4UREA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
248
structure length
248
Chain Sequence
MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
molecule tags Oxidoreductase
molecule keywords CYCLOHEXANOL DEHYDROGENASE
total genus 98
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ureA00
2RIRA 2UUPA 5IDYA 1UJMA 1O9BA 4U6SA 4RLHA 4JLWA 4UVGA 4BNWA 1ONOA 3I9LA 1PGNA 3JQFC 4NH4A 1VLLA 2VCYA 4U5QA 4NI5A 4RPLA 2PY6A 2QYTA 5IG2A 1ORRA 5AOVA 1AUPA 1LBEA 3JQ7B 5IZCC 1GQ2A 3U4IA 4J6FA 3WIDA 1Y9EA 1NPTO 3SC6A 1DIHA 3RWBA 3ZWXA 3C7DB 3UUWA 1LSJA 3NRCA 1BTOA 5JLAA 4I5GA 5COAA 1JQBA 4ND3A 3TFOA 1OC4A 5T67A 2IZZA 4DIFA 4N7RA 3EAGA 2ZKLA 1ZK1A 1SOWA 5L40A 4WKGA 1X13A 3O26A 3UAGA 3QWIA 3TPCA 3V5NA 2P4HX 4S1VA 1NM5A 2IZ1A 2B69A 3NYWA 3OQ6A 5L53A 3UVEA 1J5PA 1E3SA 1ZH8A 2HMWA 1VJ1A 4CPDA 5A5FA 1ZSYA 2C07A 1LLUA 3I4FA 3ZU4A 1OAAA 3I9MA 1KS9A 4GWKA 1E5LA 3JQBC 4CUKA 3IJPA 3IP1A 3EK2A 4RJTA 4DA9A 1Q0QA 1PJSA 3OJFA 4CQLA 1JTVA 4W7HA 5ILOA 4F46A 3F5SA 4J0FA 1XLTA 1GADO 3GVHA 4M8SA 4BO4A 4AICA 1TA4A 1GFSA 1PGOA 1GYPA 4Z6KA 1F8FA 4YEDA 2H1SA 2R00C 3TQHA 4CR7A 1R16A 1T2DA 4DYVA 1RM0A 3PJGA 2BFMA 4J90A 4R3WA 4BNMA 2YFHA 1FF9A 4U8GA 4MIYA 4NJMA 1YQGA 3DXFA 2X8LA 4NQZA 3F4LA 4AJKA 4FS3A 1AXGA 3GUCA 2YV1A 1O0SA 3C1TA 4E32A 4S3MA 1H6BA 3KO8A 2RBEA 2WD7B 3DAFA 2WJPA 2VUUA 4PLGA 2DU8A 3RQSA 4CM8B 4DGSA 1ADGA 1MC4A 5ES3A 2B35A 5F1KA 4EJ0A 4WJZA 4E12A 4D79A 1XIVA 3GMDA 3N7UA 4WEQA 3Q1LA 3FBGA 5KTKA 1CJCA 1HYHA 5CDGA 3TWOA 3W4KA 1WDKA 1ISIA 1V0JA 1ZFNA 4NIMA 2FP4A 3N74A 4ZRNA 4M1QA 3VVBA 2O7SA 3IQDB 4K6CA 1F06A 3BMOA 1YB1A 4NFHA 5CG2A 1U28A 2PD3A 1ZK4A 1QYCA 1DC5A 2GN8A 4E13A 2FPIA 4UUOA 2YHIA 4FFRA 4DQXA 1NP3A 5JPIA 2DBZA 3TNLA 2FZEA 1YWGO 3NUGA 2VQ3A 1P33A 2TMDA 5KKCA 1PZFA 1R4NA 1UR5A 4BS9A 3L6OO 3JQ7A 1TT5A 3WR5A 3QVSA 4FDAA 2DC1A 5TS3A 1VSUA 2HAEA 4D0SA 5HS6A 2P91A 2NWQA 4TKMA 2NNLD 5LCXA 3UICA 3M2PA 1DLIA 3E1KA 3GGOA 4BQRA 1VPDA 3IS3A 3UFXA 5MDHA 3HSKA 1NQOA 2QHXA 2GZ2A 2E48A 3BTOA 3HDHA 2DBRA 1KVUA 3VH2A 3WIEA 2PD6A 3GFGA 1XQ1A 2AG5A 5FEUA 3MJEA 4GX2A 3ZNQA 3H9EO 4XYMA 5L9AA 1ZXLA 2UV8A 3K8ZA 5L7YA 4BNHA 1RM3A 4KTTE 1JWAB 1EUZA 1HSZA 3DHEA 3U3XA 3WFIA 2WD7A 3ZN2A 5T8KC 5TIIA 2HMSA 3G79A 2ZJ1A 4WLUA 1NTOA 4B3IA 2PZKA 4TZTA 4R1SA 2PGDA 3K9QO 1O94A 4CV2A 4UVDA 1MUUA 2FWMX 4ZN6A 4B4WA 4PLPA 1BVUA 2G76A 5G0SA 5AXAA 1IZ0A 4YVFA 4IPTA 4CMAA 3AI3A 5KVCA 4GLOA 4IQ0A 3DBVO 4ALJA 3ROKA 5B1YA 4NK5A 5CEEA 3DONA 3GAFA 4U0KA 3NT4A 1W6UA 1GV1A 2X9VA 1WDMA 2HU2A 3D4NA 1X1TA 4CLOB 1B0AA 4J16A 5G2OA 3IAHA 4PLWA 4MVJH 5IN5A 2XAAA 5B12A 4ZRMA 4II2A 1DHTA 4QT0A 1GZ4A 1XG5A 1SZJG 4QXMA 1E3WA 4XRRA 1DJNA 5A06A 2GNAA 1ZK3A 3ZWAA 4HFRA 3KVOA 3P19A 1ENOA 4GBJA 4H16A 4BNIA 4BNVA 4CM4A 4MIEA 1N1EA 4FC6A 1TXGA 1SAYA 5A3JA 3GC6A 1XQ6A 1M6WA 4XDZA 1I5RA 2FMUA 3H2SA 4FJ0A 5I7EA 1R4NB 3DOJA 1LDYA 2JCYA 3TL3A 3WGYA 3TOZA 3HJAA 1Y8QB 1LLDA 4DIBA 5DN9A 3HADA 4ALLA 4HY3A 3OFSA 4CMEC 3K2EA 1QXSA 3A14A 1EBUA 4YACA 2IEBA 2JAPA 1EQUA 1Y8RA 4CM7A 5T6BA 3UCXA 2GPTA 3TSCA 1HLDA 1X15A 4QFCA 4JIGA 2E37A 4BO6A 3H4VA 5A9SA 1IPFA 1K5HA 4UEOA 3RC7A 2CDAA 4KMSA 4ALIA 3ASVA 2QRKA 1ZMOA 1G1AA 4BNZA 4Z0HO 5FI5A 4CM5A 3PDJA 1C3VA 3GH3A 1R4MB 2YZ7A 4X54A 1IULA 3AOEC 1GPJA 1B26A 1DFHA 3H65A 3MJCA 1X7GA 5ER9A 2VZ8A 4CLOA 3QWFA 3SJ7A 2VT2A 3AUTA 2D8AA 3KM0A 3ONEA 4IDCA 2D0IA 4XQ9A 5IXYA 1EVJA 4GH5A 3COSA 5JCJA 3GOHA 3TZQA 4DQUA 2AEJA 3U0BA 2GZ3A 3O9ZA 4E33A 4J7XA 4G81A 4LMRA 3TZ6A 1QP8A 3RU7A 3MJVA 3D4OA 4MP3A 2EV9A 3AK4A 3CMCO 5U1PA 5HTOA 3OIDA 2W2KA 3F6YA 5DP1A 4BV9A 1BGVA 5THQA 3TFQA 1EFKA 4WE3A 4BNYA 3JQ9C 1DFIA 1ISFA 1BDBA 4ROSA 3BTUA 5AXCA 3DBLA 3LLSA 1SB9A 2D2IA 2CUKA 1PSDA 4ZHSA 1GUYA 4OXYA 2C54A 4JJGA 3Q3CA 5DP2A 1VRWA 5JBIA 3WTCA 4M89A 2FZWA 1I36A 4BGEA 2CVZA 2DFVA 2VYVD 4DIOA 4E30A 3RD5A 1UZMA 3S1LA 4BNKA 1UAGA 3O38A 4CQMB 3HNPA 3W1VA 3T4EA 5JY1A 1PL8A 3E6AA 1U3WA 3ZU5A 4Q3NA 1HYEA 1Z7EA 3SEFA 1GZ3A 2ZJ0A 3MTGA 2H63A 2I3AA 3EY4A 5ER6A 4J4HA 2FHSA 4JX8A 4I5EA 1WVGA 4XB2A 4WGGA 5ITVA 2SCUA 2FPPA 2RAFA 2WDZA 4MKZA 4KDFA 2Q99A 1H9BA 3KLMX 3TDKA 4KWIA 3EGOA 2ZTVA 2J3JA 1OFGA 3WFJA 2WYVA 1JDJA 1X1EA 5T5QA 3WGOA 5TX7A 3ITDA 3JYNA 2Y67A 4MVJP 4J7UA 4RVHA 2AQIA 4EJMA 4MO2A 2GF2A 5IFLA 3QIVA 3OEWA 3OETA 2OOSA 1GUFA 1I3NA 2C82A 4MJLA 3I6QA 3E48A 2Q1WA 2XXJA 4WPGA 4BNFA 4DREA 3LQFA 1HLPA 3WWZA 1HSOA 4GSKA 1WP4A 4AJJA 4CM8A 1F12A 4IJKA 5BNFA 4O5OA 4QSMA 3OJLA 4L0QA 4YRBA 5JAIA 1DAPA 1DC3A 3JQ8A 3FNFA 4Q3EA 4E5YA 3D64A 3V2HA 2NVUB 1U5AA 1UDAA 3GA0A 1PZHA 1E7QA 3QA9A 4KUEA 4NNJA 4CMJA 2B4TO 1GUZA 3PP8A 4HWKA 3NKLA 5HA5A 2BD0A 1QR6A 1MGOA 3UHAA 5AQ1A 3RJ5A 4YTEA 1C1XB 1G6KA 3RJ9A 3WXBA 5L4NA 1EMDA 2NU8A 3LLVA 5EQFA 5G0UA 4XX0A 5DBGA 3D0OA 1U9JA 3L4BC 4E2YA 1E1NA 4Z0PA 2OXIA 1NQ5A 4LSMA 1OMOA 2XPCA 3UKOA 4GMGA 4Z9YA 3I83A 4L4RA 1V3VA 4PG5A 5TF4A 2HDHA 1KY5A 2ZB8A 1PZEA 2CVOA 2E49A 2JFFA 4RDIA 4RF5A 1XELA 3MOIA 5B4TA 1P1JA 1EK5A 1F0YA 3DWFA 1M67A 4IZIA 2JCXA 1HTBA 1Q0LA 2X7HA 1H94A 4A10A 1YONA 5JDCA 3E9NA 1NAHA 4OM8A 4DL9A 2JD1A 4ZQFA 1ZCJA 1CEQA 3RVDA 8ADHA 4F6CA 4OQYA 5TT1A 