4US5A

Crystal structure of apo-msno8
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
329
Chain Sequence
HVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSAEAAARLGLPYAYAHFITPQFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
total genus 119
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5A00
5DQPA 3B4YA 1BSLA 1FVPA 2B81A 3C8NA 3B9NA 1LUCB 1NFPA 4US5D 1RHCA 3FGCA 1LUCA 2I7GA 3FGCB 1XKJA 1NQKA 3SDOA 4J2PA 1Z69A 1M41A 3B9OA 4UWMA 3RAOA 5AECA 1F07A 1BRLB 1EZWA 4US5A 1BRLA 5LXEA 1TVLA 1YW1A
chains in the Genus database with same CATH superfamily
3LLXA 1MO0A 5CAHA 4KERA 3GU9A 2WNQA 3W87A 4ICNA 2NSOA 1Q7QA 4IXXA 2DEPA 1UIPA 4CN4A 4H9MA 1PCWA 3ZR6A 2DZUA 3HV9A 2BG5A 3TN5A 3LM7A 2PTZA 4DYKA 4Q4KA 3FDGA 2O9OA 1X8CA 4NQ1A 1EXPA 3BWWA 4HYWA 1O4UA 1ML1A 3CUHA 3SFWA 1V5XA 3QZEA 3SFKA 2YCJA 2CWXA 2NVAA 2W6RA 3K4DA 3TP4A 2E28A 2WHMA 4PMRA 3LBCA 4IL0A 3WD2A 3KL3A 1KKRA 3DKJA 4J2MA 3D0CA 4NX5A 3U4AA 2VOMA 3E6EA 1WZKA 4IP5A 1QW8A 1RAKA 1W1VA 1V6VA 2AL2B 3FFSA 3P80A 1S2TA 3WBEA 3IIZA 3NQVA 3W86A 3KW3A 2ZFAA 9CGTA 1S2AA 1AVAA 2VVSA 4ZQCA 4BFAA 1UKQA 1Q6GA 5CEWA 1E6ZA 2G50A 3GUWA 1F76A 3SCTA 3WDIA 2NV1A 2XGIA 4HPXA 2CLIA 4DYEA 1IE7C 3PBMA 5I78A 4LALA 3EA2A 3DOPA 3TTYA 2OWCA 2VWTA 4XVEA 4RR4A 2H90A 1XLHA 4Y9AA 3WDPP 2SFPA 2J25A 4NF7A 2GQAA 3GH7A 4O16A 5JVLA 3IJIA 4DN1A 2IQ0A 4GYJA 3V36A 4YTSA 1UC4A 2HVNA 2YR1A 1P7TA 3ABQA 5E6YA 4PGLA 1VRXA 3QGAC 4A3UA 1HW6A 1VC4A 4Z2KA 3LCGA 3OA5A 4GBUA 2C18A 3TFXA 2PPGA 3BLPX 5I0DA 4J3ZA 2DGAA 3EKGA 4RNIA 4MFEA 4GUIA 3RR1A 4AWUA 4CLMA 3VKBA 1J12A 3QOMA 2XVKA 1L2UA 3E0VA 1EOMA 3TDFA 4DJEA 4U2YA 3WF1A 3UPWA 1UD3A 1F74A 4NYYA 1YYAA 3T07A 5HR7A 1FWIC 1BAGA 2OOGA 4N0RA 1EDGA 3OLIA 4Q8WA 1DEDA 3PZUA 1J0ZA 2YXXA 2WZEA 2BLEA 3RLHA 3F4VA 3NQ2A 4FR1A 3CB3A 4MDOA 5AHFA 3D5HA 2XIMA 4MOZA 1V8EA 1XSIA 4IT1A 2JFEX 3CWNA 3QHNA 1IT8A 2IKIA 4B5UA 2I9EA 2J7EA 2X05A 3LX9A 3GFYA 4FI4A 3CUJA 3NPVA 2G3MA 4V33A 3QKEA 2W5FA 1R3TA 2FVKA 4WQ6A 3VX1A 2G37A 2RFGA 3GZ3A 3TZNA 4H6EA 4J35A 3C56A 4DWSD 1JPIA 5D9OA 4FO4A 2KAUC 4UR8A 1LROA 1HN1A 2WO5A 3CEUA 5LXEA 1UQYA 4DF1A 3SUWA 3UETA 4ZO8A 1RQBA 3TQKA 4TQTA 1KM1A 2Q02A 5C6MA 4LUSA 1J5TA 2Z24A 3SY5A 3TU9A 1MSSA 3ES8A 5E0CA 1SFSA 3LZ5A 3PTQA 1VEPA 2FLIA 2NLYA 3H26A 2B4GA 3PPCA 2O92A 2ZBTA 1VHCA 7XIMA 3I3BA 3TLLA 3H53A 1OHLA 1XLLA 4AHQA 4PODA 3LHZA 2RDUA 7REQB 4LUTA 1C92A 3H24A 4AZBA 4KMQA 2BGNE 4I5UA 3H54A 2VVNA 4WUIA 3MSGA 4QSHA 1VPXA 1Y5XA 4I6VA 4I8DA 1GEHA 2PI6A 3D46A 1CDGA 4WF7A 3I4KA 4DBWA 3FHAA 2WKLA 1YXDA 4GKLA 3QHMA 4WX2A 3GTXA 4HBKA 4GXMA 2AQOA 3EOUA 5LIUX 4BI6A 3OP2A 2WANA 1QASA 3S4TA 4IP4A 4LS1A 3L9CA 1FDJA 4GI6A 3S1UA 5IBXA 2FGZA 1L8PA 3KM8A 4R5EA 1KXVA 3LI0A 3WH7A 3XIMA 3VCNA 3NQAA 1RLCL 2ABBA 4RE2A 4G7EA 4WY0B 2NWSA 5I09A 1J18A 5LA1A 1RA5A 3WELA 4QCEA 2Y70A 3SN0A 1R2SA 3S1VA 4XD5A 3VNMA 1IYXA 3P8IA 4UFJA 2H3DA 5AVNA 4XZHA 5FACA 1ESWA 3AZSA 1VJIA 5JBEA 2J27A 3PPGA 2P88A 4EE9A 5K4ZA 3T8QA 4GH1A 3HBLA 5LNUA 3QQ1A 4KGLA 1MDRA 5T9BG 1SJAA 4CGTA 3T6CA 4TTGA 2QR6A 4MY9A 1AMKA 3M0HA 1WZAA 3AU6A 2V82A 1V3IA 1E4NA 4AWSA 5C9UA 2VFEA 1FUYA 3CO4A 3FXGA 4RW5A 4F9DA 3BCFA 1DPMA 4UR7A 3WQVA 3I6RA 3LLFA 1RD6A 5EYWA 3EMZA 1W1TA 4L4PA 3PC0A 2XIQA 2E9LA 4TV5A 1UR0A 2J88A 3EX6A 1KFJA 1FHUA 3I68A 1TA3A 4O12A 2E5CA 2YX0A 2PC8A 2G8ZA 3CAQA 1JFHA 4L4LA 4CD8A 3KE0A 3O6YX 5E1QA 4HA0A 5HPOA 2YLLA 3BW4A 3DYMA 3MMDA 1UCWA 3PBVA 1QTWA 1W1A1 1OFPA 1EUAA 3NOEA 1A4LA 5C2GA 3L4ZA 1Q2RA 1DIEA 3VE7A 5FI8A 5CG7A 1CNVA 1XIBA 5EMLA 4DJFC 3R12A 1F9CA 5EBUA 2VFFA 2E68A 4IIFA 3IIPA 4KH2A 4Q8UA 1SR0A 2ZZ1A 8TIMA 1U5VA 4LUJA 3ABOA 3RO6A 4R53A 2BSLA 4ZENA 5JQ9A 3W7OA 2J8FA 1IWPA 2FZBA 3LEPA 1O6IA 3E49A 3VNKA 4Z08A 1PDYA 4L61A 3PUDA 1OD0A 4YL2A 2XVGA 4TV6A 5FAGA 2GUYA 3ERPA 3GDRA 4K38A 3IGUA 3EOSA 4GFSA 1EBGA 1PKMA 3O1NA 1FP9A 4IUGA 4C7FA 3N2MA 1UR8A 1NFGA 5FJIA 2FVLA 2ZOXA 2G3NA 3FV9A 1EB3A 1CXKA 4JL1A 3DHFA 4IX2A 1HJUA 4C1NA 4Z2GA 3PUOA 2C1GA 2ZUMA 2ZZ7A 3KL0A 3TC3A 3BE7A 3NR0A 3NEVA 4GYKA 2E3ZA 1US0A 5IXEA 1JUKA 3HPZA 2WOQA 1ODZA 2BTMA 2QGHA 4E4PA 3IVTA 4WKAA 1H5VA 1JCMP 2FQIA 3BJSA 1NWSA 3B4YA 4GYFA 2C0HA 4RL3A 1B5TA 2HJPA 3LBMA 1N82A 1B30A 