  1FV3 A;  4RGA A;  1SBF A;  3VHO A;  2A6Z A;  4OHV A;  3POG A;  5EYX A;  5FZE A;  4K8R B;  1N1V A;  3N9O A;  3VD5 A;  2ID4 A;  2V09 A;  1DZQ A;  5D21 A;  1KIT A;  1JZ7 A;  5A7W B;  4I0W B;  4GA9 A;  1DQ1 A;  4C90 A;  4NHY A;  2OPW A;  5C9A C;  1O4T A;  2XJQ A;  1WD3 A;  1B09 A;  1HQW A;  1MS1 A;  1ZA7 A;  2VC9 A;  3TNQ A;  3JD7 1;  2NMO A;  5FMB A;  4DMI A;  4XAC A;  2OKX A;  2ENR A;  3CQO A;  1O4Z A;  2IC1 A;  1GP6 A;  4FPG A;  2QZ3 A;  1HXS 2;  2P5B A;  2ARA A;  2Y60 A;  3I3D A;  4XFA A;  5GLW A;  5FO9 B;  1ULC A;  4MO3 M;  3ZIW A;  1PGW 1;  4MAD A;  5CVR A;  5LB6 A;  2O1Q A;  1RL3 A;  4HPK B;  3VBU A;  1RUF 3;  2JG9 C;  1NAE A;  3LDK A;  5FYS A;  5I0U A;  3CLP A;  4MGQ A;  2IXC A;  4CA9 A;  4CXY A;  3AXD A;  1SPP B;  2JEN A;  2YGL A;  1W9F A;  3R6S A;  4N53 A;  1MAC A;  1Q8Q A;  1MZ5 A;  4GIQ A;  4CP1 A;  3IB3 A;  4AED A;  2VMC A;  3AP7 A;  2AH2 A;  2OII A;  5I0S A;  3ES4 A;  3ZN5 A;  4BQW A;  2WN3 A;  4CDW C;  4DUX A;  4RA0 A;  1KDK A;  5LW9 A;  4QAW A;  2UWC A;  2EAK A;  3AZZ A;  4NRM A;  5F5A A;  3N35 A;  4AGG A;  2A73 B;  1IKP A;  1H4H A;  1KFX L;  2EIG A;  1LKN A;  4KGG A;  5CFD C;  2XLG A;  5F6L B;  2JIJ A;  1ZZ8 A;  4XHX A;  1N47 A;  4DNY A;  4BLI A;  2YC2 A;  4P14 A;  2ZHM A;  4Y4Y A;  1LEC A;  5J98 B;  2IVI B;  3GBG A;  1J3P A;  5JPN B;  4AQ2 A;  1OQE A;  3CF6 E;  4OUS A;  1NA1 B;  1O59 A;  5A33 B;  1WMX A;  1REF A;  5FYT A;  4IEX A;  1W06 A;  4EN7 B;  1DYO A;  3IT8 A;  1QWR A;  4Y22 B;  1QXJ A;  1IKQ A;  3H8R A;  4CEY B;  3DYM A;  1NLR A;  3TN9 2;  1MZF A;  3MFC A;  2NQY A;  5J1X A;  4B4R A;  5FP7 A;  4LA3 A;  2VUD A;  2EXI A;  4COU A;  4MXW B;  5BUV A;  5JZG C;  4CCL A;  2WZR 2;  2BBV A;  1EV1 1;  4Q26 A;  3WDY A;  1HKD A;  2HWF 3;  5FQ0 A;  4HAN A;  4UFL A;  1FX5 A;  1U12 A;  2GC2 A;  4QKD A;  4AQS A;  4GWI A;  3EYP A;  4WVV A;  3H1M A;  4J1X A;  5FRE A;  5BPX A;  1QJY 1;  4RN5 A;  4J1W A;  1UF2 C;  3JQX A;  2XJR A;  2OA2 A;  2ORX A;  3OPW A;  4IER A;  1WZX A;  4XBQ A;  5FYY A;  1G7Y A;  1OXC A;  1S2E A;  2RJK A;  4C1X A;  5BXX A;  1JH5 A;  1OLQ A;  1CZV A;  1HQL A;  2YC4 A;  2HWF 1;  4XTM A;  5E6H A;  2WQZ C;  3WF1 A;  1W6Q B;  3ES1 A;  4NAM A;  1W9S A;  2NPI A;  2EXJ A;  4R9A A;  4AGR A;  5KHK A;  4XBN A;  5D1I A;  2JIC A;  2WRA A;  1TME 2;  4YG3 A;  2WO2 A;  4ZS3 A;  2PA7 A;  2ZPX A;  5FMC A;  4ZKT B;  3FHA A;  5A1L A;  2JDP A;  4L92 A;  2CDP A;  4IE5 A;  1YC6 1;  3AX4 A;  1O5L A;  2WNU A;  4PBP A;  3UGH A;  2VMD A;  5JPM B;  1ZRE A;  1UXX X;  4QHB A;  2WNO A;  4XIO A;  2PHX A;  3HOB A;  3WDT A;  3TEW A;  2C0Z A;  3VBS A;  3E6D A;  2CWS A;  1IQA A;  3FX3 A;  4FXG B;  3WW4 A;  4BQY A;  1J1L A;  3Q9O A;  2NYY A;  3RQ0 A;  3AL5 A;  3VBU C;  4XUO A;  4XIK A;  4EWD A;  2VU9 A;  2W92 A;  5GZF A;  1OVS A;  3T2Q A;  5LBB A;  4DXZ A;  2DUO A;  5DG1 A;  1PO2 2;  1VP6 A;  4QQP A;  2W3J A;  2RR1 1;  4YG0 A;  2BYV E;  3K4D A;  2VUA A;  1W8U A;  4N53 C;  4XFI A;  4Z92 B;  4LLF A;  5A7S A;  4AED C;  1W8O A;  4H7L A;  2WL1 A;  3PUH A;  4FPH A;  3TB0 A;  2ZA9 A;  3ZYB A;  4LKF A;  4YW2 A;  2G4I A;  5LY2 A;  2PLV 3;  1BEV 2;  5EPA A;  2GC0 A;  3WP6 A;  1O91 A;  5DAX A;  2X10 A;  4G4F A;  1LU2 A;  3MID A;  1ULP A;  2XJU A;  2NP0 A;  1N3Q A;  2AYH A;  4QX8 A;  5ACA 2;  3BKZ A;  2ZGR A;  3FFZ A;  5IVE A;  4PLM A;  1DQ0 A;  2PLV 1;  4PIZ A;  1I1E A;  2VW1 A;  1OQD A;  4MGS A;  1S2B A;  4MZU A;  1HRI 2;  4HOO A;  2DVF A;  5FXW A;  3ZFG C;  3IPV A;  4Z2W A;  3O1P A;  2QDN A;  3FBY A;  5FMD A;  3FZ3 A;  4MGK E;  4W65 A;  1UY1 A;  1GOG A;  1ZA4 A;  2VZ1 A;  3SLI A;  2PN5 A;  3ASI A;  3U37 A;  4CZS A;  3NV4 A;  2HWE 1;  3VZM A;  4YWA A;  3RZM A;  1NCR B;  3I2D A;  5A3U A;  1R09 2;  1BHG A;  2QBX A;  4WM8 B;  4HSL A;  2VM9 A;  4CP2 A;  1ODM A;  4Q0V A;  3KS7 A;  4QU1 A;  1EPZ A;  3VL8 A;  5JMO A;  3LAG A;  5DZF A;  1RUJ 2;  1X9T A;  2W0X A;  3U75 A;  4CUB A;  1F4H A;  3VKF C;  3PVO A;  2W87 A;  2W5F A;  1UPS A;  2DVA A;  2WFF 3;  2ZX1 A;  2BBA A;  3ZSJ A;  3USU B;  3WDX A;  4P9G A;  2DCY A;  3H3U A;  4ET7 A;  1ND2 B;  4AI8 A;  4QB1 A;  1VBC 2;  4YM3 A;  2G9G A;  3MHZ A;  4RSU A;  5DDJ 3;  5I8S A;  4U2A A;  5FZH A;  2BPA 2;  1JZ6 A;  1J84 A;  2WAB A;  5FP8 A;  1XU1 A;  1MQT A;  1OD5 A;  2CU5 A;  1VB4 A;  1RMU 3;  4CCE A;  4O65 A;  3SHR A;  3WP4 A;  5I0R A;  1TNR A;  2WFF 1;  4CPB D;  5IHR A;  2UWB A;  3N4M A;  2FBE A;  1V6M A;  3K3N A;  3I3Q A;  2DCZ A;  1RED A;  3M7A A;  2VVE A;  5IK5 A;  2QCS B;  3QOP A;  4NHX A;  2QTW B;  5DDJ 1;  2RS5 3;  3MF9 A;  3VBS C;  1BLZ A;  4E2S A;  1CR7 A;  3C7H A;  1UZZ A;  4A6S A;  3I3B A;  1OLM E;  3V56 A;  4YPJ A;  5L7O A;  1UOB A;  1RUC 2;  4N9H A;  1JMU B;  4RS5 B;  2VQ0 A;  3ALQ A;  1T6G C;  2DCT A;  4EZ4 A;  3PNA A;  2VCC A;  