5DCWA 1E7RA 1VSVA 3MZ0A 3ZWNA 2NTJA 2G17A 2JHGA 4BNUA 1AGNA 1E1LA 3BMQB 1C14A 3R1IA 4MPDA 3H9UA 2UUOA 3AM5A 2Q46A 5IZCA 4IZHA 1RYEA 1EK6A 3G0OA 5DULA 4A5OA 1MLDA 2IYPA 4D43A 4CR6A 1HDGO 1E7WA 4FFLA 1U5CA 3VZPA 1YBAA 2TMGA 3DAGA 1I2ZA 2CMDA 3DC2A 2DVMA 1GD1O 2AHRA 4R3NA 1WZIA 3OIFA 4DRYA 1YS4A 3H9GA 4CM6A 1HRDA 2X5OA 4BGVA 4L76A 1HZJA 3NGLA 5KVSA 4BHTA 1NVTA 4OJNA 2QIOA 4OHUA 4JCOA 3H9QA 1LDMA 3JCZA 2GERA 3LYLA 1ZXBA 5COQA 2G82A 4LVUA 4JROA 3NX4A 1R0KA 3BZUA 1GCOA 4K28A 4DC0A 1NYTA 4IGFA 4EW6A 2Y66A 1TVEA 1I24A 1P77A 1YOVA 2GUGA 3IUPA 3C7AA 3K73O 2Y1OA 2C59A 4YJHA 1MFZA 3S8MA 2YV3A 3GHHA 3PLRA 4CMBA 3OA0A 1FDUA 1CYDA 4BVAA 3F1LA 2O2YA 2PZJA 3ZI0A 4KQXA 1EDOA 3GGPA 5HBRA 1XSEA 3V2UA 2WTBA 3EVNA 3IP3A 3RC9A 3PK0A 1TB4A 2A92A 3CKYA 1PZGA 4BO2A 1GL3A 5L4SA 5JCJD 1KEVA 4NU5A 4FFNA 2PZMA 4DMLA 3CTMA 1E7YA 1N7GA 2Q1SA 4TRRA 1I3KA 4BOYA 1SEPA 2VTDA 3ZWOA 1GQQA 1YL5A 2VWQA 5K9ZA 2O23A 2G1UA 3ANMA 3QSGA 4IY1A 2UVDA 3HUDA 3FN4A 1VL8A 2F1KA 4UVIA 3WGGA 3ZWPA 4BV8A 2DAPA 3DDNA 4IM7A 2X23A 1ZK0A 4XEHA 1I32A 3QQPA 5DOVA 3RUIA 4ILKA 1LUAA 1Z82A 2PZLA 5HWSA 3ENKA 1E0DA 1Y6JA 4BKPA 4PVCA 4E2WA 1E3EA 1YQDA 3IOYA 5DNAA 3H5AA 1PQWA 3U4CA 4CLXA 2BHLA 5IXSA 4RPHA 1OBFO 2H5LA 2O3JA 5FWNA 2ZK7A 4I1IA 1A7KA 3PHGA 4FQ8A 1E6UA 3B1KA 2EJVA 3WG9A 1GTMA 4PG4A 3OF2A 4GLLA 2IXBA 5DBIA 4BNXA 1XU7A 4B4UA 1K6IA 2X58A 3CZRA 4R9RA 2FR1A 3RUAA 4C4OA 5CG1A 2EGHA 5K6AC 1R0LA 3WX0A 1A7AA 2AW5A 3ICCA 1W4ZA 1B15A 2Z95A 3NEPX 2JAHA 3ROQA 1KEWA 4WLNA 1O89A 1NWHA 3TOXA 4E5NA 2Y1EA 3GPIA 4XB1A 1QORA 2POQX 4KWHA 2HMUA 3HFSA 3DQPA 2VHXA 3L9WA 1DB3A 3TN7A 3WGTA 4PLCA 4AJ4A 3CEAA 3LZ6A 1YB5A 3HFGA 3Q9UA 3UW3A 1IE3A 3AOGA 4LRTB 1Z73A 1ISMA 1PR3A 4J0EA 3WJ7A 4J1SA 2YHIB 3GEDA 3PDUA 4GKVA 4G5HA 3D3EA 5EL0A 3WLFA 2EG9A 3LT0A 2UYYA 3MJSA 2ZQZA 4YA6A 3BMOB 4ITUA 4EI2A 4QX6A 3FWNA 4MVJG 1YXMA 4L73A 1V3UA 4IJVA 4CL3A 1X14A 1TT7A 2OP0A 2DM6A 4Y6PA 5EERA 3JTMA 5AYVA 3MJTA 3E5RA 1SEVA 2C2XA 4CUZA 4DPKA 3GG9A 4CM9A 1NQAO 1DPGA 1RYDA 2CD9A 3JD3A 1U3TA 3JD1A 1NX6A 2EWMA 1UUFA 4FFMA 4YPOA 2PH3A 4YJDA 1GYQA 1OOEA 1ISGA 1V8BA 3LF2A 1MA0A 5EQDA 3VKVA 5A1TA 1ZZEA 4YAKA 1LSOA 4YQYA 1W0CA 3DMTC 1K3TA 2I67A 3C1AA 3GZNB 1YDWA 2ILTA 1KIFA 2QG4A 2CVQA 3TF5A 4I9HA 3ZZNA 4RPJA 2E4AA 2DTEA 3QW2A 4ALMA 3DOCA 3EW7A 1LTHR 4CV1A 1P9LA 2DBVO 3QVTA 4PLYA 4R5HA 5JAQA 1NQTA 1YGYA 2JHFA 3D5QA 4XYLA 1O6ZA 5JXWA 3ST7A 5C7OO 4AL4A 4WK6A 3E5MA 3EZYA 2ZATA 2WSBA 2HCTA 3ZWVA 2OZPA 1GCUA 2ET6A 4XYEA 2Y1FA 4HFMA 5L7TA 3W8EA 3F4BA 4TZKA 5I8ZA 1E3IA 1W8DA 4MVJM 3PVZA 4DXHA 5ICSA 6ADHA 1EE9A 2B4QA 1P1KA 3NT5A 4BKOA 2Y0EA 1HDZA 1KVSA 5EINA 2B4RO 3RIHA 4PLZA 2I66A 1VL6A 1HE4A 3JQAD 1ADBA 3ZWYA 2BH9A 2P9CA 3RAJA 1GYRA 1SNYA 4UAGA 3F46A 4GGOA 3NJ8A 4PIVA 2YQ5A 1LU9A 1LRKA 3GF4A 1UXHA 2NADA 1IYZA 3GR6A 3GT0A 4L75A 4H7PA 3GVPA 4OL9A 5G0WA 3WYBA 1T1RA 1EQ2A 5H81A 5G4KA 3LT4A 2ZCVA 3JQGB 3R0IA 1J4AA 4FGWA 3KBOA 1C1DA 1OZAA 2P5YA 2O3SA 3ON5A 1LRLA 2GGSA 4RQTA 5DDIP 4BO8A 5JDIC 3CUKA 3DBHB 2EP5A 3GNQA 1XU9A 3GGGA 3DFZA 3H8VA 2EGGA 3JQCA 2BI7A 4J43A 5DT9A 3WNVA 4O0LA 4Y9DA 2BELA 4HUJA 1KETA 5ADHA 4YT2A 3GAZA 3OJOA 4CLHA 1UDBA 2XOXA 2P9EA 2VNAA 1UXKA 2Z1NA 3AI2A 1K6XA 1KYQA 3ORFA 2J3KA 4HX5A 1ZMTA 1I01A 1PTJA 2C7VA 3INGA 4K26A 1QLJA 5KOIA 3M1AA 1EVIA 2D5CA 4LW8A 2VYVA 1T4DA 4WNIA 4JP3A 2NTNA 3GMSA 4UEKA 4XGIA 3WTBA 1ISJA 3FF4A 2HMVA 4I5DA 4XJSA 4XYBA 3ULKA 4OH1A 1PJ4A 4LVCA 5HS4A 4KOAA 1HXHA 1KY4A 2J8ZA 2VZ0A 2R00A 2DUUA 2X6TA 3X2EA 3AM3A 2VNSA 4GX0A 3OMLA 3LC7O 5JAZA 1Q7BA 5JMPA 4TSKA 1UH5A 1YO6A 2A9FA 5F3RA 3VDRA 1WZEA 1YVEI 2ZYDA 4BNLA 2PFGA 1PJLA 1YB4A 4JP2A 3I9OA 3AU9A 3PWKA 4H3VA 1B8VA 4OGWA 3D3WA 2EW8A 5LDGA 2EERA 1DDOA 4CMHA 1NNUA 3TL2A 1O8CA 3KYBA 1Y5RA 1FJHA 2BGLA 1G0NA 2B5WA 1LDNA 4CLRB 3KSZO 4A0SA 4B4OA 1LDBA 3KHUA 4NBTA 5TJHA 1UXGA 3JD0A 3I23A 4D3SA 4RV9A 4CL8A 1K0UA 4IDEA 5L45A 3K5PA 1ZIDA 2OHXA 2NTVA 4KTVE 4O6VA 4CJXA 1M66A 4W99A 3TRIA 4FC7A 4MVJA 2PGLA 1F17A 1RJWA 4DYDA 2GYYA 4EEXA 1ENPA 4HP8A 1DO8A 3BXXA 5I9LA 4J4TA 3AM4A 3RUFA 3ZNNA 4YBZA 1VC2A 4AJOA 2VN8A 2NVBA 2IE0A 1EVYA 4INAA 3V1TC 3OECA 3JQEA 2D59A 4DWVA 5KJCA 1A9ZA 4L9RA 3LT2A 4BGIA 5I7FA 1PGJA 4RF3A 5JO0A 1ZNQO 1PS0A 1QSGA 2EP7A 2BMAA 4C7KA 4PZEA 5KJ6A 1WW8A 3GDOA 3PIDA 3PYXA 5CP8A 3JQGA 2A4KA 3S2GA 1IL0A 2WYWA 1KERA 4MVJF 4OMUA 3BHMA 3GHYA 3NT2A 4H15A 2AQ8A 3WBFA 5I7SA 2XXBA 3P7MA 5K6AA 3HB4X 4QECA 1ZBQA 3QE3A 4D3DA 3UGKA 2QRLA 5DZSA 1Y8QA 4J1QA 1T25A 1E3LA 4BKUA 4Y8VA 3DZIA 2X9NA 3U49A 2NU7A 2C7GA 2GO1A 4K6FA 4CM1A 2Y1GA 1W73A 3A9WA 3DOOA 1NWCA 4W9NC 4IDFA 2OMEA 3ADPA 3UF0A 3OBBA 5EMHA 3L07A 5JNLA 1IB6A 1TLTA 4LISA 3VOSA 2VTEA 3PPIA 5A3VA 6LDHA 2I3GA 2BGKA 4YJFA 2PA3A 2HK9A 2DTDA 2O3TA 4DPMA 1YE3A 3BHIA 1QRRA 2JD2A 2W4QA 3HZZA 5DF1A 3IJRA 4CV0A 3OJ0A 2NVWA 5IN4A 2NSDA 4XQGA 3IL2A 1O95A 1PEDA 1A4UA 1IY8A 2X9GA 4XZ3A 3QY9A 3JD2A 4P38A 1MG5A 1JWBB 1M2WA 3Q9NA 3WGZA 4EDFA 1CWUA 3ZU3A 2DUWA 3H5RA 1JLLA 1CDOA 4I9UA 3ZHXA 1CQIA 1WPQA 3OJEA 1N9GB 3B6ZA 3R3JA 4D46A 1SPXA 1X0VA 4Z0TA 1KEUA 3CIFA 1HL3A 3FR7A 4UVEA 3ASUA 3EZLA 3L0DA 3WMXA 4CM3A 