4URRA

Tailspike protein of sf6 bacteriophage bound to shigella flexneri o- antigen octasaccharide fragment
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSAAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLAYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Shigella Flexneri O-Polysaccharide Fragments Interacting with the Tailspike Protein of Bacteriophage Sf6
rcsb
source organism Shigella phage sf6
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL TAIL PROTEIN
total genus 188
structure length 509
sequence length 509
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.-:
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4urrA00
2NTQA 1OFLA 4YZ0A 4XLAA 1K5CA 1H80A 2PYGA 4YZXA 4XKVA 3VMWA 1QCXA 5AMVA 4OJ5A 1O8EA 4HWVA 2X6WA 2UVEA 3VMVA 4NK6A 1PLUA 1QJVA 4AVZA 4YEJA 1KCDA 2O0VA 1O88A 2O0WA 2BSPA 2Z8GA 4OJPA 4XOPA 2X3HA 2O1DA 2NTBA 4MXNA 2VBMA 1RU4A 1O8GA 4XLCA 4XONA 2QX3A 4YZQA 3B90A 3JURA 4OZZA 4XLEA 3GQ9A 1CZFA 3VSVA 2UVFA 4NK8A 1IDJA 2QY1A 1GQ8A 1O8FA 2INUA 3FY3A 1O8JA 1KTWA 3EQOA 4U49A 4XL9A 4W8SA 3VSTA 4XN0A 2PYHA 4YZAA 3UW0A 2QXZA 1KCCA 1O8HA 4C2LA 1AIRA 1RMGA 4OJLA 4URRA 4I84A 4EW9A 2NTPA 2VJJA 4XOTA 2X6XA 4W8RA 1OGOX 4U4BA 4XNFA 4XLHA 4XR6A 4W8TA 1OGMX 1HG8A 2NSTA 1O8IA 4XN3A 2IQ7A 3WWGA 4XKWA 4W8QA 4OJ6A 1JRGA 4XLFA 2PECA 3B4NA 1BHEA 4OJOA 4Z03A 2VBKA 2X85A 1IB4A 2VJIA 4Z05A 4YELA 1IDKA 2INVA 4XORA 1EE6A 2NSPA 1NHCA 4XMYA 1O8MA 2NT9A 3T9GA 3KRGA 5C1EA 4PMHA 4Z06A 3GQAA 1IA5A 1JTAA 1OOCA 1XG2A 2X6YA 3B8YA 4OZYA 1VBLA 2O04A 1WMRA 1OFMA 1PXZA 1BN8A 3GRHA 3ZPPA 3LMWA 2NT6A 4MR0A 4XQFA 5C1CA 1DBOA 3ZSCA 2NZMA 3GQ7A 3VSUA 2O17A 3GQ8A 2ODLA 1O8DA 1O8KA 1X0CA 1O8LA 1DBGA 4XM3A 3SUCA 3EQNA 1PE9A 1RWRA 2EWEA 2VBEA
chains in the Genus database with same CATH superfamily
