4URRA

Tailspike protein of sf6 bacteriophage bound to shigella flexneri o- antigen octasaccharide fragment
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSAAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLAYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Shigella Flexneri O-Polysaccharide Fragments Interacting with the Tailspike Protein of Bacteriophage Sf6
rcsb
source organism Shigella phage sf6
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL TAIL PROTEIN
total genus 188
structure length 509
sequence length 509
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.-:
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4urrA00
1O8IA 4XLAA 2INUA 2QY1A 1KCDA 1O8MA 3LMWA 4XKWA 1OGMX 1DBOA 4XNFA 2O17A 4W8RA 4YZAA 3JURA 1O8HA 2NZMA 1O8KA 1PLUA 1CZFA 1JTAA 1O8JA 2X6XA 4OJLA 2BSPA 2NSTA 3ZSCA 4PMHA 2UVFA 2X85A 2NSPA 4XLEA 2EWEA 4Z03A 2NTQA 4XM3A 1RU4A 4Z06A 4XORA 2X3HA 1DBGA 1O8EA 3GQ7A 3VMWA 4XN0A 3B8YA 4W8SA 4MR0A 1O88A 2QX3A 3UW0A 4U49A 4Z05A 1IA5A 1WMRA 1AIRA 5C1EA 1JRGA 1BHEA 2PYHA 2VBMA 4XKVA 1X0CA 1O8DA 3WWGA 3EQNA 1QCXA 5AMVA 2NT9A 3T9GA 3GQ8A 2PYGA 4C2LA 2NTBA 2ODLA 2IQ7A 4OJPA 1IB4A 4XOPA 1OFLA 3SUCA 1QJVA 3KRGA 4XR6A 2Z8GA 4XLFA 3GRHA 4XMYA 2VBKA 1VBLA 4YZ0A 4W8TA 4NK6A 1O8LA 4OZYA 1RMGA 2VJJA 4MXNA 3VMVA 4U4BA 4YEJA 2O1DA 3GQAA 3VSTA 1KCCA 2VBEA 2X6WA 1OOCA 1RWRA 4HWVA 4XLCA 4I84A 4EW9A 2O0WA 4AVZA 1NHCA 4OJ5A 1EE6A 4XONA 4YZQA 4OJOA 1O8FA 1K5CA 2O0VA 4XOTA 4OZZA 1GQ8A 1H80A 3B90A 1PXZA 3VSVA 1OGOX 1O8GA 3ZPPA 3VSUA 2NT6A 2O04A 4XL9A 2X6YA 2VJIA 3EQOA 1KTWA 4XQFA 4YZXA 2UVEA 4XLHA 4W8QA 4URRA 1XG2A 4OJ6A 2PECA 4NK8A 4YELA 4XN3A 3B4NA 2NTPA 3GQ9A 1OFMA 1IDKA 5C1CA 1PE9A 1HG8A 2INVA 2QXZA 1BN8A 3FY3A 1IDJA
chains in the Genus database with same CATH superfamily