2HK7A 3TZKA 1NFRA 3R3SA 4GKBA 4HXYA 4LK3A 4Y6RA 3RUEA 5KKAA 3UH1A 4URFA 4AJ1A 4BO1A 3H5NA 3OP4A 4HADA 4IINA 2C5EA 4WECA 3WGIA 3ZWCA 3VPXA 3JQ8B 1YBMA 5JDIA 4ESOA 3ANNA 3I1JA 3Q11A 2ZB4A 4C7JA 4R4JA 4NDNE 4R5MA 2NV6A 4FN4A 4RGBA 3AY6A 4N18A 4IXTA 1MB4A 9LDBA 2Q45A 4B79A 1X0XA 2OBNA 4TVBA 3DL2A 2WEKA 4CMEA 4XWYA 3OA2A 4XRGA 1I2CA 4BB6A 3QP9A 5EPOA 4GMFA 3CPSA 3L9XA 1E92A 2Q1TA 2C20A 2PNFA 4XR4A 1E1KA 2VOEA 4JNKA 4WASA 3WB9A 2V6GA 5A9SB 4RF4A 2OO5A 4IMRA 1SB8A 2OL4A 5L51A 1EEHA 2VWPA 3A06A 5G4LA 3ZV4A 2X0NA 1M76A 4JXKA 4W9NA 4UULA 3W8FA 3PHIA 2V7PA 3E9MA 4ND5A 5GZ3A 1TEHA 3EUWA 3AOEA 5HM8A 1EUCA 3EDMA 1DXYA 3KSDO 1Q7GA 2HLPA 4PRKA 4BNNA 4BO3A 1NHGA 3NDRA 4FSHA 3VZQA 2HK8A 3PRJA 1WMBA 2BFAA 2Q2QA 3AUUA 3W6UA 4DLAA 3KOUA 4FIZA 4IUYA 2HUNA 3INTA 4IIUA 2J5RA 3D4PA 2YYYA 4NHEA 4TQGA 5GZ1A 2P4QA 2J5QA 1I8TA 4NZ9A 3LT1A 3I3OA 1JVSA 3WGQA 3IDSA 4N5LA 5EJ2A 4WOJA 4BGUA 3F9IA 1PWXA 4M87A 4R16A 3UOGA 3WYEA 2BLLA 1PJQA 2X22A 5IF3A 1CETA 4CMKA 4ALKA 3KZVA 4DLBA 1K89A 4BL5A 4IDGA 1Q1NA 1HF3A 4OAQA 2GASA 3RI3A 1QYXA 4A2CA 1EE2A 1H6CA 3F47A 1ZEMA 2Y68A 2CY0A 3DZJA 2A94A 2EF1A 3M6IA 5L3ZA 4GGPA 3DBRA 1QYWA 4RPKA 4AJIA 3MCVA 3OM9A 1P3DA 1N92A 1RPNA 4TKLA 1U2GA 3JQAA 2QZ9A 5B4VA 1DOHA 4YAEA 4WOKA 3RKUA 4CM9D 4NJOA 3BMNA 4M54A 5L7WA 4Y98A 3ZW8A 4E2XA 1DC6A 3B70A 4IJWA 4CMCA 1P1RA 2V6FA 3HE3A 4YYZA 1XA0A 4ALNA 1A4IA 1IOLA 3AFMA 1PGQA 3BTVA 4RVGA 1P45A 2C2YA 3CSDA 3RSHA 1DAOA 4JBHA 1UXIA 4EZBA 1VI2A 1IPEA 5U4QA 4NBRA 1VKNA 3U9LA 5BSGA 3JD4A 1GV0A 1SC6A 2CFCA 4MIOA 4D41A 3HDYA 4TVOA 3BIOA 1WWKA 4R54A 3GG2A 4ONEA 4HKTA 2PTGA 3ENNA 1SMKA 3GDGA 4PLTA 2IXAA 4HNHA 3GLQA 2BKAA 5KJEA 4EUFA 2PKRA 4QTZA 4XD2A 4FJ2A 3VAZA 3A4VA 1JN0A 3O4RA 2DKNA 1NBOA 5KNLA 2B83A 5TJ9A 3HQ4O 1JKFA 4Q39A 3VH4A 1EVZA 4NU6A 1LQTA 2CZCA 4YWJA 4YXFA 1PGPA 1ZSVA 3K96A 1LJ8A 4G2NA 2Q2WA 1GAEO 3ZWWA 1PQUA 3JYOA 5DCYA 4RZIA 2X4GA 3C7CB 4OXNA 2WE7A 4XKJA 1A9YA 1BWSA 2YDXA 3E82A 1PQPA 3PLNA 2E82A 4XA8A 4FBGA 1SBYA 2A35A 2VRCD 4HFJA 4CLEA 2PK3A 3F3SA 1B7GO 4BO9A 5T64A 1C0IA 3D3WB 4E5PA 2RH8A 2VHWA 4Q3DA 1LSSA 3WDSA 3G17A 1U7HA 3VKUA 5JY6A 3MJ4A 1MG0A 3I5MA 2EKLA 1N8KA 1XWFA 3T7EA 4AJEA 5CAEA 4ZGWA 3IC5A 1NPDA 1HZZA 1Z6ZA 1ZUD1 3VTZA 4ZJUA 4A73A 2W98A 1WXDA 4W7IA 5TLSA 1HETA 3IKTA 3AJRA 4BNTA 3T4XA 4JJIA 2O3RA 3R6DA 5C5IA 2HRZA 1NXQA 1U4SA 3BMNB 2VRBA 4IXWA 3JYQA 2I9PA 2OFPA 4W6ZA 1ISHA 1PIWA 1LEHA 3RFVA 1FK8A 3ZV5A 4MKXA 1VE9A 2C5AA 4B8ZA 2D3TA 3RROA 3WLEA 1IZ9A 3ONFA 1Q7CA 4EGFA 4Q3BA 1N1GA 5KVVA 3ZNOA 4D45A 3JQDA 5FFFA 4UEJA 4ZA2A 3BMCA 1QV7A 1DHRA 3P5SA 4TRMA 1JU9A 4R69A 1HEUA 5THKA 4B8WA 1N5DA 2AG8A 3DBHA 3PJFA 3C8MA 3VTFA 4FD3A 3DZBA 2NUAA 1VM6A 4W82A 1A71A 5JAMA 2X1HA 4YQZA 1JKJA 2ZB7A 3F5QA 3QVOA 4J1NA 1EDZA 1XKQA 1Y9AA 1L7EA 3CMMA 4ND2A 1E6WA 3KUXA 2UAGA 2BFOA 2EKPA 2PV7A 1K2WA 5C7LO 4I8XA 3WQQA 1TT5B 1WNTA 3JQBA 2AA3A 1LDEA 4JK3A 3FNHA 3OQBA 3Q0EA 2DQ4A 4KQWA 1B14A 2WYUA 4Q9NA 5DOZA 1D3AA 2NVUA 4K1LA 3RBVA 4EBFA 5JYDA 1BXGB 4DPLA 1Y1PA 1J49A 1X7HA 5BT9A 3GFBA 4IDDA 2UDPA 1KC3A 4B3JA 2Y93A 4CODB 1PL7A 1YL7A 1T2FA 2NU9A 1PS9A 1DRWA 3PI7A 2CDBA 2FY8A 2Q50A 4RO0A 3E9QA 2Y1CA 4KDEA 4LN1A 2GSDA 4DBZA 3LC2O 3KYDB 3WMWA 1AXEA 4OOFA 2J6IA 3PEFA 4CQMD 5LC1A 4D3FA 2O7QA 5JC8A 4ND1A 3BMCB 4TRJA 1P0CA 4B3HA 2HO5A 3I9JA 4ID9A 1DEHA 4AJ2A 3U5TA 3VVCA 4D0RA 3ADOA 1D4FA 3QV1A 4R51A 4WCFB 1HDOA 1BG6A 5AXBA 4PN3A 7MDHA 2CSUA 1H9AA 3TZCA 2YUTA 1LSUA 3WSWA 1RM4A 5A4DA 1LC3A 1YH3A 1N2SA 3GRKA 1DIBA 4NBWA 4OOEA 1NFQA 4GI2A 2O2SA 3M1LA 1ZKMA 5B37A 3DZFA 5GZ6A 4WUVA 5FYDA 1DRUA 4PVDA 1GEGA 3LK7A 4G65A 1PJ3A 3OICA 1H0KA 3SVTA 1NR7A 1BMDA 1E77A 4E3ZA 4CQMA 4ZICA 4WNCA 3ZGYA 5K0ZA 5U9CA 1VJ0A 4RPGA 5FF9A 4IQ8A 2CDCA 1GQYA 5MGBA 3HB5X 4L4SA 2G5CA 1B16A 5I7VA 5IDXA 3RUHA 2HRBA 3ZH2A 3PJDA 3MEQA 1R0SA 3NDIA 1BRMA 1S7CA 1PU2A 4NR0A 3DBLB 4UREA 1G0OA 1D7OA 4MVJE 4QEDA 4ZU3A 4IS3A 3NAQA 5F5NA 4BO5A 1YJQA 1EUDA 4AVYA 3ZCXA 1PJBA 3S55A 3A28A 3BAZA 1EFLA 1U2DA 1UZLA 3LC1O 4UUMA 1A72A 1XR3A 1Y7TA 4YAGA 3FHLA 3PIIA 1U8FO 1JAYA 4XDYA 3ZWBA 1VJTA 4DVJA 4KUHA 1LQUA 4DMMA 2DFDA 4N5NA 1OC2A 1FXSA 1O5IA 4E5MA 3AUSA 5JC1A 4P22A 5A02A 4TRNA 4AG3A 2IZ0A 1PJTA 1ZK2A 3DEYX 1FDWA 5A03A 1KVRA 3SBOA 1YOVB 3L6DA 3QVWA 3HN2A 5GY7A 4RZHA 1UP6A 1YRLA 4R68A 3RCBA 3Q6IA 2P5UA 2YY7A 2BRUA 2JCVA 2O3QA 3FCOA 1BDMA 3NJ4A 5IDWA 2YFQA 5JE8A 5JW6A 1D8AA 5FI3A 2GDZA 4QFDA 5KVQA 4BMVA 3EMKA 1SCUA 2PKQO 5C7IO 4MP8A 1ID1A 3QHAA 1NFFA 1VKOA 1Y8RB 1CF2O 2VYNA 1JW9B 3PQEA 1E1MA 3C3XA 2VHVA 3BMQA 1GEEA 4YT5A 3WS7A 4OKNA 3VZRA 3AW9A 4J3FA 5KIAA 2GR9A 1H6AA 1RM5A 5F5LA 3KXDA 1Z7BA 1BW9A 1ULSA 4FOOA 1XDWA 1HT0A 5CHEA 1I33A 3VDQA 1GU7A 4L74A 4LGVA 4MP6A 4J9UE 1HYGA 4D42A 1FDSA 3JQ6A 4TMFA 1YDEA 2BF7A 2XF8A 4XGKA 3TJRA 3WSVA 2J3IA 1ONPA 3V8BA 4BIIA 3ZW9A 3H2ZA 3UCFA 2VRCA 2QW8A 4QUKA 2GRAA 3VH1A 3U62A 1LDGA 4OSPA 3G3EA 3GN1A 4PGFA 4AJLA 4U6QA 4CQLB 4OIMA 1B3BA 2VYND 2G0TA 1H2BA 4PG7A 3FR8A 3KRTA 3EC7A 4PZCA 5BSFA 1HDRA 1T24A 5TQVA 1H5QA 4UUNA 4XQCA 3KEOA 4R1UA 2W2KB 3PYLA 5JCXA 2Z1MA 4OYRA 1Z74A 1PL6A 5G0VA 2DTXA 1C1XA 1HKUA 