3AK0 A;  4DPN A;  1AR7 2;  4M4R A;  1C1F A;  1JBC A;  2JEM A;  4OZO A;  3WF0 A;  5IFT A;  1GZ9 A;  1UWW A;  4UWD A;  3DF0 A;  3C8X A;  2VW2 A;  3RZG A;  1Y9Q A;  3H9A A;  3Q8F A;  2C4X A;  1RVF 3;  2BGC A;  1NE6 A;  5T5L A;  3CDZ B;  1K5M A;  2D3P A;  3HN3 A;  2HWD 2;  3THT A;  3E5X A;  5K0U B;  5F32 A;  1W6M B;  3BVC A;  1GSL A;  3ZN4 A;  3ZFE A;  2RMU 2;  2GC3 A;  2VMI A;  3IAP A;  3WLU A;  5GJ6 A;  1YFY A;  3ACG A;  4AHY A;  2P3I A;  1SDW A;  4W6X A;  2W94 A;  1COV 2;  3V64 A;  5JXH A;  4R9B A;  2BZD A;  4AAX A;  3MBW A;  2ZMK A;  4WM7 C;  3BI3 A;  2D3S A;  1LOG A;  5F3C A;  2AGS A;  2R1B A;  2Z42 A;  2JXA A;  2BU9 A;  1XQN A;  3F95 A;  4IGQ A;  2HWB 3;  2VUC A;  3A0K A;  3FWE A;  3KSC A;  5JOW A;  3ZXL A;  3R4S A;  3MGU A;  4MGY E;  3UKN A;  5GLU A;  1NX9 A;  2DFC A;  2W1W A;  3DKW A;  3OGR A;  3ZMO A;  2XPJ A;  1CAW B;  5EHD A;  4CSW A;  1LGN A;  1WCQ A;  3WZ1 A;  4I2O A;  5FDB A;  3E6C C;  3VL9 A;  4CUG A;  2GZW A;  1RUE 3;  2Q8E A;  1UW8 A;  3M70 A;  1NKG A;  1HB3 A;  2HEV F;  2HWB 1;  5FUI A;  1DYP A;  4OQ8 A;  4GZ9 A;  5L9B A;  3VDD C;  2CNA A;  4ORF A;  2ET7 A;  2OW4 A;  3QBQ A;  3JD7 2;  2ZAA A;  2FMD A;  1AYM 3;  4XXP A;  3O5S A;  4I0A A;  4HON A;  5CAD A;  4JGZ A;  5GZC A;  1E5I A;  3IDB B;  3NJX A;  2R0F A;  4YVS A;  3VDA A;  3ZO0 B;  1W99 A;  3ZLI A;  3AMM A;  4RQP A;  2YBK A;  1MS0 A;  5HXM A;  2WT0 A;  1MQT C;  1PGW 2;  4IV3 B;  1C8N A;  4JGY A;  4MGI E;  1IS5 A;  4V2V A;  4DXR A;  3AMP A;  4XQW A;  1FNY A;  1ENR A;  4FOY A;  3THP A;  5A6Q A;  1G9B A;  3A21 A;  4BU2 A;  4JVA A;  1J3R A;  2WN2 A;  3POY A;  3BN6 A;  1W3X A;  2B7Y A;  2GMP A;  3J7N A;  2YPD A;  2D44 A;  1MVQ A;  2AEZ A;  2WNV B;  1C57 A;  3FN9 A;  3F2Z A;  4LHK A;  4MX3 A;  5EWS A;  5L7O C;  5GZE A;  1R08 3;  3HQU A;  3PIG A;  2Z69 A;  4FVV A;  5FXZ A;  4AFA A;  1AZD A;  3VHP A;  1GLH A;  1QXP A;  1WCK A;  4GAZ A;  3VZK A;  1KJL A;  1JZ4 A;  4BPZ A;  4P00 B;  1O7F A;  2OQ6 A;  2BWA A;  3I4I A;  3OF1 A;  2YHJ A;  1DGW A;  3T0B A;  2X53 S;  1UZV A;  4YW5 A;  3OY8 A;  4ONU A;  5FZC A;  1R08 1;  1IS6 A;  1LNS A;  4LBK A;  4HVQ A;  4V1P A;  3GZA A;  4LUM A;  5CFD B;  3AL6 A;  1GZW A;  1LGB A;  3ETQ A;  5FBZ A;  4PIY A;  3E5U A;  4PLO A;  4LPL A;  4SBV A;  3ME2 A;  3RRD A;  1VE0 A;  2WO1 A;  3GZU C;  1ULD A;  1JYI A;  4LOT A;  3ZFE C;  1XB9 A;  2K2S A;  1POV 1;  1V00 A;  1AJO A;  2Z79 A;  3M1H A;  5T54 A;  1UMZ A;  3AJY A;  4QXH A;  2FCU A;  2WLQ A;  5G04 L;  5H9Q A;  5B4X A;  1PIV 1;  2WNE A;  5FCC A;  5CNA A;  5EJZ B;  1CQ9 A;  2PMW B;  1Z7S 3;  3VBH A;  5DPN A;  5KXB A;  4YGE A;  1BJQ A;  1WBF A;  2D6O X;  2VQT A;  2Y6F A;  4LBJ A;  5ERL A;  4Y20 B;  3PTR B;  2ZTN A;  1HN0 A;  2J1T A;  1PMH X;  2VZT A;  1AF9 A;  4NO4 A;  3WNL A;  2ZXQ A;  3BOW A;  4CCD A;  1H6X A;  2PQS A;  3PUQ A;  5HCF A;  3ZSE A;  5F37 A;  4ARY A;  1LED A;  4HET A;  1EV1 2;  2KM2 A;  2OVU A;  1RHI 3;  3UKT A;  3A0N A;  1PO1 3;  4AZZ A;  1S2K A;  1JU4 A;  1ST8 A;  3ZMN A;  4C8D A;  3K4A A;  1LHW A;  2WAO A;  4EN9 B;  2ZEW A;  4BQ3 A;  5FWJ A;  1QJU 3;  1X7N A;  4M00 A;  4QQL A;  2SLI A;  5I0D A;  3GBF A;  2QQK A;  3ELN A;  5E8A A;  4HKL A;  1QJY 2;  2LRP A;  2AUY A;  4Y26 A;  1TQ5 A;  1JN2 P;  2HBT A;  3E5Q A;  2HWF 2;  1ZBE 1;  3UL2 A;  2JDM A;  4NHK A;  4PI0 A;  1VBE 1;  3BAL A;  1GV9 A;  3AC0 A;  3KGL A;  4JGZ C;  5T5P A;  1VAM A;  4LBN A;  5GLZ A;  3OPT A;  1W8N A;  4YVS C;  3VD4 A;  3HR9 A;  4RQP C;  4XZU G;  2DBN A;  2C1F A;  1HJG A;  4JGY C;  2ZX4 A;  3CIH A;  5L36 A;  3POS A;  5LA1 A;  4LE3 A;  1ODN A;  4HXC A;  2ZAC A;  5FYU A;  4ZXE A;  5LK5 A;  1JOJ A;  4CRQ A;  1NQD A;  4AXO A;  1HB1 A;  5AFE A;  2RR1 2;  4AEM A;  4C91 A;  3VZO A;  5IVY A;  1YI9 A;  1YWK A;  3HPN A;  3OEB A;  3TYJ A;  4ZU4 A;  2A70 A;  3L2H A;  4YW3 A;  4CP0 A;  3DCQ A;  4XXA A;  5JDB A;  3ACL A;  3PHM A;  1LU1 A;  3FMG A;  1VAV A;  2XML A;  3UYJ A;  2KR2 A;  2BVV A;  3LQC A;  5DZE A;  3VBF B;  4Q4V 1;  1OUX A;  3SH3 A;  2WS9 3;  2NZ9 A;  2R07 3;  1UPI A;  1W9W A;  5F5C A;  4M4P A;  4IL7 A;  3C7G A;  2QDR A;  3C7E A;  5IFP A;  5FMO S;  5FTT C;  3TOJ A;  4EJR A;  2VW0 A;  2Y0O A;  2ZGT A;  3BB6 A;  2PLV 2;  5T55 A;  4P02 B;  4FCA A;  2IXJ A;  1Z78 A;  3ZFG B;  1B35 B;  2VZU A;  5CFC C;  1W6N A;  1VAL A;  3WW1 A;  3JZV A;  3RMX A;  1RIT A;  3I2G A;  3MIH A;  3H7Y A;  3VBH C;  1JOD A;  2ILM A;  5GAL A;  4YG6 A;  4JV4 A;  2XVK A;  3FJS A;  4IV1 A;  2HWE 2;  4XFH A;  1ZRD A;  4P5Y A;  4FFH A;  3GBW A;  4QX0 A;  4R4X A;  4S2D A;  3U1X A;  3HWJ A;  3V65 A;  5FY5 A;  1LR5 A;  4AI2 A;  2D40 A;  3J7L A;  3VHN A;  3CZJ A;  5A7O A;  2UY8 A;  1OLR A;  2E51 A;  2HLE A;  3BPZ A;  3ZFF B;  1DG6 A;  1XYO A;  5K7P A;  1WUV A;  1Y7B A;  3K4Z A;  