4URRA

Tailspike protein of sf6 bacteriophage bound to shigella flexneri o- antigen octasaccharide fragment
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSAAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLAYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL TAIL PROTEIN
publication title Shigella Flexneri O-Polysaccharide Fragments Interacting with the Tailspike Protein of Bacteriophage Sf6
rcsb
source organism Shigella phage sf6
molecule tags Hydrolase
total genus 188
structure length 509
sequence length 509
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.-:
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4urrA00
1JRGA 2NSPA 2NSTA 2EWEA 2NT9A 2PYGA 4W8TA 4NK6A 1O8KA 4XLFA 1BN8A 1O88A 3VMWA 4YZQA 4YEJA 2PYHA 2INVA 1RMGA 4XLCA 4Z06A 4XLAA 3ZPPA 1DBGA 4OJOA 3GQ8A 1DBOA 2VBEA 4YELA 1PE9A 2PECA 2QX3A 2QXZA 1O8MA 4XOTA 4XQFA 5C1CA 2Z8GA 3GRHA 1EE6A 1HG8A 3B8YA 1RU4A 4PMHA 1PXZA 3JURA 4XM3A 4C2LA 1KTWA 2NTPA 2X6WA 4YZXA 1CZFA 4XKWA 1O8EA 4HWVA 3VMVA 1O8JA 1X0CA 1O8FA 4OJPA 4URRA 4XLEA 2QY1A 2O04A 4XORA 1IA5A 1QCXA 1OFLA 1RWRA 2UVEA 1WMRA 3B90A 3LMWA 1NHCA 3GQAA 4OZYA 3SUCA 3VSVA 2IQ7A 4W8SA 3FY3A 1OFMA 4XMYA 1JTAA 2VBKA 4U4BA 2O0WA 2BSPA 3GQ7A 3B4NA 4XKVA 4OJ6A 4U49A 1OOCA 2INUA 4Z03A 3VSUA 2VJJA 4XN3A 1IB4A 3ZSCA 1OGOX 2X6XA 4XL9A 1K5CA 4Z05A 3EQNA 1O8GA 4XN0A 3GQ9A 1O8IA 2O17A 1AIRA 4OJ5A 4NK8A 1IDJA 4YZAA 2X6YA 4W8QA 1H80A 1BHEA 4XONA 2NTBA 2UVFA 4W8RA 2X85A 3T9GA 1O8LA 4XNFA 3WWGA 2NTQA 4I84A 4OJLA 4YZ0A 5AMVA 3KRGA 1IDKA 2O0VA 1PLUA 2O1DA 3UW0A 1OGMX 4EW9A 2NT6A 1KCDA 1O8DA 4AVZA 5C1EA 4MR0A 4MXNA 4OZZA 1GQ8A 4XR6A 2NZMA 1O8HA 1KCCA 2ODLA 1XG2A 3VSTA 1VBLA 4XOPA 1QJVA 2X3HA 2VJIA 3EQOA 2VBMA 4XLHA
chains in the Genus database with same CATH superfamily