4OSOA 4FJ1A 4A03A 2J5KA 4PRLA 5TT0A 2PGJA 2Y0DA 1M75A 4YT4A 3F1KA 3VHRA 1DJQA 1PS8A 2JFHA 2IDZA 1TI7A 4RQUA 2Q4BA 2RHRA 3AI1A 1V6AA 4RLSA 3UN1A 3ETGA 1GDHA 5HRUA 1BW9B 2V6BA 4XR9A 1M6HA 2C0CA 2Q4EA 1QMGA 3EHEA 4YJHB 4W4TA 4DTIA 3DMYA 1RWBA 3MWEB 3CH6A 2VUSA 2I65A 1F14A 1IUKA 3QWHA 5F1PA 5JO9A 1C0PA 5JMWA 3IMFA 3U4DA 1DBVO 2JL1A 3AY3A 1EZ4A 4GX1A 3PFWO 3D7LA 3GK3A 4O1MA 2ZCUA 3PTZA 4TWRA 3X2FA 2V6MA 1P44A 3GNTA 2I76A 1R4MA 4WCFC 4DUPA 1IHYA 3DHNA 5JFOA 3VPHA 3VH3A 1Q0HA 2HKIA 4IS2A 4RCVA 4E31A 1DIAA 1ZO8A 1F8GA 2PKQP 3RU9A 5I8WA 1BXZA 3D1LA 1AN9A 4ZQGA 3BTSA 2Q3EA 4P8RA 4YDRA 4Z3KA 3KYCA 3ETDA 3GEMA 4UVHA 2EKQA 3O03A 1HE2A 1ZSNA 4IDBA 2ZQYA 2DPHA 2LDBA 3KETA 2PWZA 1BXGA 3U09A 3SLKA 2P68A 1HDCA 2WE8A 3GVXA 4FFPA 4M55A 1ZVMA 4E2ZA 4NBVA 2FN7A 3QLJA 1NAIA 2O50A 3PYMA 3GY0A 3I9NA 1V9LA 4FFOA 4IMPA 1MV8A 1J6UA 1DIGA 1U1IA 2ZTLA 3L77A 4RF2A 1CIVA 2IRWA 2HQ1A 4CLRA 4J7CA 2JD0A 4PZDA 2IODA 2EJWA 5JSFA 1ZW1A 2BGMA 2LDXA 2ZYAA 2X5KO 4OXKA 2X0RA 5IAAA 1MX3A 1XGKA 4BMNA 2DLDA 1J0XO 4MOWA 4P4LA 2PD4A 3Q2KA 3QJ5A 4BQPA 2YHUA 3DZGA 4GPD1 4WLVA 2NACA 4IBOA 3AY7A 1MP0A 4HV4A 2JJYA 1Z45A 3PXXA 4CLDA 5CPBA 4IGEA 4BO7A 1SOVA 4R1TA 2PLAA 2VHYA 1B3RA 3I9KA 4JJFA 4R1NA 1P31A 1V35A 5L4LA 2GD1O 3GZNA 1MC5A 3JQ9A 3DFUA 1ADCA 3PZBA 1LA2A 1LI4A 3BYZA 3IIEA 3ROPA 1FMCA 2DBQA 4I5FA 4DC1A 1JKIA 2RCYA 4IQGA 1I3LA 1QV6A 1YL6A 1ML3A 2AEFA 2EHDA 2Y0CA 1AHIA 1DLJA 4IJUA 4R01A 1KC1A 2B0JA 4WLOA 5ENVA 3T7CA 3G49A 4B7CA 5CDTA 2Y1DA 3BA1A 4CMGA 1N7HA 4KUGA 3DO5A 3G1TA 3RASA 4JBGA 3WICA 5I9NA 2AQHA 1P1FA 1EBFA 3C1OA 4FW8A 2VT3A 4N54A 1Z75A 3PQDA 2GN9A 1C1DB 3UXYA 5BNIA 3CE6A 4LSWA 2E6UX 3PGJA 3FTNA 4CR8A 1U4OA 1WAMA 2FR8A 1BXKA 3PHJA 4TROA 2VWHA 3FI9A 3S2EA 4RVDA 5CFZA 3NV9A 5AXDA 1DC4A 3QVXA 5GMOA 4D44A 1ADFA 1ZJYA 2QQ5A 4PLFA 4DBVO 3KLPX 3H7AA 2VWGA 5TRTA 4PLHA 4II3A 5CEJA 2IEDA 2YJZA 3HWRA 1JA9A 1I3MA 4E4YA 1I10A 3NDJA 3PHHA 1T2AA 3OH8A 5C3MA 2Q49A 4KP7A 1LRJA 2QYSA 3KYCB 5BNTA 1R37A 3FPLA 3G1UA 4J91A 4GVLA 3H3FA 4B7XA 3A1NA 3INRA 1P0FA 5KJ1A 1RKXA 1YBVA 4XJTA 4FB5A 4MKRA 4CM4B 3E03A 1WLYA 3LVFO 4RDHA 3V1UA 4ZD6A 3GVIA 3ZU2A 3K6JA 4AJPA 3FSRA 4U7WA 4BNGA 3LSYA 5BSEA 1H6DA 4CMIA 3I52A 3FTPA 3LU1A 1SO8A 4YCAA 3S2IA 2PR2A 3H3JA 4F3YA 1K6JA 1GY8A 1P1HA 2OBYA 2VOJA 4OO3A 4K9DA 4ND4A 1LLQA 3K92A 1NHWA 3ABIA 5ENDA 4BUCA 5H83A 1ENZA 1T2EA 2X0JA 3GUYA 1S6YA 1XHLA 2Q2VA 5JDCC 1UDCA 2DPGA 2O4UX 2Y99A 1R66A 3V2GA 3ZV6A 2WMDA 4ZQHA 5A04A 4IIVA 5B4UA 2B36A 2BI8A 4LMPA 2CF5A 3EYWA 1ARZA 4MVJI 3PHLA 4GVXA 1ZJZA 2ZTMA 3EVTA 3M2TA 4J2OA 4NBUA 3P2OA 2GN6A 1N9GA 1B2LA 1R12A 5A9TA 3JQFA 3E18A 2P2SA 2J3HA 1U7TA 3VPGA 3OIGA 3HG7A 1L7DA 3LF1A 4YB8A 1H2HA 1ZEJA 1C0LA 2P9GA 4WCFA 3DZHA 1LX6A 3RUCA 3ZV3A 1YKFA 1AE1A 2OGUA 4J9VA 1LC0A 1U3VA 4P4NA 1GR0A 3ANLA 4WLEA 3FD8A 4JQCA 3GDFA 1R6DA 4YJGA 4CUJA 9LDTA 3PGXA 4KZPA 2RH4A 1KVTA 1GZ6A 4CMIB 4YJFB 1T1SA 4LRSB 3PWSA 1QYVA 4BKQA 4EEZA 3IKVA 4GAEA 1WDLA 3KYDA 3ONDA 3PZRA 1MXFA 4NMHA 2R6JA 5T57A 5A05A 5BSHA 4BNJA 5CDUA 2AE1A 3FBTA 2D1YA 1XYGA 3C24A 3L6EA 4GL4A 3ROMA 4BKRA 1KVQA 3NGXA 4HFNA 3RFXA 4D7AA 4QQRA 1NASA 3DAPA 5G4KB 2AQKA 2OP1A 2WM3A 1NVGA 3ITKA 3W4IA 2ZIZA 4Y6SA 4YR9A 3HDJA 2OORA 3AUAA 3E8XA 3Q2IA 5BR7A 3ETEA 4RORA 1D1SA 4PLVA 1T26A 2FOIA 4RVUA 2QRJA 4Z9FA 3WOHA 3WNQA 4A27A 1PJ2A 1AHHA 3D5TA 4WEOA 2YW9A 4I08A 4XGNA 2QZZA 3KTDA 4EITA 4L8VA 3ICPA 2YDYA 5TNXA 4RVFA 4F6LA 2O48X 1H93A 3BHJA 1BHSA 4ZQBA 1CRWG 1ENYA 1HDXA 5CEFA 3JV7A 4EUHA 3UCEA 3GEGA 3PFFA 4JN6B 4ZQEA 3OQ1A 4JBIA 3RKRA 5G0TA 2W2LA 3DHYA 3VC7A 5C37A 3RBZA 1HWYA 1Y81A 1L1FA 3K30A 3FNGA 1QLHA 1E3WB 5COBA 1A27A 4GQAA 1U3UA 3C85A 3DTTA 1P74A 4N5MA 4YJGB 4J2HA 2WWRA 5IJZA 3VZSA 1FDVA 3H6KA 1LLCA 3ZNPA 2ZTUA 4LCJA 1CERA 1X7DA 3PQFA 5DCUA 4E0BA 3CZMA 1B8UA 2IYOA 2JFGA 5KCZA 1KBZA 4Z3DA 4F45A 3STHA 2YV2A 4YT8A 2CF6A 3CXRA 4PCVA 4XIYA 1CQJA 3WQRA 4L4XA 3KV3O 1BVRA 1V3TA 4M49A 5AVOA 4MVJD 2HMTA 4HBGA 3NTOA 4I9NA 1DSSG 2AMFA 3DMTA 3JQAB 1XEAA 1R15A 4FCCA 4FR5A 5CPFA 4E21A 1E3JA 3SLGA 1GPDG 1ULUA 3ZHBA 1E7MA 3DBRB 3K2BA 1I2BA 5JYEA 2NLOA 1E6EA 2H6EA 2ZYGA 1E7SA 3L4BA 4WLFA 5LDHA 1FDTA 5F1OA 2B5VA 1C0KA 5EIOA 4UUPA 1YQXA 4J49A 1NPYA 1PX0A 2PH5A 4R9SA 2H9IA 3PJEA 4YRAA 3I4CA 3WWYA 2NQTA 2NM0A 3B20A 4WCDA 5F21A 3GNSA 5EN4A 2GZ1A 3KSUA 2D5AA 4O59O 2JKVA 5ICMA 4PG6A 2FPGA 3OEYA 4FPXA 4GWGA 1UP7A 2VHZA 3MOGA 3NTRA 4YAJA 2W8ZA 1JVBA 3JYLA 4GX5A 2OUIA 3U4HA 2DT5A 2F00A 3CINA 2R2GA 2I6TA 3QRWA 3AU8A 1PWZA 4NPCA 5H82A 3WGHA 5CDYA 1P1IA 2D4AA 4MINA 4A26A 2GCGA 3OHSX 1ONNA 1HE5A 4QO8A 3B1JA 2HSDA 4DQVA 3L4SO 3VPSA 1U8XX 2RHCA 3DZKA 3JSAA 4MDHA 3S2FA 4AFNA 3QWAA 4BB5A 3MTJA 4YAIA 2Y05A 3HDQA 4AJHA 4B4VA 2AEMA 1QKIA 2FSSA 3JYPA 3RBXA 1VL0A 8LDHA 2FSVA 3DR3A 1NVMB 4NFSA 5T8KA 5BQFA 4J1TA 3RUDA 1D1TA 3AFNA 1E5QA 2NU6A 3FPCA 5CDSA 5IDQA 5KWEA 3NTQA 4PG8A 3FNEA 1DRVA 4PFJA 5TSDA 2VUTA 2QX7A 3WYCA 4B7UA 4M86A 3SC4A 2BFPA 1UZNA 2WD8A 5J23A 1DFGA 1UXJA 3HN7A 4NG5A 5EESA 5TGDA 4AJNA 3RC1A 4QO7A 2FRDA 3KB6A 3V1YA 3K31A 5ITWA 3LDHA 4P4GA 1I30A 4J4BA 4XCVA 4Q3AA 3GN2A 3GVCA 3W4JA 2I5PO 