2NTQA 1OFLA 1TSPA 4XLAA 4YZ0A 1K5CA 2BM5A 2O6WA 1H80A 1HF2A 2PYGA 4XKVA 3NB2A 4YZXA 3RIQA 3VMWA 1QCXA 5AMVA 2F3LA 4OJ5A 2J8KA 1O8EA 4HWVA 1KQ5A 2X6WA 2UVEA 1QRBA 4OM9A 1DABA 3VMVA 4NK6A 1PLUA 3PSZA 1QJVA 4AVZA 4YEJA 1QA1A 1KCDA 2O0VA 1O88A 4KH3A 2XTYA 2O0WA 2BSPA 2Z8GA 4OJPA 4OPWA 2B0RA 4YCQA 1LM1A 4XOPA 3SZEA 2X3HA 2O1DA 2BM4A 2NTBA 4MXNA 3H09A 3N90A 2VFQA 2VBMA 4YDTA 1RU4A 1O8GA 2J8IA 2QYUA 2VFOA 2VFPA 4XLCA 4XONA 2QX3A 4YZQA 3B90A 3JURA 4OZZA 1TYXA 4XLEA 3GQ9A 1CZFA 3VSVA 2UVFA 3BH6B 1K8FA 4NK8A 3SQVA 1IDJA 1EA0A 2QY1A 1GQ8A 1O8FA 2INUA 2VFNA 3FY3A 1O8JA 1KTWA 3EQOA 4U49A 4XL9A 4W8SA 3VSTA 2QZAA 4XN0A 2PYHA 1TYUA 4YZAA 3UW0A 2QXZA 1KCCA 1O8HA 2IOUG 1AIRA 1QRCA 3SY2A 4C2LA 3N6ZA 3JX8A 1OFDA 4V02C 1LLZA 1QA3A 1RMGA 2XT4A 4OJLA 2XT2A 4URRA 4I84A 1LLWA 2V5IA 4EW9A 2NTPA 2VJJA 4XOTA 2XTWA 2X6XA 4YFOA 2W7ZA 1OGOX 4W8RA 3ML3A 5DNSA 4U4BA 4XNFA 2BM7A 4XLHA 2XC1A 4XR6A 1WXRA 3AK5A 4W8TA 1OGMX 1HG8A 2NSTA 1QQ1A 1L1IA 1O8IA 4XN3A 2IQ7A 3WWGA 4JRAC 4XKWA 4W8QA 3PSSA 4OJ6A 1JRGA 4XLFA 2PECA 3B4NA 3PETA 1BHEA 4OJOA 4Z03A 2XTXA 2VBKA 2X85A 1IB4A 2VJIA 4Z05A 2BM6A 4YELA 1IDKA 2INVA 4XORA 1EE6A 2NSPA 1NHCA 4XMYA 1O8MA 3SYJA 3TH0A 2NT9A 3T9GA 3KRGA 3P4GA 3DU1X 4YEIA 5C1EA 2BX6A 4PMHA 4Z06A 3GQAA 2YUHA 1IA5A 1JTAA 1OOCA 1TYWA 1XG2A 2X6YA 3B8YA 4OZYA 1QA2A 1VBLA 3LYCA 3NAWA 3BH7B 5JMCB 2O04A 1WMRA 1CLWA 1OFMA 2VFMA 1PXZA 2G0YA 1BN8A 3GRHA 3ZPPA 3LMWA 2NT6A 4MR0A 4XQFA 5C1CA 1EZGA 4YC5A 1DBOA 3ZSCA 2NZMA 5JLVC 3GQ7A 1TYVA 3VSUA 1OFEA 2O17A 2ODLA 3GQ8A 1O8DA 1O8KA 1K4ZA 1X0CA 1O8LA 3LJYA 1DBGA 4XM3A 3SUCA 3EQNA 1PE9A 1RWRA 2EWEA 2VBEA
chains in the Genus database with same CATH topology
2NTQA 1OFLA 4YZ0A 4XLAA 1K5CA 1H80A 2PYGA 4YZXA 4XKVA 3VMWA 1QCXA 5AMVA 4OJ5A 1O8EA 4HWVA 2X6WA 2UVEA 3VMVA 4NK6A 1PLUA 1QJVA 4AVZA 4YEJA 1KCDA 2O0VA 1O88A 2O0WA 2BSPA 2Z8GA 4OJPA 4XOPA 2X3HA 2O1DA 2NTBA 4MXNA 2VBMA 1RU4A 1O8GA 4XLCA 4XONA 2QX3A 4YZQA 3B90A 3JURA 4OZZA 4XLEA 3GQ9A 1CZFA 3VSVA 2UVFA 4NK8A 1IDJA 2QY1A 1GQ8A 1O8FA 2INUA 3FY3A 1O8JA 1KTWA 3EQOA 4U49A 4XL9A 4W8SA 3VSTA 4XN0A 2PYHA 4YZAA 3UW0A 2QXZA 1KCCA 1O8HA 4C2LA 1AIRA 1RMGA 4OJLA 4URRA 4I84A 4EW9A 2NTPA 2VJJA 4XOTA 2X6XA 4W8RA 1OGOX 4U4BA 4XNFA 4XLHA 4XR6A 4W8TA 1OGMX 1HG8A 2NSTA 1O8IA 4XN3A 2IQ7A 3WWGA 4XKWA 4W8QA 4OJ6A 1JRGA 4XLFA 2PECA 3B4NA 1BHEA 