1O8IA 2QXZA 2XTYA 4XLAA 4YC5A 2INUA 2QY1A 1KCDA 1O8MA 3LMWA 4XKWA 1QA2A 1OGMX 2O6WA 1QRBA 1DBOA 4XNFA 2O17A 4W8RA 4YZAA 3JURA 1O8HA 2NZMA 5DNSA 2BM6A 1O8KA 1PLUA 1CZFA 1JTAA 1O8JA 4KH3A 2X6XA 4OJLA 1EA0A 4YEIA 2BSPA 3BH6B 2BM7A 2NSTA 3ZSCA 4PMHA 2UVFA 2X85A 2NSPA 4XLEA 2EWEA 2XT2A 4Z03A 2NTQA 4XM3A 1RU4A 4Z06A 1K8FA 4XORA 2X3HA 3N6ZA 1DBGA 3SZEA 2B0RA 2BM5A 2VFNA 1O8EA 3GQ7A 3VMWA 4XN0A 1TYXA 3B8YA 4W8SA 4MR0A 1O88A 4OM9A 3NB2A 2QX3A 3UW0A 4U49A 4Z05A 1IA5A 1WMRA 1AIRA 3SYJA 5C1EA 1JRGA 1BHEA 3LYCA 2PYHA 2J8KA 2VBMA 4XKVA 1X0CA 1EZGA 1O8DA 3SQVA 3WWGA 3EQNA 1QCXA 5AMVA 2NT9A 4YDTA 3T9GA 3GQ8A 3NAWA 2PYGA 4C2LA 2NTBA 2ODLA 1TYVA 2IQ7A 2G0YA 2XTWA 4OJPA 1K4ZA 3SY2A 1IB4A 4XOPA 2BM4A 2QZAA 1OFLA 4JRAC 3SUCA 1QJVA 2VFOA 3KRGA 3TH0A 4XR6A 2Z8GA 4XLFA 3GRHA 4XMYA 4V02C 2J8IA 1QA1A 2VBKA 1VBLA 1DABA 4YZ0A 1QQ1A 4W8TA 4NK6A 1O8LA 1TYUA 4OZYA 1RMGA 2VJJA 4MXNA 3VMVA 3BH7B 3DU1X 3P4GA 4U4BA 4YEJA 2O1DA 1CLWA 3GQAA 1QA3A 1L1IA 4OPWA 3VSTA 1LLZA 1KCCA 2V5IA 2VBEA 2X6WA 1OOCA 1RWRA 1OFEA 4HWVA 1QRCA 3RIQA 4XLCA 4I84A 4EW9A 2O0WA 2VFMA 4AVZA 1LM1A 1NHCA 4OJ5A 2YUHA 1EE6A 3AK5A 1OFDA 3JX8A 3H09A 4XONA 1TYWA 4YZQA 1TSPA 4OJOA 1O8FA 3PSSA 1K5CA 2O0VA 4XOTA 4OZZA 1GQ8A 2XTXA 1H80A 2VFQA 3B90A 1PXZA 3VSVA 1OGOX 1LLWA 3ZPPA 5JLVC 3VSUA 2NT6A 2O04A 4XL9A 2X6YA 2IOUG 2VJIA 4YFOA 3EQOA 1HF2A 1KTWA 3PSZA 4XQFA 4YZXA 3N90A 2XT4A 2UVEA 4XLHA 4W8QA 3ML3A 4URRA 1XG2A 4OJ6A 5JMCB 2F3LA 3LJYA 2PECA 4NK8A 4YELA 4YCQA 3PETA 4XN3A 3B4NA 2NTPA 3GQ9A 2QYUA 2W7ZA 2BX6A 1WXRA 1OFMA 1KQ5A 1IDKA 2VFPA 5C1CA 1PE9A 1HG8A 2INVA 2XC1A 1O8GA 1BN8A 3FY3A 1IDJA
chains in the Genus database with same CATH topology
1O8IA 4XLAA 2INUA 2QY1A 1KCDA 1O8MA 3LMWA 4XKWA 1OGMX 1DBOA 4XNFA 2O17A 4W8RA 4YZAA 3JURA 1O8HA 2NZMA 1O8KA 1PLUA 1CZFA 1JTAA 1O8JA 2X6XA 4OJLA 2BSPA 2NSTA 3ZSCA 4PMHA 2UVFA 2X85A 2NSPA 4XLEA 2EWEA 4Z03A 2NTQA 4XM3A 1RU4A 4Z06A 4XORA 2X3HA 1DBGA 1O8EA 3GQ7A 3VMWA 4XN0A 3B8YA 4W8SA 4MR0A 1O88A 2QX3A 3UW0A 4U49A 4Z05A 1IA5A 1WMRA 1AIRA 5C1EA 1JRGA 1BHEA 2PYHA 2VBMA 4XKVA 1X0CA 1O8DA 3WWGA 3EQNA 1QCXA 5AMVA 2NT9A 3T9GA 3GQ8A 2PYGA 4C2LA 2NTBA 2ODLA 2IQ7A 4OJPA 1IB4A 4XOPA 1OFLA 3SUCA 1QJVA 3KRGA 4XR6A 2Z8GA 4XLFA 3GRHA 4XMYA 2VBKA 1VBLA 4YZ0A 4W8TA 4NK6A 1O8LA 4OZYA 1RMGA 2VJJA 4MXNA 3VMVA 4U4BA 4YEJA 2O1DA 3GQAA 3VSTA 