4UREA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
248
structure length
248
Chain Sequence
b'MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOHEXANOL DEHYDROGENASE
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
molecule tags Oxidoreductase
total genus 98
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ureA00
1E3LA 2HO5A 3RFTA 1ZMOA 4HNGA 1PGPA 3ANLA 4JCOA 1HL3A 4N54A 1F06A 2GZ2A 5GZ6A 4H7PA 1NWHA 3GVIA 6ADHA 2NWQA 5I9MA 3BHMA 5DNAA 4MP8A 1TT7A 1K6JA 1JN0A 2CMDA 1C1XA 3DHEA 9LDBA 3VH1A 1QSGA 1GUFA 4TRJA 4R1SA 1ISJA 1XR3A 5JNLA 4EJ0A 3VKUA 1J49A 3ORFA 3PJFA 3ZWYA 3KSDO 3ZWOA 2X5JO 4GI2A 3CIFA 4N5MA 1MG0A 4E2ZA 2DT5A 2VOJA 2PK3A 4OHUA 4YEDA 4AJLA 4UUNA 1PGJA 2VRCA 5IDQA 1GD1O 1VKNA 5KVSA 1DC3A 4ESOA 2FPGA 4FS3A 4M87A 3H3FA 5FYDA 3C1TA 2GPTA 2FRDA 4KTVE 3PIDA 3OQ1A 2HK9A 1E7RA 3HFGA 4J9VA 4DQUA 3VVBA 4R69A 5DCUA 1GEGA 4XYMA 2YDYA 4IINA 1GTMA 4AL4A 4WASA 4Y6PA 4CQMA 5A9SB 3ONDA 4K6CA 4KUEA 1C0LA 3L9XA 4HFRA 1X7GA 2R00C 1ZK3A 1GQQA 3KLMX 4YRDA 4IIUA 1OC4A 1LDBA 1Q0HA 2GGSA 3CXRA 4WLOA 5AVOA 5BNIA 3PYMA 4J1TA 2DVMA 2J5RA 3OH8A 1LUAA 4BNKA 4WLVA 1GFSA 3C8MA 2VWGA 3H5NA 1C0PA 3GAZA 4MVJF 3ZWWA 1ULUA 3EZLA 3HDQA 5JFOA 1GZ3A 1H2BA 2O4UX 3H65A 4H15A 1MUUA 2EERA 4DGSA 1GCUA 3F47A 1R0SA 3OEYA 4CL3A 3S55A 3WMXA 1F12A 2DLDA 4TRMA 4GKBA 1KERA 3ZV3A 1LRJA 4A03A 4PLFA 1PL7A 4HP8A 3GMSA 3E9QA 3NEPX 1A7KA 3WDSA 3V1TC 3HSKA 1P1RA 2PZJA 4BQRA 1P1JA 4W7HA 3VPSA 4PLYA 1ZSVA 4YQYA 2Q1SA 2HRBA 3DZFA 3NJ8A 2NQ8A 3GT0A 5L40A 1DB3A 3P7MA 3E82A 1P1HA 2CFCA 2HU2A 2PGJA 4J6FA 2C7VA 1WWKA 2Y93A 2W2KA 1QYDA 4M55A 3PHJA 2Q2VA 2YJZA 1AXGA 2WE7A 1U3UA 4PG8A 1H5QA 3V1UA 1JKIA 4TMFA 4EZBA 3GQVA 1B8UA 1PJ3A 1PS9A 1MA0A 1YQDA 3WYEA 4ALIA 4Z0TA 1ZH8A 1PX0A 4JJFA 1YQXA 4W9NA 1RYEA 4JBIA 4XWYA 3HDHA 3MTGA 1Q0LA 5H81A 5KKAA 4E2XA 2X7HA 3CZRA 1KEWA 4J7UA 4MVJI 2P4HX 3TN7A 1DLJA 4BO1A 3PEFA 1S6YA 2EJVA 1DIRA 2AHRA 3PPIA 4WJZA 1NFRA 5COAA 4PVCA 2Y1OA 1ENOA 3UKOA 2FR0A 4HUJA 4IS3A 3WFJA 2EW8A 2FMUA 3GDOA 4YT5A 1CYDA 4RPJA 1FDUA 2Y1DA 3F1LA 2GUGA 1F14A 3O9ZA 3TOXA 2GD1O 2EF1A 1QORA 3HADA 2W90A 1HDYA 2CDAA 5ES3A 4FGSA 4DBZA 5B12A 5MGBA 1HSOA 1YBVA 1JQBA 3AOGA 1IPFA 4IJVA 1EVIA 3V8BA 1M75A 4YB8A 4CR6A 5FWNA 3Q3CA 3FTNA 4XIYA 4J7CA 2J5KA 3AI3A 5EL0A 3EYWA 4J43A 3TL3A 1V3VA 3EW7A 3BMOB 5HRUA 2O3RA 3V2GA 2VTDA 1DFGA 3TFQA 2VN8A 1KVSA 3WQRA 2V6MA 4EUEA 3DBHA 3K2EA 4BNMA 1U8FO 4XGKA 3VPGA 4QEDA 4D46A 2NVBA 2PKQO 1U4OA 5CDTA 1JWAB 1U9JA 4DLLA 3JD4A 1X1TA 2YFHA 2A35A 1MG5A 4IDEA 1LX6A 3PHIA 1QLHA 1H93A 4E31A 2X9NA 4EUHA 3W8FA 6LDHA 1I0ZA 4P8RA 4NBVA 3TZQA 1NHWA 1U3WA 5ITWA 2DTEA 2HUNA 3RUCA 1LU9A 4YBZA 3AUTA 3D64A 3CMMA 4Y67A 4D43A 1ZSYA 4LVUA 5IZCA 4ND3A 4BO3A 2GERA 1BWSA 1A71A 3DAPA 2W8ZA 1C1DA 5KJEA 2JD2A 3PHGA 3JYQA 2BI7A 1PL8A 4GBJA 1V6AA 3VDRA 4BV8A 4PCVA 2NACA 1I30A 1EMDA 2AG8A 2RH8A 4EI2A 1YB4A 3GDGA 3L4BA 3NTOA 5L7WA 1U7HA 1V8BA 2AMFA 3K92A 5CAEA 2QYTA 4UEOA 2HMTA 1ULSA 1ZUD1 1HSZA 3H9UA 4YAEA 4FOOA 4EUFA 4BKRA 1YL7A 4OO3A 3JD0A 3VPHA 3KRTA 3TZKA 3JCZA 4K28A 1DO8A 1LSJA 3MEQA 2Y1CA 5CEEA 4NHEA 4ALKA 4D0SA 4OOEA 4DLAA 1NQAO 4KTTE 5A3JA 1EE2A 3Q9UA 4NNJA 1E5LA 1X15A 3ZWVA 3NT2A 3VPXA 1SC6A 3KZVA 3GEMA 3JD1A 8ADHA 3NGLA 3EZYA 4YXFA 3AW9A 4RVFA 5F1KA 4Q3EA 4J4HA 1JVSA 1NTOA 4CM8A 5ADHA 1PGNA 2O2YA 1BXGA 1YVEI 3PVZA 4CMAA 1QXSA 2NTVA 3ZI0A 2GSDA 4KDEA 4RDIA 1R16A 1PJ4A 1XLTA 3JQ8A 1HE3A 4DQXA 4YPOA 3OJ0A 1KEPA 1HDCA 2PZMA 4EBFA 4MVJD 2D4AA 2J5QA 1JA9A 1UXGA 3IJRA 4IUYA 4QXMA 3GVHA 2AG5A 1M2WA 4KQWA 2HK7A 4WOKA 3WLFA 2PLAA 5THQA 2PNFA 1Y6JA 3GC6A 1E77A 1XGKA 3QVOA 4XRRA 3WG9A 3UHAA 3MJ4A 3PTZA 5C7LO 3JYPA 4PG5A 3RSHA 4OYRA 3RI3A 1YBAA 4BKQA 4PLVA 3GPIA 1Y9AA 2JAHA 1E7WA 4JQCA 4R4JA 3NT4A 2AEMA 3MJVA 2Y1EA 3KTDA 1NBOA 3HHPA 3ZU5A 3MTJA 3H2SA 1MC4A 3AI2A 3A9WA 1XELA 2VZ0A 3AY3A 3F5QA 1XKQA 2JFHA 1E92A 4GVXA 4FC7A 1ZNQO 4BO2A 3TF5A 4OSPA 2BH9A 4IJKA 1C1DB 1UXJA 4ALMA 2VWQA 3I4CA 1ZK2A 1R4NA 2FY8A 2EKPA 2VTEA 2OFPA 1ADCA 3DFZA 3I1JA 4JX8A 4CMBA 1YGYA 4RF3A 2XPCA 4BGVA 4CUKA 1TA4A 1U5AA 1NYTA 1ORRA 1G6KA 3PP8A 3AFNA 1EUCA 2PKQP 4A27A 3WSVA 4W9NC 3W4IA 3LC2O 4YJHA 4II3A 2PWZA 1F8GA 4RVUA 1PZEA 1SB8A 2I3AA 4RQUA 4UVIA 1HLDA 3H6KA 4IXTA 3ZV4A 4XB2A 4DBVO 1ID1A 3OICA 4TVOA 1YJQA 3RBZA 4KDFA 1VLLA 1P31A 3OF2A 1HE4A 5K9ZA 3X2EA 2PY6A 3V2HA 1KYQA 1Z45A 1NQ5A 4IGEA 4WKGA 4OXNA 4IQGA 2YUTA 3SBOA 1A9ZA 1W0CA 4J1QA 1FJHA 1ML3A 1KC3A 1LRLA 1I3KA 3B1FA 3E5MA 3DWFA 4CM8B 2C0CA 2C2YA 4U0KA 4R41A 3ROMA 4NFYA 4CUZA 3OP4A 2VZ8A 3JQ8B 4M1QA 1XU9A 3ZU4A 4UVGA 1TXGA 3UOGA 4CMIA 1Y5RA 3K30A 2ZJ1A 3ZNNA 2EWMA 3AUUA 5HTOA 5JCJA 1ZO8A 3PYLA 3SJUA 3UCEA 3WFIA 3L0DA 4CV2A 1UDBA 2VUTA 5JO0A 2C59A 2UUOA 4ZRNA 3BMQB 2PGLA 4CM4B 3BAZA 5LCXA 3D1LA 2CF5A 2B5WA 3WNVA 3ZHYA 2JCVA 2B35A 4WOJA 2HQ1A 1EUDA 3E9NA 1QV7A 4YVFA 1D4FA 4GMGA 4RF4A 1EK6A 4M86A 1K6XA 2ZCUA 1HLPA 3INTA 5BSGA 3I9MA 4Z0PA 3EK2A 4PRKA 3ITDA 3P5SA 4RV9A 1NAHA 2GF2A 4HFMA 4Z0HO 1E5QA 4A2CA 1U5CA 2X8LA 3H9JA 3NDIA 5K0ZA 1T4BA 5K6AA 1I33A 2DUUA 3KEQA 2D5CA 2EP5A 3BMCA 3EVNA 3KM0A 4RVHA 3JTMA 1SEVA 4RVDA 