4URRA

Tailspike protein of sf6 bacteriophage bound to shigella flexneri o- antigen octasaccharide fragment
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
509
structure length
509
Chain Sequence
b'GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSAAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLAYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL TAIL PROTEIN
publication title Shigella Flexneri O-Polysaccharide Fragments Interacting with the Tailspike Protein of Bacteriophage Sf6
rcsb
source organism Shigella phage sf6
molecule tags Hydrolase
total genus 188
structure length 509
sequence length 509
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.-:
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4urrA00
4W8SA 1O8EA 4Z03A 4XLCA 1O8IA 1RU4A 2QY1A 1JRGA 3T9GA 1O88A 2NTQA 2O0WA 4OJLA 2VBKA 1O8KA 1H80A 1KCCA 1DBGA 4XKVA 4YZQA 2O17A 4XLAA 1NHCA 5AMVA 2PYGA 3EQNA 2X6WA 4U49A 4EW9A 2UVEA 3B4NA 1O8GA 4URRA 3UW0A 4YELA 2NT9A 1IB4A 1XG2A 4W8QA 1O8MA 1DBOA 3SUCA 3B90A 4MXNA 4Z05A 2O1DA 2X85A 4XMYA 1QJVA 2ODLA 1O8LA 1OFMA 4XN3A 3EQOA 1KCDA 4OJ6A 4XLFA 4XNFA 2UVFA 2VJJA 4XM3A 1KTWA 2O04A 1X0CA 2NT6A 2INUA 2NTPA 2X6YA 4OZYA 2VJIA 1VBLA 4HWVA 4AVZA 1IA5A 1JTAA 2Z8GA 1GQ8A 3GQ9A 4I84A 4YEJA 4XQFA 4OJ5A 1BHEA 4XL9A 1IDJA 3ZPPA 2VBEA 2IQ7A 4XKWA 3VSTA 2INVA 1O8FA 1O8DA 3ZSCA 3GQ7A 4W8TA 2QX3A 3LMWA 3GQ8A 1O8JA 2PYHA 2NTBA 4XORA 3FY3A 4W8RA 1IDKA 2NZMA 1BN8A 4MR0A 1OGMX 3GRHA 4XN0A 1OFLA 2NSTA 4U4BA 4YZXA 4XONA 1RMGA 1EE6A 1K5CA 1HG8A 2O0VA 4PMHA 2BSPA 3VMWA 2X3HA 4XR6A 1OOCA 3JURA 4Z06A 4OJPA 1OGOX 2PECA 3VSUA 2QXZA 1RWRA 5C1EA 2X6XA 1QCXA 3B8YA 4YZAA 1WMRA 3VSVA 4OJOA 2NSPA 3GQAA 1CZFA 4XLEA 2EWEA 1O8HA 4NK6A 2VBMA 1PXZA 3KRGA 1PLUA 3WWGA 4XLHA 3VMVA 4YZ0A 4OZZA 1PE9A 1AIRA 4XOTA 4XOPA 4NK8A 5C1CA 4C2LA
chains in the Genus database with same CATH superfamily