3U10 A;  4S2F A;  1CGP A;  2Q8C A;  1FOD 3;  1TE1 B;  3J4U H;  1RUI 3;  3GJB A;  5H9R A;  3ZSL A;  1AUY A;  5CIS A;  1QJF A;  3AKQ A;  3LDR A;  4YM2 A;  3HNY M;  4K3U A;  2GAL A;  3WF4 A;  2TUN A;  2VCA A;  3AFK A;  3FLP A;  5IAX A;  3EHK A;  2WFF 2;  5D8A B;  5FY7 A;  2VR4 A;  4Q4X 1;  5FPV A;  5FZD A;  2JD4 A;  3WP5 A;  3WT3 A;  3W21 A;  1STM A;  3WW3 A;  1J1T A;  1AVB A;  1FOD 1;  2CGN A;  5F3E A;  3TRS B;  3RJR A;  5A32 A;  5DDJ 2;  3ACF A;  2BVB A;  3N9Q A;  1TVG A;  2XGX A;  4IEZ A;  3USS A;  3VZN A;  3NJZ A;  2R04 3;  5FK8 A;  4CDQ A;  2VCB A;  3OUI A;  4UFK A;  1S0I A;  5FP9 A;  3OTF A;  3VBO A;  3ZKY A;  1UU5 A;  3URF A;  2CWM A;  4NII A;  1ULO A;  1IS4 A;  4JTN A;  2GND A;  5DAP A;  2BFU S;  2BOJ A;  3A22 A;  2Z5W A;  5FZK A;  1ULF A;  2R06 3;  1DBN A;  3D5O A;  2BDR A;  1WCU A;  4NPL A;  4XMI A;  2JDH A;  2MEV 3;  1OF4 A;  2R04 1;  1DQ5 A;  1C8M 3;  2AR6 A;  4K1Y A;  5IYY A;  5CB7 A;  4FAG A;  4K20 A;  1K42 A;  3SC7 X;  3ZN6 A;  4A4A A;  2WA4 A;  4JAA A;  1JZ5 A;  2EIC A;  5H9P A;  4URA A;  2R06 1;  2VZS A;  4IXL A;  1Q56 A;  3AZW A;  3GDB A;  2H6B A;  2MEV 1;  1Q8O A;  1CN1 A;  1GNY A;  2PHL A;  3BGA A;  2WWS A;  1NUK A;  1R1A 3;  3ZXA C;  5FR3 A;  1UYY A;  1C8M 1;  4IDZ A;  4PLN A;  4AOC A;  2LM3 A;  3C7F A;  4D6R A;  1U5Y A;  1CX4 A;  2ZOE B;  5FRA A;  4J6G A;  3OYW A;  1VRH 3;  2PHW A;  1OUS A;  3W5N A;  2WIN B;  1V6I A;  1L3J A;  3AYA A;  4QPI A;  4J25 A;  1OOP A;  4I01 A;  5G05 L;  1AR6 1;  2V4V A;  4WM7 B;  5T5O A;  1RUD 1;  4CDU A;  3AYD A;  2VL4 A;  4BK5 A;  2FQP A;  3KB5 A;  4P9I A;  1ND3 A;  1OFN A;  2OZ6 A;  2B42 B;  4XCB A;  4QX3 A;  4OLL A;  4D7T A;  1CZS A;  2IVJ A;  4ZU5 A;  4IV1 C;  1VRH 1;  1HX6 A;  1UQX A;  2BNN A;  2VXR A;  4Q4Y 1;  3BOD A;  3DPR A;  4ASL A;  3NKT A;  4GB3 3;  4P5H A;  1J58 A;  1VBB 3;  1EP0 A;  1G8W A;  2VMG A;  2ZGU A;  3GZT B;  2HWB 2;  3LA7 A;  2Q1M A;  4GH4 B;  5FZ0 A;  1EAH 3;  1K45 A;  3VDD B;  1ZZ7 A;  1HRV 1;  1LOF A;  2DBI A;  1H4G A;  4MVT A;  5HCB A;  4CU8 A;  3PJQ A;  2GH2 A;  1KXG A;  3NAP B;  5BNP B;  2DCK A;  2D93 A;  5FV3 A;  4M3C B;  4Q4W 1;  2F4P A;  4YYO A;  4TYS A;  1QNW A;  5LWB A;  1IOA A;  3A7Q A;  2KD7 A;  1I6X A;  2P34 A;  1DGR A;  2PHR A;  4EE2 A;  3OD0 A;  5EXO A;  3O1M A;  4ASM B;  4NVP A;  3H50 A;  2K46 A;  3N7M A;  2PEL A;  5JAX A;  1KDM A;  1PMJ X;  3VD3 A;  4JRL A;  1UN1 A;  2DUQ A;  2ZGQ A;  3EQE A;  3N3H A;  1A34 A;  1CZT A;  1GUI A;  1CON A;  1WW7 A;  4LBQ A;  2PHF A;  4PJY A;  4CDQ C;  4D69 A;  2V72 A;  3D6E A;  1U5Z A;  3D0J A;  4UFI A;  2ZGP A;  4XUT A;  5C4W B;  1RUH 1;  4QXK A;  2VOX A;  4LHS A;  4A7K A;  1GOF A;  1ZZ9 A;  5FYB A;  1MEC 1;  5T3N A;  2GN3 A;  2XL7 A;  1Q5O A;  1VRB A;  1VBD 1;  1QKQ A;  4Q5O A;  4ZON A;  1O4Y A;  4AI3 A;  5CFC A;  1R08 2;  5JMC A;  2IUW A;  3CJI A;  1OKQ A;  2WO3 A;  2C9A A;  2CY6 A;  3H3Z A;  1W8F A;  3I7D A;  3NJY A;  1UO9 A;  1BK1 A;  3CMG A;  2W68 A;  3T30 A;  2VOK A;  3LOB A;  2XBO 2;  2P17 A;  5ABJ B;  2YU1 A;  1GYK A;  4LHL A;  3ZVX A;  4YFZ A;  4FT8 A;  2DTW A;  4BQ4 A;  2O8Q A;  4XYX A;  2VEC A;  3KV6 A;  2XWJ B;  4GKX A;  4GUL A;  2Y6K A;  4Q2F A;  4CEW B;  4E8C A;  4Q0U A;  4K6B A;  1VIW B;  5JR7 B;  2RS1 1;  4LLO A;  1D4M 1;  1PIV 2;  4CCN A;  2A3Y A;  4DUV A;  4QPI C;  5CZK A;  1OOP C;  1YIF A;  4QXC A;  1TEI A;  3WVJ A;  3W58 A;  1RB8 G;  4CDU C;  3POJ A;  1PGS A;  1ND3 C;  4L97 A;  5KHI A;  4C0B A;  2D98 A;  1K3I A;  3VBR B;  2GDF A;  2GP5 A;  4NJ4 A;  1OT5 A;  2Q0A A;  3I54 A;  3ZSK A;  3KD4 A;  3NV3 A;  5A6X A;  3N9P A;  3DPR C;  2DVD A;  2QUO A;  3SXW A;  5KXD A;  5K9Y A;  2JB4 A;  4PT6 A;  1MPX A;  1SMV A;  5EJ3 A;  3M3Q A;  3DEC A;  3FUO A;  2K0G A;  2CSG A;  1LOF C;  4HG6 B;  3WX5 A;  2VTX A;  4HVO A;  4AGV A;  4W50 A;  4EN0 A;  1QU0 A;  4YZ4 A;  1ZBE 2;  1ZZC A;  3VDC A;  3OJB A;  4QPG A;  4P9J A;  1VBE 2;  4E9K A;  1JI6 A;  1WW6 A;  4M0H A;  5CG9 A;  1SQ4 A;  3JB8 A;  2A75 A;  2EIE A;  5EYY A;  1MS3 A;  5HCH A;  1RUF 1;  3KQR A;  2E63 A;  2WAA A;  3NV2 A;  1YRZ A;  4FPY A;  3UK9 A;  2QQN A;  3DUI A;  4UFH A;  1UU4 A;  1Q3E A;  2IFW A;  2HYX A;  1HIX A;  2IXK A;  2UUR A;  3AVR A;  1XSR A;  5DZG A;  3TEY A;  5FYH A;  1YFX A;  1Q8S A;  1K5J A;  4M0N A;  4M3C F;  4YM1 A;  4LNV A;  4OI0 A;  3J8F 3;  3GNE A;  3IN9 A;  5DG2 A;  2VUJ A;  2GP3 A;  4O61 A;  4B4Q A;  1SLI A;  3BPS A;  1W6P A;  3KHB A;  4UW5 A;  1PNF A;  2GNT A;  3PU3 A;  5EV7 A;  2RDS A;  4ITC A;  2Y64 A;  4OVE A;  3VV1 A;  4FPF A;  4TWT A;  2E33 A;  4BQ5 A;  5GLT A;  2E6V A;  1I5Z A;  2X5I A;  4RL7 A;  3OUJ A;  4XF4 A;  1CJD A;  3I3E A;  3B3Q E;  1OUR A;  4KH9 A;  4Q4V 2;  3CJI C;  4CCJ A;  3WG2 A;  4ZZ8 A;  2OPK A;  1V6N A;  2IXI A;  2PYT A;  4OUE A;  4ZU7 