4ALLA 5IZCC 2I66A 1SO8A 3VTZA 2UVDA 4O59O 5T8KC 4YJGA 4JK3A 3DZKA 3ZV6A 2X0RA 1PJSA 4QTZA 4J0FA 1R12A 5G4LA 2O50A 4BNIA 4BO0A 2JAPA 3BTOA 2W98A 3VTFA 4D45A 1YQGA 3K5PA 3L4BC 5F5NA 4BB6A 3EUWA 5HWSA 4PLGA 3PHHA 3W6UA 3LVFO 1XA0A 1WNTA 1XEAA 1ZKMA 3KO8A 2P5YA 2Y67A 3BTSA 3QY9A 5KTKA 3TRIA 4GPD1 4GGPA 4YJHB 4MO2A 3RJ9A 4OJNA 4A5OA 1N5DA 1OMOA 4PLZA 2YHIA 4CLRA 4HY3A 2BD0A 3DTTA 1UXIA 2VRBA 1ZEMA 2X58A 4UUMA 3ZWPA 3DAGA 4TRNA 5FF9A 4GX5A 3ZWNA 2QHXA 3ANMA 2D59A 5DZSA 2HMUA 3H8VA 3ZWBA 4CQLA 1NWCA 1I01A 4NDNE 3PWKA 4C7JA 4NI5A 1ZIDA 4WNIA 2A4KA 1E1LA 5L45A 3O03A 1GR0A 1JAXA 3IQDB 3LLSA 3NKLA 4E32A 3IJPA 3DZBA 4R01A 4WLFA 4LRSB 3ICPA 1IHXA 2BF7A 1ADGA 1UZLA 1IZ9A 2AQHA 5C5IA 2VHZA 3FCOA 4E5MA 3GGGA 3GNSA 3ONEA 3WMWA 4CLXA 2VNSA 4FBGA 4LCJA 2C54A 4HNHA 2GN9A 4J4BA 3WQQA 5CDYA 3OECA 3COSA 1R37A 1ADBA 4BNUA 1O0SA 3JQBA 3WB9A 2EKQA 3AM4A 2FP4A 3HE3A 1DOHA 5IXYA 1EK5A 4I1IA 1HKUA 2Y68A 4D7AA 2CVZA 5BNTA 4BS9A 1HE5A 4OGWA 3G49A 4LSWA 3VZQA 2B36A 3IL2A 5BR7A 4P22A 3BMCB 4CMIB 4NK5A 5BSFA 5L9AA 4E13A 1M66A 4YYZA 2XAAA 1ISHA 1PQUA 1RM0A 3JYNA 4YJGB 1I2ZA 3CINA 5IJZA 4JIGA 2QX7A 4MP6A 3PI7A 3DMTA 3DXFA 3L4SO 4TROA 2A9FA 1MXHA 2P2SA 2ZB7A 2GASA 4J1NA 1H2HA 2VCYA 5A4DA 1IY8A 1ZCJA 1TLTA 3OIFA 1U3VA 4I5FA 5JSFA 4L4RA 3KYDA 2I67A 3GAFA 4LGVA 3H2ZA 1BTOA 1EDZA 5KJ1A 1UP7A 4OQZA 3RU9A 2VOEA 4ZVVA 3E9MA 5JPIA 1HDXA 1SMKA 4S3MA 1LNQA 4ROSA 3GG2A 5H82A 1EQ2A 1QYWA 3E6AA 4H3VA 1A9YA 1DHTA 2H9IA 1BHSA 1SEPA 1IPEA 3GNQA 5L3ZA 3B20A 2WM3A 4NMHA 4R5HA 5U4QA 3IKVA 4IJWA 3G17A 1JKJA 4RLHA 2C07A 3PQFA 5HS4A 3HG7A 1HRDA 4CQLB 4CM9D 1LDYA 3I4FA 2X5OA 2YQ4A 4FN4A 4WEQA 1KETA 1UDAA 4FJ0A 4WLNA 3ZU2A 2Z1MA 1BVRA 4DYDA 3ENKA 1KY5A 3QJ5A 4PIVA 5DP2A 3RKRA 4L4SA 2C2XA 1ISIA 3F1KA 3W6ZA 3IMFA 1G1AA 5JE8A 4U0JA 1CQJA 3IP1A 5A05A 3V2UA 4R68A 5JDCA 2OP1A 4XQEA 1K5HA 1TI7A 4TKLA 3MWDB 3LLVA 2NVWA 3O38A 2HMSA 5KCZA 2ZYGA 4MVJM 4KQXA 3WGZA 1B2LA 1DBVO 1SOWA 5A9TA 1R15A 4E4YA 2I65A 3UN1A 1SNYA 3NX4A 4PGFA 5K6AC 5L4LA 3DHYA 2JHFA 4G2NA 3EC7A 4XEHA 2WYVA 1M6WA 3UCFA 3TFOA 2O3QA 4NJOA 4U5QA 3G3EA 4PVDA 4C7KA 4BNZA 1S7CA 3D4PA 4FR5A 4XGIA 3U5TA 3GRPA 1DXYA 4F6LA 3AY6A 3VH4A 1P74A 3CTMA 1VL0A 2BGMA 1GYRA 4RPKA 4P4LA 3RFVA 1H6DA 1J0XO 4J91A 1LDNA 3ZNPA 4CV0A 4RF5A 4BNYA 1ENYA 3NTRA 4A26A 3F6YA 4I9UA 4Q3DA 1L7EA 1VC2A 3G0OA 4AFNA 1JDJA 1UDCA 5FFFA 1YJ8A 3IIEA 2YQ5A 4Q39A 1QYVA 4GSLA 1I3NA 2VHWA 2O7QA 2ZK7A 3I5MA 4E2YA 5IN4A 3IAHA 1E3WA 3S2EA 3W8DA 1G0OA 1GYPA 2DPGA 1Q0QA 1TVEA 3OETA 1GAEO 4XIJA 3KYDB 5TRTA 3NV9A 2JFFA 5I7FA 2X0JA 3B70A 1KIFA 2Q2WA 1AHIA 3CMCO 4OXYA 4I8XA 4XQCA 3GPDG 2W4QA 1MB4A 4RVSA 4B8WA 4NBWA 1W4ZA 5KJFA 1ENZA 1PR9A 4YTEA 4NFHA 2BGLA 1DAPA 3TNLA 1P0CA 5CP8A 4DA9A 4E3ZA 5THKA 7MDHA 5AXDA 3ROPA 4W4TA 5KKCA 1U1IA 1PU2A 2Q3EA 2O3SA 1YKFA 3Q6IA 3ADOA 3PJDA 4JBGA 1Y8QB 3VH2A 3BMOA 3LYLA 3TL2A 1P1KA 1GL3A 4MP3A 1I2CA 1XQ1A 3ADPA 5BT9A 4OSOA 3W4JA 3H5RA 2VRCD 4BNLA 1OAAA 2WYUA 2R6JA 5DULA 4BO6A 4GMFA 1UJMA 2OGUA 2FOIA 3EAGA 1HF3A 3D3WA 3LF1A 1PSDA 3QW2A 5DBIA 1BDBA 4KOAA 1XU7A 1Q7CA 4Q9NA 4J2OA 4HFJA 2EG9A 5JY1A 4FFRA 3C85A 3I9OA 4HBGA 3K8ZA 5JMWA 5I7VA 1A4UA 1DRUA 1NASA 5HM8A 1ZJZA 4BUCA 3ZDFA 4O0LA 4I9HA 4K1LA 2A92A 4IQ0A 4C4OA 4CQMD 4CR8A 2HK8A 4QUKA 3WOHA 4AJPA 4DMMA 2J3KA 4GX2A 3WIEA 1ZBQA 1CRWG 5CPFA 1GUYA 4AICA 1OC2A 5CEFA 2FN7A 3GFBA 4FFLA 2G1UA 2YV2A 4XKJA 3WWYA 3ON5A 1BXKA 5EPOA 4PZEA 2JKVA 3C1AA 1UUFA 2IXAA 5A5EA 4FIZA 3JYOA 3QV1A 2NADA 2P4QA 4P4GA 2BELA 4Z9FA 3ZWAA 1PJQA 2RCYA 1DRVA 4E0BA 3ROKA 4RGBA 2F1KA 5F1PA 5CFZA 4WEOA 5I9NA 5JAZA 4KUHA 2D2IA 3DMTC 5AQ1A 3N58A 4E33A 1NVTA 2OP0A 3OIGA 1D1TA 2O4CA 2RAFA 3HN2A 3PZBA 2HDHA 2YFQA 4I5GA 3R1IA 1DRWA 2B83A 2FZWA 4XR9A 4HKTA 4DPLA 1D8AA 2HMVA 4CLEA 3BXXA 4TRRA 5TT0A 4ALJA 4D79A 3PHLA 2H1SA 3M2PA 3ONFA 3U4IA 4AJKA 3HFSA 3ASUA 1E3WB 1X13A 3KV3O 4XR4A 2D8AA 2HAEA 3JQ9A 5DOVA 5BSEA 4QX6A 1X7HA 4QO8A 5A5FA 1HYEA 1N9GB 4U6SA 4D3SA 4ZN6A 3QSGA 1NP3A 1PWZA 5EMHA 2EP7A 3JQCA 1Q1NA 1YONA 4AJ2A 3C24A 3NRCA 3KYBA 3OA2A 5A3VA 1CQIA 5I8WA 2AW5A 4XZ3A 4E5PA 2PGDA 3PXXA 2BGKA 4HXYA 1VSUA 2X1HA 3W1VA 2B4QA 1X0XA 3I9KA 3ETEA 5EJ2A 1NFFA 3DEYX 1ZJYA 2O3UA 1N1EA 3OSUA 4AVYA 2CZCA 1U7TA 4JROA 4BO8A 2OMEA 4CMJA 5LDGA 1Y5MA 5G0UA 4Y8VA 1WZEA 2YHUA 1TT5B 4B7CA 1GZ6A 2PV7A 4RCVA 5EESA 3VC7A 3D3WB 5JC1A 2EIHA 1CEQA 1E7MA 1V9LA 3AU9A 5JDCC 2UAGA 3RC7A 4KP7A 3T7EA 5TT1A 4BO4A 1GZ4A 2PZLA 1WVGA 3FBGA 4ZQHA 3ENNA 3HZZA 4R3WA 3AK4A 4R54A 4LK3A 1OFGA 4J4TA 4UUPA 4DIBA 4L0QA 1E1MA 2EKLA 1H6AA 4LSMA 4A7PA 1BW9B 2ZB8A 2WSBA 2YZ7A 4RL6A 2FR8A 4CODB 3HB5X 4FSHA 5EN4A 1BSVA 2ZTLA 3Q11A 4EEXA 1PJCA 4Z9XA 3GFGA 1O8CA 4D0RA 4A0SA 1KVTA 3MJCA 3DTYA 1O5IA 2D0IA 1DIAA 3BMNB 5G0TA 3WSWA 1QLJA 4U8GA 3DZIA 2IYOA 1X1EA 4JNKA 5DBFA 5G0SA 3LC7O 1MFPA 3EMKA 3VZPA 4K26A 3E18A 4RPGA 2EGGA 3A06A 3I23A 4MINA 4W7IA 4FPXA 4OQYA 1DAOA 4GLOA 3VOSA 5JYEA 2PH5A 1ZFNA 2IE0A 5GZ3A 4KZPA 3DZJA 1H94A 1KY4A 1BMDA 2WD7B 4NFSA 2UYYA 2PFGA 2X0NA 1YB1A 1Y9EA 3DBVO 4Q3AA 3R0IA 2V6GA 1B7GO 2I6TA 1HYGA 2Q4BA 2YYYA 3UW3A 5IG2A 5TNXA 1X7DA 4DYVA 2BHLA 3WGHA 4BIIA 