4W8SA 2VFQA 1O8EA 4Z03A 4XLCA 1O8IA 1RU4A 2QY1A 3SY2A 2VFPA 1TYUA 1JRGA 1QA2A 3T9GA 1O88A 2NTQA 2O0WA 1QA1A 4OJLA 3SZEA 2VBKA 2XT2A 1O8KA 4YEIA 1EZGA 1H80A 1KCCA 1DBGA 4OM9A 4XKVA 4YZQA 2O17A 2XC1A 4XLAA 1DABA 1NHCA 5AMVA 2VFOA 2PYGA 3EQNA 2X6WA 4U49A 4EW9A 2UVEA 3RIQA 1TYWA 3B4NA 1O8GA 4URRA 3UW0A 4YELA 2NT9A 1IB4A 1XG2A 1TSPA 4W8QA 1KQ5A 1O8MA 2G0YA 1OFEA 1DBOA 3SUCA 3B90A 1K4ZA 4MXNA 2IOUG 4Z05A 2O1DA 1K8FA 2X85A 4XMYA 1QJVA 2ODLA 1O8LA 1OFMA 3ML3A 4XN3A 2QYUA 3EQOA 2XT4A 1KCDA 4OJ6A 4XLFA 1LLZA 2UVFA 2VJJA 4JRAC 1LLWA 4XM3A 4XNFA 2BX6A 3NB2A 1KTWA 2O04A 1X0CA 2NT6A 2INUA 2NTPA 4OPWA 5DNSA 3TH0A 3AK5A 2F3LA 1OFDA 2X6YA 4OZYA 2VJIA 1VBLA 4HWVA 3H09A 4YC5A 3DU1X 4AVZA 2XTWA 1JTAA 1IA5A 2J8IA 2Z8GA 1GQ8A 3GQ9A 4I84A 4YEJA 2VFNA 4XQFA 1EA0A 4OJ5A 1BHEA 3PSZA 4XL9A 1IDJA 3ZPPA 2VBEA 2IQ7A 3NAWA 4XKWA 3SQVA 3VSTA 2INVA 1O8FA 1O8DA 3ZSCA 1WXRA 3GQ7A 4W8TA 2QX3A 3LMWA 5JLVC 3GQ8A 1O8JA 2PYHA 2J8KA 2NTBA 4XORA 2BM4A 3FY3A 4YFOA 4W8RA 1IDKA 2NZMA 2B0RA 1BN8A 2O6WA 1LM1A 4MR0A 1OGMX 3GRHA 4XN0A 1OFLA 1TYVA 2NSTA 3P4GA 4U4BA 4YZXA 4XONA 1QA3A 1RMGA 1EE6A 4YDTA 2VFMA 1K5CA 3LYCA 2XTXA 1HG8A 1QRCA 2W7ZA 3BH7B 2O0VA 4PMHA 1L1IA 3JX8A 1TYXA 2BSPA 4YCQA 2X3HA 3VMWA 4XR6A 1OOCA 3JURA 1CLWA 4OJPA 4Z06A 3BH6B 1OGOX 2BM6A 2PECA 3VSUA 2QXZA 2XTYA 1RWRA 5C1EA 2X6XA 1QCXA 3B8YA 4KH3A 3LJYA 4YZAA 1WMRA 3VSVA 4OJOA 5JMCB 2NSPA 3GQAA 1CZFA 4XLEA 2EWEA 3SYJA 2YUHA 1O8HA 4NK6A 2VBMA 3PSSA 1QRBA 1PXZA 2V5IA 3KRGA 1PLUA 3WWGA 4XLHA 3VMVA 4YZ0A 3PETA 4V02C 1QQ1A 2QZAA 2BM5A 4OZZA 3N90A 1PE9A 1AIRA 4XOTA 4XOPA 2BM7A 4NK8A 3N6ZA 5C1CA 1HF2A 4C2LA
chains in the Genus database with same CATH topology
4W8SA 1O8EA 4Z03A 4XLCA 1O8IA 1RU4A 2QY1A 1JRGA 3T9GA 1O88A 2NTQA 2O0WA 4OJLA 2VBKA 1O8KA 1H80A 1KCCA 1DBGA 4XKVA 4YZQA 2O17A 4XLAA 1NHCA 5AMVA 2PYGA 3EQNA 2X6WA 4U49A 4EW9A 2UVEA 3B4NA 1O8GA 4URRA 3UW0A 4YELA 2NT9A 1IB4A 1XG2A 4W8QA 1O8MA 1DBOA 3SUCA 3B90A 4MXNA 4Z05A 2O1DA 2X85A 4XMYA 1QJVA 2ODLA 1O8LA 1OFMA 4XN3A 3EQOA 1KCDA 4OJ6A 4XLFA 4XNFA 2UVFA 2VJJA 4XM3A 1KTWA 2O04A 1X0CA 2NT6A 2INUA 2NTPA 2X6YA 4OZYA 2VJIA 1VBLA 4HWVA 4AVZA 1IA5A 1JTAA 2Z8GA 1GQ8A 3GQ9A 4I84A 4YEJA 4XQFA 4OJ5A 1BHEA 4XL9A 1IDJA 3ZPPA 2VBEA 2IQ7A 4XKWA 3VSTA 2INVA 1O8FA 1O8DA 3ZSCA 3GQ7A 