1LNQA 4BMSA 4BO0A 3GPDG 4CV3A 4FOSA 1B8PA 2C29D 2AE2A 3GRPA 3ZHZA 4NJMB 4IDAA 1YJ8A 4OKIA 1UP4A 1A5ZA 2HJRA 2W2LD 3KEQA 5TC4A 3ZDFA 7ADHA 4XYGA 2I99A 4E6PA 2VZ9A 4EJ6A 4NFYA 1T4BA 4EUEA 5IZ4A 3GQVA 3TZHA 2Z5LA 3PWZA 4DLLA 1UAYA 4XIJA 5KJFA 1Y5MA 3HHPA 3N58A 2X0IA 3MWDB 3QWBA 1QYDA 2B37A 1KOLA 4GSLA 3O8QB 4JGBA 1MXHA 3P2YA 4Z9XA 5A5EA 3FRJA 1OI7A 5JS6A 3RC2A 1I0ZA 2GLXA 5ILGA 3H9JA 3WJAA 2EXXA 3GZ4A 2EEZA 1HE3A 5DBFA 1KEPA 4XQEA 4Q3CA 3ZWMA 1PJCA 1NR1A 3O8QA 2EW2A 5I9MA 4EYEA 1HDYA 3WBBA 4RL6A 4FGSA 4LCEA 3RFTA 1DIRA 3SJUA 3ZHYA 1WMAA 2X5JO 2FR0A 3IUSA 1PR9A 3DTYA 1XCBA 3FWZA 2EIHA 1JAXA 2YQ4A 4ZVVA 4A7PA 5A9RA 3I6IA 1Q2XA 1LXCA 4YRDA 4U0JA 3AWDA 2W90A 2Q1UA 2X86A 3DB2A 1MFPA 2AXQA 4NK4A 4HNGA 2O4CA 2GN4A 4OQZA 1QG6A 2ZB3A 3W8DA 4Y67A 1BSVA 4RVSA 3WQSB 2HJSA 2CNBA 2V65A 2NQ8A 3OSUA 4R41A 3VPFA 3B1FA 4E5KA 3SX2A 1IHXA 1T2CA 5L95A 2O3UA 3W6ZA 3SXPA 4O63O
chains in the Genus database with same CATH superfamily
1TE2A 2UUPA 2OFXA 1EP3B 2YC2C 1KRWA 1KPGA 4U6SA 5J47A 4BNWA 4L2IA 1OY1A 1NVXQ 1T6ZA 4Z49A 1BFUA 1Q1GA 4GSYA 4MRSA 4HDSA 2VCYA 4MRRA 3PE4A 4AZ0A 1RAGA 4U5QA 4MEBA 1NVVR 3K0AB 1N5JA 2IYTA 2JHAA 2PY6A 3EXHC 1N6OA 3BCHA 1OWMA 4JYCA 2B1RA 1Z4IA 5EJ5A 1CFJA 1LBEA 3K9CA 3AR6A 4NE7A 2K2WA 4MW7A 1F7VA 4TZ6A 4KO4S 2X0EA 5BV1A 2H2GA 4TMWA 3SC6A 4Q05A 3G6KA 5IK2A 3UUWA 2JGDB 3NRCA 5BSMA 2C03A 5JLAA 4D3ZA 1L2TA 4JSYA 4ND3A 4KRFA 2AFHA 1OC4A 3IEPA 3ELYA 2WFMA 4PAWA 4C0KA 2O9JA 4DIFA 5ALUA 1T6XA 3DVAA 4AAYA 3FA2A 1ZK1A 2W2TA 3DW1X 4IDQA 2HNBA 1NRIA 2PBFA 3DQZA 4WKGA 5GGXA 4B81A 1X13A 4FI3F 2YZKA 3G0DA 3GIDA 2P62A 2P4HX 1P2VA 4G97A 3NYWA 1YOBA 4DDUA 3OQ6A 4N03A 1SXPA 1U9CA 3UVEA 1J5PA 2Z3WA 3IVMA 3A1FA 3SG0A 4CKWA 1ZSYA 2XD9A 3ZU4A 3KB1A 5BSKA 1KS9A 1T5TA 3L7JA 4WAUA 1QIKA 2FN8A 2M1XA 2FE1A 4BX2A 4ZAYA 2BM1A 4ZYXA 4RJTA 5HFAA 2IWHA 1Q0QA 1PJSA 4HZUA 3LWDA 4F11A 1N5IA 3FDZA 4NF2A 1EM8A 4EVRA 4M8SA 5AW8A 1SWVA 3DE7X 4CCYB 3ZBTA 2DSTA 3Q7EA 2H2HA 1MDBA 1CY6A 1PWHA 2ZYSA 1SKYB 2ZAGA 4YEDA 1GTRA 4IF6A 1F4PA 4IO1A 1RM0A 3PJGA 2BFMA 2QVBA 1M5TA 1JLMA 4EHDA 4KSBA 5EKXA 2ZS9A 1TAHA 4ARBA 4NJMA 1ZD3A 2X8LA 521PA 1FTGA 1XMOB 1K4KA 4OTZA 2PG3A 3OCCA 5DBEX 2F1JA 1G2PA 3U3JA 2RGRA 1TCVA 3WHPA 4MAAA 1IBKB 4L5IA 3IE1A 3HKBA 3K0EA 2ZSIA 1RKBA 3KAQA 4TL6A 4U9HS 2VUUA 4AKHA 2D0PB 3OX1A 3MELA 3RVJA 1XMVA 2H11A 2OGWA 3P2IA 4HS9A 4KJZA 1MX9A 1SZCA 3BF8A 2R1TB 5F1KA 3H1EA 5HE9A 1FFYA 3KD3A 3X1DA 3GLKA 1XIVA 4KBFA 1TOAA 4DV2B 3FBGA 5LQUA 1SURA 2BFBB 3HY3A 5KTKA 1HYHA 3TIVA 4X85A 2V55B 5FOWA 5K0GA 2ZI9A 2O2HA 2WJGA 1WDKA 5DTJA 3W4KA 5CBPB 1ISIA 2VT6A 1R18A 3LL4A 1A96A 4NIMA 5EIAA 5J59A 4F6RB 3VVBA 3QEKA 1SA0B 2Y4NA 1A8UA 3EFHA 4K05A 5DRTA 1W59A 1V11A 1JXOA 4PZYA 1YB1A 1CUCA 3P0RA 3ZIAA 3G82C 4FU0A 2X3FA 1E8NA 4HR7A 4MWOA 5FBVB 2AZDA 3AFIA 3GRUA 4WHMA 3BWXA 1V1MA 2YYSA 4CKYA 5JD6A 2IPOA 1QYCA 1DC5A 3BOSA 4E13A 4QOHA 4UUOA 1JDPA 3IV6A 2YHIA 1R2QA 2A5YB 1NOJA 1AGRA 2PVCA 4KLAA 5K01A 3A9RA 2VDWB 2YH2A 1SC4A 1M34B 3H5WA 5KKCA 1PZFA 4BS9A 4UDOA 1ECFA 1XTRA 2B94A 2WTMA 4H77A 4PNPA 5EWLB 1SRRA 5BRJA 5KNDA 4FDAA 3EPRA 2P9FA 2DC1A 1N8TA 3O3MB 4DDHA 4NYIR 1NE2A 3KEMA 2P91A 1XMQB 2NNLD 2NGRA 4XLTA 3UICA 3G13A 1DLIA 1VPDA 3IS3A 5MDHA 4RPCA 2J4DA 1T8WA 2P5TB 1BQ3A 2GZ2A 2E48A 3BTOA 4URZR 2DBRA 4EW1A 4JL6A 4UZSA 3D7NA 1DRJA 3VH2A 3GFGA 2EZTA 2ZPAA 4GR5A 3H9EO 4MRPA 2HEGA 4U8HA 4IZ6A 1EUQA 3L8DA 1YZHA 5L7YA 2V3VA 3L06A 4C2TA 3THOA 4DR2B 1JA1A 1JWAB 3LCRA 1HEIA 4Q4DA 3DHEA 4MPPA 3WFIA 3WLIA 2VYFA 3BULA 3KJIA 1X7WA 2ONZA 3DZCA 4UARA 5I9TA 4CDNA 4JLBA 3HCDA 3GYGA 2RI1A 2KB0A 4Y2SA 3CZQA 1ZNZA 1NTOA 2LP4Y 5J40A 4DQKA 1TMYA 2PZKA 2Q28A 3BZBA 3H2BA 2OA0A 3X1WA 4BAZA 1DG9A 3KNZA 1A4RA 3B12A 2A0YA 5E3IA 3I2HA 5H02A 2FWMX 2ZTHA 3KPYA 3Q12A 4F2PA 2GAFA 4PLPA 1BVUA 4M60A 2PPVA 5G0SA 5AXAA 4EB3A 4OREX 3GGDA 4CMAA 3D8NA 4GLOA 4IQ0A 1ODIA 3PUVA 4ALJA 2ZRHA 8ABPA 3EIXA 1UKAA 3GFTA 5FTWA 3U6KA 3QFSA 3IUBA 1WDMA 2Y92A 3HGMA 5KYXB 4WINA 5LQNA 2YJNA 1Z8NA 1B0AA 1A2QA 1Z39A 4PLWA 4AO8A 1NBHA 4X1OA 5D3MA 1J2EA 4D82A 1CC1S 1W0KD 3IDQA 3CVYA 3I62A 4DM7A 3VTAA 1DKPA 4EMTA 2WYHA 3E9EA 5SY9A 1XE3A 3WLLA 3K0CA 3DAYA 4ENRA 2QQFA 1BGXT 1KAEA 5JS8A 2YFKA 5ISMA 5CCXA 4G5OA 1SVUA 4E2FA 2GNAA 4MUXA 3H5LA 4MYTA 1W30A 5A06A 3IIKA 4BP1A 4ENVA 3L7NA 1A9PA 3FNRA 4TM8A 4H16A 4WK4B 4ETWA 4OP2A 5TF0A 1JQJC 3ZJ5A 1IHUA 1N1EA 1VI6A 5KTRA 5KVSA 5JNSA 4Y0AA 3WE7A 5EUQB 4AF7A 2LR0A 1TXGA 4JC4A 1UJ2A 1OT5A 4BLRA 1WXHA 1Y33E 1I5RA 5IABA 1IAQA 2AMLA 2PX3A 4EG0A 3LG2A 5I7EA 2QEQA 3KCQA 5CD1A 1GPWB 4I3GA 1LDYA 1C9NA 1ZUIA 2XIQA 2JCYA 3TL3A 3WGYA 4B4DA 1OYYA 1RMTA 2PJZA 3OM0A 1CDDA 1MRZA 4EUNA 4N0EA 1OVGA 2YOHA 4ALLA 1IQ0A 4HY3A 4RAOA 4M22A 1A8PA 3DL4A 3IMEA 1PK8A 3HU5A 3EH2A 4UMEA 1JEAA 3UJBA 1DMSA 5CX1A 4BLOA 4KVGA 3HXTA 3ZXXA 4LF7B 1A50B 2E4ZA 1Z6GA 2GPTA 1Y42X 1HLDA 1N2EA 2HSEA 3L1IA 1ZQ9A 2COKA 2G04A 2JLWA 4BO6A 3IAXA 1K5HA 4LF8B 4ZRDA 4UEOA 1YIAA 2XUFA 3ASVA 1JJIA 2WTXA 1UMBB 4PSKA 1ZMOA 4DSUA 1XOIA 1SCQA 1F2UA 1Q3TA 5FOXA 3G5UA 3CX3A 4Z9AA 3RRZA 4CM5A 1QONA 4PGMA 1U98A 1V37A 4LEIA 4OIFA 3AOEC 