4NG5A 1O95A 2JD0A 3R6DA 5JAMA 3NGXA 3H7AA 2G17A 4IDCA 4TZTA 1T4DA 3OBBA 2V65A 3SLGA 1UAYA 3AM5A 3DZGA 1KBZA 2VT3A 2ZTUA 1DIHA 3TPCA 3I6IA 1AHHA 1NVMB 1NXQA 1R0KA 3DOJA 5KOIA 4JP2A 4L8VA 4IY1A 2V6FA 2J3IA 2Y99A 1AGNA 1UXKA 3RD5A 1R66A 3S2GA 5L51A 3H9EO 4PLCA 2C5EA 5TX7A 3BMQA 4CM4A 3T4XA 2NTJA 5IDWA 1V3UA 4IMRA 4E12A 2E82A 3ZW8A 3VVCA 2J6IA 1ENPA 1BRMA 3DHNA 4FC6A 3AOEA 4JP3A 3ZH2A 2BFPA 3BHJA 1Q7BA 5DCWA 3WGQA 1T1RA 3TWOA 1E7SA 3EHEA 4I5EA 5T6BA 4ZQFA 3VZSA 3WR5A 1T24A 1N2SA 4DMLA 1E7YA 5CG1A 5KIAA 2X9GA 5A06A 3A4VA 3D5TA 5EERA 1PR3A 1Z6ZA 1GDHA 1V3TA 1NHGA 2OBYA 3ICCA 1Y81A 2YV3A 3PRJA 1E6EA 4ILKA 1BGVA 1WP4A 4RVGA 1UAGA 1E1KA 1A5ZA 1SZJG 2X4GA 3G1TA 3DQPA 4BGIA 5EQFA 4I08A 2EHDA 2Y0EA 3RUFA 1JAYA 4WUVA 4YAJA 2W2LA 3E03A 1HDOA 3FRJA 4XYEA 1HE2A 2VHXA 1PL6A 4OXKA 2EGHA 2EJWA 1PGQA 4AJ1A 3DAFA 4FFMA 3HN7A 1T1SA 1YS4A 1PJLA 3UCXA 4ALNA 1VJTA 2CSUA 4CMCA 3T7CA 1FDWA 3CSDA 3OIDA 2VHVA 3IUPA 3M1LA 3RC9A 2VQ3A 5DP1A 2VYVA 3EGOA 3OHSX 2OOSA 1HDZA 1ONNA 4XA8A 3HDYA 1P9LA 3O26A 3LU1A 3HJAA 1EEHA 3JQ9C 4M8SA 3DBRA 5AOVA 4MKZA 1L1FA 1ZXLA 3AJRA 3QWAA 5AYVA 1WXDA 1Z7BA 1Z74A 3DDNA 3S1LA 3RVDA 3VHRA 3TJRA 3RQSA 1BDMA 4IDFA 4BNFA 5A03A 3OA0A 1UXHA 2RH4A 1ZSNA 3CE6A 3GVPA 3QP9A 4J3FA 1Q2XA 3RJ5A 4LRTB 4YWJA 2Q1UA 2AXQA 3B6ZA 4OMUA 3RAJA 2VNAA 2PD6A 1Z73A 5KVCA 1YO6A 4NR0A 1JU9A 3FBTA 4UEKA 3ZWXA 4NU5A 4CUJA 2NV6A 3STHA 1Z75A 5ER9A 3RC2A 2RHCA 4ITUA 4XDZA 4RZHA 1P3DA 2X22A 1SB9A 4L4XA 4CM5A 3UGKA 3HNPA 4J90A 3KXDA 3ZNQA 2QYSA 4WECA 3RUAA 3V1YA 1LLUA 2NM0A 2JHGA 4IDDA 5AXCA 1PZGA 4R1NA 4PG4A 4FQ8A 4J9UE 4D3DA 1H9AA 2H6EA 4AJOA 1GPJA 5JC8A 1YL5A 3U9LA 3PQDA 3E48A 5B4TA 3AI1A 3S8MA 1T25A 5JCJD 4I5DA 1QG6A 3JQAA 3ITKA 3PWZA 1QMGA 4J16A 5ILOA 3EY4A 4AG3A 4F6CA 1U8XX 2OL4A 3KYCA 4OH1A 4F3YA 4M89A 3GVCA 1P0FA 3KSUA 1X14A 3H4VA 2RHRA 2CUKA 5DN9A 4IMPA 1N7GA 3FHLA 3AU8A 1MV8A 1GU7A 3WNQA 4CMEA 5T57A 3WGGA 1QRRA 3RCBA 4ND2A 5T64A 3WGTA 1YL6A 3RBVA 1W8DA 1H6CA 4R5MA 3A14A 4LCEA 4JGBA 3NDJA 2O2SA 3QA9A 4BOYA 1MGOA 1I8TA 4PLHA 2X86A 1N1GA 2B69A 3IOYA 2J3JA 5GY7A 3KUXA 3M2TA 2G82A 4TSKA 2DC1A 2EXXA 4IDBA 3MJEA 3IKTA 2AEFA 2GZ3A 3KSZO 1PJ2A 5HBRA 2IEDA 1LBEA 1B3BA 5TJHA 1U2GA 1EVJA 4P4NA 4KUGA 4YT4A 2WEKA 1A27A 3QVTA 3DBRB 1T26A 2O23A 3GMDA 5DT9A 5FI5A 1EFLA 1WMAA 3G1UA 3JQGA 3PGXA 3GK3A 4PZCA 1GADO 1B0AA 4E5NA 2GNAA 4XB1A 1LLCA 5JYDA 2EV9A 4D3FA 5JW6A 1GPDG 4HV4A 1W73A 4CLOA 1WDLA 1XHLA 1MFZA 4FB5A 2ZATA 2HMWA 4O5OA 3CPSA 4CR7A 4NZ9A 4OOFA 4AJNA 2D3TA 4B7XA 4TQGA 2R2GA 2I76A 2CF6A 4XRGA 4IBOA 2NVUA 4ZQGA 1LSSA 5F21A 5DOZA 3AOEC 3PGJA 3GOHA 1UH5A 1MLDA 1PQWA 1ZK1A 4BQPA 2YY7A 4CM6A 3D3EA 3Q2KA 5I7SA 3ZN2A 3AY7A 1VJ1A 3GH3A 3U4CA 2O3TA 5LDHA 1PZFA 2BLLA 3K73O 4DC1A 4WE3A 3DZHA 2VYNA 3OMLA 4NBUA 3PFWO 4TVBA 1IHYA 1PJBA 2CDBA 4BO9A 1NQTA 3JQAB 5A04A 3PZRA 1DC5A 1FK8A 1M67A 4S1VA 3SC4A 4ZQEA 1XSEA 3QE3A 4JN6B 4LMRA 1LLQA 2FPIA 3KYCB 5COQA 4O1MA 1H0KA 4YQZA 1PS8A 4BMVA 2PA3A 5JAIA 3FWZA 2O48X 2X23A 4GX0A 1KVQA 3MWEB 1E3IA 4XQGA 4RJTA 5L4SA 4ZD6A 4RORA 4F45A 3NUGA 1P44A 3AFMA 3P2OA 3UUWA 4B3JA 1NFQA 2G5CA 4DRYA 4PLPA 4FFNA 1D7OA 1I2BA 4MIOA 3BYZA 5G4KA 1EVZA 4B4OA 1E3SA 1UZNA 1NX6A 3TDKA 1IB6A 3LZ6A 2NU8A 3I9JA 1QR6A 4JXKA 1Q7GA 1H6BA 1YDEA 3PK0A 4GL4A 4R3NA 4YAIA 4FGWA 4DQVA 3DC2A 5DF1A 4BNNA 4NU6A 1J5PA 3ST7A 4Q3CA 1I3MA 1WZIA 1E6UA 5H83A 4AJEA 1ISMA 3JQGB 1KOLA 2BFAA 3U0BA 1DEHA 4DIFA 3O4RA 1Y8QA 3JQ7B 1NM5A 3UXYA 1FDVA 1LDGA 3GLQA 2X9VA 4FD3A 3UVEA 5JXWA 1XQ6A 4BO7A 1MP0A 1UP6A 2P68A 2Y66A 5JDIA 3WJAA 1LQUA 1PIWA 1VE9A 2IODA 2VWHA 2YDXA 4XYLA 1ONOA 4CLOB 3K2BA 1PEDA 5F3RA 3MCVA 1NR1A 2CNBA 1OZAA 2DTDA 4IIVA 3KETA 1PQPA 1U4SA 3WGYA 3D5QA 4EJ6A 2NVUB 3ZCXA 2O7SA 5L4NA 3UFXA 4DPKA 2DBRA 3INGA 4AJHA 4E21A 3NAQA 5ICSA 3PQEA 2VHYA 2E49A 4IGFA 4UULA 3GN1A 3JYLA 4K6FA 1IUKA 4QO7A 1CF2O 3QWIA 3MOGA 1KVRA 3OQBA 2WTBA 3K9QO 3PWSA 3KBOA 5IDYA 4IM7A 4D41A 1NPTO 4O63O 3LT0A 2HLPA 1E7QA 5G2OA 1HZZA 4KWHA 3WXBA 1Y7TA 1FDTA 3D0OA 5ICMA 1SBYA 2ET6A 5B4UA 2Q2QA 3NYWA 1N8KA 5DCYA 1YDWA 4GLLA 3C3XA 4XJTA 3ZU3A 2AA3A 4M49A 4PRLA 5KJCA 1ZK0A 4CMEC 2IZ0A 2HJRA 2I5PO 5L53A 3I3OA 1QKIA 5BQFA 4WPGA 2B4RO 4W6ZA 3ZW9A 2VZ9A 3ZNOA 1NPYA 2NSDA 5J23A 4YAGA 1A72A 4DLBA 4UUOA 1ADFA 3ASVA 1TB4A 4FOSA 2BFOA 4IXWA 5G4KB 3QVSA 1N9GA 3QRWA 2Z5LA 3HQ4O 4B4VA 4ZQBA 4GGOA 2VUUA 1SAYA 2FWMX 5EINA 4DVJA 4EJMA 1E1NA 4AJIA 2ZJ0A 1VPDA 2WMDA 5IFLA 2ZQZA 4G81A 4WLEA 1YBMA 3RUEA 4CMHA 4XJSA 2UDPA 2I3GA 2NLOA 4X54A 2DBZA 2DM6A 1B3RA 4CLDA 1CDOA 1QYCA 5IXSA 3HDJA 1T2FA 4R51A 3RKUA 3QWHA 2GN6A 1P1IA 2HCTA 5ENVA 3F9IA 3NJ4A 3HB4X 1A4IA 3GA0A 3OEWA 4NJMA 5CEJA 1TT5A 1GEEA 4YT2A 1E3EA 1SOVA 3KHUA 1YH3A 3RUIA 3QLJA 3H5AA 1GQYA 1G0NA 2JD1A 3F5SA 1DC4A 3U09A 2POQX 3ZWMA 1N7HA 3S2FA 1K89A 1RWBA 3WWZA 1M76A 1PS0A 4PFJA 1CETA 1HT0A 5T67A 1JLLA 2QRKA 3KVOA 3JQDA 3LDHA 5EQDA 1B26A 1OI7A 3WTBA 4EYEA 5COBA 4WCFA 2OBNA 4B3IA 1BW9A 3GUCA 4OAQA 4R16A 1ZMTA 1U3TA 2FZEA 3WBBA 4HFNA 1IL0A 3JQBC 3P19A 3U4DA 5JS6A 2UUPA 4IS2A 2XF8A 1H9BA 4EEZA 4GQAA 3WYBA 2QIOA 1BG6A 2QG4A 5C7IO 3UH1A 3DL2A 3BMNA 4BO5A 