4YDTA 1LLZA 1JRGA 3DU1X 3PETA 1EA0A 2NSPA 1TYXA 2NSTA 2EWEA 2NT9A 3P4GA 4YFOA 2PYGA 4W8TA 4NK6A 1O8KA 4XLFA 1BN8A 1O88A 1EZGA 2XTWA 2BM7A 3SQVA 3VMWA 1K8FA 2O6WA 4YZQA 2QZAA 4YEJA 2PYHA 2INVA 1RMGA 4V02C 5DNSA 4XLCA 4Z06A 3N6ZA 1QRCA 4XLAA 3ZPPA 1KQ5A 1DABA 1L1IA 1DBGA 1QRBA 4OJOA 4YCQA 3GQ8A 1DBOA 2VBEA 2G0YA 4YELA 1PE9A 2PECA 2QX3A 2QXZA 1O8MA 4XOTA 4XQFA 5C1CA 1QQ1A 2Z8GA 3GRHA 1EE6A 1HG8A 3B8YA 1RU4A 4PMHA 5JMCB 3PSZA 2VFPA 2YUHA 1PXZA 3JURA 4XM3A 4C2LA 1KTWA 2QYUA 2BM5A 2NTPA 2X6WA 4YZXA 1TSPA 5JLVC 1QA2A 3BH6B 1CZFA 1WXRA 4XKWA 2XTYA 1O8EA 1TYVA 4HWVA 3VMVA 1O8JA 1X0CA 1O8FA 4OJPA 4URRA 4XLEA 2QY1A 2O04A 4XORA 1IA5A 1QCXA 3BH7B 1K4ZA 4KH3A 1HF2A 1OFLA 1RWRA 1LM1A 1WMRA 2UVEA 3B90A 3LMWA 3RIQA 1NHCA 3LJYA 3GQAA 4OZYA 3SUCA 3VSVA 2IQ7A 4W8SA 3FY3A 1OFMA 4XMYA 1JTAA 2VBKA 4U4BA 2O0WA 2BSPA 3GQ7A 3B4NA 3SYJA 1OFDA 4XKVA 4OJ6A 2XTXA 4U49A 1OOCA 2INUA 2F3LA 2XT4A 4Z03A 3VSUA 1LLWA 2VFQA 2VJJA 4OM9A 4XN3A 1IB4A 3ZSCA 1OGOX 2X6XA 3AK5A 4XL9A 2VFOA 1K5CA 4JRAC 4Z05A 3EQNA 1O8GA 4XN0A 2J8IA 1O8IA 3GQ9A 3NAWA 2O17A 2B0RA 3TH0A 1AIRA 4OJ5A 4NK8A 1IDJA 4YZAA 2X6YA 4W8QA 1H80A 1BHEA 4XONA 2NTBA 2UVFA 2V5IA 4W8RA 2X85A 3T9GA 2BM4A 1O8LA 4XNFA 3WWGA 1CLWA 2NTQA 3PSSA 4I84A 4OJLA 5AMVA 3KRGA 4YZ0A 2BM6A 1IDKA 4OPWA 1QA3A 2O0VA 1PLUA 2O1DA 3UW0A 3LYCA 3SY2A 1OGMX 2VFNA 4EW9A 2NT6A 4YEIA 1O8DA 1KCDA 3SZEA 2VFMA 2XT2A 4AVZA 2XC1A 5C1EA 1QA1A 4MR0A 4YC5A 1TYUA 4MXNA 3H09A 4OZZA 3N90A 1GQ8A 2J8KA 4XR6A 2NZMA 1O8HA 1KCCA 2ODLA 2IOUG 1TYWA 3JX8A 2BX6A 1XG2A 1OFEA 3VSTA 1VBLA 4XOPA 1QJVA 3ML3A 2X3HA 2VJIA 3EQOA 2VBMA 3NB2A 4XLHA 2W7ZA
chains in the Genus database with same CATH topology
1JRGA 2NSPA 2NSTA 2EWEA 2NT9A 2PYGA 4W8TA 4NK6A 1O8KA 4XLFA 1BN8A 1O88A 3VMWA 4YZQA 4YEJA 2PYHA 2INVA 1RMGA 4XLCA 4Z06A 4XLAA 3ZPPA 1DBGA 4OJOA 3GQ8A 1DBOA 2VBEA 4YELA 1PE9A 2PECA 2QX3A 2QXZA 1O8MA 4XOTA 4XQFA 5C1CA 2Z8GA 3GRHA 1EE6A 1HG8A 3B8YA 1RU4A 4PMHA 1PXZA 3JURA 4XM3A 4C2LA 1KTWA 2NTPA 2X6WA 4YZXA 1CZFA 4XKWA 1O8EA 4HWVA 3VMVA 1O8JA 1X0CA 1O8FA 4OJPA 4URRA 4XLEA 2QY1A 2O04A 4XORA 1IA5A 1QCXA 1OFLA 1RWRA 2UVEA 1WMRA 3B90A 3LMWA 1NHCA 3GQAA 4OZYA 3SUCA 3VSVA 2IQ7A 4W8SA 3FY3A 1OFMA 4XMYA 1JTAA 2VBKA 4U4BA 2O0WA 2BSPA 3GQ7A 3B4NA 4XKVA 4OJ6A 4U49A 1OOCA 2INUA 4Z03A 3VSUA 2VJJA 4XN3A 1IB4A 3ZSCA 1OGOX 2X6XA 4XL9A 1K5CA 