3EA5A 1IEQA 4MKGA 5C52B 1QGAA 1GPJA 4YAFA 1O94C 2YWXA 3MRVA 3DL0A 3FIUA 3DUWA 5JSZA 2FH5B 4JJ7A 5FPPA 3U7QA 1GL6A 4WK2B 3DDWA 4NDAA 1OX5A 1X7GA 1ZZGA 2TMYA 2QAIA 3QFFA 3RARA 1CG6A 2Q5HA 3MGCA 1DAKA 3V7YA 1AUVA 4NS1A 1IN1A 3QWFA 4REMA 1T1IA 3B60A 3IOCA 3C70A 3LWZA 4R2KA 5K0NA 1XRNA 1ZGHA 1F1BA 2HIMA 3E7XA 3KM0A 3PQ7A 2LBPA 3AVQA 3H8WA 1NVDA 3TEMA 1AQUA 2CXOA 4FSXA 1E2FA 4YCJA 3COSA 1OWOA 4EYQA 3S40A 1T9ZA 2PRIA 2AEJA 2Q3MA 2F1RA 3DZ8A 3O9ZA 4J7XA 5GWXA 4E33A 5D00A 1G59A 4DWOA 4LMRA 3TZ6A 2VXYA 1VLHA 3RU7A 2XJ9A 3D4OA 1D4OA 2WNSA 3IR5A 4FZ5A 4BLSA 2GA9A 3CY6A 5DHTA 2ADMA 3FJOA 4LUCA 1Z5NA 3NIBA 4I2NA 4IV5A 3F6YA 1H0SA 2ETXA 3L1UA 4KSCA 1GQSA 1SXJC 1NRWA 5DNUA 4WFQA 1DFIA 1ISFA 3DJFA 3KQTA 4KSYA 4PWZA 4ROSA 2JCSA 1CUDA 2J46A 3LP5A 3QX8A 3DBLA 2D2IA 1MO4A 3UT5A 1PSDA 2HNAA 4O8CA 1T9DA 4OXYA 3UT5B 1BE1A 2C54A 2BFCB 3E7FA 3BCRA 3FNIA 3MHPA 2HV9A 3GD5A 3WRYA 5JBIA 2JA1A 4CNBA 3PSAA 3SU8A 4M89A 1NW6A 1P8AA 2ACVA 3T1OA 4EYSA 4W9MC 1X7XA 2VYVD 4DIOA 4E30A 1TO2E 3QE2A 1N4DA 3S99A 4L3OA 4F4DA 4FS8A 3RHZA 1XV5A 3W1VA 5LD2B 4IF4A 4Q03A 1HORA 5JY1A 4RJKA 4HWOA 2GHQA 5B57C 4DNQA 1NXXA 1Z7EA 2OY0A 2XYVA 3AJDA 3KD2A 2AJ8A 2I3AA 4QWWA 4I5EA 1GLGA 4RWEA 4WGGA 4KQGA 4YJ3F 4JSRA 4MYRA 4D3XA 3TGLA 4FYJA 2GBPA 2XBLA 2IHVA 4M46A 4BWYA 3KLMX 4YP9A 3H86A 4J0IA 1NTRA 3EGOA 4FLFA 1ATIA 2J3JA 3H0EA 5EPUA 5F64A 1JNXX 2IYAA 4K87A 2DCUA 4MZXA 1E9FA 2DHRA 2EJUA 2QTZA 1U65A 1WSDA 4UPVA 4KPEC 4RVHA 2AQIA 4EJMA 4MO2A 4B71A 1BDHA 4LF4B 1ABEA 1E58A 2FU5C 2ODWA 3RGWS 4B47A 2H08A 1PD1A 5G02A 2J9FB 1GUFA 3C6MA 3AXSA 4PFQA 3EXG2 4WXPA 2I87A 3B5EA 4BU1A 1A8SA 2IY9A 3MINB 4L4ZA 4MJLA 5E7QA 5JCPA 1KRXA 1OD6A 2I6QA 1XRQA 2Q1WA 2FPUA 4MULA 4BNFA 1WHSA 1NOKA 3ROEA 3EPLA 1HSOA 5GOTA 2OZLB 4RNCA 4IJKA 1VE5A 3C3AA 1ZD9A 4QSMA 1DKNA 1AF4A 4L0QA 2V7EA 3ITEA 2VJLA 1MC8A 3JQ8A 1HFKA 2JGRA 3M9XA 4DNXA 2V7BA 2B8EA 4FHCA 3LUAA 5D3KA 3KOMA 2B3TA 4DZRA 4CEHA 3IAM6 1CJTC 1NATA 4KR9A 1F6DA 4UCQA 3MD0A 1U5AA 2EGUA 2FJPA 2OO7A 2A9PA 4C5BA 4REOA 1J2RA 4QEKA 5CT8A 1BS1A 2DR0A 4JBXA 2Z08A 2IYFA 1NSYA 3PP8A 2CKDA 4ARZB 3E5HA 3D6FA 4X1IB 3SK0A 4IOMA 4Z1MD 1MGOA 1K8YB 4B33A 3UHAA 4WRRA 3RJ5A 1ZN9A 5DHQA 3RJ9A 4L0DA 4FN5A 3JQQA 4BV2A 1EMDA 5L4NA 2NU8A 5G0UA 1N36B 5DBGA 2A9RA 2FGKA 3OQJA 3UB3A 1I4LD 3L4BC 2BBWA 1MO3A 3MCZA 3VISA 4AULA 3FWPA 1E1NA 2PX2A 1ABBA 4QYTA 4YV2A 5D1NA 1GNPA 3QJYA 4YLYA 2ESRA 2W2PA 3NM4A 4ZAXA 1O87A 1YI0A 3DKVA 4XJXA 3ANXA 3LUBA 3L0SA 2HHLA 2Z09A 3ZWQA 1OKKD 1PZXA 2I2CA 3P9QA 2NYUA 4KIJA 3BVPA 4PG5A 1VG0B 3FUTA 5D7BA 4F71A 4ZV4A 1KJYA 2E49A 4Y2HA 1QF7A 2JFFA 1ZX1A 3DWIA 3UBTA 1XELA 5B4TA 2WHXA 3I2GA 4L5CA 1FIUA 3FWYA 1O5OA 3AKCA 3L4EA 3GGJA 1KI8A 5I6DA 3PEWA 1HTBA 4AQYB 2E4UA 2X7HA 4WZBB 4NE9A 3P2MA 2FA9A 4KK3A 5EEHA 2PUHA 2ZUUA 1CEQA 2BDTA 3LO5A 1DX4A 4HNTA 4CVNA 1ZG3A 2IA5A 1E7RA 3G85A 5LBIA 3FYCA 4BZQA 3NBMA 1NLFA 5KI6A 5AP9A 2G17A 1YZ3A 1J5XA 3URKA 5J4KA 3GBPA 4KRGA 3PDCA 3Q7SA 3HZHA 1MEEA 2Q46A 5LYJF 1EK6A 3B9QA 3G0OA 3PUYA 1JG7A 2YVUA 4JCCA 1MLDA 5DULA 5SZHB 4BMYA 1TRKA 4D43A 2XY4A 1HDGO 1E7WA 2Y9PB 1A9RA 1HDEA 3EEFA 4MK4A 1NYLA 3FLBA 1OZFA 3ADCA 1ES9A 2TMGA 5GPBA 1HI9A 1PT7A 2FYTA 1SXIA 1T0JB 2DVMA 3TKLA 1VA4A 4EB8A 3FSGA 1RQLA 4TMYA 3CRVA 3HFRA 1WCIB 3OIFA 5P21A 1UBJS 1YS4A 2VDQB 3H9GA 4RMGA 4F9FA 4M7WA 5H7XA 5BW4A 4L76A 3DNPA 3A3YA 3AF0A 4GMHA 3LY5A 3JRWA 3N0XA 1BJTA 2X42A 1R5OA 2ZIVB 2O07A 5F52A 4K8RB 3G1WA 2F48A 1AZSC 2C77A 1FL9A 4OHUA 1EXMA 2VPZA 4ZCMA 2BHSA 2CCGA 4M6WB 3OWXA 1ZXBA 1ODFA 4LZWA 1X2EA 1UZAA 1R0KA 5CX1B 4IEIA 1NKSA 4K28A 3Q0IA 4M9QA 3S27A 5BR4A 1G5HA 3BKWA 5C9ZA 2J0UA 3GFSA 1KZ4A 1MKYA 3SC2A 5BQXA 3LTNC 3K09C 1YOVA 2GUGA 2XHEA 5FA8A 3UWDA 4BC0A 2H4WA 4H7DA 2JFBA 3K73O 3QPCA 4X71A 1DXOA 1GZVA 1N1DA 4WWHA 4YJHA 5JEDA 1MFZA 2RGUA 3KZKA 3S8MA 3K6SA 3FJYA 2YV3A 3PLRA 1AOXA 1U7UA 3LQYA 1CYDA 4MQ6A 3LYHA 3E61A 4BLUA 2NXNA 3E2IA 4YRPA 1G38A 2O0HA 4H31A 5ALIA 3UXHA 4O4JA 3V2UA 3CW8X 3RC9A 3TMKA 5DTQA 3KKPA 1F2DA 4BO2A 3RVSA 1ZU4A 5L4SA 2VAXA 4D9FA 3B85A 5AJXA 4NU0A 4FFNA 4WKNA 1CB0A 2L0XA 1W49A 2FZVA 3OO1A 1K7CA 1QO9A 2PN1A 4MICA 1N7GA 1QH8B 3KQMA 1ZUNA 3WLNA 3K2IA 4GNKA 2YC4C 2Z4TA 3HC7A 3H4TA 4X5OA 3ZWOA 2VWQA 1YL5A 3PXEA 4D0GA 4D6YA 3MWKA 1K06A 5K9ZA 4PSVA 4ID3A 3QSGA 4IY1A 1NOIA 2HSJA 2UVDA 2UYOA 1OASA 3Q8WA 3ZR4B 2AS0A 1UBHS 4JKYA 5CW1A 2L2QA 2QTNA 2ZRLA 2QORA 3UTDA 3EXEA 2DAPA 3SAJA 4HAIA 3VR2A 4M37A 3V4PB 2DB3A 1OXUA 4C43A 1RT9A 4ILKA 1TVKB 3AT1A 4GHWA 5CIQA 3EEQA 4MMYB 3AP3A 4X7PA 1Y6JA 4O4IA 1QR2A 4Z4IA 1T10A 2X41A 2X4LA 3IO3A 3K1AB 5E6SA 2JI6A 2XE4A 4J0HA 1AH2A 3GEPA 1Z06A 3T95A 5DNAA 2ZT5A 4INPA 3JVDA 3H5AA 1YKSA 1KQFA 3S1SA 2CV0A 3U4CA 4CLXA 4X6UA 3U3ZA 1U0SY 2JZOA 3HABA 3LXXA 5EHGA 1OBFO 4PC3A 3VAYA 1KJZA 1X39A 4D9IA 4YO7A 5LQAA 4G01B 1CJUC 2R7MA 1KZ6A 4D56A 3D1VA 2EJVA 3F98A 4JYAB 1WUIS 4Z8XA 4JZYA 4LYDA 1KI3A 5BPFA 3DDOA 1S8NA 5CLIA 5FA6A 1HTWA 3MIIA 1DWUA 1RJDA 3HJBA 5DM70 1QDLB 5JXHA 1X9IA 4HLUA 1R0LA 3KZ1E 2AW5A 2IYWA 4NBSA 2WVJA 2Z95A 4Z5XA 1AC5A 4HS4A 4LOKA 2ISCA 3LA6A 4IRXA 3WAGA 1O89A 3GBVA 3GPIA 1BMTA 4PPFA 