4W8TA 2QX3A 3LMWA 3GQ8A 1O8JA 2PYHA 2NTBA 4XORA 3FY3A 4W8RA 1IDKA 2NZMA 1BN8A 4MR0A 1OGMX 3GRHA 4XN0A 1OFLA 2NSTA 4U4BA 4YZXA 4XONA 1RMGA 1EE6A 1K5CA 1HG8A 2O0VA 4PMHA 2BSPA 3VMWA 2X3HA 4XR6A 1OOCA 3JURA 4Z06A 4OJPA 1OGOX 2PECA 3VSUA 2QXZA 1RWRA 5C1EA 2X6XA 1QCXA 3B8YA 4YZAA 1WMRA 3VSVA 4OJOA 2NSPA 3GQAA 1CZFA 4XLEA 2EWEA 1O8HA 4NK6A 2VBMA 1PXZA 3KRGA 1PLUA 3WWGA 4XLHA 3VMVA 4YZ0A 4OZZA 1PE9A 1AIRA 4XOTA 4XOPA 4NK8A 5C1CA 4C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8S A;  1O8E A;  4Z03 A;  4XLC A;  1O8I A;  1RU4 A;  2QY1 A;  1JRG A;  3T9G A;  1O88 A;  2NTQ A;  2O0W A;  4OJL A;  2VBK A;  1O8K A;  1H80 A;  1KCC A;  1DBG A;  4XKV A;  4YZQ A;  2O17 A;  4XLA A;  1NHC A;  5AMV A;  2PYG A;  3EQN A;  2X6W A;  4U49 A;  4EW9 A;  2UVE A;  3B4N A;  1O8G A;  4URR A;  3UW0 A;  4YEL A;  2NT9 A;  1IB4 A;  1XG2 A;  4W8Q A;  1O8M A;  1DBO A;  3SUC A;  3B90 A;  4MXN A;  4Z05 A;  2O1D A;  2X85 A;  4XMY A;  1QJV A;  2ODL A;  1O8L A;  1OFM A;  4XN3 A;  3EQO A;  1KCD A;  4OJ6 A;  4XLF A;  4XNF A;  2UVF A;  2VJJ A;  4XM3 A;  1KTW A;  2O04 A;  1X0C A;  2NT6 A;  2INU A;  2NTP A;  2X6Y A;  4OZY A;  2VJI A;  1VBL A;  4HWV A;  4AVZ A;  1IA5 A;  1JTA A;  2Z8G A;  1GQ8 A;  3GQ9 A;  4I84 A;  4YEJ A;  4XQF A;  4OJ5 A;  1BHE A;  4XL9 A;  1IDJ A;  3ZPP A;  2VBE A;  2IQ7 A;  4XKW A;  3VST A;  2INV A;  1O8F A;  1O8D A;  3ZSC A;  3GQ7 A;  4W8T A;  2QX3 A;  3LMW A;  3GQ8 A;  1O8J A;  2PYH A;  2NTB A;  4XOR A;  3FY3 A;  4W8R A;  1IDK A;  2NZM A;  1BN8 A;  4MR0 A;  1OGM X;  3GRH A;  4XN0 A;  1OFL A;  2NST A;  4U4B A;  4YZX A;  4XON A;  1RMG A;  1EE6 A;  1K5C A;  1HG8 A;  2O0V A;  4PMH A;  2BSP A;  3VMW A;  2X3H A;  4XR6 A;  1OOC A;  3JUR A;  4Z06 A;  4OJP A;  1OGO X;  2PEC A;  3VSU A;  2QXZ A;  1RWR A;  5C1E A;  2X6X A;  1QCX A;  3B8Y A;  4YZA A;  1WMR A;  3VSV A;  4OJO A;  2NSP A;  3GQA A;  1CZF A;  4XLE A;  2EWE A;  1O8H A;  4NK6 A;  2VBM A;  1PXZ A;  3KRG A;  1PLU A;  3WWG A;  4XLH A;  3VMV A;  4YZ0 A;  4OZZ A;  1PE9 A;  1AIR A;  4XOT A;  4XOP A;  4NK8 A;  5C1C A;  4C2L A; 