A;  2P3Y A;  3OEA A;  3Q8B A;  3LPF A;  3W9A A;  2GC1 A;  4DY3 A;  2VOW A;  1GNZ A;  4Z8B A;  3KF5 A;  1O3R A;  2IXH A;  3WD5 A;  1SLL A;  2G9Z A;  4BYY A;  3JUU A;  1BK0 A;  4IEY A;  4A7Z A;  4XAB A;  5FY8 A;  2UYB A;  4DUW A;  4N43 B;  2QQL A;  4H3W A;  3TWI A;  2P4E A;  3NV1 A;  4OHY A;  4A42 A;  5F8P A;  4BHP A;  1UY2 A;  1VBA 3;  1GP4 A;  1AL0 G;  1LOC A;  2QKD A;  2E31 A;  2V73 A;  3DGT A;  1YNA A;  3MW2 A;  1O3S A;  1BXH A;  3EJK A;  3NW4 A;  4AW7 A;  2OQ7 A;  3WNK A;  1GIC A;  4BA6 A;  5T5J A;  4XDO A;  2VMH A;  1YCI A;  5FZ9 A;  4D3W A;  3O1R A;  1S4C A;  3I59 B;  3NJV A;  1A8M A;  2BUK A;  2XJV A;  3I2J A;  4RYD A;  4KMQ A;  1QGL A;  4LJH A;  3BCW A;  4I09 A;  2VQU A;  1E5R A;  4IEP A;  3JQW A;  1BBT 3;  2XUM A;  3AXE A;  4RGG A;  2FZ1 A;  4XE9 A;  2Q30 A;  4BWO A;  4OUM A;  5CKQ A;  3SEP A;  4PDW A;  4D0Q A;  3DXU A;  2W9X A;  5C71 A;  3BTX A;  2W91 A;  5IWF A;  2P6C A;  5HV0 A;  1IPK A;  1FMD 3;  4QPG C;  3WNX A;  1QIQ A;  4HT1 T;  2YRO A;  1O3Q A;  2K9Z A;  1NLQ A;  1GP5 A;  2A6Y A;  1SCR A;  4JCK A;  1JOB A;  3KLS A;  2WJS A;  3EO6 A;  3FLR A;  4Q4X 2;  1DGR N;  5E88 A;  3U07 A;  5JSP A;  3GGL A;  1URX A;  4LMF A;  3UNP A;  2YBP A;  3FC0 A;  1FOD 2;  1XNK A;  1MS8 A;  2JE9 A;  3J7H A;  5HV4 A;  4UF0 B;  1IS3 A;  1FMD 1;  1W8H A;  1LEN A;  3HMY A;  4F8A A;  3V0B A;  2HBU A;  5FZ3 A;  1DQ4 A;  4XQD A;  1XNC A;  1W03 A;  2W1Q A;  4YVW A;  3SIS A;  1E57 A;  1X36 A;  5EQU A;  3JU9 A;  3AMQ A;  5EP9 A;  1N1Y A;  1GZC A;  2P2K A;  3RZZ A;  3I2O A;  5DMY A;  4QQO A;  4BCU A;  5A3P A;  4GAL A;  1US3 A;  3B02 A;  1XPW A;  4Y1Y A;  5DUW A;  2R04 2;  4QDQ A;  5LY1 A;  5LEK A;  1QDO A;  4OHW A;  2QZ2 A;  5FPB A;  1F2N A;  2JG8 A;  3HBK A;  4R9D A;  5T50 A;  4Q1P A;  5A3W A;  2ET1 A;  4B8E A;  1AR8 3;  1C1L A;  2X5I C;  1OLM A;  3APB A;  3M2M A;  3U4X A;  2GU9 A;  2R06 2;  4H55 A;  2FD8 A;  1WW5 A;  2MEV 2;  2VY0 A;  4LOR A;  1DGL A;  1C8M 2;  3MPP G;  1F5F A;  1AX0 A;  2XVL A;  1ULE A;  4CXW A;  4DXS A;  1ENQ A;  1S1A A;  1AR9 3;  3G7D A;  4IEO A;  5A6Z A;  1QH6 A;  2WII B;  5C8C B;  5FZ1 A;  2ERF A;  4CDX A;  2YBS A;  1TNF A;  4QWN A;  4XJU A;  1AR6 2;  3O14 A;  1PK6 A;  1RUD 2;  4FPK A;  4QGL A;  4HFS A;  3A4U A;  5F5I A;  2DWR A;  4LUK A;  5IW0 A;  1AR9 1;  3DN7 A;  1W6O B;  4IV1 B;  1VRH 2;  3WSO A;  5FP3 A;  4Q4Y 2;  1W2A X;  2PHT A;  4GMP 0;  4ZXK A;  4DFS A;  5BNN A;  4FO9 A;  4CCC A;  4KGQ A;  1V70 A;  4FPE A;  4RR3 B;  2ZX2 A;  3I2K A;  1UKR A;  3ITQ A;  3L9J T;  1ONA A;  4OFG A;  2B9U A;  3RVH A;  5IT6 A;  2B8M A;  2WNU C;  5JOZ A;  1UAI A;  3MIF A;  4MUV A;  2E7A A;  1HRV 2;  2VXJ A;  3AVS A;  2XXZ A;  3D8C A;  4E4D X;  2NN8 A;  2YPJ A;  4K21 A;  4JTO A;  5FPX A;  3FUQ A;  1YQ5 A;  1RMU 1;  1V9U 3;  3WF3 A;  2NLR A;  2ZHK A;  4Q4W 2;  1LGC A;  5F3G A;  4FBF A;  4CP9 A;  2B5H A;  4XF3 A;  3ZXG A;  2ZEY A;  3H8U A;  3QCW A;  1Y3T A;  1DQ2 A;  2ZKN A;  2BV4 A;  4Y5Z 0;  4IE4 A;  3RMY A;  4YLZ A;  2RS5 1;  5C6C A;  4AVS A;  1SLC A;  4LT5 A;  3M4F A;  1V0A A;  2VZV A;  3GJA A;  1F9K A;  2OZJ A;  4JDN A;  2JDA A;  4N7I A;  3O1S A;  3ZYG A;  1CAV B;  5A1F A;  1PX3 A;  5CKN A;  4Y3O A;  4WVM A;  5FZO A;  5FZG A;  5KHJ A;  3N36 A;  1H8T A;  2JDN A;  3V0A B;  2QQI A;  2QJV A;  4LBO A;  2XQX A;  3DYP A;  3TNP B;  2F4L A;  2XR4 A;  4YVW C;  1RUH 2;  5A1A A;  5BNO A;  5FFO C;  2DUP A;  4NUB A;  1PM7 A;  2W39 A;  3ETP A;  1NXM A;  4KG0 A;  1MEC 2;  4WVW A;  1UY0 A;  4D7S A;  1RVF 1;  1VBD 2;  3IDE A;  4I3G A;  5FXX A;  2WZE A;  3ZXK A;  3T0D A;  2BJS A;  2JG8 C;  4NRP A;  3RJ2 X;  1ZBA 3;  2UYA A;  1V6L A;  1GWM A;  1A6C A;  2P3J A;  3UKV A;  5FLJ A;  3WNP A;  3ON7 A;  2IXL A;  2VD7 A;  1CAX B;  4AAP A;  1GKB A;  4LO8 A;  3POB A;  1PHM A;  3ABZ A;  5FKB A;  3ZYR A;  5L9V A;  1NCQ B;  4YZ5 A;  1RGS A;  5JXG A;  3TEX A;  3LE0 A;  4I02 A;  5T52 A;  1ZBA 1;  3LZZ A;  4P08 A;  4P9W A;  3IMM A;  2RS1 2;  1ASJ 3;  1D4M 2;  3P5B A;  2ZBJ A;  4CDX C;  1QOO A;  2RDR A;  1DYK A;  4D6Q A;  5LRS A;  1PK6 C;  5JOY A;  3SCH A;  3AMH A;  1GMM A;  5FPL A;  3B01 A;  5DXD A;  5C5T A;  5C9A B;  1K12 A;  1UYZ A;  3AZY A;  4ZHN A;  3IIA A;  5A7W A;  4AFB A;  3LFI A;  1CIY A;  2XLF A;  1JU3 A;  2YB7 A;  4XJZ A;  1RUE 1;  4IGO A;  1CAU B;  4DY5 A;  5BNN C;  3GCX A;  1W3V A;  2E26 A;  2L9L A;  4ISQ A;  3H8X A;  4LA2 A;  1N1T A;  1KD7 A;  1OHF A;  1O6U A;  4XW3 A;  4FOW A;  4QKB A;  3OSD A;  3O12 A;  4IEW A;  3FFQ A;  1SG3 A;  2JG9 B;  2ES3 A;  4NWW A;  1AYM 1;  2Z4F A;  1H30 A;  4HPK A;  4IEQ A;  4H7M A;  5AVP A;  5HI0 A;  1I9R A;  3PJY A;  4HBN A;  3O7O A;  4L9B A;  2YMZ A;  5E16 A;  3WXP A;  4ZY9 A;  2PHU A;  1OKO A;  1DU3 D;  4X6Q B;  3LWC A;  1XXN A;  1HV1 A;  1C4R A;  4Q29 