4GNRA 2POQX 5FBHA 5EP4A 1YZTA 4KHZA 1H5UA 2YL2A 2VHXA 3L9WA 2JHPA 4JASB 3AFHA 2J07A 3TN7A 4QPDA 2HW8A 4X66B 2F1IA 3CEAA 2OBFA 1C3OA 1ZNXA 2XB6A 1DBRA 5CFNA 4EFLA 3ZKWB 3UW3A 1RLJA 1JH8A 1IE3A 2GHTA 1M1YE 2HF7A 3AOGA 3J7TA 4LRTB 5DX0A 4C7MA 1RYNA 5AW0A 1ISMA 1CV2A 4J0EA 3ECCA 2F3TA 2Y6UA 4PYLA 2MR6A 2HJGA 1SQ5A 3DH0A 4PR3A 5K5EA 1JA0A 5ED4A 4J1SA 2FFRA 3GEDA 3PDUA 1MA3A 4QOGA 4PNZA 3HXPA 1A5TA 2KS6A 2PQ6A 5U4XA 3TO5A 3DE0X 1XMIA 3RUPA 1QJCA 3FYUA 3MGGA 4F97A 3ZDDA 4YA6A 4HRVA 4QX6A 4FGKA 1SUWA 3ZKWA 4G4SO 1YXMA 4EHFA 4L73A 3HKEA 4RYDA 4IJVA 4QYIB 2YIJA 5CHYA 3BWMA 2EF0A 1NJ6A 4RESA 5C8VA 4MCAA 4DCSA 4TSFA 3KQLA 4L16A 3GJ3A 2VUIB 2CL6X 5TPWB 1ZA1A 2HXSA 1P9RA 1EHCA 1E69A 1XROA 1AKEA 3E5RA 3RTEA 2C2XA 2FSIA 2XBMA 1IIRA 4MQFB 5B2EA 3FZNA 1ZBDA 2PZGA 2CNWA 1DPGA 1RYDA 2CD9A 3JD3A 3A6HA 4G8BA 2ZI6A 1V4BA 2EWMA 4ARVA 3NOXA 4QFMA 5AK5A 1RIIA 2COUA 3RVRA 3K70C 1AKTA 4PX2A 3W5BA 4IW3B 2YVAA 3A36A 1JGTA 1O57A 4KE9A 1OOEA 4KR0A 2CL5A 4RD3A 5KSYA 5EQDA 5SY4A 1HC7A 3UENA 3SBDA 2KI5A 3FSJX 1IEWA 3QY0A 3TKAA 1IC6A 1UKCA 2ISSD 1ZZEA 3AV3A 4FCVA 3H83A 1DELA 3UJ9A 2IW3A 4YQYA 5JH7F 1G3UA 1O6FA 4R8KA 4Y3UA 2I67A 3C1AA 3NHSA 4UEQA 3WL3A 4P81A 1NP6A 2JIZA 3D7RA 1RRVA 4IRMA 2W8BB 4M3NA 3RVMA 1TEZA 1FUEA 5J5VA 2DTEA 4QARA 3DOCA 1P9LA 2DBVO 3KUCA 3MFQA 4R5HA 1AKUA 5JAQA 5I47A 2ZTSA 3IURA 3PTLA 1D2MA 2C4UA 1U9YA 3E3LA 1PFUA 1ORIA 5C7OO 4WK6A 4OEHA 4ER0A 6REQA 1G291 1ADYA 2OOKA 2H4ZA 4G5RA 4TYMA 1TC1A 1U2SA 3A8TA 2AN5A 4F06A 3CF6R 3ZWVA 1P73A 3LQ1A 1L7QA 1CRZA 3LE8A 4RSGA 4HFMA 3RU2A 2F3UA 2HMYB 4BLVA 1OB5A 3GFVA 3W8EA 1PLJA 5BNZA 1VLQA 2QROA 1T5OA 4M0PA 4LFCB 3RF6A 1ZVVA 1I2AA 3ASZA 3H1TA 1U2QA 5I8ZA 3R8FA 2ZROA 2QN8A 4OQDA 4BY9E 4IIJF 3W0LB 2B4QA 4AG6A 4AS3A 1YTLA 5DMHA 3AI7A 2RAPA 5ALFA 4BKOA 1A4XA 3HLYA 1AM4D 1HDZA 1MH1A 1P2DA 2XJ4A 2JARA 1MABB 4XUCA 4ZGGA 5LLDA 3OE5A 1VL6A 5CTAA 2ORIA 3HZRA 1HE4A 3IEKA 2B20A 2C9MA 1ADBA 1KI1A 2V6IA 1KPIA 5IUNC 3ILYA 1FFSA 1JHAA 1QIIA 3H6HA 4Q82A 4EPRA 3ZWYA 5LZ9A 4YK7A 2BH9A 2P9CA 3I45A 4FYXA 3SIPA 4I55F 4ZYZA 2Q5CA 3X1KA 3LKBA 1LU9A 4LOJA 1TAUA 1XX6A 3V4ZA 1UXHA 2QR3A 1QPBA 5HRCA 1WZ2A 4H7PA 4OL9A 1KE1A 3GJTA 2EBFX 1PG5A 2I1LA 3R5JA 4G67A 4XM0A 1N3IA 3THRA 1I1QB 5I4IA 1CX9B 1RC8A 4YIKA 1T1EA 3OJXA 3HDGA 4RS3A 4BC1A 1QIDA 3WAJA 5EUMA 3OU6A 2ZCVA 3DTVB 4KPUA 4PZLA 5LQDA 4N6OA 3R0IA 1J4AA 3NRJA 3IAS6 3NIFB 2ZIGA 1HFEL 3R5TA 1P1CA 3DVRX 1OZAA 2MYTA 3F8SA 1F8UA 1GPMA 2BY4A 2O3SA 3HO6A 3ON5A 3OVMA 4BO8A 1X9GA 3KR0A 3NTLA 4PHFA 3GQBB 1XU9A 3D0KA 1ECLA 1QIMA 1NBAA 2ODPA 2JEYA 3GLHE 4K3VA 4E5UA 3DFZA 5ALHA 5JBNA 1Q0TA 2BI7A 2CCKA 4HWGA 3RAEC 1FDRA 2I2DA 4LV8B 4AO7A 4KC0A 5FI1B 4J03A 5C0OE 1I4EB 1TJ4A 5ADHA 3PGLA 4FI3C 4BX8A 4YT2A 3DEJA 3GAZA 6Q21A 1PT5A 3G2PA 5JV5A 3VNVA 2P9EA 1E89A 2C8JA 4LI3X 2X0DA 4HX5A 1ZMTA 1PTJA 1U81A 4HDKA 3TAUA 5KPDA 4K26A 2Z9DA 3AIIA 2MYNA 1C50A 3P4UA 1FRVA 1HQCA 2OCDA 3M1AA 3ONNA 4LZLA 4N8DA 5DGDA 2D5CA 3S2UA 5EXSA 4YJ2F 1T4DA 4X0EA 1YJCA 3R7LA 4R2JA 4UBLA 1N33B 2NUPB 1SUBA 4UFPA 1T5IA 4HL6A 4I5DA 3ULKA 4TKVB 3IQIX 4CCWA 1JFFA 5ICEA 4OH1A 5HS4A 1L8LA 1YNOA 2C7PA 1Q57A 3I76A 1QK5A 2J8ZA 3UQYS 2R00A 4LOIA 5G3YA 2CHGA 3EZFA 2D3WA 1SBHA 3AM3A 3N8KA 1XF9A 1AK1A 2DWUA 2JGEA 3F5DA 4GX0A 4R9NA 4TT8A 3DEZA 3UK2A 3LC7O 3TRDA 2BKXA 1KH2A 5FBZA 1UBUS 4ZT4A 4TSKA 5HKLA 3ZUGA 2JLRA 4RDCA 3A9TA 1MAUA 1NI4B 2PZBA 3QTBA 1V7CA 2GXQA 4JP2A 2P3LA 3AU9A 4PZ0A 1FVOA 4RXUA 5EC8A 1JQDA 4OGWA 5HE8A 2EZ8A 4LWZA 4J75A 4XPIA 1G9XA 1JAZA 2Q5OA 5LDGA 4DEXA 1I0IA 5KX5F 5LOVF 2BSAA 3R3YA 3ZC3A 4PWYA 2R8BA 1P3Y1 2QL9A 1ULHA 1EK2A 3L40A 4Q34A 3V9AA 5FUVA 3KHUA 2IHNA 4AYXA 3F3KA 4RLQA 3ZIUA 4YALA 1DKUA 3P45A 1F6WA 4D3SA 5FR2A 1GTJ1 1K0UA 1DC8A 1UJ5A 5AHKA 3STXA 1U0HC 4PIPA 4ARZA 2F1OA 4HWPA 1N4AA 2OHXA 3EG9A 3Q10A 3TIXB 3KQKA 4ZPJA 1L4UA 4FC7A 2DJIA 3CRQA 2WA1A 4FUQA 4DYDA 3E7DA 2XCSB 2RKWA 2V98A 2XZDA 4R9VA 1ZWKA 3TLCA 2VPYA 3BXXA 5FYQA 3ESAA 3HBAA 4J4TA 5A5VA 2DMRA 3AM4A 3P9ZA 1CEEA 1JHVA 3RUFA 2AMYA 1AGXA 4AJOA 3U5ZB 2XMGA 3IELA 1VPVA 3LP6A 4A8HA 5K3OA 1V11B 1IXZA 1YZVA 4L9SA 1EVYA 3V1TC 4GYWA 4L02A 2UVPB 3OQIB 4DWVA 5C5CA 1W96A 3H17A 4BGIA 4QJ3A 5BVHA 5EJ4A 2ZYIA 3WKBA 5A5GA 5JO0A 1JZSA 2FX2A 1ZNQO 2QN1A 2A0XA 2BMAA 3NOQA 4KYVA 5EIBD 1DJLA 5CURA 3AEQB 3R3XA 5KJ6A 3BD9A 2CL0X 4KE7A 1U8TA 4AZWA 4EPWA 2LKDA 3B82A 1P0PA 1PKXA 4GI5A 3AW8A 1JHPA 4MVJF 1GM5A 2H4HA 2RKBA 3I72A 3GHYA 4HDMB 1LFDB 3KQWA 3WBFA 4I2VA 4PU0A 4IIFA 5K6AA 4K0KB 4LY6A 1CUJA 1W48A 2GTHA 2B5OA 2G0AA 1YULA 4URXR 1S2DA 1TQ2A 3EDRA 3UGKA 5KNCD 4H6XA 3H5TA 3N39C 1Y8QA 1WU7A 4J1QA 4WBSA 1XF1A 3A7DA 5BQ5A 3LUJA 4Q7EA 3W5VA 2WJJA 3G2IA 2EBWA 2EL7A 3DZIA 2Z1DA 3SI7A 3SYLA 2X9QA 3E70C 2LW7A 3IBTA 2C7GA 3EY9A 4WT7A 3BN3A 5IBCA 1J70A 1GLNA 5ESXA 3DOOA 3Q88A 3RTCA 2E4YA 3O9MA 5IBQA 3ROTA 1TIPA 3O4GA 1O6GA 1VG9B 1GJRA 2H57A 1UWVA 3UF0A 4TMTA 1NXSA 2NAFA 5EMHA 3UOAB 3B9RA 2ZJZA 1NNI1 1AB5A 3E4CA 1Q17A 1PK7A 1TLTA 4YDSA 1X7XB 1XTJA 2VTEA 4RM2A 3VOSA 5AUQA 1SUIA 1W5TA 3PPIA 1KDYA 2I3GA 3ND8A 2JFYA 4BNDB 2PA3A 4R40A 3ROXA 5E95A 5HZKA 2JD2A 2JIOA 