1KCCA 2VBEA 2X6WA 1OOCA 1RWRA 4HWVA 4XLCA 4I84A 4EW9A 2O0WA 4AVZA 1NHCA 4OJ5A 1EE6A 4XONA 4YZQA 4OJOA 1O8FA 1K5CA 2O0VA 4XOTA 4OZZA 1GQ8A 1H80A 3B90A 1PXZA 3VSVA 1OGOX 1O8GA 3ZPPA 3VSUA 2NT6A 2O04A 4XL9A 2X6YA 2VJIA 3EQOA 1KTWA 4XQFA 4YZXA 2UVEA 4XLHA 4W8QA 4URRA 1XG2A 4OJ6A 2PECA 4NK8A 4YELA 4XN3A 3B4NA 2NTPA 3GQ9A 1OFMA 1IDKA 5C1CA 1PE9A 1HG8A 2INVA 2QXZA 1BN8A 3FY3A 1IDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8I A;  4XLA A;  2INU A;  2QY1 A;  1KCD A;  1O8M A;  3LMW A;  4XKW A;  1OGM X;  1DBO A;  4XNF A;  2O17 A;  4W8R A;  4YZA A;  3JUR A;  1O8H A;  2NZM A;  1O8K A;  1PLU A;  1CZF A;  1JTA A;  1O8J A;  2X6X A;  4OJL A;  2BSP A;  2NST A;  3ZSC A;  4PMH A;  2UVF A;  2X85 A;  2NSP A;  4XLE A;  2EWE A;  4Z03 A;  2NTQ A;  4XM3 A;  1RU4 A;  4Z06 A;  4XOR A;  2X3H A;  1DBG A;  1O8E A;  3GQ7 A;  3VMW A;  4XN0 A;  3B8Y A;  4W8S A;  4MR0 A;  1O88 A;  2QX3 A;  3UW0 A;  4U49 A;  4Z05 A;  1IA5 A;  1WMR A;  1AIR A;  5C1E A;  1JRG A;  1BHE A;  2PYH A;  2VBM A;  4XKV A;  1X0C A;  1O8D A;  3WWG A;  3EQN A;  1QCX A;  5AMV A;  2NT9 A;  3T9G A;  3GQ8 A;  2PYG A;  4C2L A;  2NTB A;  2ODL A;  2IQ7 A;  4OJP A;  1IB4 A;  4XOP A;  1OFL A;  3SUC A;  1QJV A;  3KRG A;  4XR6 A;  2Z8G A;  4XLF A;  3GRH A;  4XMY A;  2VBK A;  1VBL A;  4YZ0 A;  4W8T A;  4NK6 A;  1O8L A;  4OZY A;  1RMG A;  2VJJ A;  4MXN A;  3VMV A;  4U4B A;  4YEJ A;  2O1D A;  3GQA A;  3VST A;  1KCC A;  2VBE A;  2X6W A;  1OOC A;  1RWR A;  4HWV A;  4XLC A;  4I84 A;  4EW9 A;  2O0W A;  4AVZ A;  1NHC A;  4OJ5 A;  1EE6 A;  4XON A;  4YZQ A;  4OJO A;  1O8F A;  1K5C A;  2O0V A;  4XOT A;  4OZZ A;  1GQ8 A;  1H80 A;  3B90 A;  1PXZ A;  3VSV A;  1OGO X;  1O8G A;  3ZPP A;  3VSU A;  2NT6 A;  2O04 A;  4XL9 A;  2X6Y A;  2VJI A;  3EQO A;  1KTW A;  4XQF A;  4YZX A;  2UVE A;  4XLH A;  4W8Q A;  4URR A;  1XG2 A;  4OJ6 A;  2PEC A;  4NK8 A;  4YEL A;  4XN3 A;  3B4N A;  2NTP A;  3GQ9 A;  1OFM A;  1IDK A;  5C1C A;  1PE9 A;  1HG8 A;  2INV A;  2QXZ A;  1BN8 A;  3FY3 A;  1IDJ A; 
#chains in the Genus database with same CATH topology