A;  2IZW A;  3S30 A;  3ZYI B;  1SPP A;  2TBV A;  4KWU A;  1H6Y A;  4FPL A;  1RUF 2;  1ZZB A;  2HWC 3;  3MIE A;  4JHZ A;  4LKD A;  4NPM A;  5JWP A;  2VBD A;  2FMY A;  1S0C A;  3HIF A;  3CEW A;  2FCV A;  4CDW B;  4LIV A;  3PTY A;  5FIX A;  3JCI A;  4NAO A;  3T1M A;  4ASK A;  4L8Q A;  4COV A;  1SHW B;  2WO7 A;  4NHL A;  2JDU A;  2Y6G A;  3SIT A;  4AHZ A;  5F2S A;  1XSQ A;  1H8T C;  2A6X A;  4YAR A;  1K5M C;  1HJF A;  2V5D A;  3WG4 A;  5EIY B;  1W04 A;  2ZEZ A;  5FZL A;  5BNO C;  1NYW A;  5A7Q A;  5C70 A;  5KXC A;  3IMN A;  3S7E A;  2RS3 3;  1AYN 3;  2XJS A;  1PM4 A;  4XTP A;  3AP4 A;  3WNN A;  3RYK A;  4PF1 A;  4AQT A;  3RI8 A;  1JXN A;  4BOW A;  2ZS6 B;  1NA1 A;  5A33 A;  2MHF A;  2D5F A;  1OI6 A;  3POW A;  4OZX A;  3WDV A;  1WGP A;  3NNG A;  1YEW A;  2QQM A;  4K40 A;  1C28 A;  2BP6 A;  4Y22 A;  5CIR A;  1JTZ X;  2JDZ A;  3UJO A;  3MIC A;  4B4P A;  1ZNP A;  5L19 A;  2RS3 1;  1R1Z A;  3EXU A;  3SNM A;  2JE7 A;  3I3M A;  3D0S A;  1POQ A;  2R6Q A;  3HVD A;  4A3X A;  2Y8K A;  3NVC A;  1JHJ A;  5A3O A;  4CEY A;  2CYF A;  4DEV A;  2PAE A;  1Q8P A;  2BEO A;  4HN0 A;  4XUQ A;  1Z7S 1;  5IK4 A;  2MNG A;  1DHK B;  3HNM A;  2Y33 A;  5LA9 A;  2WBK A;  3ZDS A;  3P3N A;  1KJR A;  1LRH A;  2RHP A;  4FFG A;  2XH6 A;  5JSR A;  3RNS A;  1UKG A;  2YV8 A;  2JKX A;  4D8M A;  1G9A A;  3WDW A;  3WHT A;  1RHI 1;  1I3H A;  5F2W A;  1PO1 1;  3G6J B;  2ZML A;  4KWK A;  2TNF A;  2ZGS A;  4E4S A;  5L9R A;  3T2P A;  3DYO A;  2BTV C;  4NMI A;  1QJU 1;  1W6Q A;  2WT2 A;  3HN1 A;  2X8K A;  2YFZ A;  2Y34 A;  4DOU A;  4QU2 A;  4UI9 L;  2Y38 A;  2VG9 A;  3K51 A;  1LOE A;  1F15 A;  1MS4 A;  2WKK A;  3NNF A;  4IE0 A;  3S5Q A;  4Q0Q A;  3VBU B;  4DB5 A;  1D2S A;  1YUD A;  5BNQ A;  3U14 A;  3LSD A;  3WQ0 A;  4F7Z A;  3M3I A;  4XHB A;  5J09 A;  3ZXD A;  1H2N A;  4KU8 A;  3LB9 A;  4N53 B;  4BQX A;  5IVB A;  2WQ4 A;  3OGG A;  1E5H A;  2CTV A;  4AED B;  1IG0 A;  1BYH A;  1XE7 A;  5I0T A;  3ZDV A;  2QQP A;  1OD3 A;  1FMD 2;  3KCY A;  5M0T A;  5B2G B;  1LHU A;  1C3H A;  3ZPO A;  3O0W A;  4YM0 A;  2BNM A;  2ZGK A;  3WV6 A;  3WF2 A;  4QM9 A;  5FUN A;  5LA2 A;  3AM2 A;  1LTE A;  4XF0 A;  5E89 A;  1IG3 A;  3EBR A;  2ZKL A;  3AZX A;  2H6C A;  2OS2 A;  3NKG A;  2WA3 A;  3AP6 A;  2QQU A;  3VHR A;  5IAT A;  2FHR A;  4XIL A;  3RS6 A;  5FP4 A;  3ZR6 A;  2D6M A;  2WS9 1;  1DIW A;  1WA6 X;  1YQ2 A;  3MIB A;  1SBE A;  2R07 1;  3OBA A;  4L2N A;  4XMA A;  3VD9 A;  4MG2 A;  2CGO A;  3B00 A;  1H2L A;  4AFM A;  1NA1 C;  1LOD A;  2WZR 3;  1BVP 1;  4QHO A;  3SMH A;  1PX4 A;  3VKM A;  4K7J A;  5FZB A;  1WKY A;  1H9P A;  5J36 A;  4QX5 A;  1V6O A;  3LSE A;  2FDH A;  4UFJ A;  1W2O A;  4CEY C;  2RM2 3;  4Y24 A;  3MPB A;  1GNH A;  1NCR A;  2PAM A;  5FQ0 B;  1X8E A;  4NIG A;  2VPV A;  1O8S A;  3PVB B;  3ZYJ B;  1QHD A;  4WM8 A;  3ZXJ A;  1LAJ A;  1OA3 A;  1NZI A;  3ILF A;  5TSW A;  1PGL 1;  4F3J A;  4HLT A;  2PXJ A;  4X6R B;  3EB7 A;  1AR9 2;  2R1D A;  5IAV A;  4Q0P A;  3KV5 A;  2RM2 1;  3HT1 A;  4XJ8 A;  2YZ4 A;  3USU A;  5H9S A;  2WWU A;  1ND2 A;  4CCM A;  1TMF 3;  1S0B A;  4RFT 0;  3H8O A;  1OSG A;  1US2 A;  3R0R A;  3LOI A;  3QH6 A;  1GFF 2;  4HK9 A;  4QMA A;  1F4A A;  4CE8 A;  1EY2 A;  2O14 A;  1RC6 A;  3IM0 A;  2WNU B;  1QJX 3;  2W08 A;  4H2A A;  1HV0 A;  4XVH A;  1SEF A;  3R05 A;  3FHI B;  1PO2 3;  1HQN A;  4U36 A;  3UET A;  2W2I A;  1RUI 1;  3VBS B;  3IDA A;  3ZXF A;  3GCW A;  3SH4 A;  3N9N A;  1TMF 1;  4YRD A;  4E4H A;  3THC A;  3AKT A;  5FK7 A;  4W8J A;  3J7M A;  1RMU 2;  1Q8V A;  1XNT A;  4NIA A;  1J59 A;  4LE4 A;  2XJP A;  1QJX 1;  3KT1 A;  3RFR A;  5IVV A;  1YFW A;  4RS5 A;  3WCR A;  3OCP A;  5FZ8 A;  2BGO A;  3E97 A;  3DV8 A;  3K75 B;  4CYD A;  1BEV 3;  1ZVF A;  2RS5 2;  3E1F 1;  2EVX A;  3RZL A;  1REE A;  2DYC A;  4QKF A;  2QFE A;  3MDP A;  2XKP A;  1Y9M A;  2XVG A;  1DF0 A;  3QH7 A;  4QKN A;  1YJK A;  4GWN A;  2XHN A;  5KC5 A;  1VMH A;  5ACA 3;  3SKV A;  3WQ1 A;  2GMM A;  3AMN A;  4CUA A;  4LK6 A;  1JS9 A;  1XOY A;  1XJA A;  4XFB A;  3RGB A;  1L7L A;  4BK4 A;  3MFA A;  3BU7 A;  1NY7 1;  1NLS A;  5LBE A;  2X05 A;  2O0O A;  1WW4 A;  4MYE A;  1EPW A;  4Z07 A;  3LPG A;  5K0U A;  1W6M A;  1RIN A;  4BB3 A;  1IHM A;  1T2X A;  3O1U A;  1QJZ A;  4K8F A;  4Y5T A;  2DUR A;  3WQB A;  3K77 A;  3KHC A;  2VGD A;  4YW1 A;  1JYN A;  1ZZ6 A;  1RVF 2;  4AEK A;  3GM8 A;  4UBH A;  4IUG A;  2DCJ A;  5J48 A;  1YQ8 A;  3JXS A;  4YZ3 A;  1VLN A;  3BTA A;  3IPV B;  4XF1 A;  3RWK X;  1SAC A;  2E7T A;  3T08 A;  4HN1 A;  3A23 A;  1R1A 1;  2O8O A;  3KVB A;  1R09 3;  3P1I A;  5FOJ B;  4NWV A;  4XBL A;  3AZV A;  4JKM A;  1C5I A;  3ZFF A;  4IND A;  4JQT A;  1JYX A;  1RUJ 3;  4QGM A;  1RIR A;  4PI2 A;  3T2T A;  3LF7 A;  4IET A;  2BRT A;  1ZBA 2;  