2W4QA 1N6PA 4KPGA 1UKEA 3HZZA 4DIEA 2BSQA 2DGDA 3E9DA 4R7TA 4WX2B 4EG6A 1CDEA 4Q1VA 4JVMA 2LD4A 1O95A 2ZIXB 3KQOA 4R2LA 2WJVA 1GNQA 3ESZA 1L4HA 2K7FA 2R6DA 1JWBB 2NZYA 2JBWA 2YV4A 3Q9NA 4LX0A 5CK5A 5D2CA 2DUWA 3VJMA 4BMPB 1CDOA 3ES9A 4EHHA 2WM8A 2WK1A 1SPXA 2GARA 4QU5A 1F3LA 4NPHA 2ETVA 2UKDA 5AUNB 3IP7A 4G63A 3TQTA 1RQXA 3FOAA 1QX4A 4L15A 1R74A 3FSGD 3V7UA 3PFBA 3ZJUA 3WMXA 4B46A 4CM3A 3IILA 2HK7A 3TI7A 2BCEA 3TZKA 1T4CB 4LK3A 3P26A 1SRQA 4GKBA 4X61A 4Y6RA 1H1LA 4BO1A 3LHKA 2Q3JA 4QVKA 5TV2A 1WCYA 2C5EA 2P8SA 3ZWCA 3P9SA 4KGZA 2SKEA 3JQ8B 1YBMA 3L7DA 3VPXA 5HBGA 2PUCA 2J0QA 3WL5A 4ESOA 3ET5A 4Q4HA 3Q11A 2WWVD 4EJSA 2ZB4A 4MJXA 4R4JA 1NBIA 1L4LA 1QFMA 4QDTA 5FWYB 4G9BA 3D8BA 3EAFA 4RGBA 1UDXA 1C3EA 1JF8A 3C4QA 1MB4A 2GF9A 2C57A 2Y71A 3B9BA 5AKEA 5DTMA 4KODA 3CLVA 2Q45A 3VVLA 5FOQA 2O5RA 4MS4B 1SCNE 3L05A 4LRQA 3D8SA 4HDRA 2VA8A 1NXTA 3KUDA 3OA2A 4XWYA 4XRGA 1NN1A 1ZCAA 1Y4AE 2WWTA 3R3ZA 4TWJA 3RYIB 1KDOA 1HGXA 5HR5A 4G5XA 1E92A 1MEJA 1J42A 1G4AE 2PKEA 6CHYA 2C20A 3ZXYA 4JNKA 1ZINA 1GA6A 2DWQA 3IVGA 1APBA 1C30A 1OB2A 1E60A 3U80A 3GLFE 1QYRA 4QQKA 2II6A 5HYVA 2G83A 2XI4A 3ZV4A 1R6BX 4C6SA 1NG9A 1M76A 1NE7A 4W9NA 2C97A 3PHIA 3IUQA 5EWJB 4L8LA 4KI7A 1OGYA 1DKQA 3AHJA 1XCJA 2RHLA 2VK2A 4C03A 5GZ3A 1TEHA 2PQ0A 3KEFA 4OFBA 2CW5A 5HM8A 4AWXA 1XLVA 3N05A 2GPNA 1W4RA 5IKMA 1CQZA 1DXYA 1HQKA 2OFWA 5ALWA 4PRKA 3PX3A 1U8YA 1QGED 3LNTA 2HK8A 3PRJA 4RHCA 1WMBA 2BFAA 2IVZA 2NPOA 4N7BA 2R6CA 5DSZA 3UOWA 2GXSA 4FIZA 4K2AA 1AV6A 4DDVA 1IFXA 5K99A 1JT2A 2E5FA 2YYYA 3D4PA 2CYBA 3LX8A 4TQGA 3RIXA 5GZ1A 2ZUFA 3DVLA 1Y6FA 2AKEA 2J5QA 1I8TA 5EQJB 4BB9A 4NZ9A 5BV8A 1Z5UA 1JVSA 2P11A 3KKKA 3RNOA 4N5LA 5EJ2A 4PCAA 3S7ZA 1ZXXA 5IVKA 1UJBA 4CRWB 3RBAA 3RC8A 4UZEA 4BGDA 2P2ZA 4R16A 1Q50A 1PJQA 2PFSA 2CLHB 2AXPA 1PX2A 1RJ9A 3GJ6A 4EA7A 1DC7A 5IF3A 4YCNA 3WL6A 3LO8A 3PUZA 1J5EB 4DLBA 2VATA 2VSXA 4FUTA 3UGQA 5K4GA 4WADA 3OPYI 1UQUA 3GJRA 5DX1A 3I6ZA 2FZKA 4D8VA 1PSWA 1EE2A 1H6CA 1X8LA 3N6RA 2Y68A 1LD3A 1C3JA 1L8XA 2CY0A 2ZBRA 2GD2A 2FVXA 1G17A 4GGPA 3BWEA 3K16A 4ITRC 3B89A 1QYWA 4I3HA 2WPDD 3OM9A 1P3DA 5EKDA 2G5TA 1G19A 1ODJA 3L8CA 1RPNA 4JR1A 1U2GA 4TKLA 4LHZA 5AM1A 2LTAA 2R6R1 3FKSA 4YAEA 5HJ5A 1XQVA 5T41A 5MGNA 4NBLA 1UWCA 1BC5A 2CLOB 4KJXA 1A2BA 3BMNA 4M54A 4QOIA 4A1FA 5IJ9A 2NU7B 3FMGA 1P1RA 1XA0A 2NO0A 1JJBA 2ZDHA 1C8LA 2PJUA 1VGVA 3AVOA 2OFOA 1W93A 1PGQA 4P32A 4DDWA 5G40A 1RCUA 2A8YA 1NIJA 2C2YA 2GZDA 3CSDA 3S4YA 3T7AA 2FGJA 3VZCA 4UTVA 4EGAA 2FG6C 2EDAA 1F8XA 3HXQA 3LRPA 4TTPA 1XB2A 1KFEB 3F2VA 4YRCA 1X7YA 1PT9A 3JD4A 1GV0A 1SC6A 4CL0A 7REQB 4MDEA 1WHTB 2IXTA 1KPHA 3IPYA 1JMVA 2FAXA 1JPNA 3THYB 2W2VA 1G7CA 4B3RB 4ONEA 3EGVA 4HKTA 4TL8A 5JYCA 1W29A 2WI8A 3ENNA 1SMKA 4HNHA 2QVGA 3GLQA 5KJEA 5C7YA 1A3CA 4QTZA 2HEIA 3OU7A 4JOBA 3KFVA 3WVNA 1OH5A 3HSYA 5IW8A 4LAFA 1JN0A 5HKAA 4R0NA 4RK0A 2VS1A 5EG5A 4ZK2A 4QGAA 2CC2A 5TJ9A 4EECA 1B23P 1JTEA 3GJYA 1OAOA 2Q6VA 3U7FB 3EWSA 3KX2A 3T7JA 4TTVA 4PZZA 3T3NA 1GXSA 4LWQA 1NLZA 1LQTA 3ODGA 3WBJA 1UK7A 2CFSA 2IGBA 4HZGA 1NNEA 3RSFA 4TWIA 1LJ8A 4BPBA 4OA5A 3I73A 4G2NA 4MX8A 1WPRA 3ZWWA 2EKZA 1PQUA 3JYOA 3M5WA 3IDOA 5EHIA 1EFVA 3UJ7A 1JIUA 4RZIA 3KJEA 2WE7A 1M6YA 1BWSA 5DHRA 3U39A 3GJXC 3OIYA 1C7QA 2P30A 3B7GA 4FBGA 1BEEA 1SBYA 4J2TA 4QUDA 1QHNA 1CQWA 4MR7B 4HFJA 1Y1LA 5ALVA 1B0ZA 1F5SA 4ZREA 3T4UA 1TTPB 3P94A 4LVOA 4NY1A 4OJYA 3NDPA 4PHGA 5T64A 4E5PA 4EVSA 1X7YB 1LSSA 3ISTA 5ICGA 2OYCA 3HM9A 3GLTA 5ALZA 5FPYA 5JY6A 3MJ4A 1IJBA 3JY6A 1EX1A 2ICAA 4EBBA 3S3TA 1N8KA 1IZZA 1EKXA 1XWFA 4AJEA 5CAEA 3AEYA 1MHTA 3NHBA 3IC5A 3TEFA 2QUHA 1XTPA 4JWTA 1ZUD1 4ZJUA 4LJ8A 2J3QA 3C8HA 3BE4A 3L7CA 2XGOA 1BX1A 3VGPA 1HETA 1XZ8A 5FTKA 4C4RA 4G0OA 2Y8EA 2FWNA 2O3RA 3QK7A 3MAAC 1JDBC 5CVEA 3BGWA 5C5IA 2FW0A 2M2IA 4EOGA 3BMNB 3NR2A 2OHJA 3FVTA 1VIVA 5H68A 4ZZ3A 3DGEC 2K6GA 1ISHA 3C2QA 3F7OA 2QBYB 3OPQA 1DXQA 1TL7C 1VL2A 1WEKA 1XA3A 5CM9C 4K6MA 3N0VA 1FJGB 2VXBA 3ZPXA 2RBGA 2D3TA 3WLEA 3JZAA 5IAKA 5A7FA 4YCDA 3ONFA 5CFOA 5KNBA 2AN1A 3G68A 2D0OB 3PX7A 4M7PA 3OIWA 4DEVA 4Q3BA 1N1GA 3ZNOA 4DV6B 5B7PA 3KT3A 3BMCA 4PTLA 2XB2A 1DHRA 3E3NA 3P5SA 4TRMA 4ZOLB 2GK6A 1YZUA 4R69A 5AM3A 5CLLA 1S8AA 2CE2X 3IKJA 4MITA 2R6FA 1YB6A 1N5DA 2BMWA 1S7GA 3JASB 3MLEA 1FP4B 2RJOA 2IIVA 2ODNA 4FD3A 3H2HA 5GJVC 5E1MA 5AW9A 1NZFA 2X1HA 1QOZA 1JKJA 5CVUA 4ZAWA 1PDWA 2WUGA 3K0CC 1Y9AA 4J1NA 4NCBA 4ND2A 3KUXA 5LUAA 2UAGA 3SDZA 1XAIA 1K2WA 4RHXA 4MJ7A 4TS9A 4BJ1A 1YFJA 4URUR 3F3MA 1XTTA 2R11A 2R60A 1X3SA 1WKCA 1LDEA 1OYVA 2A0KA 2H5JA 2Z5FA 3LX6A 3M1IA 4DTCA 5F9HA 4Q9NA 2XUGA 3PR2B 4K9OA 5KYGA 4ER6A 1D3AA 4V0MA 2C5FA 2IXDA 3KOWA 4K1LA 2D62A 2VXOA 4YUYA 4YMVA 4N48A 1JG2A 1PZMA 2O8VA 1LVGA 1XN1A 3GFBA 2P77A 3C5VA 7AT1A 3U0VA 1KAHA 2Y93A 2HHJA 4LQLA 4BQIA 1CR0A 1Y5LA 2DX7A 4P4UA 3PC4A 2OYRA 3P0HA 4GEKA 1T2FA 2JF0A 2XAUA 3DE6X 3PI7A 2Q50A 2ZRJA 3R75A 3E9QA 4Q4AB 1IM2A 1IMOA 5AKGA 3VQTA 1DWOA 2Q7OE 5CBPA 2VF8A 2H8KA 4V24A 1SXJB 5FWXB 3F7MA 1PO7A 3BB3A 3QVGB 4GO1A 2RHOA 2W37A 3B6IA 4BFLA 3BMCB 3G7UA 1AX9A 1F3OA 1P0CA 3C3PA 4RH1A 2G09A 1P2BA 1B2RA 3IV9A