3HG3A 2WB5A 1YKWA 4LAMA 2OLHA 5JIPA 1WCGA 4HOZA 2O56A 4LY8A 2NVDA 1DQXA 5IFTA 1MDLA 1REQB 4M8UA 2HNHA 4A05A 4BCEA 1DV7A 2WC7A 4PRTA 5JH2A 4KCUA 2FTYA 1RV8A 3MMTA 3Q37A 5DQPA 1LRQA 2G4JA 3AYRA 5A2CA 4RZ5A 3FHQA 4S1FA 2I5GA 4FX6M 4LBSA 1H7RA 3L67A 3R8GA 4KWVA 1IT0A 4CN1A 4WRHA 1OQFA 4EAYA 3HGJA 2QCGA 2VOTA 2EQDA 2CBUA 2PTXA 5I3HA 2E6FA 5GNYA 1DJWA 1HKKA 4AXNA 3FOKA 2W92A 3TOPA 5FESA 3NUKA 1K03A 3N13A 3A4JA 2VZSA 3EWUA 3L5LA 4V2XA 1HJXA 4C6MA 4A2SA 1JPMA 5LGZA 2ODOA 2BVDA 1EOKA 2X41A 4H9UA 2MANA 3RG6A 3GHUA 4O1CA 3TMQA 3WZ0E 2ZWYA 4CD7A 3WMSA 3PZNA 1ZJIA 3WLIA 3PB0A 4ES4A 1IQ8A 3MUCA 1FH8A 1R30A 3RR4A 1OX6A 4AHOA 3CHVA 3N9RA 4FEZA 1J0KA 5F2LA 1HJQA 3TJXA 2Z7GA 4IF2A 2VZOA 4HB7A 4AHPA 1FWTA 4A8IA 2ATMA 2VEIA 2D3LA 4Q8QA 3PG8A 7ENLA 3GZAA 3KZPA 1FWSA 4MGGA 1ODUA 1JCTA 3JVAA 4HPGA 3EXRA 1XLCA 4RCXA 1UPMB 4F0SA 3BUVA 1ZBWA 1K3UA 2X09A 1IXNA 3E0WA 1D3CA 3HIJA 1TJ1A 3CUFA 1EP3A 4S23A 1R46A 3A4AA 3FKKA 3UESA 3BDKA 4NZ5A 8A3HA 3UZXA 1CX9A 3LD5A 3DHDA 4JTSA 3FS2A 3BC9A 1MYRA 3S5OA 2CW6A 2XVPA 2C14A 4AIUA 4XD4A 3B8TA 3RF9A 4WSJA 3MYPA 4H04A 1EXBA 3AMDA 3B0XA 1O5KA 1S1RA 1G4PA 4QM1A 2FPTA 1Q6RA 2QAPA 3N6HA 1I8JA 1UKOA 1HL8A 3IV8A 4A6GA 4ZB5A 3WUFA 1RBLA 1WX0A 2PGFA 1EKOA 1GZGA 3K2GA 4QX4A 2VC6A 3M07A 3VINA 5HNNA 4NP7A 1JAEA 3U2OA 3VUSA 4G7EB 1IXPA 1E9IA 1XD1A 4UXDA 3GSMA 4PCTA 3HB9A 1LM1A 4HCLA 3DESA 5TIMA 3CZLA 1H7WA 3M0IA 3F4DA 1HP5A 4KT2A 4UUIA 4W88A 2INZA 3MP3A 5CLTA 1OWQA 1HUVA 1GYMA 4LCSA 2OOFA 4DF2A 1P6WA 5AYYA 2PDMA 4Q4QA 1JFXA 2WVUA 4M6VA 2XH2A 1XYLA 4XUGA 4DAFA 4QSFA 1KM5A 1EJXC 3C8FA 3KOFA 2MNRA 1DJGA 2CESA 4GYPA 1S2UA 3MKCA 3W83A 3VD9A 1GYLA 4FIRA 2X0HA 4XIMA 2IXVA 1HTIA 4J7RA 1XGDA 5HINA 4WOZA 3W88A 2PURA 5A6BA 2Y6ZA 3PZ9A 1TJ0A 3RJYA 2BNJA 4UTFA 2PF0A 5HANA 1PIFA 2DW6A 4PRRA 2OGYA 1V93A 4UQCA 4S3FA 4Z0SA 4BI7A 4XBSA 1GTEA 3SAZA 4ZQNA 3WH5A 1XSJA 3RHGA 2QCHA 2VENA 3TYAA 3C3UA 3WLOA 1E0XA 5I3IA 1XUZA 3WJWA 3UZ5A 2FMOA 3GG8A 1V08A 3W71A 4LNCA 4GQRA 1DXFA 3LA4A 1XQLA 4N9BA 2PSNA 1KFWA 4HPNA 4QDWA 1GONA 3CUIA 3E5PA 4J4KA 4AF0B 2GDQA 5HULA 1K9TA 1HZYA 1ZJBA 1JUEA 2XISA 1MFVA 2GLKA 3KEHA 1J11A 5D2YA 2NXIA 1EGZA 1K9EA 3A3XA 5HPCA 4AD2A 4GIEA 1ITCA 1TPH1 1PBGA 2HMCA 5IDIA 1YE6A 3AHYA 3KWXA 1QR7A 2R1PA 4DXKA 3VD7A 1JDDA 1QOQA 3PZVA 4MVAA 4Q32A 1SMDA 3S9IA 4ERAA 1OK6A 1UZHA 2XFWA 3IEBA 2OCZA 2QV5A 1GG0A 2BGSA 4XIAA 5AECA 4JN8A 1LDCA 3UWEA 3AO0A 1EDQA 2FHCA 1GYNA 4O18A 4DB7A 3NWRA 1R3SA 3H2NA 1EA9C 2YDSA 4C6QA 1XLEA 3QSRA 4JFWA 3W1AA 1OYCA 4F2TA 5DT7A 2HSAA 1E6NA 5HUPA 4AY8A 4PMYA 1KW1A 4OFCA 3F7JA 2A85A 5CC7A 6TIMA 1W5NA 3OPSA 3CL6A 5EA9A 3CQJA 5HATA 3CTTA 3R7MA 4FHAA 3VGEA 1ZP3A 1VPQA 3F4NA 3QGVA 1ME9A 4RDYA 1OZMA 2ON3A 3SDOA 4X0NA 5KETA 3IGXA 1TTQA 1YADA 4HHHA 1DJNA 1KQZA 3CHEA 2RUSA 4B4HA 4PMJA 1WOBA 3LTPA 2QJHA 3VKDA 1AD1A 1HXJA 2G0WA 4AVNA 5AHMA 3FX4A 4HSHA 3A6OA 1C7SA 1K8YA 1PWMA 3CGTA 1YDVA 4QS6A 4FLSA 5JH1A 2XJ7A 3VKJA 4GPNA 3UP8A 4ATLA 1JD7A 1E5NA 2QF7A 3GIQA 3MANA 4LAOA 5LHEA 1GKQA 3UW6A 4FB7A 2ZRYA 1Y65A 1YXCA 4E38A 3WD3A 1JCLA 1AH3A 5A6MA 2GGIA 4GQGA 4OHQA 1OFAA 1YW1A 3QRHA 4B5WA 4PN2A 1V02E 4P5UA 4J27A 1LT7A 2ZC1A 3BAJA 4AWEA 4XKYA 1KGXA 2XM2A 1QI2A 3KX6A 2OXNA 3U48A 4H6KA 4GY7A 5C8BB 3NIYA 4KFOA 3LUTA 3VGDA 3CV2A 2NT1A 3SCWA 4JNMA 3PAOA 3W2NA 3CEPA 4X9SA 1XIMA 2WMJA 3HGOA 1L0PA 4MAZA 2P50A 2ZX9A 2ZC8A 1L6FA 2Y24A 4PRWA 3KOXA 2CFFA 3QV7A 1DVJA 3GHTA 6REQB 4Z1BA 2WC4A 2BOFX 2V63A 2VEFA 3N6JA 3PAJA 5IHRA 4IJBA 4IFKB 4F8XA 4UC5A 1A80A 4AVOA 4DELA 2JE8A 1G7VA 2F38A 3B9DA 3MVTA 5TD4A 4O1FA 2PWFA 4MF4A 2Z4GA 6A3HA 4EAMA 4LYQA 1U1JA 1MI3A 4GX8A 3KFTA 3S5NA 5BXRA 3N04A 4W8AA 4O50A 3IUIA 2BB0A 2A1YA 1TPEA 5E70A 2E1WA 5A94A 4LVAA 1UIOA 4XAFA 3B3DA 5GQBA 1A5UA 5DXXA 1A5KC 2A7PA 2IQDA 3WLKX 2JF7A 1DOSA 2HVMA 1JI2A 1AW1A 3ZT6A 1O5XA 1R85A 3GUGA 3TV8A 3K5XA 4YVXA 5BWAA 3FYYA 2GJRA 1U1HA 3NZPA 1VS1A 3P93A 3W4RA 1CPUA 3N6QA 4V1XA 4FNQA 2VFHA 1BRLB 3W9ZA 5AYIA 4LEQA 3SIMA 3W7QA 4LAKA 4OTKA 1XYZA 1WPCA 1Z44A 3LQLA 3SN4A 5KZDA 2WXDM 2VC9A 1YDYA 3RCMA 2YFNA 3TYBA 1OG6A 4I7WA 1H7NA 4NAEB 2YA2A 3HF3A 4M81A 4JHOA 2ZUUA 3MCMA 3S83A 4MB4A 4NJHA 1F4AA 4HGXA 5DXYA 4K3ZA 1OYBA 4CCZA 4V28A 