4XDP A;  3VD7 A;  2CGP A;  3M3E A;  4QM8 A;  3RZJ A;  3THD A;  5FYI A;  2E53 A;  4FPO B;  1SCS A;  2PHD A;  2P37 A;  2YXS A;  1CAW A;  3I8T A;  4JC1 A;  2WC2 A;  1AHS A;  1CES A;  1LOB A;  4WM8 C;  4Z82 A;  1IPS A;  4FI9 A;  3RWN A;  4HZF A;  1QMJ A;  1RUG 3;  5D2A A;  3CJX A;  1MS9 A;  4EZH A;  1WMF A;  1SDD B;  4GB3 1;  4NE9 A;  3WEZ A;  2YGM A;  3GZE A;  3WUD A;  4P9X A;  2EAA A;  3DXT A;  3WP3 A;  1RUE 2;  5BNN B;  1VBB 1;  3WUC A;  1ND2 C;  4B7E A;  3B9I A;  1JYW A;  5J7M A;  5EFU A;  4KL1 A;  1EAH 1;  2ARE A;  4JX0 A;  4RGK A;  1MQT B;  2ORZ A;  4W6Y A;  1W2N A;  3NNJ A;  4LO4 B;  1RUG 1;  4NN0 A;  4KBZ A;  4LR4 A;  3ZYH A;  1RUC 3;  4BIO A;  4IV3 A;  3ZXE A;  1AYM 2;  4I30 A;  3C2U A;  5FYV A;  1O5U A;  1F35 A;  4TLG A;  1ENX A;  5IVF A;  3R4D B;  1OVP A;  1AR7 3;  1NE4 A;  1XNA A;  2GN7 A;  1FPN 3;  2RVA A;  1KQR A;  4KQ7 A;  4W4Z A;  5E1R A;  1FI2 A;  5L7O B;  2ETE A;  2OT7 A;  2UU8 A;  2R32 A;  3U4S A;  3ZYP A;  5A70 A;  1QEX A;  2WNV A;  4JDM A;  3VBO C;  1F8V A;  3MF6 A;  1NZC A;  2ZEX A;  2I2S A;  2D43 A;  2J1R A;  1OH3 A;  4DEQ A;  2GNM A;  4YZ2 A;  2VJX A;  1W8T A;  4LKE A;  5KR7 A;  5CEH A;  4G9S B;  1FPN 1;  3LIH A;  2XOM A;  2HEW F;  1V6J A;  3POF A;  1HN1 A;  2BER A;  2PFW A;  2YU2 A;  1CX1 A;  4NRQ A;  3R4U A;  3OBZ A;  4W6W A;  3ST7 A;  1JUI A;  4BMB A;  3B9C A;  1COV 3;  1K5M B;  2VCM A;  2RJ2 A;  3ACI A;  1GBG A;  4KNC A;  5CA6 A;  2VO5 A;  1WLT A;  2EID A;  5F6K A;  2J1U A;  2VTX J;  3ZFE B;  4BXS V;  2VNR A;  4E2G A;  2DVB A;  5JSO A;  4LBL A;  1X9P A;  4LHN A;  4DIN B;  1VAK A;  4FTB A;  2HEY F;  3HT2 A;  4IEV A;  4QXB A;  4YGD A;  1U5I A;  5GZG A;  2G19 A;  2ZZQ A;  3I49 A;  5JUV A;  1P8J A;  4R52 A;  1RYY A;  4RHV 3;  2PTM A;  2RS3 2;  4OMD A;  4Y20 A;  2JDK A;  1LCL A;  1F31 A;  5IJR A;  2BQP A;  3OGJ A;  1XE8 A;  1W90 A;  2RV9 A;  1Z7S 2;  4MSV A;  2VTF A;  4XDQ A;  2WQ8 A;  5KXE A;  1DDL A;  3KCX A;  1AL2 3;  1FAT A;  3NQH A;  1ZM1 A;  3JD7 3;  2XON A;  4HKO A;  4XFG A;  4LK7 A;  4RHV 1;  2ADE A;  5CAZ A;  4OYU A;  3WDU A;  5C3Q A;  3JBG 3;  4L99 A;  4AL9 A;  2JB8 A;  5F1R A;  2LW8 A;  3N7J A;  2J42 A;  3NST A;  1H1A A;  3O0V A;  3PME A;  1RHI 2;  4XPV A;  4XQ4 A;  1PO1 2;  2ZX3 A;  2Y0I A;  2YG0 A;  1YYN A;  1WD4 A;  1AL2 1;  1YFU A;  3IBM A;  1QJU 2;  4JGZ B;  4DIQ A;  3POI A;  1LJ7 A;  4YVS B;  2A1X A;  3WW2 A;  3ZR5 A;  2J1E A;  3JBG 1;  4OMC A;  4RQP B;  4UFM A;  3PUR A;  3RI9 A;  1XND A;  4JGY B;  4KBB A;  3FLT A;  4FP2 A;  4BLJ A;  4IV3 C;  1SLT A;  5FYZ A;  1D0G A;  1E5S A;  3PLQ A;  2A7A A;  2VNG A;  2Q8O A;  3B7M A;  2AZ5 A;  4Y1U A;  2GSY A;  4Y33 A;  2XLA A;  2HH9 A;  4N7U A;  4AVV A;  5I93 A;  2WNV C;  5LA0 A;  5LCW L;  2D6K A;  4UOJ A;  2G1M A;  5F5Q A;  3BTY A;  1KRI A;  4CTE A;  4EWA A;  5HXV A;  3UT0 A;  1DZT A;  1DFQ A;  2JWP A;  1D4V B;  3KVA A;  2YUE A;  3Q8A A;  1POV 0;  4XUR A;  4A44 A;  2ADD A;  2OUH A;  5FBJ A;  1ZX5 A;  2VOV A;  3OY8 B;  3J8F 1;  5LBC A;  2W95 A;  3KM5 A;  4Q8L A;  1PNG A;  4R8H A;  1JYT A;  1TG7 A;  2OUJ A;  3VBF A;  1GZW B;  2ZX0 A;  3I2I A;  1OQ1 A;  4NRO A;  2W1S A;  1W28 A;  1H1M A;  3LCP A;  4FSJ A;  1OF3 A;  1JHN A;  3OG2 A;  5FJK A;  3H0O A;  2C9K A;  2D7F A;  4AR2 A;  4WVZ A;  5LBF A;  2WS9 2;  1S0E A;  4WBB A;  2R07 2;  3WHU A;  1X33 A;  2VAU A;  1NXD 1;  4P9L A;  1KEX A;  4HSJ A;  2MPF A;  1RJ7 A;  3VBH B;  3ZFG A;  5HPO A;  1B35 A;  2AC1 A;  2NMN A;  2VUL A;  1EV1 3;  5DUV A;  5JXI A;  1JW6 A;  5ANQ A;  1RUO A;  2R7E B;  3MLJ A;  2E32 A;  1GU3 A;  1JYC A;  3J9S A;  4LO6 B;  3IWZ A;  4BQ2 A;  4FXK B;  3OB8 A;  2ARB A;  5F7U A;  1JZ2 A;  3TEZ A;  4OHX A;  4NIH A;  3J26 N;  5A3T A;  2I45 A;  3W5M A;  5FZ7 A;  1DLL A;  1LHV A;  4XJW A;  1ACC A;  3RZK A;  2ZMN A;  1UD1 A;  2ZGO A;  2JJ6 A;  4GWJ A;  4Q0S A;  1QJY 3;  1OH4 A;  1DP0 A;  1UY4 A;  4G3Y C;  4LIT A;  4OQ9 A;  3AP9 A;  4CU6 A;  1VBA 1;  1BKZ A;  3GHM A;  4PQ9 A;  4C1W A;  1OA2 A;  2H0V A;  4UYB A;  5DUU A;  5FY9 A;  1PGL 2;  2LTN A;  1J3Q A;  1LEM A;  2JDY A;  3S7I A;  4QT6 A;  2B39 A;  3AYC A;  2XUE A;  2D6P A;  1BVV A;  1QXR A;  1U0A A;  1VB2 A;  1XRU A;  1YI7 A;  1R64 A;  2QQW A;  2TEP A;  2RM2 2;  3KQ4 B;  3MW4 A;  3N9M A;  4Y5S A;  4YGB A;  1VPH A;  3NO8 A;  1A3K A;  2D97 A;  4F83 A;  4XC9 A;  2YDE A;  3OGV A;  4LO5 B;  5GLV A;  4A3Z A;  5C5U A;  4OI4 A;  5CU1 A;  4OI1 A;  3GHN A;  5J37 A;  1UNB A;  4QD2 A;  4GJY A;  1TZO A;  4WV8 A;  1BBT 1;  3MUZ 1;  3S57 A;  1UZW A;  5D8A A;  1W0P A;  2Y6J A;  4NPR A;  5K4L A;  1RUI 2;  1G9D A;  2RR1 3;  4ATF A;  1X82 A;  5JR2 A;  2GAU A;  3WG1 A;  1TMF 2;  4RD7 A;  3W20 A;  2GH8 A;  4QHZ A;  3NNM A;  4JHT A;  4QDS A;  2BW8 A;  1QJX 2;  2KA3 A;  4QPY A;  2Y6H A;  3T09 A;  