4Z05A 3EQNA 1O8GA 4XN0A 3GQ9A 1O8IA 2O17A 1AIRA 4OJ5A 4NK8A 1IDJA 4YZAA 2X6YA 4W8QA 1H80A 1BHEA 4XONA 2NTBA 2UVFA 4W8RA 2X85A 3T9GA 1O8LA 4XNFA 3WWGA 2NTQA 4I84A 4OJLA 4YZ0A 5AMVA 3KRGA 1IDKA 2O0VA 1PLUA 2O1DA 3UW0A 1OGMX 4EW9A 2NT6A 1KCDA 1O8DA 4AVZA 5C1EA 4MR0A 4MXNA 4OZZA 1GQ8A 4XR6A 2NZMA 1O8HA 1KCCA 2ODLA 1XG2A 3VSTA 1VBLA 4XOPA 1QJVA 2X3HA 2VJIA 3EQOA 2VBMA 4XLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRG A;  2NSP A;  2NST A;  2EWE A;  2NT9 A;  2PYG A;  4W8T A;  4NK6 A;  1O8K A;  4XLF A;  1BN8 A;  1O88 A;  3VMW A;  4YZQ A;  4YEJ A;  2PYH A;  2INV A;  1RMG A;  4XLC A;  4Z06 A;  4XLA A;  3ZPP A;  1DBG A;  4OJO A;  3GQ8 A;  1DBO A;  2VBE A;  4YEL A;  1PE9 A;  2PEC A;  2QX3 A;  2QXZ A;  1O8M A;  4XOT A;  4XQF A;  5C1C A;  2Z8G A;  3GRH A;  1EE6 A;  1HG8 A;  3B8Y A;  1RU4 A;  4PMH A;  1PXZ A;  3JUR A;  4XM3 A;  4C2L A;  1KTW A;  2NTP A;  2X6W A;  4YZX A;  1CZF A;  4XKW A;  1O8E A;  4HWV A;  3VMV A;  1O8J A;  1X0C A;  1O8F A;  4OJP A;  4URR A;  4XLE A;  2QY1 A;  2O04 A;  4XOR A;  1IA5 A;  1QCX A;  1OFL A;  1RWR A;  2UVE A;  1WMR A;  3B90 A;  3LMW A;  1NHC A;  3GQA A;  4OZY A;  3SUC A;  3VSV A;  2IQ7 A;  4W8S A;  3FY3 A;  1OFM A;  4XMY A;  1JTA A;  2VBK A;  4U4B A;  2O0W A;  2BSP A;  3GQ7 A;  3B4N A;  4XKV A;  4OJ6 A;  4U49 A;  1OOC A;  2INU A;  4Z03 A;  3VSU A;  2VJJ A;  4XN3 A;  1IB4 A;  3ZSC A;  1OGO X;  2X6X A;  4XL9 A;  1K5C A;  4Z05 A;  3EQN A;  1O8G A;  4XN0 A;  3GQ9 A;  1O8I A;  2O17 A;  1AIR A;  4OJ5 A;  4NK8 A;  1IDJ A;  4YZA A;  2X6Y A;  4W8Q A;  1H80 A;  1BHE A;  4XON A;  2NTB A;  2UVF A;  4W8R A;  2X85 A;  3T9G A;  1O8L A;  4XNF A;  3WWG A;  2NTQ A;  4I84 A;  4OJL A;  4YZ0 A;  5AMV A;  3KRG A;  1IDK A;  2O0V A;  1PLU A;  2O1D A;  3UW0 A;  1OGM X;  4EW9 A;  2NT6 A;  1KCD A;  1O8D A;  4AVZ A;  5C1E A;  4MR0 A;  4MXN A;  4OZZ A;  1GQ8 A;  4XR6 A;  2NZM A;  1O8H A;  1KCC A;  2ODL A;  1XG2 A;  3VST A;  1VBL A;  4XOP A;  1QJV A;  2X3H A;  2VJI A;  3EQO A;  2VBM A;  4XLH A; 
#chains in the Genus database with same CATH topology