4RUBA 1NQKA 4HA4A 3ZVHA 1TX2A 5I00A 2XIBA 3R4IA 4PC8A 3QKZA 4Z1DA 4GNKB 4ZTXA 5G2HA 4UQAA 1HL9A 2E6YA 4WD0A 2YW3A 3L2MA 3G8EA 1HFBA 5CSUA 1OIMA 1ONWA 1YHTA 2WM0A 1YTEA 1M1BA 3BV7A 3FN9A 4HMDA 4HZ7A 1VFMA 5FJRA 3HG4A 3I6EA 3UNDA 2PRHA 5I3DA 3AOFA 3EX3A 2R94A 3KRUA 4Q8MA 4M0XA 4XUYA 3SB0A 3GB6A 2I14A 4OBTA 4QGCA 1JZ6A 5E0FA 4M82A 3PUEA 2WCGA 3K8KA 1X98A 3TONA 3LXBA 4B9ZA 3BSMA 4XZNX 4XD6A 2IPJA 1WQ5A 4S3DA 3VOJA 2AMGA 1M7JA 2ISSA 3N3MA 3ZO9A 4DHGA 3CH0A 3KZSA 1LL4A 5ECUA 5AFDA 1FHVA 1SFTA 3VYLA 3PPHA 1R3VA 4R7JA 1FWHC 4EANA 3ITXA 1AMYA 3GXIA 2ZQ0A 3G8RA 1JL8A 2Z25A 1J0JA 3CQIA 4DZ5A 3AIVA 5F1VA 1TQJA 3S6TA 1FWDC 3AISA 1UZDA 5DMNA 3VGGA 2IS7A 3IGSA 1EJWC 2CLHA 1NY1A 4MUPA 4K8GA 3BOXA 1QPNA 1F5ZA 2YSWA 3RPDA 1FTXA 4DUWA 1QATA 2FZNA 3CPUA 3IJQA 4KWOA 4GYPC 3ANUA 3CJPA 3W75A 4M29A 3UERA 4IPIA 2P76A 1FH9A 1VFOA 2E1DA 1ZUAX 2CXGA 3PY2A 5CH9A 4DRSA 1F05A 1XBXA 1DWGM 7ODCA 3A64A 2JK2A 4PCPA 1C90A 1X8FA 2J78A 5C54A 1XBVA 5HMDA 1F6KA 3CH9A 4OV9A 1UJPA 3QV9A 1VFSA 4IMCA 5GNXA 3BVJA 2DH2A 3MWCA 1W3IA 4BK9A 1BPLB 1OX4A 2B7PA 3E2RA 4I5XA 3NO1A 1DJQA 3DFPA 3WLJA 4P2VA 4FNUA 2IKHA 5E0KA 4IP7A 3TSDA 4N4PA 3INPA 2X1IA 4JTAA 2CBVA 3MUAA 3SUTA 3WY1A 1LJYA 4S3EA 4UMCA 2O4QA 1B3OA 3RK8A 4IICA 3REQB 4N2YA 1X7IA 4PMVA 3WH6A 5M5DA 1PIGA 3KAOA 4DLFA 4R9OA 3QTGA 2OVLA 4TX6A 1HGWA 2E09A 4JFSA 2GL5A 1EZ2A 1RD5A 4DZAA 1E6QM 4XG1A 2Y7GA 4F2BA 3O8AA 1ZS2A 3DAQA 3S2MA 4AD1A 5IBXC 4XAZA 2CLFA 4L4MA 1WE5A 3A5VA 1UH4A 1VFLA 5HMEA 2AL1A 3GS6A 5H6HA 1GK8A 2VC5A 3MJYA 3E9AA 1J0HA 3UR5A 3NQDA 1J2BA 2QDDA 2TAAA 2QIWA 3U5UA 5CPMA 2FHBA 4U28A 4OKDA 3G77A 2DP3A 3S2JA 2WZMA 2DZPA 4Q4MA 1T8XA 4FF5A 2A7RA 2X0YA 3FAXA 3WQ5A 1V51A 4NY2A 4TIMA 3PK7A 1JCNA 3CT2A 5D2WA 3LY0A 1YNQA 4R27A 2VD9A 3H7RA 1GOWA 2ZXBA 4G1NA 3LNMA 1Q5MA 1R7OA 4I9MA 5AN7A 3MQTA 2CZVA 4HIBA 2EBNA 1KM2A 4NL1A 2EPMX 2GVGA 2WLYA 4NRSA 3UJSA 3W73A 3BGJA 3WENA 5T9CE 1EIBA 3V7PA 2DVTA 2GPTA 1ZJHA 1U22A 3QEZA 3OYXA 2C7FA 3N19B 2QUNA 3FA4A 2PRMA 2V5LA 3MI6A 1OJXA 4E2DA 1D2KA 2Y89A 1JEZA 3S1WA 3USZA 1P6CA 3B9AA 3CIXA 1ZJAA 3JS3A 5EMYA 1NIUA 4IMEA 4JIQA 3EWDA 3T40A 2IQTA 1QOXA 4MB3A 3PNZA 2Z1SA 1UR2A 3GW3A 3NYZA 1XW8A 2OFJA 1MQRA 1S2VA 4HSOA 1BVWA 2J62A 1KR1A 1ONXA 4GABA 1DXIA 1I9CB 4HTBA 3PHAA 2DZSA 4JTCA 5KZMA 3U5YA 4MPQA 4UTMA 1BVNP 1GOIA 4LW7A 5GJPA 5I3JA 3P74A 1QMLA 3PJUA 2OELA 3AMGA 1V7AA 4PB3A 2ZDSA 1XYFA 3BL3A 4BWLC 1GOQA 1W6TA 1JI1A 4AX6A 1C8XA 1Z48A 2H8XA 3DBPA 5DBTA 2ZUNA 1SZRA 3GR4A 5M2FX 3MMWA 1TTIA 4MB5A 4MZYA 1EO5A 1BKHA 4LBRA 4PCNA 3CU2A 3GXFA 1S38A 3IV3A 4HKPA 4CNTA 3SCUA 5AHLA 1OFRA 2ESCA 1SO6A 2DV0A 3B0VC 1ZCCA 5CBJA 3T05A 2AQWA 3W3OA 5BCAA 4IPNB 3M0LA 3LPGA 3ELFA 3CV7A 3CV1A 1ZQ5A 5CLWA 4XAYA 4IZGA 2Y7DA 1ZSXA 4GBDA 2GSJA 3R8RA 1SW7A 2OSWA 4ZTYA 3THQA 1H2JA 5A2BA 2QCMA 1GVEA 2F2KA 1BLIA 4Q7BA 3CQ0A 1OCNA 1RUSA 3LB0A 1CXLA 3DX5A 1JDFA 3LCFA 1VIWA 1LORA 5HK4A 1G4EA 5K7JA 1W3TA 3SCRA 2Z1KA 4EWND 3LI1A 1CXHA 5K9XA 2W66A 1ZRQA 4YCOA 4HOXA 1GOOA 2V69A 3LHVA 3FVMA 2I5QA 5E09A 1Q6LA 2WBGA 3RX2A 3F2CA 3O15A 5CJMA 3PWIA 3AJXA 3VD5A 1XIGA 2ACQA 4PCFA 5D9NA 3EA3A 1CGVA 2YCIX 3S2LA 2EG6A 2DSWA 1AW2A 3SEPA 4KWWA 3GX9A 3PFMA 1IF2A 3KS5A 2O0TA 3MJMA 2G3FA 2AGTA 2ZA3A 1XLKA 1JRCA 3O05A 3QM3A 1R2RA 4LYKA 3O16A 4LS0A 2DT0A 1A0DA 3TN3A 3APYA 2AL2A 5G1YA 1A49A 3TFCA 3CLWA 1ZBCA 4WGHA 3FGCB 2VXNA 1E1CA 4QEHA 2ZE0A 2ZYFA 1UHVA 4O4VA 3ONBA 1EDTA 5FF2A 3NTYA 4JFUA 1NAL1 2XZ7A 4B3KA 1P0NA 3KOZA 3GNXA 5FCZA 2JBMA 3CHFA 3DHPA 3G0XA 3GAKA 1X39A 4E3TA 3DC0A 2TSYA 1NP2A 2ZIDA 3TKFA 4BF7A 3PJWA 4J1OA 4ZCWA 1NVMA 3AC0A 2RDWA 3LV6A 3Q94A 3W7RA 1GPWA 3EKLA 3WQGA 4DJED 3C86A 1SYTA 3IVUA 3VIOA 2D2OA 4JQ2A 4AYSA 1T0OA 4LX4A 4EPEC 1VCVA 3I65A 1QRQA 1Q2SA 3C2YA 3HG5A 3J7HA 5HR6A 3OG2A 3LCWA 2CU0A 3VE9A 1Q13A 4L5ZA 3N9SA 2VL4A 4US5A 3W25A 4WHBA 2EKCA 2R1KA 4O53A 6XIMA 3W7EA 3RUBL 2DFAA 4PMNA 4MNJA 3UWWA 2ZE3A 3WMBA 3DFNA 5AOUA 2WZIA 1ICSA 1QNSA 1KFBA 2YGYA 3GVGA 2CHRA 2I16A 3CZJA 4C1LA 3VTRA 2WMIB 3CT7A 3WLPA 1KWGA 5FJPA 3R1ZA 4H9TA 3KVMA 1DQWA 2H3BA 3IUHA 1JDCA 5HOSA 4C65A 4W84A 2XWDA 4FIQA 4MLRA 2D24A 1YDOA 3LYEA 3PS7A 4GK8A 4UWMA 4LCQA 2PUZA 5CGQA 1R87A 3BLOA 4FK9A 3EDKA 