 1O8I A;  2QXZ A;  2XTY A;  4XLA A;  4YC5 A;  2INU A;  2QY1 A;  1KCD A;  1O8M A;  3LMW A;  4XKW A;  1QA2 A;  1OGM X;  2O6W A;  1QRB A;  1DBO A;  4XNF A;  2O17 A;  4W8R A;  4YZA A;  3JUR A;  1O8H A;  2NZM A;  5DNS A;  2BM6 A;  1O8K A;  1PLU A;  1CZF A;  1JTA A;  1O8J A;  4KH3 A;  2X6X A;  4OJL A;  1EA0 A;  4YEI A;  2BSP A;  3BH6 B;  2BM7 A;  2NST A;  3ZSC A;  4PMH A;  2UVF A;  2X85 A;  2NSP A;  4XLE A;  2EWE A;  2XT2 A;  4Z03 A;  2NTQ A;  4XM3 A;  1RU4 A;  4Z06 A;  1K8F A;  4XOR A;  2X3H A;  3N6Z A;  1DBG A;  3SZE A;  2B0R A;  2BM5 A;  2VFN A;  1O8E A;  3GQ7 A;  3VMW A;  4XN0 A;  1TYX A;  3B8Y A;  4W8S A;  4MR0 A;  1O88 A;  4OM9 A;  3NB2 A;  2QX3 A;  3UW0 A;  4U49 A;  4Z05 A;  1IA5 A;  1WMR A;  1AIR A;  3SYJ A;  5C1E A;  1JRG A;  1BHE A;  3LYC A;  2PYH A;  2J8K A;  2VBM A;  4XKV A;  1X0C A;  1EZG A;  1O8D A;  3SQV A;  3WWG A;  3EQN A;  1QCX A;  5AMV A;  2NT9 A;  4YDT A;  3T9G A;  3GQ8 A;  3NAW A;  2PYG A;  4C2L A;  2NTB A;  2ODL A;  1TYV A;  2IQ7 A;  2G0Y A;  2XTW A;  4OJP A;  1K4Z A;  3SY2 A;  1IB4 A;  4XOP A;  2BM4 A;  2QZA A;  1OFL A;  4JRA C;  3SUC A;  1QJV A;  2VFO A;  3KRG A;  3TH0 A;  4XR6 A;  2Z8G A;  4XLF A;  3GRH A;  4XMY A;  4V02 C;  2J8I A;  1QA1 A;  2VBK A;  1VBL A;  1DAB A;  4YZ0 A;  1QQ1 A;  4W8T A;  4NK6 A;  1O8L A;  1TYU A;  4OZY A;  1RMG A;  2VJJ A;  4MXN A;  3VMV A;  3BH7 B;  3DU1 X;  3P4G A;  4U4B A;  4YEJ A;  2O1D A;  1CLW A;  3GQA A;  1QA3 A;  1L1I A;  4OPW A;  3VST A;  1LLZ A;  1KCC A;  2V5I A;  2VBE A;  2X6W A;  1OOC A;  1RWR A;  1OFE A;  4HWV A;  1QRC A;  3RIQ A;  4XLC A;  4I84 A;  4EW9 A;  2O0W A;  2VFM A;  4AVZ A;  1LM1 A;  1NHC A;  4OJ5 A;  2YUH A;  1EE6 A;  3AK5 A;  1OFD A;  3JX8 A;  3H09 A;  4XON A;  1TYW A;  4YZQ A;  1TSP A;  4OJO A;  1O8F A;  3PSS A;  1K5C A;  2O0V A;  4XOT A;  4OZZ A;  1GQ8 A;  2XTX A;  1H80 A;  2VFQ A;  3B90 A;  1PXZ A;  3VSV A;  1OGO X;  1LLW A;  3ZPP A;  5JLV C;  3VSU A;  2NT6 A;  2O04 A;  4XL9 A;  2X6Y A;  2IOU G;  2VJI A;  4YFO A;  3EQO A;  1HF2 A;  1KTW A;  3PSZ A;  