 4YDT A;  1LLZ A;  1JRG A;  3DU1 X;  3PET A;  1EA0 A;  2NSP A;  1TYX A;  2NST A;  2EWE A;  2NT9 A;  3P4G A;  4YFO A;  2PYG A;  4W8T A;  4NK6 A;  1O8K A;  4XLF A;  1BN8 A;  1O88 A;  1EZG A;  2XTW A;  2BM7 A;  3SQV A;  3VMW A;  1K8F A;  2O6W A;  4YZQ A;  2QZA A;  4YEJ A;  2PYH A;  2INV A;  1RMG A;  4V02 C;  5DNS A;  4XLC A;  4Z06 A;  3N6Z A;  1QRC A;  4XLA A;  3ZPP A;  1KQ5 A;  1DAB A;  1L1I A;  1DBG A;  1QRB A;  4OJO A;  4YCQ A;  3GQ8 A;  1DBO A;  2VBE A;  2G0Y A;  4YEL A;  1PE9 A;  2PEC A;  2QX3 A;  2QXZ A;  1O8M A;  4XOT A;  4XQF A;  5C1C A;  1QQ1 A;  2Z8G A;  3GRH A;  1EE6 A;  1HG8 A;  3B8Y A;  1RU4 A;  4PMH A;  5JMC B;  3PSZ A;  2VFP A;  2YUH A;  1PXZ A;  3JUR A;  4XM3 A;  4C2L A;  1KTW A;  2QYU A;  2BM5 A;  2NTP A;  2X6W A;  4YZX A;  1TSP A;  5JLV C;  1QA2 A;  3BH6 B;  1CZF A;  1WXR A;  4XKW A;  2XTY A;  1O8E A;  1TYV A;  4HWV A;  3VMV A;  1O8J A;  1X0C A;  1O8F A;  4OJP A;  4URR A;  4XLE A;  2QY1 A;  2O04 A;  4XOR A;  1IA5 A;  1QCX A;  3BH7 B;  1K4Z A;  4KH3 A;  1HF2 A;  1OFL A;  1RWR A;  1LM1 A;  1WMR A;  2UVE A;  3B90 A;  3LMW A;  3RIQ A;  1NHC A;  3LJY A;  3GQA A;  4OZY A;  3SUC A;  3VSV A;  2IQ7 A;  4W8S A;  3FY3 A;  1OFM A;  4XMY A;  1JTA A;  2VBK A;  4U4B A;  2O0W A;  2BSP A;  3GQ7 A;  3B4N A;  3SYJ A;  1OFD A;  4XKV A;  4OJ6 A;  2XTX A;  4U49 A;  1OOC A;  2INU A;  2F3L A;  2XT4 A;  4Z03 A;  3VSU A;  1LLW A;  2VFQ A;  2VJJ A;  4OM9 A;  4XN3 A;  1IB4 A;  3ZSC A;  1OGO X;  2X6X A;  3AK5 A;  4XL9 A;  2VFO A;  1K5C A;  4JRA C;  4Z05 A;  3EQN A;  1O8G A;  4XN0 A;  2J8I A;  1O8I A;  3GQ9 A;  3NAW A;  2O17 A;  2B0R A;  3TH0 A;  1AIR A;  4OJ5 A;  4NK8 A;  1IDJ A;  4YZA A;  2X6Y A;  4W8Q A;  1H80 A;  1BHE A;  4XON A;  2NTB A;  2UVF A;  2V5I A;  4W8R A;  2X85 A;  3T9G A;  2BM4 A;  1O8L A;  4XNF A;  3WWG A;  1CLW A;  2NTQ A;  3PSS A;  4I84 A;  4OJL A;  5AMV A;  3KRG A;  4YZ0 A;  2BM6 A;  1IDK A;  4OPW A;  1QA3 A;  2O0V A;  1PLU A;  2O1D A;  3UW0 A;  3LYC A;  3SY2 A;  1OGM X;  2VFN A;  4EW9 A;  2NT6 A;  4YEI A;  1O8D A;  