1XIDA 4H2HA 4JQAA 3WUGA 1O5RA 1LWHA 2GYIA 4GJJA 2J9ZA 1LF1A 4LQ1A 4EOUA 2WSPA 4XO6A 1WZMA 3HGSA 3UEQA 3O06A 3BOLA 4TMCA 1PS9A 1XLFA 2VP8A 1OFOA 2A6NA 4CQCA 1O95A 3GW0A 2REQA 3LDVA 1MEHA 1SUXA 3BQ6A 1KRCC 3R8HA 2TYSA 2RGLA 1Q7ZA 5GNZA 2OQLA 3QBUA 4DXXA 1OM0A 3BK0A 2NV9A 2WSRA 3FJLA 1KFCA 1R6WA 3H2AA 3HQ1A 7TAAA 3WQFA 4FALA 2G3JA 4NHVA 1N2VA 2ZTJA 3H23A 4NZCA 3R10A 1OCQA 2J7CA 1J0YA 3R58A 5EMMA 1X6NA 2WLZA 4IMGA 2HV5A 5G4WA 3UZYA 4B2DD 1OK4A 1FKWA 4YIWA 4CU7A 2HNEA 3PUGA 3WD0A 4YYCA 1XDJA 1XKJA 1NU5A 4OUEA 4EXAA 3A24A 1Q63A 3SCSA 2VZTA 4L1XA 1F3WA 3AUOA 4A3QA 4XZ9A 1PHQA 4GY0A 3ARUA 4NZ4A 2W4XA 1NOWA 3H4XA 1UUQA 3GBEA 1IXQA 4PA8A 5BRBA 2B7QA 5DT5A 1S46A 1ELSA 4MKSA 4G5DA 3S0CA 1FBAA 2GGJA 4ZOBA 3AIBA 2PZ0A 1KM0A 4MKNA 3VMOA 3URBA 4O0QA 5A6KA 1UMYA 5C71A 1OINA 3PVFA 4L1WA 1DTUA 3CS2A 1JPDX 4UTHA 4K7VA 3GG1A 4CQ9A 5F4WA 4KWUA 3CNYA 2QIIA 1AODA 4E0CA 1JNEA 4HZ8A 4LUIA 1BHGA 2G5WA 3VNYA 2R14A 4G7FA 4YTUA 5I77A 4G9PA 3NZQA 4S39A 3W1UA 3VOFA 1NDVA 3GR8A 1JXJA 4RJEA 5CSRA 4UTJA 3LGGA 4GI9A 2YJQA 4IMDA 5BMWA 4CQBA 1CB2A 4RV3A 2ONEA 2QPUA 1PAMA 3OQ8A 3QPZA 2NZLA 3ALGA 3TYEA 3AQUA 3UYIA 1PIIA 5A6SA 1E0VA 3DIPA 3BICA 2YPIA 1EC7A 4L65A 3A4XA 3VNIA 2VCBA 4DBSA 5C7HA 2QMJA 5D2VA 2OZ0A 4GZIA 3L5AA 3GXNA 2QCFA 3ZFHA 1PEZA 3M5ZA 2YXGA 3KBMA 4ACZB 5F7UA 1BTMA 1F8MA 4FNPA 4S3AA 3QY6A 1FWBC 4HHMA 1I2RA 3NZGA 1TV7A 1ZLPA 1UP0A 1LWIA 3DZ1A 3KTXA 1D8WA 1EP1A 2VYOA 1W1ZA 4IQLA 1K6WA 2OB3A 3GVRA 3R79A 2VCCA 3QR0A 3PJXA 4Q4SA 2D3NA 3TUUA 1ZP4A 4ZODA 1ZHAA 2OX1A 3CQHA 4K68A 4HCDA 2ZX8A 4C6LA 5BNKA 1PZ3A 1CLVA 3PNUA 1C91A 4KF1A 3L4UA 2EKGA 1B3XA 2EXOA 1AUSL 1V02A 3DN5A 5G1MA 1G69A 3D3FA 1SJCA 2J4GA 2BVYA 4ZEPA 4JKMA 3N29A 2QKFA 2XSAA 2Y5SA 3MMUA 4NZJA 4MZ8A 4PUWA 1XBYA 5E9XA 4AW7A 3N2OA 3UWVA 1KCXA 2V30A 1EJRC 5FF0A 1EYWA 3LMZA 3URNA 3NO5A 1KR0A 4OBSA 4GNJA 3H7VA 3ZZ1A 3BSGA 3CUGA 2VRKA 2GGGA 3EMQA 1LWJA 2A4AA 2C0AA 2DUXA 3EXSA 1ZAHA 2IXUA 2QDHA 4BQ3A 3WH9A 4QG8A 4LTSA 1W31A 1V6UA 3W2JA 4AY7A 1SMAA 1XG4A 1ITXA 1TIWA 1W91A 2HVOA 2J7HA 3IIVA 2WYSA 4ERGA 3U0HA 2BOGX 2QULA 1IWBA 1KGWA 5DCEA 3W37A 2V2HA 1HF6A 3KRBA 2X1TA 4H19A 3STGA 3WO8A 3L0NA 1EHAA 3JW7A 1HJSA 1VBHA 1DWJM 4AISA 1V0NA 1QO5A 3DG7A 3MUIA 3UZWA 3DECA 1LBMA 5F4XA 3THCA 4I9TA 1PSCA 1QNRA 1W8SA 2OZ3A 4O1AA 3WLNA 4AEEA 1A5SA 3HQPA 3BXWA 5LA2A 2H8ZA 2QPXA 1H62A 1OABA 1ADDA 4PTMA 4BQ4A 4IXHA 3WQ6A 5MHBA 3E0IA 5RUBA 1EX1A 1UWRA 5MF5A 2VGBA 4NNCA 2WHKA 4PZVA 4JYEA 1FHDA 3FSUA 3EYPA 1XG3A 3UD6A 4QG6A 2FJKA 3ZWTA 2HEJA 4JCMA 1MNSA 1E0WA 4AD5A 3UPBA 1ZAIA 1RQHA 4PR4A 3EEZA 5DF0A 1EA0A 1V3MA 4Z1YA 4HHPA 2VGIA 2B0MA 2W91A 1MZHA 5A95A 3QSTA 1V6YA 1H0IA 4RK8A 1JYNA 1L6WA 4TVDA 1O60A 1CGYA 3VOIA 4ERIA 4GKTA 1JF6A 2J9YA 3QMSA 4FXJA 3N12A 2PU1A 1OFQA 1ZPTA 4XV0A 3W2UA 3EDDA 4UB9A 1GJWA 1SW3A 4A3HA 1QPKA 4N7QA 4TU1A 2XUCA 1XPGA 1P0KA 4Y2WA 3PZGA 1M03A 2V8ZA 5K3VA 4TMBA 5D05A 2ZZ3A 2A3BA 2BBFA 4B5NA 3IANA 4QLJA 4WEVX 3T42A 2WJFA 1K4GA 4M24A 4GQBA 4HNUA 2ZUWA 4PMOA 3GD6A 1OC7A 2QCLA 3H21A 3Q67A 2Z00A 1GQKA 5FL0A 5HJXA 4JYFA 1M5WA 4GH3A 3PZOA 1Q45A 4JX6A 2O7SA 1TV5A 1EJTC 1MW0A 4I6KA 3RPMA 1B9BA 3SZ8A 1EX5A 1CLXA 3HTWA 1BXBA 5D30A 4AZ6A 3PJTA 1H1NA 2WVSA 3ITCA 4MNLA 1JIBA 4RV8A 4HJFA 2XZ9A 1E9LA 3UVIA 3TQVA 1V4YA 3AYVA 3GLCA 4AG0A 3K8MA 3CYJA 5ABGA 3E5BA 1TG7A 1UB3A 5BOOA 3U57A 4ORMA 5DMLA 4PYSA 5EU9A 3BMWA 3SJNA 3C3NA 4JIIX 1DXEA 1XLBA 4LV9A 1RCOB 3G1SA 3A4WA 4N4QA 1CXIA 2QQ6A 2EJ1A 2PWDA 4PUUA 4UTWC 2PWHA 4PUMA 3T0DA 2NQ9A 1J2WA 3RILA 2QEZA 2WKGA 4IIHA 4MB1A 1M7PA 3SCOA 3PSWA 2JIWA 4WXZA 2P3ZA 1G7UA 2OZ8A 2D69A 5AZ1A 1W17A 4MM1A 3DC8A 3TYUA 2JKAA 4YYFA 3WQEA 2FJUB 1BSLA 3ARWA 1F4HA 1OZQA 1TELA 1YNPA 4Q7IA 5CZSA 3W1TA 5DY3A 3M43A 4DI9A 1EJ7L 3BLLA 5ECVA 4PMXA 3CIVA 1HO4A 4PBFA 3EX4A 4RXFA 1VP5A 4IM4A 3DG6A 4DXVA 3N2XA 3LXCA 3EAUA 3F5LA 3AAMA 5CPLA 1EF3A 4GZ7A 3UYCA 3RM4A 1R0MA 1Q3NA 4W5ZA 4NJKA 3AXKA 2PRLA 3N3TA 4EVZA 4EX4A 4NI3A 5E5CA 3A47A 4LUYA 1K8XA 1XLMA 7CGTA 1KFLA 1ZENA 3U9IA 4EXQA 4C90A 4JGDA 1CXEA 2J6VA 2Q3OA 4CN6A 3GH4A 3GIYA 4B3LA 2Z1BA 3V0UA 4KKXA 4RNFA 4JTUA 1RLDA 1TREA 4C6BA 3B40A 1OEPA 2OT0A 1C8QA 1D7KA 3SRFA 5LIYX 3ARYA 1TKKA 3KBWA 5JBFA 