#chains in the Genus database with same CATH topology
 4W8S A;  2VFQ A;  1O8E A;  4Z03 A;  4XLC A;  1O8I A;  1RU4 A;  2QY1 A;  3SY2 A;  2VFP A;  1TYU A;  1JRG A;  1QA2 A;  3T9G A;  1O88 A;  2NTQ A;  2O0W A;  1QA1 A;  4OJL A;  3SZE A;  2VBK A;  2XT2 A;  1O8K A;  4YEI A;  1EZG A;  1H80 A;  1KCC A;  1DBG A;  4OM9 A;  4XKV A;  4YZQ A;  2O17 A;  2XC1 A;  4XLA A;  1DAB A;  1NHC A;  5AMV A;  2VFO A;  2PYG A;  3EQN A;  2X6W A;  4U49 A;  4EW9 A;  2UVE A;  3RIQ A;  1TYW A;  3B4N A;  1O8G A;  4URR A;  3UW0 A;  4YEL A;  2NT9 A;  1IB4 A;  1XG2 A;  1TSP A;  4W8Q A;  1KQ5 A;  1O8M A;  2G0Y A;  1OFE A;  1DBO A;  3SUC A;  3B90 A;  1K4Z A;  4MXN A;  2IOU G;  4Z05 A;  2O1D A;  1K8F A;  2X85 A;  4XMY A;  1QJV A;  2ODL A;  1O8L A;  1OFM A;  3ML3 A;  4XN3 A;  2QYU A;  3EQO A;  2XT4 A;  1KCD A;  4OJ6 A;  4XLF A;  1LLZ A;  2UVF A;  2VJJ A;  4JRA C;  1LLW A;  4XM3 A;  4XNF A;  2BX6 A;  3NB2 A;  1KTW A;  2O04 A;  1X0C A;  2NT6 A;  2INU A;  2NTP A;  4OPW A;  5DNS A;  3TH0 A;  3AK5 A;  2F3L A;  1OFD A;  2X6Y A;  4OZY A;  2VJI A;  1VBL A;  4HWV A;  3H09 A;  4YC5 A;  3DU1 X;  4AVZ A;  2XTW A;  1JTA A;  1IA5 A;  2J8I A;  2Z8G A;  1GQ8 A;  3GQ9 A;  4I84 A;  4YEJ A;  2VFN A;  4XQF A;  1EA0 A;  4OJ5 A;  1BHE A;  3PSZ A;  4XL9 A;  1IDJ A;  3ZPP A;  2VBE A;  2IQ7 A;  3NAW A;  4XKW A;  3SQV A;  3VST A;  2INV A;  1O8F A;  1O8D A;  3ZSC A;  1WXR A;  3GQ7 A;  4W8T A;  2QX3 A;  3LMW A;  5JLV C;  3GQ8 A;  1O8J A;  2PYH A;  2J8K A;  2NTB A;  4XOR A;  2BM4 A;  3FY3 A;  4YFO A;  4W8R A;  1IDK A;  2NZM A;  2B0R A;  1BN8 A;  2O6W A;  1LM1 A;  4MR0 A;  1OGM X;  3GRH A;  4XN0 A;  1OFL A;  1TYV A;  2NST A;  3P4G A;  4U4B A;  4YZX A;  4XON A;  1QA3 A;  1RMG A;  1EE6 A;  4YDT A;  2VFM A;  1K5C A;  3LYC A;  2XTX A;  1HG8 A;  1QRC A;  2W7Z A;  3BH7 B;  2O0V A;  4PMH A;  1L1I A;  3JX8 A;  1TYX A;  2BSP A;  4YCQ A;  2X3H A;  3VMW A;  4XR6 A;  1OOC A;  3JUR A;  1CLW A;  4OJP A;  4Z06 A;  3BH6 B;  1OGO X;  2BM6 A;  2PEC A;  3VSU A;  2QXZ A;  2XTY A;  1RWR A;  5C1E A;  2X6X A;  1QCX A;  3B8Y A;  4KH3 A;  3LJY A;  