1KCD A;  3SZE A;  2VFM A;  2XT2 A;  4AVZ A;  2XC1 A;  5C1E A;  1QA1 A;  4MR0 A;  4YC5 A;  1TYU A;  4MXN A;  3H09 A;  4OZZ A;  3N90 A;  1GQ8 A;  2J8K A;  4XR6 A;  2NZM A;  1O8H A;  1KCC A;  2ODL A;  2IOU G;  1TYW A;  3JX8 A;  2BX6 A;  1XG2 A;  1OFE A;  3VST A;  1VBL A;  4XOP A;  1QJV A;  3ML3 A;  2X3H A;  2VJI A;  3EQO A;  2VBM A;  3NB2 A;  4XLH A;  2W7Z A; 
#chains in the Genus database with same CATH homology
 1JRG A;  2NSP A;  2NST A;  2EWE A;  2NT9 A;  2PYG A;  4W8T A;  4NK6 A;  1O8K A;  4XLF A;  1BN8 A;  1O88 A;  3VMW A;  4YZQ A;  4YEJ A;  2PYH A;  2INV A;  1RMG A;  4XLC A;  4Z06 A;  4XLA A;  3ZPP A;  1DBG A;  4OJO A;  3GQ8 A;  1DBO A;  2VBE A;  4YEL A;  1PE9 A;  2PEC A;  2QX3 A;  2QXZ A;  1O8M A;  4XOT A;  4XQF A;  5C1C A;  2Z8G A;  3GRH A;  1EE6 A;  1HG8 A;  3B8Y A;  1RU4 A;  4PMH A;  1PXZ A;  3JUR A;  4XM3 A;  4C2L A;  1KTW A;  2NTP A;  2X6W A;  4YZX A;  1CZF A;  4XKW A;  1O8E A;  4HWV A;  3VMV A;  1O8J A;  1X0C A;  1O8F A;  4OJP A;  4URR A;  4XLE A;  2QY1 A;  2O04 A;  4XOR A;  1IA5 A;  1QCX A;  1OFL A;  1RWR A;  2UVE A;  1WMR A;  3B90 A;  3LMW A;  1NHC A;  3GQA A;  4OZY A;  3SUC A;  3VSV A;  2IQ7 A;  4W8S A;  3FY3 A;  1OFM A;  4XMY A;  1JTA A;  2VBK A;  4U4B A;  2O0W A;  2BSP A;  3GQ7 A;  3B4N A;  4XKV A;  4OJ6 A;  4U49 A;  1OOC A;  2INU A;  4Z03 A;  3VSU A;  2VJJ A;  4XN3 A;  1IB4 A;  3ZSC A;  1OGO X;  2X6X A;  4XL9 A;  1K5C A;  4Z05 A;  3EQN A;  1O8G A;  4XN0 A;  3GQ9 A;  1O8I A;  2O17 A;  1AIR A;  4OJ5 A;  4NK8 A;  1IDJ A;  4YZA A;  2X6Y A;  4W8Q A;  1H80 A;  1BHE A;  4XON A;  2NTB A;  2UVF A;  4W8R A;  2X85 A;  3T9G A;  1O8L A;  4XNF A;  3WWG A;  2NTQ A;  4I84 A;  4OJL A;  4YZ0 A;  5AMV A;  3KRG A;  1IDK A;  2O0V A;  1PLU A;  2O1D A;  3UW0 A;  1OGM X;  4EW9 A;  2NT6 A;  1KCD A;  1O8D A;  4AVZ A;  5C1E A;  4MR0 A;  4MXN A;  4OZZ A;  1GQ8 A;  4XR6 A;  2NZM A;  1O8H A;  1KCC A;  2ODL A;  1XG2 A;  3VST A;  1VBL A;  4XOP A;  1QJV A;  2X3H A;  2VJI A;  3EQO A;  2VBM A;  4XLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...