2OG9A 4PMUA 2YKKA 5LZLA 1L6SA 1XWYA 3KBSA 3NDZA 5A5WA 3M1ZA 3LENA 4TVUA 3GG7A 3IUDA 3VZZA 3U2EA 1H61A 2EPOA 3VOCA 2BODX 2BXYA 4IFKA 2VO5A 3M64A 1UKTA 1BWLA 1GVIA 3NM1A 2A21A 2KX9A 4F0RA 3K8LA 1P43A 9XIMA 2FPYA 1FP8A 4H9YA 3L65A 4KEMA 4JDYA 3POHA 1K1DA 3TJ4A 3PN8A 3E2VA 3OO2A 1EC8A 2PP3A 3FGCA 3N1AA 3RXZA 3EA1A 1POJA 3WD4A 2UY3A 3DU0A 1RJQA 3SQMA 5C0QA 3BV4A 4P7LA 4LCRA 5HAOA 1PX4A 1XIEA 2D1ZA 2XSXA 1XH1A 4QHRA 5CXPA 3BLIA 4GVFA 1JZ8A 1KTBA 4H9XA 3MCNA 4UOJA 1XKYA 4I90A 3KP1A 4IIDA 3S9YA 1JYVA 4ORIA 1TB3A 3KLKA 4JTKA 3THDA 4YXGA 1FWJC 4IIEA 1IIGA 1HVQA 5FF4A 3MT1A 2VNCA 5MKGB 3VXGA 4KEVA 1GOXA 3H2FA 1PHWA 3OHIA 1OGGA 1QWGA 3FLUA 4NNAA 4XQ6A 3O07A 4H9ZA 1AQ0A 4M51A 3NZ1A 4AYGA 1XRSA 3CMFA 3IRSA 4O8AA 2PDWA 3VABA 4JTIA 2V3DA 4ADUA 3W81A 3TYZA 5H8PA 1UR3M 2PA6A 1EO7A 2ISFA 1U30A 4AD4A 2YBTA 1O5QA 5LNWA 1H11A 1RPKA 1YLVA 3V5CA 3E3HA 1JPHA 2FGLA 2Y5JA 3GR7A 1CIUA 1AQFA 3NPUA 1PV8A 1EJVC 2Y8KA 2OT1A 3UA4A 1V0LA 4ZE5A 3HZ3A 2PDJA 3FXYA 1B9ZA 2C6QA 1DWFM 3GHRA 3WL0A 1XD0A 4CUCA 1SFLA 3MI3A 5KSWA 1R38A 3T8LA 4MWAB 4O11A 4MADA 4C6CA 4G2DA 1NF0A 3VKCA 3U8GA 2CLOA 4GIRA 4OBRA 1EH9A 1VF8A 1UQZA 3HPAA 3FVDA 3LPFA 4IG2B 3B05A 1FWFC 3O6DA 2X2GA 3TW6A 1G01A 3VNDA 3EWCA 1AH0A 3DYPA 3GDBA 4REQA 3C2VA 4UOZA 1PX8A 3AYTA 1Z7AA 3QMRA 4UNLA 2YFOA 3W27A 4M6QA 3H2CA 2OU4A 2PDQA 2XVLA 4GACA 3NZRA 3QPYA 2QDEA 5FJTA 3HN3A 4ZO6A 1UYQA 4J2PA 3QLLA 4IMAA 3A5FA 2DT2A 2Y8UA 4XX6A 1WZLA 1GVYA 1XFCA 4LXFA 4FAMA 1KC7A 4Q8VA 2QJGA 1EGVA 1PB0A 3BZJA 4RE0A 4ZSUA 4FA3A 3M16A 1UA7A 1X6UA 1UZ4A 3H4WA 4IFOA 3C2EA 1GHSA 5KITA 4B5VA 2CERA 3KBJA 1AD4A 1AA1B 1KFEA 3F4WA 3IJ7A 1K9FA 3GC5A 4PUEA 1HKJA 1F3EA 2OPJA 2CLKA 1BQCA 3JRKA 2NT0A 1FKXA 4CVUA 1RBAA 2NUWA 1TTPA 4U3CA 2Y5EA 1E55A 3CPGA 2CHNA 4E8CA 1OX4B 1F6YA 1B3WA 2EPHA 4PBEA 3W7GA 4DUVA 4DO6A 3ONCA 1CGWA 3OZPA 2V5DA 1OD8A 4F0KA 4L6OA 3W74A 3GY1A 4ZB0A 2CPUA 5CQ1A 4WK9A 3LLDA 4GO8A 1QW9A 4N6FA 1B31A 5BRQA 2WM1A 2XSBA 4C91A 1BF6A 2XG9A 4YCPA 1A4MA 4HNLA 1TUFA 3GKFA 4BI5A 1GGOA 5XIMA 3G2GA 1EEPA 4JS3A 3WJSA 1JZ3A 3DGRA 4C1NB 4RPPA 4PUKA 4JDBA 1R9XA 4A3YA 3R43A 5CBBA 4PUNA 5TQLA 3NAVA 2OR2A 4R3UA 4P8VA 2ZZ5A 3ZR5A 5A8PA 5I3GA 1OYAA 1XR2A 1Z9AA 1V03A 1MW2A 4MWAC 1SW0A 2DH3A 4W4QA 1JQXA 4E4FA 1GHRA 1XL9A 3OIXA 2BY0A 1E4LA 3TYCA 4AEOA 1WDSA 3DFYA 1XUUA 3D3AA 1WAUA 1WDRA 3KHJA 4QDPA 4BF5A 2EJAA 2UWFA 1TWIA 4FXSA 1C7TA 2IMRA 1B90A 1J10A 4XB3A 4LAUA 3T0BA 3CAWA 4GXPA 4O10A 1E71M 2GWNA 3F2DA 3OVGA 1US3A 4KFNA 3ZJ6A 2OLAA 4QIUA 3WMLA 4NT0A 2EPNA 3PB2A 1TZ9A 3UGRA 4DPQA 1RJRA 3ABSA 3ICJA 1ZTVA 3IARA 3W7MA 2HWGA 4BKNA 2H9AA 1H1YA 1PTDA 5BOFA 1NDWA 1E73M 5EFDA 3HU7A 3P82A 3M9YA 4EIVA 3EPOA 1MW3A 5KZEA 4FOUA 2Y63A 5A6AA 5D8ZA 1X7FA 3AXIA 3GFXA 1YRRA 1IV8A 3MZNA 4DYJA 1RP8A 3VGBA 3UG4A 4DO5A 1TPC1 4CVWA 2JIEA 1EJSC 4LC8A 4W5UA 4K8EA 3VM7A 1TPDA 3NG3A 1QPQA 4A35A 1J4EA 5A8QA 1TE6A 3QF0A 1RALA 1R47A 2J79A 4BY3A 3CYVA 2PTYA 3M5YA 4HN8A 3TW7A 1KRAC 1UASA 2Z1VA 4JNZA 4FP1A 3N4AA 4LPCA 4F2UA 5F4SA 2Y62A 4X9YA 3WBWA 1XLAA 1WXJA 4AZHA 4IL2A 2BY3A 3PZTA 3L23A 2DQXA 4WSHA 1LTDA 3UXAA 3B8SA 5AYZA 3JZEA 2HXTA 3QMTA 4S2BA 5L6UA 1RZMA 3AIEA 4UTLA 1VZWA 5G1TA 4C6NA 2Q09A 4KRUA 4ACYA 3AU2A 3M0JA 5ENLA 2D20A 3OGRA 1BSIA 2YL6A 3TR9A 3AHVA 2OZTA 1PKLA 4YNGA 1NH6A 3DFOA 1FY6A 2XVNA 1POKA 3Q58A 3TTSA 2RDXA 1FWWA 5EB8A 2DJLA 4RZ6A 5I2UA 4ASTA 3NVTA 3WUEA 4P8UA 1SPQA 2FYMA 2ZZ6A 3KDNA 1A53A 1T7LA 2I56A 1TWSA 2EAWA 1JCYA 1JRBA 1S5TA 3ARVA 2A3LA 1OT1A 2GSHA 5HBFA 3G3MA 3PZIA 4KWSA 1HO1A 2J8GA 2PWUA 1JNDA 2ZA1A 3GFZA 4GD0A 4ZVJA 1TZZA 3SECA 4QRNA 5IM51 1W3KA 1IEIA 4JHZA 4O19A 4ZQOA 1H3GA 3BAYA 1UR1A 1LUCB 4EF8A 3VIKA 1K8ZA 4GISA 1NTHA 4JKLA 1WBHA 4ZSTA 2ZVIA 2W9MA 1IEWA 1LCOA 1VR6A 1ECQA 4AZCA 3WIJA 5AHEA 3KCLA 1DKWA 1HG3A 1RCXB 4Z2HA 6ALDA 3GWQA 3TMLA 4E8GA 5CGTA 2FTWA 2G95A 1OT2A 4Z17A 5CPSA 4N02A 3UY8A 2OEJA 3WFLA 3L4VA 2V2CA 2VEMA 3WSUA 4QNWA 1OFDA 3BMVA 4B92A 3P8JA 5A8OA 3W72A 1WUEA 3WX7A 1PDZA 3CAVA 1H1ZA 3ATYA 5BU9A 2B81A 4RDVA 4Y9NA 3COTA 1QNOA 3MI2A 4KW2A 1LQ2A 4ATDA 1JZ5A 1X97A 3F5KA 2ALRA 3M7SA 3GE7A 3NDOA 2E6AA 1V3KA 3W07A 4IQEA 4JHMA 4AC7C 2INFA 2VGFA 1VFFA 4MY8A 4D6HA 4HNTA 1Q6QA 2QUUA 3M0ZA 