1ZK4A 4NPCA 4CM7A 5TJ9A 3QHAA 4BNWA 3FTPA 4MDHA 4NH4A 1LSUA 4MKRA 2EW2A 4OM8A 4URFA 3FNGA 3N7UA 5B37A 1Y1PA 3E5RA 2ZQYA 5IDXA 1FF9A 1ZZEA 3A28A 5T5QA 3RC1A 3WICA 1AXEA 2H5LA 2XXBA 1ZVMA 4DL9A 4BGEA 1WLYA 4R9SA 1P77A 3GR6A 1CIVA 2WD7A 4NQZA 1P1FA 1EDOA 2XXJA 3TZ6A 2FPPA 4N7RA 2Q4EA 2RIRA 2BI8A 1GY8A 4XGNA 1LJ8A 1SPXA 2NTNA 3FD8A 4BNGA 3DB2A 4JJGA 1FMCA 1F0YA 5L7YA 4A73A 4GH5A 1C1XB 3RBXA 2IYPA 5GZ1A 9LDTA 1MXFA 3ETDA 4L75A 1UR5A 4TZKA 2GN8A 4JBHA 4LISA 4HADA 2QRJA 4WLUA 2SCUA 3SJ7A 3AM3A 1WDMA 5B4VA 3LF2A 3QIVA 2F00A 4IDAA 2TMGA 3KB6A 1IULA 1C3VA 4YJDA 1BVUA 4B4WA 5IAAA 3I83A 1NAIA 1B8PA 2WYWA 3OJOA 4N5LA 2ZYDA 3L07A 2VWPA 4UREA 3GY0A 1BXZA 3VKVA 4UVHA 1DC6A 1EQUA 5JDIC 3ZHXA 3VH3A 1P33A 1NQOA 2NU7A 4BNXA 4CPDA 5ILGA 4N5NA 1I24A 1VRWA 3JQFA 1QP8A 1T2DA 5ITVA 4NJMB 4Y98A 1ARZA 2WE8A 2QQ5A 1NVGA 4GAEA 1YB5A 1LQTA 3GZ4A 3OJEA 3SC6A 2FSSA 4NIMA 4DWVA 2C7GA 3C1OA 1LSOA 2TMDA 1O6ZA 4IDGA 1LLDA 3LT4A 3S2IA 2Z1NA 2O3JA 4M54A 2Q1WA 2Y1GA 4NK4A 4R1UA 4CQMB 2JL1A 2OUIA 1VSVA 2ZTMA 3JD3A 3GVXA 4BNHA 2H63A 2Y0DA 1M6HA 3U62A 5G0VA 4WCFB 4BNTA 1DFHA 3CZMA 1DLIA 5KJ6A 3WJ7A 1B14A 1I5RA 1VI2A 4BB5A 5F1OA 2YW9A 5AXBA 4E30A 3WQSB 5JO9A 1CWUA 1ONPA 2HJSA 2Q46A 4G65A 1WPQA 4G5HA 3ULKA 3F3SA 5B1YA 2OHXA 1AE1A 2Q49A 1EBFA 1WAMA 4R9RA 1LXCA 3BHIA 3RROA 2GCGA 1YXMA 1R0LA 1HZJA 4ZJUA 4CL8A 3BZUA 1CERA 4BGUA 4XYGA 3SXPA 2NQTA 3VZRA 1XYGA 1B16A 2ILTA 2WD8A 2DTXA 3BIOA 5LC1A 1CJCA 1KEUA 3FN4A 1K2WA 3LQFA 1R6DA 1R4MA 2Y05A 5T8KA 1T2CA 4BHTA 2QW8A 1X0VA 2XOXA 4MIYA 2ZCVA 5F5LA 2GN4A 1NNUA 1NR7A 2GRAA 5DBGA 1EUZA 3I9NA 1GYQA 4BVAA 3KEOA 3UAGA 3FR7A 2DKNA 4MVJP 4XX0A 3INRA 2W2KB 2Y0CA 4JLWA 5CDGA 5IF3A 2C20A 4WGGA 1DJQA 5C3MA 2QRLA 2FR1A 1PGOA 3ETGA 3ZWCA 1HYHA 2IRWA 4GWKA 1VKOA 2PD3A 2QZ9A 4MVJA 4GWGA 3K96A 1WMBA 3V5NA 1EE9A 5TGDA 1QV6A 4LMPA 3TZHA 1LEHA 1ZXBA 4QT0A 2YV1A 3ZGYA 3ZZNA 2EEZA 4MPDA 3QQPA 4QFCA 3W4KA 2OZPA 3KOUA 4W99A 4FJ1A 2ZIZA 5L95A 4IPTA 2E48A 3WS7A 4GVLA 2LDXA 1JTVA 3FNHA 3QWFA 4RDHA 3B1JA 1I32A 5GMOA 2GR9A 4N18A 4MKXA 4CM1A 1RYDA 2BFMA 2ZB4A 3GZNA 3FR8A 1AN9A 1KEVA 2J3HA 2X5KO 1HDGO 1E0DA 1DIBA 5I8ZA 1IZ0A 5C7OO 1WW8A 1I3LA 1YRLA 3PFFA 5TIIA 3FPLA 3GNTA 4J49A 1YE3A 3OQ6A 4PG6A 4XCVA 3PLRA 4DREA 4ID9A 1XIVA 4WCFC 1U2DA 2C5AA 4RLSA 1IOLA 3I6QA 3GRKA 1RKXA 1DSSG 1KVUA 1MX3A 2NNLD 2UV8A 3M1AA 2GDZA 3NDRA 1LC0A 4Z6KA 3DBHB 2I9PA 3Q1LA 5JBIA 4L73A 1VJ0A 2E4AA 3FNFA 2AE1A 4E2WA 2DBVO 4RPLA 5TSDA 3E8XA 3JD2A 4Z3DA 5ER6A 3U3XA 4Y6SA 1WDKA 3K6JA 3X2FA 1TEHA 2C29D 4ND5A 4L74A 3OFSA 3WTCA 4FJ2A 2WWRA 4DTIA 3E1KA 4B3HA 2G76A 3AUAA 4Y9DA 4E5YA 2GZ1A 3TZCA 1K0UA 2RBEA 4BKOA 4RPHA 2BKAA 4TWRA 3EDMA 3F4BA 4OKIA 2X0IA 1C14A 1ZEJA 5KVQA 4BNJA 4ONEA 5U9CA 2IZ1A 3GG9A 3ANNA 1R4MB 1P45A 2IEBA 3JQ6A 4Q3BA 1LTHR 3WYCA 1GQ2A 1HDRA 4K9DA 5JMPA 1V35A 5IZ4A 2OORA 1XG5A 2W2LD 3DR3A 3GDFA 3TQHA 3DOOA 3TSCA 2PD4A 5A9RA 4Q3NA 4MVJG 2B0JA 4Y6RA 4RQTA 5KNLA 3IS3A 1SCUA 2JFGA 1IE3A 4UEJA 1U28A 3G79A 1QYXA 4E6PA 1PZHA 3GHYA 3C7CB 4E5KA 2JJYA 2VYVD 4YDRA 3Q9NA 4D42A 3FF4A 3PJGA 4W82A 5JLAA 1PJTA 2Z95A 4CMKA 5CG2A 3LK7A 1PTJA 3JQEA 3A1NA 1XCBA 2CVQA 1C0KA 2QZZA 4LN1A 2HKIA 3B1KA 4HX5A 1F17A 3JQFC 3OJFA 1DIGA 2DBQA 3DBLA 3WLEA 2P9GA 3GHHA 3QVWA 2Q50A 3HUDA 2B4TO 4F46A 4JJIA 4R1TA 1LRKA 1BXGB 3H3JA 1K6IA 4QQRA 3GZNB 3UF0A 3ZV5A 4DIOA 4BL5A 4FDAA 1KS9A 4GSKA 4CMGA 4ZA2A 4H16A 4ZICA 4LW8A 2VT2A 2NU6A 2IZZA 1HETA 2DU8A 2FHSA 2HSDA 4TKMA 1W6UA 3Q0EA 2PZKA 1O89A 2JCXA 2A94A 2PH3A 5DDIP 1HWYA 2B5VA 2C82A 1EFKA 4UAGA 3SX2A 2IXBA 2ZB3A 4GX1A 5TF4A 1I10A 2P91A 1DDOA 2PR2A 2CY0A 3RIHA 3RU7A 1EBUA 5ENDA 2D1YA 3DOCA 4BV9A 3FWNA 4J2HA 1E6WA 2PTGA 1XWFA 4IQ8A 3WBFA 3DFUA 4FFPA 3TOZA 3GEDA 3WIDA 4EGFA 2CVOA 1C0IA 4YRBA 2J8ZA 3JSAA 4Z3KA 5HS6A 3GN2A 3ZHBA 3QVXA 2V7PA 4QECA 3L6DA 1ZW1A 1LI4A 4Z9YA 2DPHA 2AQKA 4NBRA 4BKPA 4GKVA 3ROQA 1GV1A 4LVCA 3DMYA 2D5AA 3U4HA 1T2EA 1YWGO 4BMNA 4CLHA 2LDBA 3FPCA 3MJSA 4YJFA 5AXAA 3JQAD 1UP4A 4WNCA 4FCCA 3GGOA 2NUAA 1DJNA 4PZDA 1JKFA 3FSRA 1D1SA 1R4NB 3K31A 4KWIA 3VDQA 4D44A 4DXHA 5JY6A 5HA5A 4PN3A 2P9CA 1VL8A 5CPBA 1FDSA 1KC1A 2AE2A 3PIIA 3I52A 1LA2A 1T2AA 4UVEA 4XD2A 4A10A 4AJJA 3JQ7A 4YACA 3FNEA 4PLTA 2HRZA 3GGPA 4B7UA 1XDWA 5BSHA 3WGIA 3MZ0A 2AQ8A 3OM9A 1ISGA 3RFXA 1IYZA 3LT1A 4YA6A 1Y8RA 5CHEA 2P9EA 1JW9B 3BTVA 3R3SA 5IN5A 3ABIA 8LDHA 2BMAA 2DQ4A 4QFDA 2ZTVA 4DPMA 3AUSA 3D4OA 3EVTA 4MJLA 4YR9A 4ZHSA 4OIMA 1J4AA 4II2A 1B15A 3NTQA 3P2YA 5TLSA 2DUWA 2I99A 3UICA 4CJXA 3L77A 3C7AA 3MJTA 2R00A 3DBLB 3VPFA 3WGOA 1A7AA 2DFDA 4XQ9A 3GEGA 3SVTA 3O8QA 2ZYAA 4XDYA 1Z82A 4B4UA 4EITA 1YOVA 4BKUA 3U49A 3CH6A 4RZIA 4YCAA 1EZ4A 3R3JA 1LDEA 4RO0A 3DO5A 4J0EA 4PG7A 5C37A 4DC0A 4OKNA 1GUZA 3BA1A 3H9QA 2GYYA 2Y1FA 5EIOA 1RM3A 3IP3A 5JAQA 3RWBA 3SLKA 4MVJH 4CM3A 2Q1TA 3DONA 5TC4A 5FEUA 2WJPA 2OXIA 3ZHZA 4O6VA 4KMSA 2AEJA 3SEFA 1DFIA 1LDMA 4IJUA 1V0JA 2IDZA 4OL9A 5KWEA 3PDJA 1EVYA 1MC5A 3L6OO 3W8EA 4INAA 4I9NA 2JCYA 1N92A 4B79A 5JCXA 1RPNA 2VUSA 4NBTA 3RUHA 5I7EA 7ADHA 3IDSA 4B8ZA 4WCDA 4IZIA 2B37A 1B8VA 2P5UA 4ZRMA 1RM5A 2Q99A 5TS3A 3IUSA 3OJLA 2VYND 