4OJOA 4Z03A 2VBKA 2X85A 1IB4A 2VJIA 4Z05A 4YELA 1IDKA 2INVA 4XORA 1EE6A 2NSPA 1NHCA 4XMYA 1O8MA 2NT9A 3T9GA 3KRGA 5C1EA 4PMHA 4Z06A 3GQAA 1IA5A 1JTAA 1OOCA 1XG2A 2X6YA 3B8YA 4OZYA 1VBLA 2O04A 1WMRA 1OFMA 1PXZA 1BN8A 3GRHA 3ZPPA 3LMWA 2NT6A 4MR0A 4XQFA 5C1CA 1DBOA 3ZSCA 2NZMA 3GQ7A 3VSUA 2O17A 3GQ8A 2ODLA 1O8DA 1O8KA 1X0CA 1O8LA 1DBGA 4XM3A 3SUCA 3EQNA 1PE9A 1RWRA 2EWEA 2VBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTQ A;  1OFL A;  4YZ0 A;  4XLA A;  1K5C A;  1H80 A;  2PYG A;  4YZX A;  4XKV A;  3VMW A;  1QCX A;  5AMV A;  4OJ5 A;  1O8E A;  4HWV A;  2X6W A;  2UVE A;  3VMV A;  4NK6 A;  1PLU A;  1QJV A;  4AVZ A;  4YEJ A;  1KCD A;  2O0V A;  1O88 A;  2O0W A;  2BSP A;  2Z8G A;  4OJP A;  4XOP A;  2X3H A;  2O1D A;  2NTB A;  4MXN A;  2VBM A;  1RU4 A;  1O8G A;  4XLC A;  4XON A;  2QX3 A;  4YZQ A;  3B90 A;  3JUR A;  4OZZ A;  4XLE A;  3GQ9 A;  1CZF A;  3VSV A;  2UVF A;  4NK8 A;  1IDJ A;  2QY1 A;  1GQ8 A;  1O8F A;  2INU A;  3FY3 A;  1O8J A;  1KTW A;  3EQO A;  4U49 A;  4XL9 A;  4W8S A;  3VST A;  4XN0 A;  2PYH A;  4YZA A;  3UW0 A;  2QXZ A;  1KCC A;  1O8H A;  4C2L A;  1AIR A;  1RMG A;  4OJL A;  4URR A;  4I84 A;  4EW9 A;  2NTP A;  2VJJ A;  4XOT A;  2X6X A;  4W8R A;  1OGO X;  4U4B A;  4XNF A;  4XLH A;  4XR6 A;  4W8T A;  1OGM X;  1HG8 A;  2NST A;  1O8I A;  4XN3 A;  2IQ7 A;  3WWG A;  4XKW A;  4W8Q A;  4OJ6 A;  1JRG A;  4XLF A;  2PEC A;  3B4N A;  1BHE A;  4OJO A;  4Z03 A;  2VBK A;  2X85 A;  1IB4 A;  2VJI A;  4Z05 A;  4YEL A;  1IDK A;  2INV A;  4XOR A;  1EE6 A;  2NSP A;  1NHC A;  4XMY A;  1O8M A;  2NT9 A;  3T9G A;  3KRG A;  5C1E A;  4PMH A;  4Z06 A;  3GQA A;  1IA5 A;  1JTA A;  1OOC A;  1XG2 A;  2X6Y A;  3B8Y A;  4OZY A;  1VBL A;  2O04 A;  1WMR A;  1OFM A;  1PXZ A;  1BN8 A;  3GRH A;  3ZPP A;  3LMW A;  2NT6 A;  4MR0 A;  4XQF A;  5C1C A;  1DBO A;  3ZSC A;  2NZM A;  3GQ7 A;  3VSU A;  2O17 A;  3GQ8 A;  2ODL A;  1O8D A;  1O8K A;  1X0C A;  1O8L A;  1DBG A;  4XM3 A;  3SUC A;  3EQN A;  1PE9 A;  1RWR A;  2EWE A;  2VBE A; 
#chains in the Genus database with same CATH topology