3H4GA 3AMCA 2VTFA 4XKYB 3FK4A 5BZAA 4HD5A 3MHUA 4N9CA 1HKMA 3PZMA 3W23A 1CECA 1E6RA 2OO6A 1AZ2A 1E72M 3D47A 2DZAA 4BEQA 5D33A 5F1UA 3TTQA 1M9HA 4HSNA 3U2ZA 3NQ6A 5I24A 1C9DA 1T99A 4LUTB 1RP9A 2C19A 2V5BA 2X2YA 5C2CA 4GGHA 3C2FA 2PE4A 5F2IA 3P61A 4DVOA 3WJYA 2JGQA 2YXOA 2QJNA 1H63A 3NA8A 3T4CA 6REQA 2PDFA 3TAKA 1UD8A 2D0GA 3P6LA 1G67A 4CD6A 4GC4A 3WQPA 4B5SA 2ZRWA 4CEXC 1DYSA 4JTLA 4L56A 3A3WA 3GHSA 3ARPA 2CLLA 5KZ6A 3ZJ7A 1LUCA 2Z1WA 4R7OA 3AXXA 1FFRA 4JOMA 3PTMA 1KD0A 1H49A 2XN0A 1A5AA 4LSBA 4YWSA 1VFTA 3AI0A 4F0LA 2VZUA 3WLSA 1QHZA 1Z89A 3C5QA 4IUOA 2DU2A 1V0MA 1LP6A 4GX9A 2NWRA 2XIJA 3EDJA 3BJFA 1UP2A 2A79A 2AGKA 4BZYA 3LG3A 3W7PA 3WF2A 1CW2A 3IAPA 1UBPC 3VGFA 1SJBA 1J9YA 3B4UA 4WXYA 2EPKX 1S1PA 3SSZA 2O4MA 5AC5A 1UMLA 4NG3A 1I75A 1CT5A 3L7RA 1PKYA 1RR2A 1GVQA 1M6JA 3ABRA 3BANA 3SBFA 1BGGA 4QAIA 5C9XA 1FWCC 1OY0A 1A47A 1W37A 4CCCA 4QROA 1FH7A 4TR9A 3HURA 1XLIA 1IT7A 1Q8JA 3HQNA 1MNZA 2DVUA 4YPJA 2CLPA 2Y2WA 3W1PA 1SZNA 2W61A 3K46A 5CC3A 4NJJA 3P0WA 1TA3B 3IIXA 4GUJA 3S42A 1EQPA 1KNWA 2VRJA 3KOYA 4AMCA 1ISXA 2F6KA 2TODA 2QMKA 5AY7A 3WK1A 4W86A 3L21A 1P5BA 3NURA 3WQ4A 4J3TA 4MMWA 4DO7A 5FA5A 1RVKA 2WKJA 3NVDA 3TJLA 3UG3A 1CTNA 2ACUA 5B80A 1U1UA 4ZA0A 3M6DA 1VBGA 2AKMA 1PWLA 4Q22A 3ZJ8A 2NQLA 3W29A 4XZBA 3SCVA 2VX7A 1A5LC 1G4SA 3ZQ9A 5AVHA 4ZGYA 2X8RA 1Q8AA 5FSDC 1ADSA 5CZTA 3AWOA 3GM8A 4RPQA 3ZR4A 1XRVA 2GOKA 1VIZA 1B3VA 1NP0A 3OTRA 3EB4A 3NSNA 2PLCA 1LRTA 2VWSA 5E9AA 4Y8EA 1QBAA 3QXBA 4LAZA 4DNHA 3OG3A 1PZ1A 3G22A 1BWVA 2C16A 3QW3A 2UY4A 2QV4A 1FX6A 3TX9A 4H2CA 1XYMA 2YCLA 1MZRA 4C6DA 2WWDA 5F2MA 2C79A 5CSSA 3KCOA 3VDHA 3GC2A 4LV4A 4L9YA 2DY3A 5CC5A 5FJOA 4JIPA 2DIEA 2J13A 1ENUA 1NEYA 5ABEA 4HU4A 3H12A 3UJEA 2GFTA 4HQVA 4U4MA 4W85A 4KRTA 3TYDA 3VIGA 4EPKA 2F9RA 3KRZA 5IHSA 3S9ZA 3G1HA 3OGVA 3SO7A 4DM2A 3IJ8A 4UBPC 1XIIA 2WAGA 6CGTA 4MFDA 1RCQA 1B2YA 3LPPA 4AX7A 3BTNA 3GDKA 3WLLA 2ACSA 2X40A 3N73A 1E15A 2ZVRA 4Z2LA 3RX4A 3GXMA 2RKXA 3V5OA 1Q85A 2GGEA 3NL2A 1UWTA 1E5JA 1EWEA 2PLJA 1REQA 5AHNA 1XISA 3EOOA 4KETA 3NQFA 3F2BA 3F5JA 1HGYA 1I4NA 4PEEA 1UUMA 4H7CA 4WZHA 1MW1A 3BGAA 1L6YA 3VFCA 4LYRA 1ZU8A 3WBYA 3VOHA 3T9PA 1IR1A 4HOWA 5CAKA 5HJYA 4G8TA 1EWDA 4NXKA 3W28A 1VENA 2Z2BA 4WVXA 2E0PA 4DAIA 3B03A 1M04A 2ANUA 4RXGA 3BJTA 1W32A 4ZXOA 1ISYA 2QNEA 1LT8A 2X1UA 5F2GA 1WO2A 2BMBA 3LHTA 3LHWA 2F2HA 2DQWA 3NEHA 4H83A 4WSKA 2YBUA 1Z6KA 2C15A 1EIXA 1ZBVA 1Q4NX 3LCLA 2HBXA 7TIMA 2RDTA 3C0JA 2ZWZA 1KLYA 3QTPA 3USBA 4H00A 3UR2A 3FJ6A 3LCXA 3WQWA 3P0XA 1JULA 2P53A 1TFVA 1ISWA 4X2RA 3M6YA 3CHCA 2BXVA 1TR9A 1IGSA 4S38A 3SCPA 2VEKA 3RMEA 1JXKA 2PLMA 2J75A 1R5YA 1XSKA 3N18A 3PULA 4AMAA 4QQ3A 4G1KA 2O9PA 1LLOA 3T7VA 3TZFA 2YB1A 4LUSB 4CU6A 2VDHA 3I10A 2PWGA 3VKAA 1V3HA 5HNTA 5DANA 4B91A 1KM6A 4KCTA 3DGBA 3NFUA 4D71A 1GG1A 1SZEA 3ATZA 1K4HA 3ITLA 1FVPA 4KIRA 3A9IA 3MDUA 1OB0A 3S46A 2VEGA 1XX1A 4MJZA 3QFEA 5A8NA 1UWIA 2CCRA 4PUJA 1OGBA 3OVRA 3WDRA 1M65A 3NXFA 3LRLA 5DY2A 1TTJA 2V3FA 1R7AA 3NQBA 3QV8A 3O2LA 1CENA 3T0CA 3C0LA 1MVYA 2NLIA 2VUYA 3KCJA 2F61A 1KLZA 1R3YA 1KBKA 4I9JA 4IJCA 1MWOA 2PDLA 2PS2A 4Q4OA 1TVLA 4EPDC 3O7UA 1CCWB 1JGIA 5H1WA 4LOCA 4CQAA 2C3ZA 3STEA 5I07A 1FRBA 7A3HA 5HDRA 2V38A 4L4OA 5EL1A 4LB3A 2WMIA 4AZCB 5DCDA 2Y0FA 1TPWA 3CV6A 2G41A 3MSYA 2FPVA 5BROA 3IGHX 1K70A 1HJVA 1TQXA 4AZGA 2YCEA 3UG5A 1WUFA 1E1FA 1H50A 1MUMA 3G24A 2GJNA 4LRTA 2PP0A 3CZ8A 1GVOA 3TXVA 3ZWSA 3KDOA 5I06A 2PD9A 3WLHA 2ZZ4A 4GRSA 5TF0A 3A12A 2P3EA 1ZL1A 3L0GA 1OG0A 4AC1X 2WQPA 4UTIA 1I2QA 3K13A 4DEFA 4MNMA 4O13A 3DFTA 5DX7A 1ONEA 2WPBA 5C55A 1GQIA 3WK0A 1GVSA 3OLDA 4W93A 3EGJA 4MNKA 5K4XA 1W3NA 5H8UA 3CQKA 4Q3MA 1GJPA 3GU1A 2CKRA 3PFRA 3MKVA 4UQDA 2R91A 1H41A 4U10A 3NO3A 1XC6A 3AIWA 1MEWA 4B4FA 3P5ZA 1L9WA 3R0KA 4F40A 4GZJA 1MXSA 1HX0A 2JF6A 4LH8A 1UPPA 1S3TC 1A5CA 1VBRA 1TPB1 4K8HA 1SO3A 4NZFA 4ZXLA 3DEQA 2E9MA 3S47A 1XM3A 3BARA 5LIXX 3P14A 3UXIA 2V2DA 3MDWA 4F4RA 2DZXA 5A8MA 4WCJA 2WHJA 2OSYA 2PC4A 3H7UA 1E0UA 3ZSSA 1B3ZA 2Y4SA 1UWSA 1U33A 2PCEA 3U3HA 1F73A 4PB4A 4E6MA 2PF8A 1K77A 1CZ1A 3LN3A 1VHNA 2F6UA 4OV4A 1LL6A 4HJWA 4A8NA 3ZLFA 2ZUVA 1U83A 5LNSA 2GUBA 3PTKA 1S39A 1PCKA 4J3UA 4MJ4A 5AC6A 