4ND1A 4PLWA 4QSMA 1O9BA 3AWDA 4YJFB 4BNVA 1GV0A 5TQVA 3LSYA 2BRUA 2FSVA 1DHRA 2X6TA 1ISFA 3VAZA 1K3TA 2GLXA 3NT5A 4P38A 2E6UX 5CDSA 2G0TA 1DPGA 3IC5A 4BMSA 3JV7A 1JVBA 5G0WA 1VM6A 1Z7EA 5I9LA 4MIEA 1E3JA 4U6QA 4CM9A 4RF2A 4U7WA 3PYXA 3PJEA 3WX0A 2Q45A 3C7DB 4WK6A 3N74A 4CV3A 2DAPA 3LT2A 3PLNA 4FW8A 2DFVA 2GO1A 3H9GA 5FI3A 4MOWA 1Y8RB 5BNFA 3Q2IA 4L9RA 1LC3A 3PDUA 5L7TA 2YHIB 4CLRB 1HXHA 1JWBB 1I36A 2E37A 5A9SA 2WDZA 1HTBA 3KLPX 1OBFO 3M6IA 5KVVA 1NPDA 2CD9A 3F4LA 4ZU3A 4MVJE 1GCOA 4J1SA 4CV1A 5CDUA 3CKYA 1UZMA 3FI9A 4IZHA 3F46A 4EW6A 3D4NA 2AQIA 3O8QB 3RUDA 5U1PA 2V6BA 5MDHA 3GUYA 2PKRA 3HWRA 1FXSA 3L6EA 2CDCA 3CUKA 4XYBA 1YOVB 3T4EA 1F8FA 4ND4A 4DUPA 1RM4A 2OO5A 1OOEA 3D7LA 4FFOA 1J6UA 5A1TA 2NU9A 1PWXA 3L9WA 3MOIA 3I9LA 3RASA 2ZKLA 4ZGWA 3GF4A 3QWBA 4EDFA 4AJ4A 1O94A 3LC1O 1D3AA 1HEUA 1L7DA 4L76A 4HWKA 4YAKA 3CEAA 3BTUA 1AUPA 4J7XA 4YRAA 4YT8A 1VL6A 5A02A 1RJWA 4UVDA
chains in the Genus database with same CATH superfamily
2B99A 2NTEA 2RI6A 4FONA 2F9FA 3SNHA 4EY7A 2PUJA 1MTOA 2PRYA 3FAZA 1DKNA 2EJCA 4HNGA 1PGPA 4JCOA 4N54A 1HL3A 4ZC1A 3MLBA 1IEWA 1U7OA 5AUOB 3W05A 5GZ6A 4L4ZA 5EJ4A 4JLNA 1NWHA 1UFVA 2CUNA 4QBGB 3TW4A 4YDSA 4GWLA 3CLRC 1NDHA 1TT7A 2XUKA 3C5EA 2YIMA 4K40A 4QHYA 1C1XA 2KI5A 3DHEA 4PFKA 4XCQA 9LDBA 1GUFA 2ZWOA 5KTSA 3FFBA 4DY4A 2QSYA 3T34A 1NBMA 1L4FA 5JNLA 4Z1OA 5JS7A 1X7XB 4N49A 4LVOA 3NIFB 4B45A 1J49A 1T4MA 4KSCA 4B7AA 5EA2A 2G28A 2HA7A 2IUYA 1EKXA 1OZ0A 4GI2A 4V0KA 4ZYLA 2Q9CA 5HGXA 4FNMA 2DT5A 4DC9A 4BBPA 2Z09A 3AHDA 4JJ8A 3NP7A 4BCDA 1EPUA 3ES9A 2P77A 4AJLA 2B21A 1XPJA 2D13A 1DKMA 4UUNA 5B3KA 1PGJA 5C3UA 3F96A 3HO8A 5D6NA 3NKVA 1I7NA 4WKPA 1KWGA 1KKMA 2E7ZA 3R6LA 4LXUA 3KELA 4UW9A 3NAMA 2FPGA 3T0GA 3SQNA 4F21A 3HTXA 4BN4A 4KKXB 3SBXA 2QTVA 1IEXA 3CUWA 5BSRA 4IRUB 4DHWA 2Q5LA 2AI1A 1GNQA 1KO7A 2XNDA 1AY0A 1K63A 2FRDA 1Y6RA 3AR3A 3QOXA 3L6BA 3OY7A 1WSWA 1E7RA 4DQUA 3NHFA 2QLBA 1NQVA 2XDQA 4P7FA 3EDOA 1HM5A 1K4YA 1U9CA 1DQNA 1GEGA 2RAUA 3QXHA 4IINA 4QARA 1JIXA 1E1QD 1GTMA 3GL9A 2GNOA 2AK3A 4WASA 4PPFA 4AS3A 1F0PA 2CKDA 1A5BB 4HFRA 1SCDA 3T5CA 1SURA 4RX1A 2P1DA 1OC4A 3C74A 1J2YA 3CXRA 4F2HA 1MV5A 2CUTA 2VJKA 4ID3A 4LJ7A 5EP3A 2AS0A 4BMDA 2CXPA 3EY9A 2QJFA 3MCUA 5SY9A 5KNBD 2OXTA 2QPOA 1KMCA 1GFSA 3GJTA 1EXMA 1MJ5A 1Q57A 3CW9A 3ETNA 3UJ8A 4IRXA 4BUZA 1MVLA 5A4JA 1USWA 3GCZA 3DE4X 4ABYA 3ZE6A 4A6DA 2J59A 1UL1X 1G2QA 5IBQA 3G5MA 1QU2A 3FOCA 1RPJA 3OKCA 1EFRA 4Z9AA 4DGSA 1TYAE 3RJMA 1XHEA 1R0SA 3TCNA 1CQJB 3TCKA 3WMXA 4ARCA 1FDIA 1HTWA 2DLDA 5HIJA 3DCNA 1XRSB 4GOKA 3ZV3A 4B48A 4F4IA 1UPFA 1IBKB 3I0ZA 1Z4IA 4A03A 5EIEA 5LYJB 2ANCA 1JE1A 1KRXA 1Y1LA 1XP5A 2WJZB 4LZPA 3GMSA 5C18A 2WAYA 2V0GA 1D6MA 4ZXPA 1SZPA 5TQ2B 5KYWB 1U1DA 3WDSA 2I7VA 3LXUX 3HYCA 2ZI9A 4J0KA 4MV1A 1L9KA 2PMKA 3V1TC 4E08A 3VPSA 3QXJA 1ZSVA 3HCAA 4YP0A 3TW8A 3B12A 3A4IA 4JODA 2C3UA 2BOVA 1INLA 3GT0A 4WA7A 5DYNA 1DB3A 3ZU6A 3E82A 4DTCA 4K9PA 2GK3A 5C8YF 1P1HA 2CFCA 4J6FA 4RY0A 1QHHA 5AFSA 2OD9A 2HLHA 2Y93A 1L5WA 2ZT7A 4GPIB 4XVHA 5CVUA 1L4MA 1QYDA 4M55A 4TTTS 3PHJA 2DY1A 3RRJA 1AXGA 1U3UA 1E1CA 2HIHA 2OC4A 3WB1A 1E61A 1JKIA 5A3SA 2VF4X 1PS9A 4CFYA 5A4MS 1K8ZB 1HH4A 4IIGA 3DMPA 5TMEA 1EGHA 3WDKA 4JBIA 3MTGA 2QBYB 1XALA 3EIUA 5DNEA 4QVKA 4YMVA 5KKAA 2ATEA 1Y5NA 4MWGA 1HEYA 2AD5A 3A58B 4MUMA 1SQ6A 2XNHA 5EWMA 3ZY4A 4K9KA 1N0UA 3T1VA 3TN7A 5AR1A 2BCJQ 1PKEA 1K5PA 3BC1A 3IE2A 5COAA 4PW0A 1ENOA 3UKOA 3F2IA 2BMEA 1D8TA 4J0QA 4F1WA 2HIGA 4IICA 4R8RA 3HYLA 1XMVA 3H8WA 4KI7A 4DNOA 1FNMA 4AZSA 1GA1A 1P80A 2OV8A 1MOPA 4RPJA 4DM3A 4P32A 2AI3A 2GUGA 1KS2A 4JU8A 4UE3S 1DO2A 4Y6LA 4YRTA 2W6ID 3HADA 1BXRB 2P90A 3MGKA 4JBWA 5ES3A 1DBPA 3TRKA 1EIWA 2XB4A 4YJ2F 1HSOA 1NN5A 3RSGA 1JQBA 1Z6TA 1IPFA 4MR8A 1JSXA 2HA4A 2REBA 4J07A 4M6WB 4BFUA 5FWNA 1P5RA 3FTNA 1UMKA 4G84A 4XIYA 3SHFA 5CVDA 4ARBA 3K4PA 4YBRA 2DJIA 1XMOB 3OZ7A 4XASA 4RD2A 1T5OA 2OSBA 5G1OA 4NEHB 4DDKA 3JARA 2GS9A 4KHPB 5JCOA 2IDJA 5BWNA 4RTQA 3HCCA 4RD3A 5J4LA 5HRUA 1CUSA 1DELA 3BGSA 3BGOS 3AM1A 4KAFA 3MD9A 4FMCF 3TFQA 4RV4A 5C2JB 1YF3A 3IAM1 2GPWA 4EUEA 3DBHA 3ZEIA 1XD9A 4YV0A 4BNMA 1XZAA 3AGPA 4NFLA 1V16B 2CNKA 3DOHA 2I1LA 1ESEA 2UVQA 4Y0VA 3SC2A 5HKLA 4FCWA 3ILHA 4HDRB 4GF5A 4IDEA 3S1AB 3WGUA 1LX6A 3QYPA 1W44A 4TL9A 4E31A 2AC2A 5LU9A 2GFQA 4QUJA 2JKYA 4G0MA 5GVRA 3T3MB 2V54A 5H8WA 3UH0A 5ITWA 1XTIA 2KQUA 5FQNA 3UMRA 4C3UA 1E2EA 5EP1A 1IM8A 4ZAWA 1F8YA 3CLHA 4N5HX 4DFDA 4KNYA 4UATA 4EW2A 3P1JA 5DXFA 3HRHA 5DHSA 1KEZA 1UJNA 1VSQA 3CMMA 3K1ZA 4ES6A 2AC4A 3PXBA 3EZGA 2KWIA 4BO3A 2HNBA 1BWSA 3DAPA 5KJEA 3QKUA 4U7HA 2F3TA 3IE0A 3TI7A 4UNSA 1ZM3A 2WYIA 4XUEA 5DK6A 5FNZA 2V74B 3JWGA 4GBJA 4DQLA 1XTQA 4B75A 2PGXA 2QU7A 4RE6A 3ZX5A 4KQEA 2NACA 3AR2A 4BQEA 3CZAA 1QP7A 1WB9A 1OHHD 1YB4A 2PBLA 3I0MA 5L7WA 4P80A 4X8MA 2Q0SA 2R48A 1CG6A 3KEFA 1NQWA 1NTRA 1V8BA 3Q7SA 1RLUA 3VI4B 4MYHA 5CAEA 4CZ2A 4CCYA 2FB9A 2ODBA 1ZUD1 1M1UA 4HGZA 5KWJA 4YAEA 4BPRA 4EUFA 1M6YA 3N8DA 4BKRA 3HRKA 1A0OA 2IHNA 3KRTA 1IZZA 2AG6A 1HNNA 4K28A 1VLVA 3B5IA 3Q5GA 4AD8A 2IIQA 1MQAA 2PUDA 1FIUA 4D97A 2Q3DA 2M98A 3PBKA 4NHEA 