 2NTQ A;  1OFL A;  1TSP A;  4XLA A;  4YZ0 A;  1K5C A;  2BM5 A;  2O6W A;  1H80 A;  1HF2 A;  2PYG A;  4XKV A;  3NB2 A;  4YZX A;  3RIQ A;  3VMW A;  1QCX A;  5AMV A;  2F3L A;  4OJ5 A;  2J8K A;  1O8E A;  4HWV A;  1KQ5 A;  2X6W A;  2UVE A;  1QRB A;  4OM9 A;  1DAB A;  3VMV A;  4NK6 A;  1PLU A;  3PSZ A;  1QJV A;  4AVZ A;  4YEJ A;  1QA1 A;  1KCD A;  2O0V A;  1O88 A;  4KH3 A;  2XTY A;  2O0W A;  2BSP A;  2Z8G A;  4OJP A;  4OPW A;  2B0R A;  4YCQ A;  1LM1 A;  4XOP A;  3SZE A;  2X3H A;  2O1D A;  2BM4 A;  2NTB A;  4MXN A;  3H09 A;  3N90 A;  2VFQ A;  2VBM A;  4YDT A;  1RU4 A;  1O8G A;  2J8I A;  2QYU A;  2VFO A;  2VFP A;  4XLC A;  4XON A;  2QX3 A;  4YZQ A;  3B90 A;  3JUR A;  4OZZ A;  1TYX A;  4XLE A;  3GQ9 A;  1CZF A;  3VSV A;  2UVF A;  3BH6 B;  1K8F A;  4NK8 A;  3SQV A;  1IDJ A;  1EA0 A;  2QY1 A;  1GQ8 A;  1O8F A;  2INU A;  2VFN A;  3FY3 A;  1O8J A;  1KTW A;  3EQO A;  4U49 A;  4XL9 A;  4W8S A;  3VST A;  2QZA A;  4XN0 A;  2PYH A;  1TYU A;  4YZA A;  3UW0 A;  2QXZ A;  1KCC A;  1O8H A;  2IOU G;  1AIR A;  1QRC A;  3SY2 A;  4C2L A;  3N6Z A;  3JX8 A;  1OFD A;  4V02 C;  1LLZ A;  1QA3 A;  1RMG A;  2XT4 A;  4OJL A;  2XT2 A;  4URR A;  4I84 A;  1LLW A;  2V5I A;  4EW9 A;  2NTP A;  2VJJ A;  4XOT A;  2XTW A;  2X6X A;  4YFO A;  2W7Z A;  1OGO X;  4W8R A;  3ML3 A;  5DNS A;  4U4B A;  4XNF A;  2BM7 A;  4XLH A;  2XC1 A;  4XR6 A;  1WXR A;  3AK5 A;  4W8T A;  1OGM X;  1HG8 A;  2NST A;  1QQ1 A;  1L1I A;  1O8I A;  4XN3 A;  2IQ7 A;  3WWG A;  4JRA C;  4XKW A;  4W8Q A;  3PSS A;  4OJ6 A;  1JRG A;  4XLF A;  2PEC A;  3B4N A;  3PET A;  1BHE A;  4OJO A;  4Z03 A;  2XTX A;  2VBK A;  2X85 A;  1IB4 A;  2VJI A;  4Z05 A;  2BM6 A;  4YEL A;  1IDK A;  2INV A;  4XOR A;  1EE6 A;  2NSP A;  1NHC A;  4XMY A;  1O8M A;  3SYJ A;  3TH0 A;  2NT9 A;  3T9G A;  3KRG A;  3P4G A;  3DU1 X;  4YEI A;  5C1E A;  2BX6 A;  4PMH A;  4Z06 A;  3GQA A;  2YUH A;  1IA5 A;  1JTA A;  1OOC A;  1TYW A;  1XG2 A;  2X6Y A;  3B8Y A;  4OZY A;  1QA2 A;  1VBL A;  3LYC A;  3NAW A;  3BH7 B;  5JMC B;  2O04 A;  1WMR A;  