4PH6A 1FFQA 2V81A 5TAOA 4J40A 4QLKA 5AKQA 3CZKA 1RQEA 3NSXA 4OOUA 1V6TA 5BXPA 1MEIA 4P7OA 2BHZA 2WK2A 4D6CA 1BXNA 4GHRA 2VR2A 3RJXA 3V4BA 1ZALA 4DQWA 2PDNA 1M41A 1DBTA 3SY1A 1YE4A 4JKKA 3UXKA 4HU8A 4HMEA 2HISA 4I5RA 4OZOA 4QXIA 3W2KA 1GW9A 2BVWA 3NSMA 3FW6A 3VD4A 3OGSA 3MP4A 7REQA 5L9FA 2WPGA 3TC7A 4FXFA 4IQJA 3PWAA 2P0IA 1WKFA 4LB4A 1YEYA 4J3WA 3BPWA 5J5RA 2ZZ2A 4C5YA 4XD3A 3NOYA 3P2VA 4H41A 4WGXA 1KCLA 4N42A 1E4MM 2Z1XA 4JTJA 5LYRA 3NGJA 4ML4A 3WDHA 4JIEA 4MUZA 1T40A 1SVDA 3RYSA 4DJDC 4EXBA 4IHCA 3MUXA 2YDRA 3ZVHB 3AXHA 2DZWA 2YOCA 1L2QA 4OQVA 3SQLA 1J8VA 2ZICA 5JIWA 1PX3A 1A5MC 5A6TC 3UG8A 4YLWA 3FJNA 4ZBCA 2H6RA 3VIFA 2PDIA 1UROA 1JDEA 3NNTA 1GT8A 4HK6A 1HL2A 2IKJA 4MWAE 2HRWA 3AIUA 4LS2A 5I03A 1BYCA 4O8RA 2A3AA 1B3YA 1MRAA 3QHOA 7PTDA 4XISA 2ZXDA 1C8VA 1QPOA 5JUVA 1NWRA 2Y8VA 4MYAA 3EEGA 2J7GA 1RH9A 3KLLA 1QAPA 1A0EA 4PMZA 4LVDA 5J8LA 3L4TA 4H8HA 3QV6A 1GKPA 4RX0A 3VD3A 2WQDA 3DUGA 2ZRXA 1C93A 1TPVA 5CPQA 3ARTA 5BYWA 4R7WA 3CMJA 1EPXA 4HYRA 1C9WA 2PDPA 5CKSA 3GH5A 1EL3A 4UNIA 1WKYA 4YN5A 1PTAA 4XZWA 2QJMA 4G56A 2C71A 4JTEA 3OZMA 1LOQA 3VKKA 4FOKA 1HQTA 2CXEA 1QOPA 3W1XA 1O68A 1TJRA 4BHYA 4LU0A 4ZQPA 2CYGA 3GIPA 3M5VA 2C1HA 3LHYA 1ECEA 2D0FA 2EF9A 3V1PA 1BGAA 1GCYA 4EWJA 5EBAA 1ZBKA 1UR9A 5D9PA 2R1MA 4HVXA 3L4XA 3P84A 4B16A 4S3GA 1BYAA 2X7VA 1SO4A 3DBNA 4FMVA 1Y8BA 3R5EA 1F07A 4P7QA 5DMYA 4B2DA 1BEUA 2Z27A 3KVLA 5H2ZA 4XBJA 1DHKA 3BG3A 4NUWA 1IHIA 4AIEA 3R94A 4MDPA 3W7KA 1EC9A 3VU2A 1E3ZA 8RUCA 1Q6EA 3SUSA 3OZOA 1R86A 5CZ0A 4IQDA 1T96A 2HQAA 4Y90A 4A3RA 1WDPA 3VNJA 1ME8A 4FLRA 1T8QA 3QOKA 2XN2A 2D2GA 1UJQA 5HNRA 5DLCA 4AD0A 3M0MA 1W5QA 4DWSB 3LPOA 1F7BA 3GDLA 4UTTA 2E8ZA 1UP3A 4ZQMA 3T44A 2FFCA 5DMMA 3GG0A 3LM3A 3W70A 4CQ8A 1FCVA 2QF8A 1VGAA 4K1GA 1TUXA 3TXZA 4ZR8A 4IPJA 1D3HA 2QAFA 3SJ3A 1SU5A 5M1TA 1KTCA 5KEZA 2JGYA 3MHGA 4M6PA 3AYSA 2FDMA 2KZHA 3L68A 2Z7KA 1S3HA 3P62A 1E56A 5A2AA 2PODA 3SR7A 1E40A 4NNBA 1TPUA 2POTA 3QY8A 4YHEA 4JAWA 4H6RA 1CEOA 2ACRA 3B8VA 3AICA 1VFUA 3LS9A 3B8DA 3M0XA 4GJ1A 1A5OC 1M01A 1Z42A 3TTOA 3W6LA 1MMFA 3LCIA 3DKLA 4IG2A 3QYSA 4HA1A 2GK1A 3S5YA 1DL3A 1AJZA 1UUOA 5HQLA 3WLTA 2EEXA 1GZ1A 4HNCA 3TC6A 2WJDA 2VX4A 3ITGA 4GMEA 4ZO9A 3G1AA 3CMGA 3G0SA 2P1FA 1OVDA 1F2JA 1KKOA 2PWEA 4D8LA 4GI8A 3WNPA 3K4WA 5G4HC 5M03A 3KXQA 1YBQA 1FCBA 2V5KA 4QG9A 1H51A 4XTIA 3TR2A 3K1DA 2NVCA 1KBIA 3WG6A 2J47A 5B7YA 4W9TA 1VH7A 1VBUA 4A2RA 3U4FA 4QLLA 3HQOA 3WUBA 1RSCA 1MFUA 4PSPA 4DI8A 1R3RA 1QUMA 3F1QA 3N14A 1XGZA 3K1GA 3QY7A 2E25A 3BAXA 2YL9A 2NQ5A 2HBVA 3UPMA 1IR2A 2NQZA 2IUZA 2J6XA 1NFBA 3QN3A 2O7QA 2P8CA 3GNRA 3LMYA 3GAYA 3VCCA 4O15A 1QPRA 1HKVA 2NXGA 1JDAA 4B5TA 4F3HA 2DT3A 3KVKA 3UZJA 1YNYA 4H01A 3OW1A 2OYLA 5A1AA 4CNUA 4MTVA 1W9UA 4NAFB 5AZ0A 4QCFA 1G5AA 1KTNA 4M3PA 1J6OA 1KCZA 1FCQA 4NI8A 4DZIA 4H1ZA 1XFBA 1OCJA 2CITA 4IWWA 3SW6A 3T4WA 2FDSA 1LG2A 3SGGA 2FB3A 2ZA2A 5DRIA 4KCWA 5I79A 4YTRA 3EX1A 4QP0A 1VEMA 3FCPA 4JN6A 2WSYA 2X0SA 2D73A 1P1MA 2VQTA 4LF1A 3WEOA 4M7SA 4WDXA 1UC5A 4TX8A 1FXQA 2QCEA 4JCLA 2YA1A 1O1ZA 2BASA 1TVNA 1W5PA 2P5NA 4POCA 4YTTA 3S1XA 5FEZA 3XISA 1H09A 4ZE4A 4JQ1A 3GNNA 3O6AA 1GEQA 1KBBA 3BO9A 2F8QA 4H8VA 2CHOA 1B4KA 3HMJG 1ZFJA 5HNUA 4JX4A 1P7TB 2P8BA 1K7EA 1XQKA 3HG2A 1CGUA 3CB8A 5HJLA 2WC3A 5D8WA 4QEEA 1TVPA 2BZNA 3WQCA 3LK6A 3ME3A 1C8YA 4BJHA 3EWZA 1AL7A 3VZYA 1WNOA 3DFSA 1QJWA 4A29A 5EMUA 4MLJA 5D04C 5EMJA 3M41A 4HNOA 1K7XA 3ZYZA 2E67A 5KTLA 3EWYA 3S8HA 2GJXB 4TXEA 3RM8A 1JZ4A 1I0DA 4AZIA 4HZ6A 3DI0A 1PVNA 1QNPA 1RA0A 3CTLA 3ID7A 3MA8A 4E2VA 1DIDA 4JTGA 3AHXA 4Z0JA 4EKJA 3BAIA 3AZTA 5I6SA 4Z42C 2VGGA 3RITA 2BHUA 3WK3A 1SQ7A 2CZ5A 3PWGA 1XCXA 2D2JA 1N55A 2CBIA 4UQEA 2R82A 4K37A 1TCMA 1TJPA 3B0YA 1FWAC 3FEQA 4WDUA 4FZIA 2W3ZA 4GCAA 3AJ7A 4DWDA 4DPPA 1TX0A 3E96A 1X38A 3ARQA 3ABZA 5M3WA 5KINA 2JKEA 3NQEA 3CXOA 3PANA 4D1IA 1XV8A 1NOUA 4OU1A 4QJ5B 3W1RA 3WH8A 3UWYA 4EP8C 1XGEA 3OZYA 1CYGA 2A3CA 2W0UA 2VT0A 1JGMA 1XINA 1VB9A 5AYXA 1OSEA 1DJXA 2GVYA 4ICMA 1P0DA 3QQ0A 4RDWA 2AMXA 5HMSA 3M0KA 1LG1A 4FNSA 5D2XA 1NWTA 2TRSA 2ZXAA 2PBOA 3TE9A 2OKTA 2PDCA 3ECQA 3FY1A 2OEMA 4ACZA 4GG9A 1TWWA 1QI0A 4XZIA 3WDJA 1N7KA 3MVIA 3VCRA 4WOQA 5D38A 