1YCDA 1X19A 3A27A 5F9HA 2I7XA 2F62A 3OJWA 4DMGA 5A3JA 4X00A 3DVRX 3H86A 3P0EA 3ZWVA 3PQCA 3KWJA 5LQNA 4AKSA 3PC8A 3D7MA 8ADHA 1NDQA 3P4XA 1UK8A 3BFKA 5JISA 1YI8A 2RGUA 3PGLA 3ZY3A 2EVWX 1GTJ1 3IBCA 3QELA 1X7ZB 3H42B 4X3PA 4Q3EA 3AQIA 2Y4NA 2VPIA 4WA8A 1NTOA 2VP0A 1EXWA 3HGQA 1PGNA 2O2YA 1BXGA 1YVEI 2PGIA 4CMAA 5CB4B 3ZI0A 5IUNC 2GSDA 4RDIA 5KQRA 1R16A 4XGRA 3I01A 2G40A 2OKCA 4FYYA 3ETLA 2NSHA 3Q8KA 2HBYA 4QOSA 2HI0A 3ZYCA 4JI2B 4QJBA 4TMWA 2PUAA 2R8YA 2DLNA 5IF9A 1UXGA 2HWKA 3IJRA 5ALQA 4BBAA 5JZOA 2E2WA 1RXUA 2QZ4A 2F17A 1HC7A 1U04A 4OHZA 5K03A 1N2XA 2AG5A 2JGIA 2EARA 2HK7A 1SCBA 3W0LB 4YRCA 1NNI1 4Y30A 2QQGA 3N2IA 2PNFA 4OUKX 3ZWKA 3SZLA 1QK4A 1Y6JA 3PR3A 5K2MA 1E77A 4R7GA 3WG9A 2O2CA 1DL5A 2GPJA 2CXNA 4HRYA 4EJ2A 3JU3A 2R47A 4HYTA 1NNLA 2Z5GA 2ASVA 2CHQA 4PG5A 3RSHA 1UEJA 5C5EA 1SG9A 4AP6A 2HSWA 2YV5A 5KZMB 1J0EA 1Y8AA 5DSTA 3CNLA 4L78A 1ND5A 5CT5A 5ICGA 2ZDHA 4C43A 1BFUA 1E7WA 1OTHA 4V0LA 2VJNA 3SS7X 5KBYA 1LV8A 2AEMA 2Y1EA 3MJVA 2YZ2A 4G25A 1T6NA 4W7SA 5B3JC 3VSDA 5KX5A 2PEYA 3ZU5A 3MTJA 3RU2A 2ZTHA 2WYOA 3F5QA 4MUYA 2CYBA 2JFHA 4P2BA 3OY2A 4JLMA 3ZD7A 2IOQA 3N59A 2CE7A 3F4KA 1R9NA 3W2EA 1XZPA 4ZVMA 3RNLA 2RGCA 4ETMA 1KJWA 2HWUA 4OSPA 5GAJA 3PC2A 4MUAA 3H13A 3TF5A 1UXJA 1YJAA 3DEIA 4HEJA 1VB3A 1ZK2A 3AUKA 1XD8A 2FY8A 1CJTC 4KLCA 2VTEA 1JTFA 4TWZA 4OHXA 2XPCA 2FUEA 3VDNB 3NEAA 1SVMA 3WP1B 1AKYA 5BUCA 4UQLA 1D1QA 2F1RA 2FQ1A 2WWYA 5HOEA 3LZCA 1ORRA 2P9YA 2EYUA 2WG2A 1TW2A 4PBSA 5AW9A 2ZUBA 3AFNA 3EZFA 4JBNA 4BVFA 1U2EA 2FW0A 4XDGA 3KL4A 3NU1A 4JGIA 3W4IA 3CLKA 2ECFA 2HV8A 1F8GA 1ECGA 1KMQA 1IM2A 4RVUA 1PZEA 1SB8A 2I3AA 2O6HA 3EFOA 4RQUA 1ORWA 3TOSA 3W5VA 4DV2B 4EAQA 4HTFB 2I2XB 1BX0A 3IMEA 1HLDA 3W7AA 5I3ZA 5JXGA 4IXTA 3ZV4A 4XB2A 1TVKA 2ZSUA 3FDZB 3BH0A 3GPBA 1FUYB 4HQLA 1VLLA 3PC7A 1D1PA 3AV3A 3OU6A 4PYJA 2I71A 2PY6A 2ORWA 4F04A 2CLLB 1KYQA 2ZRDA 5EIAA 3SBDA 2AN1A 1T10A 5DH9A 4YMSA 4LV6A 5CB6A 4OXNA 3T5MA 3MS2A 3SBOA 2TSYB 2V9CA 5AKYA 1QTNA 1FW6A 1W0CA 4GSYA 4EB3A 1ML3A 4QRIA 2YVQA 4GW3A 1VYVA 3TTXA 3DWFA 3FHCB 1D0SA 1DNPA 1NMZA 4G85A 3OTIA 2C2YA 2HWXA 3LQRA 5LQDA 3ROMA 3OP4A 1C8LA 3GDHA 2QQFA 3FW1A 2NZXA 1FP4B 3A1CA 1S8NA 3K0BA 3HJFA 3FPJA 3QUBA 4UVGA 1K5DA 3SF8B 4HDCA 4B84A 5ICEA 1JIIA 1Z6XA 2ZJ1A 3IQIX 3ZNNA 5JATA 3STXA 1NXTA 5HTOA 2P2NA 2NPOA 3V33A 2O8BB 2VUTA 1YD7A 4V0RA 1JBKA 1TAGA 2P0EA 4LPKA 4ZRNA 1SIUA 3DMGA 2PTHA 4ZC8A 1L5KA 4DZTA 5K0SA 3DD1A 3TOVA 1R8XA 2VPZA 2FW9A 2VAVA 3D1LA 2CF5A 4QL3A 1DMSA 1G9XA 1UT6A 3GARA 3WC4A 5FOQA 1XCMA 2YN4A 2ZJ4A 4HVAA 3DVAA 5EMJA 1T0UA 1FXUA 3E9NA 1P62B 4KMOA 4B73A 4RF4A 3PCRB 4FYMA 4M86A 5EJ7A 1OX4B 1PNVA 2IHTA 4AG6A 3CZ4A 4BX0A 2H11A 4ZI7B 3U56A 1QOQB 3B85A 4UMDA 3EK2A 4YRMA 4H0CA 3MCZA 4G26A 1X3SA 3C6BA 2DHQA 1VLQA 3EXG1 3BBLA 1AZSC 3H9JA 1LX7A 3KEQA 3PDHA 4AYWA 8AT1A 2Q9AA 2FMIA 1SEVA 2PH1A 5IZCC 4QFBA 5J4YA 5K0BA 2CK3A 1BMQA 1Q3HA 1WCYA 3VTZA 5IC4A 1CK4A 4O59O 4QUGA 5FBHA 4NXMB 4HXFB 1YJBA 2XXAA 5G3YA 5I6DA 2RJNA 1PJSA 4AUNA 4MMXB 1MDBA 1R12A 1DTWB 1XZDA 2RHHA 1JSRA 4BNIA 4RD1A 3DHWC 3LPMA 3BTOA 3ZTTA 3MCWA 5BMVB 3HPQA 3L4BC 1PV1A 3G8DA 2O8NA 4BEVA 1GGMA 2IWRA 4BB6A 1RYHA 5HWSA 2V7GA 4EFNA 3B2QA 4ENWA 5BXYA 1RW4A 3LVFO 5CJJA 4W5TA 2FPOA 2HDNB 4GPTA 3WZLA 4YRNA 1P1CA 4NONA 1XEAA 1Y8ZA 1SBNE 3KO8A 1EUCB 1O7JA 1W6RA 2V96A 2H1IA 3N0XA 4R8SA 4ZOCA 4MS3A 3IMCA 2VAWA 1DUSA 3A36A 5E6SA 2VQDA 2AJLI 2RHGB 3F6BX 4BN0A 3BB3A 3MSCA 4IO1A 4OJNA 3LY8A 1ELOA 1GAJA 3K6RA 4A5OA 4M7OA 5ED4A 1OGYA 1O03A 4Z4HA 1OMOA 4XLZA 1E9CA 4HDSA 3KTAA 2DWOA 1XD2B 3PWTA 4CLRA 4B6EA 1L5HB 3DTTA 1TO2E 4Q4AA 2VRBA 1RLTA 3L46A 1P7WA 1G20A 1T5DX 5C9ZA 1ZEMA 4S05A 4WSOA 3Q7QA 3ZWPA 2IQIA 1MVOA 3DAGA 4Q93A 1CW2B 4LGCA 3JWEA 5FF9A 4GX5A 5GQSA 3ANMA 4J29A 2J3MA 4PS0A 1G2IA 1ODTC 5JSUA 5L3SA 1Y8CA 3WYGA 4XE5A 5IT5A 4JLDA 3PWKA 5FB3A 4C7JA 1J9EA 1KZ9A 2FW6A 3ED1A 1NMYA 4MGKR 2CSXA 3WGKA 1MEJA 3H3XA 3I0NA 1E1LA 1E79D 1JPNA 1XRLA 3LIPA 4TWIA 3V4PB 2NO5A 1UBJS 5DNUA 5JVDA 1JAXA 3HUUA 5HW0A 4ZO4A 3IQDB 1F9AA 5I9SA 3HK2A 1IY0A 3C1UA 3HY4A 3TYXA 4WXYB 3PE6A 2XNKA 4E32A 1Q1AA 1U2DC 2Z83A 3HJBA 5ALUA 3DWEX 1PUXA 5J2TF 5E7JA 1IVNA 2IELA 4DV4B 2XWJI 3P9KA 4E5MA 1AKRA 1SQ0A 1TZBA 2GHTA 3N07A 4L8LA 2R86A 1Z7WA 3DEHA 5GGYA 3O3CA 3OO1A 4FBGA 2UUBB 4HNHA 3WQQA 2BEUB 2CXRA 3JRWA 4NV1A 1N6PA 1Z7YA 3OECA 2HHLA 2VZEA 3NIBA 1RCUA 4CIVA 1RI4A 3DMRA 5JQGA 1TJNA 3M3HA 4BNUA 3NOXA 4QEZA 2EKQA 4O3MA 3CUTA 4B34A 2F1IA 2BF4A 1SCIA 4YI5A 4D9JA 4L0CA 1DOHA 4RIHA 2PRZA 5TY0A 3ONNA 3OIWA 5BNTA 4YEDA 4OGWA 3HJGA 5F76A 2BISA 3IL2A 5KSOA 2PXCA 4P22A 4CMIB 2ZT8A 5AM5A 1R8QA 4LEIA 4B3CA 1E8MA 1GPBA 5E2AA 2XAAA 5EHGA 2VHEA 4OG2A 2XZPA 3THYB 3JYNA 5DTJA 2A9RA 2I2DA 4YJGB 4RXUA 4DQDA 2YXDA 3KKOA 5IJZA 3M4YA 4M1YA 4MP6A 3RYCA 4LNAA 4JC0A 4LJ6A 3SKYA 4DS3A 1V48A 5JD5A 2PXAA 4EJSC 4S2EA 5E1BA 2E87A 4QNMA 2B3TA 4TROA 3QBTA 2GRJA 2P2SA 2ZB7A 3HL4A 1MC1A 2GASA 4ER7A 5JQWA 1EYZA 2ESRA 5DCLA 4K81B 1T9KA 4FMBB 5AQEA 2VRNA 2XF2A 4Z54A 1TLTA 4I5FA 4D57A 3JAWB 3UJPA 3PD7A 4BLSA 3T3IA 2JS7A 3GAFA 3ZD9A 4OMCA 1BTOA 4A92A 5KJ1A 1KIAA 1IG0A 3HCDA 