5EZW A;  1OC1 A;  5JOX A;  2ZHL A;  4QQH A;  1BQP A;  1Q43 A;  4AVB A;  1UL9 A;  4UXA A;  1SLB A;  4DRR A;  2UY9 A;  5KC6 A;  3HD8 B;  3N7K A;  2VZO A;  3B94 A;  4GXL A;  3WOG A;  4D6S A;  2Y26 A;  2WYF A;  1VR3 A;  3CBN A;  4LQR A;  5APA A;  4AHW A;  4ARX A;  1OPO A;  3PUA A;  1SFN A;  3LFM A;  4LKS A;  3PDQ A;  1W05 A;  4LXL A;  4TSV A;  4COZ A;  2ATF A;  4EV0 A;  4FTE A;  1WLC A;  3KGZ A;  5JVV A;  3VBF C;  2RDN A;  2VQA A;  1NY7 2;  1AXK A;  1DZR A;  3LEK A;  4IE7 A;  4JKL A;  4AF9 A;  1HB2 A;  4TZD A;  5FMO L;  1DGW X;  2EAL A;  4LUL A;  2Q1F A;  3ATG A;  1AR8 1;  3GXU A;  5AVA A;  2G9F A;  2FCT A;  1I5P A;  4PHZ A;  4Q1R A;  4XZP A;  4IES A;  1GZT A;  1RTV A;  2HWE 3;  3EMR A;  1W6N B;  2EA7 A;  2VZR A;  2ZGN A;  1R1A 2;  2AEN A;  4I0B A;  4QX2 A;  1B35 C;  4WM7 A;  2A3X A;  4GJZ A;  1S0F A;  5JCT A;  2VME A;  3ZM8 A;  1WLD A;  4FPJ A;  3S0M A;  2UWA A;  4BDV B;  3U78 A;  4QB6 A;  2C26 A;  3K2O A;  5JLV A;  1W0O A;  2DFB A;  5I8T A;  2VZQ A;  1HLC A;  1W39 A;  3FL7 A;  1YO8 A;  4I3P A;  1CWP A;  1RUN A;  2ARX A;  3LIG A;  3WQ7 A;  2N7G A;  5C7G A;  4WZC A;  1UOF A;  3VN4 A;  2A3W A;  1BZW A;  1DLC A;  3RSJ A;  1AXY A;  4XAE A;  5GKA C;  2I07 B;  4MHR A;  5LAT A;  1QQP 3;  4CVU A;  1BMV 1;  1W8W A;  4GH4 A;  1Z0H A;  3DEM A;  3VDD A;  4PQQ A;  4GB3 2;  3ZFF C;  1MR5 A;  5AC9 3;  4PDW C;  4AYU A;  2P3K A;  3NAP A;  1VBB 2;  3K46 A;  4JKK A;  5FXV A;  5BNP A;  3M8L A;  5CG8 A;  1EAH 2;  1GOH A;  1WCD J;  3B93 A;  2YFU A;  3LGR A;  4M3C A;  5KHG A;  1QQP 1;  1UOJ A;  1H8V A;  1RUG 2;  1UX7 A;  3GYD A;  4QB2 A;  4ERO A;  4XET A;  4BME A;  2LAL A;  3O1V A;  3AJZ A;  2J1A A;  4AFD A;  2IWG B;  5AC9 1;  1IPJ A;  4PCR A;  5D8A C;  5A32 B;  3SQO A;  5DQ0 A;  2YC0 A;  2XB6 C;  5IK8 A;  1QOS A;  1V9U 1;  2XDV A;  4HKW A;  5DN2 A;  5FUP A;  3ZSM A;  1EYB A;  3POE A;  2JKB A;  4CDQ B;  2J22 A;  2HKX A;  1DQ6 A;  1UIK A;  4FOV A;  3VBO B;  1MVE A;  3U0Z A;  4MGT A;  2XG3 A;  1JZ3 A;  4UAP A;  1RXF A;  2BFU L;  5C4W A;  2WUH A;  1UYX A;  3VKO A;  3WIN E;  1SBD A;  1W9T A;  1FPN 2;  4XJ9 A;  1LHO A;  1MS5 A;  4B29 A;  1AX2 A;  1WBL A;  2ARC A;  4GD4 A;  2JEC A;  3ZN6 B;  4AE2 A;  1T6B X;  3NNL A;  4YGC A;  4BM8 A;  4QGN A;  3KZ4 C;  4A2U A;  3K3O A;  1N3O A;  3WY6 A;  1WME A;  3WG3 A;  4XF9 A;  2VBB A;  3TAY A;  1AXZ A;  1YHF A;  3UES A;  3ZX7 A;  4B3N A;  5ABJ A;  5FZF A;  1KGY A;  2A5Z A;  3BIW E;  4LEJ A;  3RYR A;  3KWV A;  4KWJ A;  1GAN A;  1H1I A;  3OYW B;  3T2O A;  4DS0 A;  4CEW A;  4AI1 A;  4M3C E;  4DRV A;  5CBL A;  4QPI B;  3NMB A;  1OOP B;  1W0N A;  2F6B A;  3CZU A;  1FT9 A;  3ZPY A;  1Y43 B;  2XJT A;  4CDU B;  3K48 A;  1JOP A;  2GNB A;  4ISR A;  1SFY A;  1QJE A;  1GWK A;  5I91 A;  3OD4 A;  1ND3 B;  1S0G A;  2VVD A;  1PZ8 A;  4YNI A;  1PVC 3;  1NT0 A;  4XJA A;  1FYU A;  3VLB B;  3CKH A;  1ASJ 1;  4MH0 E;  2Y6L A;  3N7L A;  2VNV A;  3DPR B;  4BQ1 A;  4O9E A;  3VBR A;  2CAU A;  1Y9G A;  3PMS A;  5JZG B;  2VVF A;  4XCA A;  2Q8D A;  5HCA A;  4UW4 A;  4PF5 A;  1NG0 A;  1PZ9 A;  1YIP A;  3B5L B;  3MLK A;  5SV8 A;  4H14 A;  1H9W A;  4RHV 2;  3OBT A;  3BUC A;  1CJP A;  3VKL A;  1PVC 1;  4QQ2 A;  4LOS A;  5DAB A;  2WDB A;  5CYY A;  2QVS B;  2PQQ A;  4XFF A;  1XNB A;  1JYV A;  3CO2 A;  4GH4 C;  2E7Q A;  2VE1 A;  4Y1V A;  1KS5 A;  2OX0 A;  4XOG A;  5LZ6 A;  3VDB A;  2WFP A;  1U5X A;  2I74 A;  3E6B A;  3IAQ A;  3MW3 A;  3WNO A;  3BU0 A;  1AL2 2;  2AAC A;  4E27 A;  1ZRI A;  3MIG A;  3LEG A;  4PBO A;  3NAP C;  5LEJ A;  3BIE A;  2QQJ A;  3ZOI A;  4AI0 A;  1WCS A;  5BNP C;  4RFR B;  1D0H A;  4N90 A;  2W52 A;  3ACH A;  3AKP A;  3JBG 2;  5KBF A;  1LB2 A;  4OCT A;  3M3C A;  1GQG A;  2RDQ A;  3IKW A;  2BOI A;  3VZL A;  4L0P A;  4EN8 B;  2WLP A;  2ZAH A;  1QOT A;  2ZZJ A;  2VH9 A;  2IFR A;  3HQX A;  2RE9 A;  4LBQ B;  3FHQ A;  1YJL A;  3MUY 1;  3NL1 A;  1CPM A;  4B1L A;  2D6N A;  4FAH A;  2HWC 1;  5DAV A;  3OBR A;  4R4Z A;  5FKC A;  3BOP A;  3H42 B;  4AK3 A;  2B45 X;  4ES8 A;  4R9C A;  4QPW A;  5C4W C;  1QF3 A;  2QNK A;  4JZR A;  1VMF A;  3P6B A;  2DV9 A;  3HBZ A;  2EXH A;  5HBA A;  3KCC A;  4IEU A;  4UW6 A;  4CPB A;  1UMI A;  3U11 A;  5CFC B;  2XBO 3;  3J8F 2;  1UMH A;  1WWY A;  3CJI B;  4FFI A;  1YQC A;  3I2H A;  1GWL A;  1POV 3;  1H2K A;  4X8P A;  5FYC A;  4COY A;  3LKJ A;  4MLO A;  2Q5T A;  1EUU A;  3NRU A;  3LA3 A;  5FZ6 A;  1N3P A;  3ORJ A;  3CNA A;  2ZJC A;  4XAA A;  1W2U A;  1PIV 3;  5J96 B;  1IQD C;  1AYN 1;  1L7R A;  4BJ0 A;  3D3A A;  4E2Q A;  3RG0 A;  3VB9 A;  2XBO 1;  3W59 A;  5ABJ C;  1UZY A;  4MXW A;  3RZH A;  2JD9 A;  2FDG A;  4HK8 A;  1AJK A;  4NID A;  1MZ6 A;  4IW3 A;  4CEW C;  1RJ8 A;  1HDK A;  2FDJ A;  5FZA A;  4N43 A;  5A7N A;  5FJH A;  4DZG A;  3NWK A;  3C7O