4YZA A;  1WMR A;  3VSV A;  4OJO A;  5JMC B;  2NSP A;  3GQA A;  1CZF A;  4XLE A;  2EWE A;  3SYJ A;  2YUH A;  1O8H A;  4NK6 A;  2VBM A;  3PSS A;  1QRB A;  1PXZ A;  2V5I A;  3KRG A;  1PLU A;  3WWG A;  4XLH A;  3VMV A;  4YZ0 A;  3PET A;  4V02 C;  1QQ1 A;  2QZA A;  2BM5 A;  4OZZ A;  3N90 A;  1PE9 A;  1AIR A;  4XOT A;  4XOP A;  2BM7 A;  4NK8 A;  3N6Z A;  5C1C A;  1HF2 A;  4C2L A; 
#chains in the Genus database with same CATH homology
 4W8S A;  1O8E A;  4Z03 A;  4XLC A;  1O8I A;  1RU4 A;  2QY1 A;  1JRG A;  3T9G A;  1O88 A;  2NTQ A;  2O0W A;  4OJL A;  2VBK A;  1O8K A;  1H80 A;  1KCC A;  1DBG A;  4XKV A;  4YZQ A;  2O17 A;  4XLA A;  1NHC A;  5AMV A;  2PYG A;  3EQN A;  2X6W A;  4U49 A;  4EW9 A;  2UVE A;  3B4N A;  1O8G A;  4URR A;  3UW0 A;  4YEL A;  2NT9 A;  1IB4 A;  1XG2 A;  4W8Q A;  1O8M A;  1DBO A;  3SUC A;  3B90 A;  4MXN A;  4Z05 A;  2O1D A;  2X85 A;  4XMY A;  1QJV A;  2ODL A;  1O8L A;  1OFM A;  4XN3 A;  3EQO A;  1KCD A;  4OJ6 A;  4XLF A;  4XNF A;  2UVF A;  2VJJ A;  4XM3 A;  1KTW A;  2O04 A;  1X0C A;  2NT6 A;  2INU A;  2NTP A;  2X6Y A;  4OZY A;  2VJI A;  1VBL A;  4HWV A;  4AVZ A;  1IA5 A;  1JTA A;  2Z8G A;  1GQ8 A;  3GQ9 A;  4I84 A;  4YEJ A;  4XQF A;  4OJ5 A;  1BHE A;  4XL9 A;  1IDJ A;  3ZPP A;  2VBE A;  2IQ7 A;  4XKW A;  3VST A;  2INV A;  1O8F A;  1O8D A;  3ZSC A;  3GQ7 A;  4W8T A;  2QX3 A;  3LMW A;  3GQ8 A;  1O8J A;  2PYH A;  2NTB A;  4XOR A;  3FY3 A;  4W8R A;  1IDK A;  2NZM A;  1BN8 A;  4MR0 A;  1OGM X;  3GRH A;  4XN0 A;  1OFL A;  2NST A;  4U4B A;  4YZX A;  4XON A;  1RMG A;  1EE6 A;  1K5C A;  1HG8 A;  2O0V A;  4PMH A;  2BSP A;  3VMW A;  2X3H A;  4XR6 A;  1OOC A;  3JUR A;  4Z06 A;  4OJP A;  1OGO X;  2PEC A;  3VSU A;  2QXZ A;  1RWR A;  5C1E A;  2X6X A;  1QCX A;  3B8Y A;  4YZA A;  1WMR A;  3VSV A;  4OJO A;  2NSP A;  3GQA A;  1CZF A;  4XLE A;  2EWE A;  1O8H A;  4NK6 A;  2VBM A;  1PXZ A;  3KRG A;  1PLU A;  3WWG A;  4XLH A;  3VMV A;  4YZ0 A;  4OZZ A;  1PE9 A;  1AIR A;  4XOT A;  4XOP A;  4NK8 A;  5C1C A;  4C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...