3CBQA 4ZVVA 3E9MA 1SXGA 5D84A 4FXPA 1SMKA 2BZSA 2QSJA 3VTKA 1T0HB 1S7GA 3AR7A 2Y1KA 3GG2A 3LCMA 1JV2B 3MRXA 4PPGA 4ROSA 1EQ2A 2F3PA 2VATA 4QICA 4WIAA 3MTAA 3K1AA 3A2MA 5J3JA 5CFQA 1UBNA 2VCEA 1OKKA 3BSFA 3F7MA 3L7AA 2YBEA 4PS1A 5GONA 1WUHS 3KZXA 5J5VA 2QUAA 3B20A 1P8JA 3BB1A 4FZRA 3E1SA 3OPQA 1EUQA 3EBPA 4O2AB 3NBFA 2AFHA 4FLEA 1ZXXA 1JNXX 1M2FA 3AQ4A 4ZEMA 3L06A 4I6GA 2XMRA 3ZE7A 1M2OB 1CEEA 1J8DA 3Q0TA 4CM9D 3U7HB 3MF4A 2X5OA 4K8OA 2YQ4A 3CVUA 3QI2A 3UUEA 5I45A 1E99A 1G5PA 4QLOA 3ZU2A 3ORHA 2BIFA 1M2GA 2V6JA 2AR9A 3NALA 3IESA 4L9SA 2E4ZA 5K8TA 4PQEA 1N5IA 3GZJA 1R9GA 2BT4A 2PGNA 4L4SA 4BMZA 2Y2VA 1GPWB 3IAEA 1DOZA 5CMLA 2Y6VA 3W6ZA 2O2DA 4KYUA 5CVTA 4ESVA 1OREA 2ZRBA 4D4HA 3IP1A 4ENQA 2OP1A 5LJIA 4EPRA 1MJFA 1S2DA 3CNNA 1TI7A 2CL5A 2H7VA 2RFLA 2PGAA 4I9FA 3IOMA 3LDFA 4M7WA 5JBNA 3QOFA 5IP5A 3ZDXB 4G6ZA 1VL2A 3PE4A 1B2LA 4ZOAA 1DBVO 1NY5A 1SOWA 2F9MA 4LAFA 4E4YA 1C81A 3WHKA 4TQAA 1SNYA 4PGFA 3ZOZA 4JXZA 1LK7A 4P2GA 4KQ6A 5K6AC 3MBKA 1JJBA 4NENA 4G2NA 4IDPA 2FP4B 3QX9A 2FV8A 4MH0R 3LX6A 1MIOB 2WJJA 3UCFA 2O3QA 3JATA 2ZRIA 3G3EA 3FETA 2WQZA 4PVDA 4ZO7A 5ERGB 5IAJA 4BE4A 1KY3A 1S7CA 1R0ZA 4N7JA 4DB4A 3KR2A 4P3OA 2XADA 1DXYA 5JH7B 4F6LA 1ORHA 2FUKA 3VH4A 1KI7A 4KQKA 4P86A 3DFFA 1RFLA 4OJTA 1IY2A 3HN6A 5AO9A 1PZNA 5FPPA 1SG6A 2X4IA 4YMGA 1XRQA 1LDNA 2C31A 3C41J 4ME6A 1F5NA 4HDMA 2OHGA 4BNYA 4A26A 4IHKA 2IS4A 3PD0A 1NR5A 2JGDA 3F6YA 3FZEA 3PXCX 1O94D 4DRZA 4JYPA 1G3IA 1R8JA 3DB1A 1MRSA 3G0OA 1IK4A 1IB0A 5EE1A 5KC9A 1C4KA 4Q9AA 3C5WP 4HPWA 1QYVA 2XYVA 4Y2PA 2BZGA 4O4LB 3VR4A 4BFCA 4Y18A 1DZ3A 4OFBA 4MEJA 3S2EA 1YFKA 7REQA 3OETA 1GAEO 3EXG2 3H5VA 3KUKA 3KYDB 5DBOA 3BAFA 2JFFA 1FDRA 4U63A 5TRTA 5I7FA 2O20A 3C3BA 1YDGA 5LBTA 2JLUA 3CMCO 4XQCA 4I8XA 3WLAA 4UUAA 3OWHA 3D3KA 1MB4A 4RVSA 1AGXA 5DRYA 5AW0A 1W4ZA 4DLPA 1X2EA 1ENZA 3SG0A 2YFYA 4QRDA 4WMLA 4PC6A 3HBNA 1U0SY 4NARA 2O1SA 1YUMA 2OFXA 5BVHA 3HCRA 1VKHA 3TNLA 4DA9A 5CP8A 4MGHA 3IYLW 3FRIA 1W4CA 5AXDA 2BN4A 4AWAA 4W4TA 1SUPA 5EIFA 1X9GA 4K9SA 1PU2A 1UJCA 1IJKA 2QTTA 4PPQA 4PZAA 4B3FX 4G0WA 4CEIB 3PJDA 2PMCA 3CX6A 1VPEA 1JKJB 1GL3A 3I8OA 5E6UA 1N77A 3ADPA 1D2RA 5K1ZA 3KCNA 3QUAA 2C99A 4BNLA 2EFJA 3W78A 5LP1A 3NHSA 3HYRA 3SICE 3ZW7A 1MJGA 2HW8A 4GMFA 1UJMA 2KMLA 3EAGA 4LY3A 4PSDA 5DN6A 3D6VA 3V4VB 4FEEA 4ZAXA 5HF9A 3ZV7A 4BX8A 5DV9A 1FP1D 2M32A 5KNDA 3DV9A 4BYMA 1GPUA 2JFQA 1WHSA 3CRQA 4HFJA 1LNSA 2VDJA 1XEXA 2QXUA 4JASB 2E4XA 2WFLB 1UM9A 2QIPA 3ELYA 2OYCA 3S2YA 2N46A 5AKHA 1NASA 5HM8A 1RPTA 1ZJZA 4B1FA 3MB8A 4UEWA 2YWRA 4O4JA 5ESRA 3WRYC 1N6RA 1R00A 1ZCBA 4CQMD 3TMAA 3X43A 1SD1A 1YHZA 2J3KA 3WIEA 3UFXB 1W88B 4Q6BA 2GAOA 4FSDA 1QFYA 2RHWA 3RTGA 1OC2A 1S9DA 5DX0A 5AHWA 4FFLA 2W7TA 1F3OA 2D4HA 1ORIA 4GMXA 3U7QA 3QU7A 3VHXA 5LMCA 2YV2A 2YWHA 3SXUB 3CNHA 3O90A 1O97D 2R8ZA 1M0SA 3VR5H 2PLRA 4PZEA 4QGFA 1XDZA 2ZR9A 1NSTA 3N70A 3TO5A 5EPUA 1EFVB 1HT3A 2C9ZA 3IA2A 5JYBA 3HVKA 2FKAA 3JYOA 3LUJA 2P4QA 3VC1A 3IUJA 5CD9A 2BELA 3VGPA 5AJHA 1H1TA 2RCYA 3MJFA 2C2BA 4E0BA 3PI6A 2HU8A 3JASB 3HFRA 3PKIA 1G291 3G2OA 1XLVA 2IX3A 1ZAKA 3NH6A 1OJLA 2D2IA 1NVTA 3C39A 5FBZA 3HCOA 1UBRS 2RAFA 2X2FA 4BFXA 2AOTA 4I5GA 3EDQA 1VFNA 1QHFA 1Q19A 3M89A 4MQFB 1OSNA 1CB0A 2FZWA 4C07A 2FYTA 4AUEA 4F5WA 1KK3A 4HKTA 4DPLA 3B5JA 1ZH2A 3DYVA 4AMUA 1IVYA 4DV5B 2FG5A 2P9TA 3CONA 4U2FA 1X38A 3K15A 3OQJA 1KYIA 1NKVA 2YZMA 3R3WA 2H1SA 3U4IA 3ASUA 1X13A 2IL1A 4TTVA 2HAEA 1LPOA 4O02B 5ADVA 3LW7A 2EWVA 3DE7X 1IQUA 2PL3A 4QO8A 1HYEA 3LCVB 2A9OA 5ALGA 3UPDA 1NP3A 4Q1FA 3VYUB 2FX3A 4PSAA 2MR6A 3JQCA 3GWZA 4X6YA 4C0LA 1Q1NA 1RXYA 1JHOA 5GVSA 3KKNA 3C24A 3H1PA 5A3VA 3IDQA 3QPAA 1KMHA 3ESCA 4R1OA 3ZDAA 4H17A 4I8IA 4AM8A 3P9IA 4I50B 5BOSA 2HJWA 4P4SB 5CFRA 1JEQA 2BMVA 1P4JA 1ZICA 3MS4A 1ZD9A 5FL3A 4EFKA 3ETEA 1E4EB 5CIYA 5EJ2A 1NFFA 3DEYX 2O3UA 3GJQA 4AVYA 5KTNA 4ZU1X 1U7TA 2W6ZA 1G3MA 4JROA 3NTXA 4LJ5A 4XM0A 2E4VA 2H65A 4HI0E 4L0MA 1N5MA 5LDGA 3UK0A 3WJ1A 3HSYA 1W59A 2Z6AA 5EXSA 2B2NA 3HZHA 1WZEA 1X86B 1TT5B 4HXEB 1NW4A 2ZE7A 3UMJA 421PA 4Y0AA 3VNVA 5EESA 1RPAA 5U4XA 4O29A 2CCKA 1SWVA 1TQ6A 1V9LA 4UM8B 1QMPA 5JDCC 2ZFUA 4JHXA 4KLRA 3AF6A 4KWTA 4R2KA 4BO4A 1DZIA 3FBGA 4FW9A 1K3UB 3QF4B 4HQOA 4KHZA 4N12A 2XLCA 4OBXA 1EX9A 1BMFD 2F43B 3WWYA 4LK3A 2J0EA 3CEHA 4G5OA 1BU5A 1CCWA 1X7WA 4TS4A 1OFGA 3ECSA 4J4TA 4ZT4A 2HMAA 4LXTA 4Z1MD 5LOVB 1G66A 4U7DA 1E1MA 2EKLA 1H6AA 4YX9A 4A7PA 1BW9B 1C3OA 4KAXA 4KQFA 2WSBA 2YZ7A 4JEUA 2C1XA 2G5TA 4RL6A 3EDYA 5BV7A 4X20B 4F12A 3HB5X 1UBKS 1NUTA 3WB2A 4L85A 5DASA 3Q11A 4EK9A 1ITZA 1PJCA 4RMIA 1JF8A 1QDEA 4XTCS 1Q83A 2DUJA 2AXNA 1O8CA 3GI1A 3MQ4A 1GXSA 3I1YA 5CJ2A 3SQMA 3GAMA 2ZUEA 3G0BA 2HNKA 3SR3A 3AETA 1JHQA 3OE4A 3K53A 3GBSA 2PX0A 4LNHA 1QIIA 2ZUUA 5E9QA 1QQ5A 3TINA 2HSJA 2XCUA 1UEXC 3AG5A 3DZIA 1QFJA 4XDHA 2J33A 3CLUC 5DBFA 5FV7A 5IW8A 2E89A 2FI1A 1MFPA 4OXRA 2QTRA 1UK9A 3D7NA 3M5CA 5BW8A 1EHYA 4MWZA 4NY1A 4P53A 3A06A 4CL2A 2PH5A 2UZ1A 2ZXFA 3QLUA 4HQNA 4PHFA 4QOGA 1E4VA 4KZPA 2P6UA 3MVEA 2WD7B 1T3HA 4NFSA 3EODA 1K7XB 1GG2A 4YIKA 1Y9EA 1JG2A 3HA7A 1IOWA 2AJ8A 1Y37A 3QU4A 2V6GA 3PL5A 