A;  4UBG A;  2WR9 A;  3O0X A;  1HXS 3;  4TXW A;  4MGZ E;  2VBP A;  5FO7 B;  3MZH A;  1UY3 A;  3PU8 A;  1HB4 A;  2EF6 A;  3III A;  4L11 A;  1PMI A;  4MHU A;  1RXG A;  4JQR A;  4YW6 A;  5FPU A;  2E9Q A;  4GWM A;  3VBR C;  5FPZ A;  1VBA 2;  1KS4 A;  4IGP A;  1UZ0 A;  4LIU A;  4CCK A;  3I59 A;  4AVA A;  3KT7 A;  1ZBE 3;  1LUL A;  1S0D A;  1VBE 3;  1HXS 1;  5IUQ A;  2DU0 A;  3UGG A;  4QX7 A;  4A6O A;  4AG4 A;  4FTS A;  4AI9 A;  4TLF A;  1M4W A;  1GQH A;  1X8M A;  1ULG A;  2EXK A;  4P9Y A;  1C5H A;  5LAS A;  4A7Y A;  4YSF A;  1GQP A;  4QDR A;  4QPG B;  5F9T A;  2C6S A;  2SBA A;  2WWJ A;  3GF6 A;  1WLW A;  3HJR A;  4A45 A;  4B7K A;  4E4Z A;  2R49 A;  1YQ6 A;  5JXJ A;  2OYZ A;  3DL3 A;  3PUI A;  2WZ8 A;  5A7P A;  3KT4 A;  2FDK A;  3VUO A;  1BBT 2;  1XYN A;  3LD8 A;  4Y1Z A;  3ZYF A;  2VOT A;  2XL9 A;  2W47 A;  4OUL A;  5KHH A;  3DKQ A;  3OOX A;  4S2H A;  4EYU A;  1UOG A;  3KV4 A;  2W46 A;  4C0H A;  2R30 A;  3AYE A;  1H2M A;  5C3R A;  3QAC A;  4FP3 A;  4OI2 A;  4UF0 A;  2LS6 A;  5A3L A;  2JIG A;  1L7Q A;  5FY0 A;  5A3N A;  4LTA A;  1H0B A;  5FZM A;  2CHH A;  4KU7 A;  4BIS A;  4BE3 A;  4BIF A;  2D3R A;  4XEZ A;  1W6P B;  3UJQ A;  5A80 A;  4Q4V 3;  2VZ3 A;  3ENR A;  3ILR A;  4JDO A;  4O9G A;  2LUW A;  2PAK A;  2FDF A;  2H0B A;  3CU7 A;  4TN7 A;  3IDC B;  2ZCW A;  1KFU L;  3B69 A;  3MV0 1;  4URT A;  3TN9 3;  1A8D A;  1G9F A;  2X5I B;  4EWE A;  2Q4S A;  2WSV A;  5IK7 A;  2Q1Z B;  1APN A;  3MEP A;  4IE6 A;  3PVE A;  4UW3 A;  3O1O A;  1UIJ A;  1DCS A;  3X29 B;  5DUX A;  4LBM A;  2DVG A;  2JX9 A;  1UYP A;  2Z2S B;  4N9I A;  1YXW A;  2J7M A;  1AR8 2;  4KI5 M;  5FLH A;  3TN9 1;  2ZAB A;  5CKM A;  1OA4 A;  2DTY A;  2WZR 1;  3RPQ A;  3PVN A;  5C8C A;  4CCO A;  1EUT A;  3LEI A;  4HL0 A;  4AVC A;  2XHK A;  3AB0 A;  3FBM A;  2DDU A;  3SEE A;  4AEJ A;  4N43 C;  5JIU A;  3PIJ A;  1TME 3;  2V5Y A;  2CV6 A;  3PL0 A;  1D2Q A;  5JI7 A;  4E8D A;  1XU2 A;  1XBF A;  3MO4 A;  2WYS A;  2CL2 A;  4LBQ D;  1UXZ A;  3ILN A;  4WZF A;  4UT5 A;  5K8S A;  1W6O A;  3H7J A;  4XFC A;  4AWD A;  2KXL A;  4HVR A;  2V4A A;  3AP5 A;  4GQ7 A;  1O3T A;  4MOA A;  4ATE A;  5FYM A;  4GMP 3;  3UV9 A;  4RR3 A;  1TME 1;  4LO7 A;  5JIA A;  1IZ3 A;  3INA A;  3LA2 A;  5FOB B;  5LK7 B;  1BMV 2;  3Q8C A;  1HW5 A;  3AKR A;  3WR0 A;  3MYX A;  2BNO A;  1IGO A;  1FAY A;  2WZP P;  4BZ4 A;  4D7Y A;  1CIW A;  4PDW B;  4MET A;  1G6N A;  4Q4X 3;  5AFB A;  4MV2 A;  2C5D A;  2F17 A;  5BYN A; 
#chains in the Genus database with same CATH homology
 2OQ6 A;  5IVB A;  5FYH A;  3PU8 A;  4CCL A;  4IGO A;  3K3O A;  5FZC A;  3K3N A;  2GP3 A;  5FPU A;  5FV3 A;  5FZ1 A;  5FP8 A;  3PU3 A;  4IGP A;  3KVB A;  4LIU A;  3ZPO A;  5FZF A;  2YBS A;  3AL6 A;  4CCK A;  5LWB A;  4QWN A;  5FUN A;  4DIQ A;  3OPW A;  4QX7 A;  5FYY A;  5F5I A;  5FY5 A;  4AI9 A;  5ISL A;  4EZ4 A;  4XDP A;  4D6S A;  5E6H A;  3PUR A;  5A7O A;  5IW0 A;  2OS2 A;  5FYI A;  4QXH A;  4CCJ A;  4DO0 A;  5FP3 A;  2WWJ A;  3PUA A;  5FP4 A;  5A1L A;  4LXL A;  3PDQ A;  5FYZ A;  3LDB A;  5A7P A;  2Q8C A;  3KV9 A;  3LD8 A;  4Y33 A;  4LIV A;  4EZH A;  3PTR B;  5FZE A;  3RVH A;  3N9O A;  2Q8D A;  5FY8 A;  3AL5 A;  4ASK A;  3PUQ A;  4EYU A;  5F37 A;  3AVS A;  3KV4 A;  2XXZ A;  5FZB A;  5FYB A;  3DXT A;  5F32 A;  4V2W A;  5A7W B;  5FZD A;  5F2S A;  4UF0 A;  1VRB A;  5FPV A;  5FY7 A;  3KVA A;  4C8D A;  5FY0 A;  5F3E A;  5A3N A;  5FWE A;  2OX0 A;  5FZM A;  3NJY A;  5FZL A;  5FWJ A;  5F3G A;  3N9Q A;  5FBJ A;  4BIS A;  4Y4R A;  2OQ7 A;  4GJZ A;  5A7Q A;  5A7S A;  4XDO A;  2P5B A;  5FZ9 A;  5A80 A;  5FYV A;  3U78 A;  5FP9 A;  2YU1 A;  5IVF A;  3K2O A;  5F3C A;  2PXJ A;  5LY2 A;  3KV6 A;  4TN7 A;  2OT7 A;  3PUS A;  3U4S A;  3KV5 A;  4IGQ A;  5F39 A;  5FZK A;  3N9L A;  5FYS A;  5A1F A;  4Y3O A;  5FJK A;  4CCN A;  3OPT A;  2WWU A;  5FZO A;  5FZG A;  4CCM A;  4QXC A;  4CSW A;  4BXF A;  4QX8 A;  3DXU A;  5KR7 A;  5CEH A;  5F3I A;  5IWF A;  5IVE A;  4CUG A;  2Q8E A;  4NUB A;  4URA A;  2YU2 A;  5ANQ A;  2W2I A;  2GP5 A;  4HOO A;  5FXW A;  5FXV A;  5FYU A;  3N9N A;  3N9P A;  5A3T A;  5FXX A;  5FZ7 A;  4E4H A;  2YBP A;  5LW9 A;  5FY4 A;  5IVY A;  4CCO A;  4D6R A;  4UF0 B;  5FZI A;  4HON A;  4LIT A;  5F5A A;  5F2W A;  5IVV A;  2VD7 A;  4AAP A;  3ZLI A;  5FZ8 A;  5IVC A;  5FZ3 A;  5FYC A;  5FY1 A;  2YBK A;  2XDV A;  5FY9 A;  4QXB A;  5FUP A;  4V2V A;  5FZ6 A;  2XUE A;  5IVJ A;  3UYJ A;  2XML A;  3N9M A;  4QU1 A;  4BU2 A;  5FYM A;  5A3P A;  5FZ4 A;  5LY1 A;  5F5C A;  2YPD A;  5FPB A;  5FYT A;  5FPA A;  4D6Q A;  5A3W A;  4GJY A;  5FXZ A;  5FPL A;  5FZO B;  4GAZ A;  5FZH A;  5FZA A;  5A7N A;  5FJH A;  5FZ0 A;  5A7W A;  5K4L A;  4GD4 A;  5FP7 A;  3AVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...