4XQF A;  4YZX A;  3N90 A;  2XT4 A;  2UVE A;  4XLH A;  4W8Q A;  3ML3 A;  4URR A;  1XG2 A;  4OJ6 A;  5JMC B;  2F3L A;  3LJY A;  2PEC A;  4NK8 A;  4YEL A;  4YCQ A;  3PET A;  4XN3 A;  3B4N A;  2NTP A;  3GQ9 A;  2QYU A;  2W7Z A;  2BX6 A;  1WXR A;  1OFM A;  1KQ5 A;  1IDK A;  2VFP A;  5C1C A;  1PE9 A;  1HG8 A;  2INV A;  2XC1 A;  1O8G A;  1BN8 A;  3FY3 A;  1IDJ A; 
#chains in the Genus database with same CATH homology
 1O8I A;  4XLA A;  2INU A;  2QY1 A;  1KCD A;  1O8M A;  3LMW A;  4XKW A;  1OGM X;  1DBO A;  4XNF A;  2O17 A;  4W8R A;  4YZA A;  3JUR A;  1O8H A;  2NZM A;  1O8K A;  1PLU A;  1CZF A;  1JTA A;  1O8J A;  2X6X A;  4OJL A;  2BSP A;  2NST A;  3ZSC A;  4PMH A;  2UVF A;  2X85 A;  2NSP A;  4XLE A;  2EWE A;  4Z03 A;  2NTQ A;  4XM3 A;  1RU4 A;  4Z06 A;  4XOR A;  2X3H A;  1DBG A;  1O8E A;  3GQ7 A;  3VMW A;  4XN0 A;  3B8Y A;  4W8S A;  4MR0 A;  1O88 A;  2QX3 A;  3UW0 A;  4U49 A;  4Z05 A;  1IA5 A;  1WMR A;  1AIR A;  5C1E A;  1JRG A;  1BHE A;  2PYH A;  2VBM A;  4XKV A;  1X0C A;  1O8D A;  3WWG A;  3EQN A;  1QCX A;  5AMV A;  2NT9 A;  3T9G A;  3GQ8 A;  2PYG A;  4C2L A;  2NTB A;  2ODL A;  2IQ7 A;  4OJP A;  1IB4 A;  4XOP A;  1OFL A;  3SUC A;  1QJV A;  3KRG A;  4XR6 A;  2Z8G A;  4XLF A;  3GRH A;  4XMY A;  2VBK A;  1VBL A;  4YZ0 A;  4W8T A;  4NK6 A;  1O8L A;  4OZY A;  1RMG A;  2VJJ A;  4MXN A;  3VMV A;  4U4B A;  4YEJ A;  2O1D A;  3GQA A;  3VST A;  1KCC A;  2VBE A;  2X6W A;  1OOC A;  1RWR A;  4HWV A;  4XLC A;  4I84 A;  4EW9 A;  2O0W A;  4AVZ A;  1NHC A;  4OJ5 A;  1EE6 A;  4XON A;  4YZQ A;  4OJO A;  1O8F A;  1K5C A;  2O0V A;  4XOT A;  4OZZ A;  1GQ8 A;  1H80 A;  3B90 A;  1PXZ A;  3VSV A;  1OGO X;  1O8G A;  3ZPP A;  3VSU A;  2NT6 A;  2O04 A;  4XL9 A;  2X6Y A;  2VJI A;  3EQO A;  1KTW A;  4XQF A;  4YZX A;  2UVE A;  4XLH A;  4W8Q A;  4URR A;  1XG2 A;  4OJ6 A;  2PEC A;  4NK8 A;  4YEL A;  4XN3 A;  3B4N A;  2NTP A;  3GQ9 A;  1OFM A;  1IDK A;  5C1C A;  1PE9 A;  1HG8 A;  2INV A;  2QXZ A;  1BN8 A;  3FY3 A;  1IDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...