1HYGA 2YYYA 5IG2A 1M33A 4J3NA 2CHVA 2OENG 1X7DA 2B7BA 2QLJA 3EFEA 4S1OA 4UQOA 3WGHA 2FOXA 4V2UA 4HUTA 1N2CE 1QFSA 5CNKA 1PSWA 3JALA 4RVOA 3WLRA 1KQGA 1QANA 2JDIA 2HJVA 3ODGA 3NGXA 1U7XA 2IU3A 4GOXA 1N3IA 4TTIA 3U1VA 3WSVA 1MX5A 1JT2A 5LXTA 5IYZF 5JJLA 3X1XA 3BEOA 2BR3A 3QX8A 3ANTA 3PDIA 2PL9A 1DV2A 3AM5A 3AKDA 5KMGB 1QIJA 2VT3A 3C8DA 2IDKA 1R0KA 1PCXA 2IZ7A 1TZMA 4KH1A 2I6XA 2QRZA 4RH0A 2QNIA 3VZBA 4BVJA 2ZBGA 4P0PB 4AZ0B 4BRWA 1SQSA 1USVA 1UXKA 1N6IA 1HY3A 2JIOA 4LQDA 2G9VA 4PLCA 4OP1A 1TMOA 3COZA 3GJ7A 2OGZA 1TYCA 1I6LA 1LTQA 1GZDA 2WU8A 5HE9A 1FJGB 4QUEA 3CPHA 4Z4GA 1K1EA 4TKVB 2BFEA 4KVAA 3S70A 3ZCRA 2YZGA 4U7FA 5FULA 3EEIA 4KN5A 2J6IA 1BRMA 2YJGA 1NUHA 4DMHA 3OFND 3BHJA 1EXNA 1RQPA 1WE2A 4OJKA 4F5EA 1T1RA 1DBIA 1I0IA 5C8YA 4BJ1A 1E7SA 3EHEA 4I5EA 16PKA 3PFBA 1J42A 5EPEA 2WIBA 4YLGA 1STOA 5LP6F 3EQ7A 5LA6F 3K2IA 1KL7A 3D6FA 2WA1A 3QKSA 5A06A 4GQIA 2Q8NA 3L3BA 1MQ8B 1V3TA 4INPA 2OBYA 3ICCA 4JSYA 1Y81A 1GGNA 4GBED 4ILKA 3KG2A 1BGVA 1NJFA 1XF1A 4ZVNA 4ZCQA 5DMHA 2IOFA 3BIJA 4EL5A 3I62A 1E1RD 1DAFA 4FMPA 1A5ZA 1J8MF 1QU3A 4LVNA 2RGYA 3QMVA 4MWEA 5EWLB 3OZGA 4JI7B 5EQFA 1BQ3A 2EJBA 1ZUNA 3UFBA 5BY2A 1JAYA 2ACKA 4KO2S 1ZGBA 3HJCA 2CLFB 1HDOA 4EPVA 3TGPA 1JG1A 3GLKA 4TUYF 5ALYA 1Y1QA 1SCQA 3HN7A 3KP1A 1T1SA 5LMNB 2HF2A 1YR2A 4K1XA 4HPJB 5BVGB 2XD4A 3KVVA 4ZKDA 4F3RA 3T7CA 5EJGA 2P2ZA 4FBMA 3WMRA 5FBWB 2I78A 1CZNA 2VHVA 3ROFA 4WXHA 3HYSA 3TQIA 4DLYA 2VF2A 1JH9A 1E9EA 4YJ2A 2FN8A 1M74A 3NBZC 3OU7A 2DQSA 2HGSA 4RLQA 3TXXA 4FNGA 2W6MA 1PK7A 1R27A 1FYEA 3C45A 3FWYA 3ACBA 3ZJVA 4HEQA 3HDYA 3LWZA 3O26A 5ADUS 5SICE 1B00A 5IH3A 3V8RA 3DLAA 5HP4A 2F55A 2J0SA 3HJAA 5AOVA 3AVWA 1GKKA 1ZXLA 1GZ5A 4OYHA 3QWAA 1ODSA 1K7SN 1CE8A 1U0FA 1WXDA 3MOSA 1NBME 1XCJA 4FILA 3THWA 1Z74A 2FXVA 2Z57A 3OC6A 1NQUA 4OB7A 4BFZA 4D25A 1QO7A 3C7KA 3G9ZA 3TJRA 4S1PA 2IEIA 4W5QA 4B46A 1FS5A 1BDMA 4IDFA 4Y7CA 4BNFA 2XKJE 4TMTA 1H2EA 1MW9X 2XOEA 4JHLA 4U7GA 3SOPA 1ST2A 1N5RA 1WM1A 2YNMD 3DL4A 2C2GA 3GT3A 3QP9A 4WK4B 3P8ZA 1Q2XA 4XUDA 2NP6A 3EEYA 1W35A 3LSTA 1JLKA 3DP7A 1WDTA 3B6ZA 3TNYA 2AK2A 3AG6A 2LD4A 5HIMA 1FXWF 3C3MA 3W2IA 4EX7A 1FX0A 1I1NA 1YO6A 2CL0X 2W83A 3IMKA 4L28A 3FBTA 2G04A 1FNCA 2Q2NA 3AF2A 2FEAA 4M46A 1Q0UA 4YMUA 2A7QA 4MUJA 1AO0A 3V1KA 4GT1A 2W00A 1OFUA 3DUWA 2NV6A 4N03A 5F3WB 3RC2A 2I9KA 4M9RA 2QGZA 3I5AA 2YY6A 1SB9A 5AHKA 4ER0A 4XLLA 3FAKA 3HNPA 3TUZC 1TX4B 2I1VB 4L07A 4N3NA 2QYSA 4WECA 2SBTA 4MW5A 2NM0A 4G8JA 2JHGA 1ZGJA 3RUAA 3T9BA 4R1NA 3K72B 5K20A 3GP8A 2ZRKA 1XTPA 1LI5A 4BBJA 5DM70 5HZMA 4CIAA 4J9UE 5DHTA 2OQVA 4D3DA 2H6EA 3CLTC 3KB1A 5E4JA 2CV1A 2GSWA 1P6QA 4OBEA 5B4TA 1A7JA 1T25A 3JR3A 4O1IA 1RP7A 2DR3A 2VYQA 3E7PA 5JCJD 3PWZA 1Z29A 3A6JA 1RI3A 3EY4A 4RZQA 5K3DA 1VMKA 2BFDA 2VJPA 4F6CA 3DQQA 3R9XB 4OH1A 5CBPB 5IHPA 1P0FA 2EX1A 3N5CA 3P94A 5DN9A 4HWTA 3UMSA 1YB2A 1N7GA 3AU8A 5B64A 2J46A 4I6EA 5T57A 3WGGA 3PT5A 3B6EA 5CH5A 3VPCA 3WGTA 4JMPA 2QENA 5JWRA 3I61A 4HC4A 3B60A 5AK0A 1H6CA 4LCEA 4YK7A 2RHOA 1P6UA 3CBGA 4I66A 1MGOA 4QBTA 5GPBA 1N1GA 1PKXA 2AMJA 2RB4A 5GY7A 1EFHA 3ENVA 3OE1A 2D2EA 3M2TA 3ZWDA 4KPEC 2G82A 3ESDA 2EXXA 3FCAA 4IDBA 1VMAA 2R7LA 3P0IA 4QBKA 3EHDA 3KSZO 4XQ0A 4ZCLA 1JAHA 3FG9A 1PJ2A 3G9XA 4TWBA 3TLGA 2FFQA 5HBRA 2IEDA 2JGJA 1LBEA 4R1PA 5BN5B 3GFSA 1B3BA 3P2EA 1UDXA 1IK6A 2HYDA 2MTBA 2PRSA 3L7BA 1B42A 5DTMA 2XUOA 1A27A 1J8YF 4JUCA 3QZUA 4LS3A 4RGVA 2ODPA 3GUZA 2RGNA 4TQUS 5DT9A 1VG8A 3G1UA 5FKJA 1JS1X 1Z4OA 1SXHA 1YDFA 4S1NA 1LLCA 4GVPA 3MQ2A 4EENA 1E6KA 2HX1A 4D9GA 2QUZA 2MOKA 1D07A 5DSXA 4CU2A 1W34A 4MYRA 4QQFA 3ZD6A 3OG9A 5F23A 2BTQB 1RKQA 5FUMA 4C05A 1XHLA 3OSZA 3S2UA 4OLJA 2HMWA 3BH6A 3DZ8A 2V4UA 4B83A 3HDVA 2FPXA 3CPSA 3IOBA 4F06A 4KN6A 2QMYA 4OOFA 1RS0A 1CFJA 4TQGA 3ADDA 2VJCA 1J0AA 2CF6A 1ZR2A 3OPMA 3LQ2A 1E2GA 4IBOA 1AS3A 4RO0A 2CLIB 1P1BA 1RWVA 5REQB 5E3IA 4PO1A 5K0CA 4EG8A 4F0JA 1JLMA 3AOEC 3RYFA 4DLRA 1CYEA 1WCWA 2RB5A 4RS4A 4EG3A 4K8RB 3PGJA 1L5RA 1XTZA 4ZDJA 2YS6A 3NPAA 1BVHA 1PQWA 2ZS9A 2YY7A 1CXZA 4KQHA 1A2BA 1YHNA 1MW8X 1AZWA 5I7SA 1SUIA 5C7YA 2C3YA 3BK2A 1KJ8A 3TRJA 5HZHA 1UZUA 3TQSA 3TZEA 4EF5A 1UPTA 2IITA 2X1LA 4O2RA 2QD3A 4WE3A 3DZHA 2VYNA 2NO1A 5DM60 5ISMA 1IHYA 1JBQA 4BDSA 4BO9A 1NQTA 1VBKA 4MRSA 2Y9PB 4RWZA 4U2DA 1IH8A 2GBGA 3Q85A 4QA9A 1S89A 3OE7A 3QE3A 4LMRA 1XKLA 2RKBA 3W8NA 2DT8A 1J25A 2J09A 3KYCB 1DX9A 3I73A 4JUBA 4AMBA 4CKYA 2GKSA 2WIAA 1JR3D 2E4UA 4NHOA 2E9SA 4NJEB 4BMVA 4NBKA 3OEHD 4BZXA 4JUFA 2O48X 2BWJA 1ZP6A 5FRDA 3FDIA 1OXMA 1E3IA 3H16A 4X6LA 4XQGA 4ZD6A 3V4LA 5CM9C 3V7YA 4RORA 2BEVA 4QXPA 4F45A 3SYMA 1P44A 3UUWA 2B8EA 1GTL1 1QH9A 2G5CA 4LY6A 3ZHQA 2HPVA 3G85A 2REQB 4BVBA 1AMUA 2EP8A 1ODIA 2H1HA 4YRLA 3R5SA 4QVIA 1CRPA 2J67A 1F6DA 1I2BA 3HCFA 3BYZA 4F2PA 2M6RA 2P3OA 2JI7A 1VFPA 5KYNA 1G8HA 1E3SA 1UZNA 1NX6A 4L6IA 3LZ6A 4G4SO 2NU8A 4CQJA 2ODWA 1DTEA 1IBRA 4I36A 1MO2A 2QE7D 3I9JA 1QR6A 4YCLA 4JXKA 4R1MA 5IASA 1CJVC 1ZOLA 1TZKA 2WOOA 1J5PA 3OZRA 3U4AA 3ST7A 4Q3CA 2XMDA 1I3MA 5EQJB 4ZDKA 4UAVA 1WZIA 3H04A 5H83A 3Q87B 1ISMA 3JQGB 3LLUA 5D2CA 1KOLA 1DEHA 1ANKA 4CKCA 1Y8QA