1CLW A;  1OFM A;  2VFM A;  1PXZ A;  2G0Y A;  1BN8 A;  3GRH A;  3ZPP A;  3LMW A;  2NT6 A;  4MR0 A;  4XQF A;  5C1C A;  1EZG A;  4YC5 A;  1DBO A;  3ZSC A;  2NZM A;  5JLV C;  3GQ7 A;  1TYV A;  3VSU A;  1OFE A;  2O17 A;  2ODL A;  3GQ8 A;  1O8D A;  1O8K A;  1K4Z A;  1X0C A;  1O8L A;  3LJY A;  1DBG A;  4XM3 A;  3SUC A;  3EQN A;  1PE9 A;  1RWR A;  2EWE A;  2VBE A; 
#chains in the Genus database with same CATH homology
 2NTQ A;  1OFL A;  4YZ0 A;  4XLA A;  1K5C A;  1H80 A;  2PYG A;  4YZX A;  4XKV A;  3VMW A;  1QCX A;  5AMV A;  4OJ5 A;  1O8E A;  4HWV A;  2X6W A;  2UVE A;  3VMV A;  4NK6 A;  1PLU A;  1QJV A;  4AVZ A;  4YEJ A;  1KCD A;  2O0V A;  1O88 A;  2O0W A;  2BSP A;  2Z8G A;  4OJP A;  4XOP A;  2X3H A;  2O1D A;  2NTB A;  4MXN A;  2VBM A;  1RU4 A;  1O8G A;  4XLC A;  4XON A;  2QX3 A;  4YZQ A;  3B90 A;  3JUR A;  4OZZ A;  4XLE A;  3GQ9 A;  1CZF A;  3VSV A;  2UVF A;  4NK8 A;  1IDJ A;  2QY1 A;  1GQ8 A;  1O8F A;  2INU A;  3FY3 A;  1O8J A;  1KTW A;  3EQO A;  4U49 A;  4XL9 A;  4W8S A;  3VST A;  4XN0 A;  2PYH A;  4YZA A;  3UW0 A;  2QXZ A;  1KCC A;  1O8H A;  4C2L A;  1AIR A;  1RMG A;  4OJL A;  4URR A;  4I84 A;  4EW9 A;  2NTP A;  2VJJ A;  4XOT A;  2X6X A;  4W8R A;  1OGO X;  4U4B A;  4XNF A;  4XLH A;  4XR6 A;  4W8T A;  1OGM X;  1HG8 A;  2NST A;  1O8I A;  4XN3 A;  2IQ7 A;  3WWG A;  4XKW A;  4W8Q A;  4OJ6 A;  1JRG A;  4XLF A;  2PEC A;  3B4N A;  1BHE A;  4OJO A;  4Z03 A;  2VBK A;  2X85 A;  1IB4 A;  2VJI A;  4Z05 A;  4YEL A;  1IDK A;  2INV A;  4XOR A;  1EE6 A;  2NSP A;  1NHC A;  4XMY A;  1O8M A;  2NT9 A;  3T9G A;  3KRG A;  5C1E A;  4PMH A;  4Z06 A;  3GQA A;  1IA5 A;  1JTA A;  1OOC A;  1XG2 A;  2X6Y A;  3B8Y A;  4OZY A;  1VBL A;  2O04 A;  1WMR A;  1OFM A;  1PXZ A;  1BN8 A;  3GRH A;  3ZPP A;  3LMW A;  2NT6 A;  4MR0 A;  4XQF A;  5C1C A;  1DBO A;  3ZSC A;  2NZM A;  3GQ7 A;  3VSU A;  2O17 A;  3GQ8 A;  2ODL A;  1O8D A;  1O8K A;  1X0C A;  1O8L A;  1DBG A;  4XM3 A;  3SUC A;  3EQN A;  1PE9 A;  1RWR A;  2EWE A;  2VBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...