3WNKA 3AS3A 1HP4A 1GVRA 1AQHA 2PDBA 3UJ2A 1LBFA 3ALFA 2D22A 5EY5A 4LBUA 3BLFA 4UTWA 5LIKX 4MSSA 2RJHA 3BG9A 2UBPC 1ITQA 3IJ9A 3STCA 2GQ9A 3U7BA 4TUFA 3E12A 3DCPA 4CNPA 3EWXA 4UCFA 4XZLX 1X6LA 1BQGA 3RGTA 3W6MA 1WXYA 3EPNA 1DORA 1LQ0A 4I9AA 3PTDA 1W1B1 4FX8A 1HIZA 3CC1A 3Q65A 2GVEA 1ZZMA 4NASA 2GVJA 3NDYA 3NQCA 1DWIM 4LANA 2QLYA 3NGFA 1XF0A 3XINA 5G2WA 1SFJA 3VPLA 5IOBA 1W1IE 1TV3A 3TN6A 2ISVA 9XIAA 1XLGA 4AIOA 4FX7A 2R9RA 3OJGA 2DSUA 1UD4A 2X30A 3T08A 1ISZA 2XN1A 3R11A 4C7DA 2ZX5A 3TCEA 3W01A 3EOLA 1F8IA 1KQYA 5CSYA 5BXTA 3CUZA 3HFYA 3M0VA 4HN4A 3UA3A 4AH7A 2J7FA 2IPWA 3ES7A 3VC6A 4WJ8A 3A22A 1VJSA 3B0PA 5A6LA 4U5IA 2VC7A 3RDKA 1TMHA 1S2CA 1N8FA 2Z29A 2Q71A 4LY4A 1FDZA 1UOKA 3K30A 3ZLHA 4XK2A 3N4FA 4YTQA 3HOJA 4ROQA 3OYZA 4CQDA 4X60A 3I7SA 3PR2A 4ONVA 2B7NA 3W7NA 4NZ1A 3BMXA 4W87A 4XAPA 3UFYA 1X96A 5CZKA 2QT3A 4QISA 3E1F1 1P48A 1JVNA 3DYOA 4RZ4A 3M47A 3MV01 4NRRA 4YVPA 1XYAA 2ATSA 3NYDA 4URIA 1ISVA 2Q8ZA 2FMNA 3T0TA 1DJIA 3ZXWA 3M46A 1RK5A 4CCEA 3RMJA 2G96A 1A0CA 3SY8A 1BXCA 3SI9A 1TV4A 1DIOA 2F7FA 3BW2A 3B9EA 3B8UA 1FHLA 3HJZA 3DDMA 4FNRA 4IPLA 2D23A 1S5VA 2XGZA 2E40A 3WF3A 5EPDA 1KM4A 2PD5A 4V27A 3B97A 4M19A 2DUZA 4MWAD 4OGZA 1AZ1A 4IGHA 3W7DA 4Q4RA 4ADSA 4YMZA 3R89A 3QZ6A 1H5YA 4XKMA 4UTUA 2EO7A 1DQUA 3MTWA 4GY1A 2BS9A 1W9BM 3AUJA 4JX5A 4CKQA 4J3XA 2POZA 4ATWA 1QI4A 3EPMA 3WBAA 1R3QA 2CZFA 3L5MA 1OF8A 2YL5A 4LT9A 1UKSA 3QPEA 4YVVA 3N2CA 4NZ3A 3BCDA 5LHFA 4CD4A 3G18A 4QDMA 4R9XA 2YDAA 2DIJA 4DO4A 1T6MA 3QR3A 4RDZA 4GVIA 1QI3A 4IGMA 4Y9PA 4US5D 1DHPA 3V0TA 2PDXA 3PP7A 3QR1A 1Y0EA 1XP3A 4JTTA 3C0QA 1Q4WA 1BG4A 4D6FA 5BWFA 3ORWA 4JFVA 4IOTA 3M7WA 2V5CA 2B7OA 1G4TA 2OSXA 1JAKA 1D7FA 4QAWA 4YHGA 3MZ2A 2G97A 3KTCA 1TPFA 1FA2A 1ZY9A 3WK2A 1X1NA 1SSDA 5FEXA 1BF2A 2WMHA 1JF5A 3A3HA 4XZMX 3UQNA 3W85A 4L9ZA 1H7XA 2DW7A 3WKZA 1AFSA 4H6QA 1FCUA 4UZSA 3L12A 3TIMA 1J0IA 4NILA 1O12A 4UQBA 5BOEA 4HMNA 3WNNA 1WDWA 5C9WA 2EPLX 4CNOA 2Q6ZA 3CL8A 3UCDA 3HM7A 2FZ8A 1J96A 1J93A 3UU0A 4C6FA 3VM5A 1LL7A 1WA3A 4PSRA 4M1RA 4GZEA 5AC8A 1W0MA 3S2NA 2V3GA 1SO5A 2RHGA 2VURA 1F61A 3EB2A 4J3VA 4D6GA 4WKFA 2BY1A 3QYQA 3RX3A 1P0EA 3QW4B 3WNLA 3PM6A 4GO9A 1OC5A 4WY0F 3GDTA 4MAVA 3W2LA 3W1QA 2XH4A 3IIOA 2FH6A 3C61A 2ALDA 1TJ2A 2BHYA 1I1WA 3N11A 3L66A 4J9JA 2Z0IA 3B04A 4JL2A 3S1GA 3W7CA 4L7ZA 1O94A 1XDMA 2YZ5A 3GXPA 4ZOEA 4ZZ9A 1I1XA 2NUYA 2YA0A 3IJ6A 4UNKA 2AOSA 3OIHA 3VC5A 1U5HA 3D6NA 2CIPA 4W8LA 1PYMA 5JXQA 3MSDA 1RY0A 2REQB 3LHUA 3A13A 2AQVA 2X42A 4PL2A 4I7VA 3VIMA 3OLEA 1GQNA 3QZAA 3W22A 4CD5A 4Z2JA 1A3XA 1TYGA 1W2VA 3MHFA 3W6YA 4XVDA 1YDNA 1TWZA 3MWAA 4KFPA 4D8AA 4KCVA 4M56A 3E02A 1ADOA 2DZVA 3WL1A 1FWEC 1DTNA 4AB4A 1OGSA 3KOWA 4U5KA 3RRXA 3HMCA 2BX7A 1X1ZA 3FAWA 1OADA 4QJ4B 5GPRA 3SSJA 2I7GA 5CZJA 5A6BD 6ENLA 1IZCA 1YMYA 1AG1O 3MUZ1 3GQYA 5AHIA 1B54A 3WMCA 1XH2A 3MPGA 1TCDA 1TWDA 1TO3A 3TOYA 2Y1HA 4YWIA 4HU0A 2ISDA 2VQUA 3WLMA 3CWHA 3RLVA 2WVVB 1XRFA 3LGDA 4ZOAA 3GC4A 3VOGA 3TNOA 2YB4A 3NXLA 4PTXA 3P67A 1KWKA 3N17A 2W27A 3NQ8A 1SSGA 4IGNA 3JR2A 2VD8A 3BGGA 4KS0A 2FIQA 2QCDA 3ZT5A 2R8WA 4JEQA 3DHUA 3OOQA 1UD5A 1LYXA 1W9DM 3TCSA 1TV8A 2NX1A 2TMDA 2XH7A 2GZXA 3E2QA 4JIRA 4R34A 1H0GA 3URQA 2I9UA 4KEUA 4LRSA 1GORA 4Y9MA 3JZUA 4QE4A 3EXTA 1VQTA 2BV9A 2GUUA 4OECA 2J7BA 3BCJA 3UR8A 2QUVA 3NL5A 3LERA 2WSQA 3FKRA 4AD3A 2DZTA 1MUCA 3B9OA 4ZO7A 3V35A 4HT3A 5CGMA 2O55A 2QDGA 1N8IA 3I7RA 2R24A 1OBAA 3W76A 3CZEA 4Y96A 2D0HA 8CGTA 2GWGA 4RE4A 5GJNA 1LOLA 2ZXQA 2C1IA 1U2YA 4RE3A 5DELA 3LSBA 3UCCA 4GLEA 1DP0A 4AZ5A 2GQ3A 2NQHA 2Z6JA 4V1YA 3STPA 4E8DA 3G1FA 4FLOA 5JU6A 1YBQB 4ZFCA 4C7GA 3O9NA 2NX9A 1ALDA 3G6MA 1PXGA 1V6WA 1QW7A 4DNMA 2RAGA 1E3XA 2VX6A 3EOEA 5HA7A 2JALA 1XS2A 1XYBA 1GOKA 4GNVA 3G1XA 1L6GA 5I3FA 1QO2A 2BDQA 1AJ0A 2G3IA 1JR1A 4Y7EA 3W53A 5HQEA 4X0VA 3OA3A 8XIMA 3OLGA 2XGBA 4JNYA 4E3VA 5FF3A 2C91A 4GCXA 3W0KA 2O9TA 2QPSA 4FOJA 4M7TA 4GIYA 1OFEA 3LTSA 1YPFA 4DY1A 3THUA 4BQ5A 3W1LA 1Z3NA 4GQQA 2E9BA 3HPSA 4JY8A 3V75A 5FKYA 1EHNA 2NW0A 2QYGA 1R3WA 2CLEA 3VX0A 1GJUA 3SM0A 4TX9A 1BVZA 4C1KA 1O7AA 3WD1A 3ZSTA 1LZOA 3WQ8A 1MQQA 3ZS4A 1Q6CA 2W63A 3VMNA 2XPKA 1NOFA 1QBBA 1EUNA 1SGJA 3EX2A 4KIEA 1ONRA 4BS0A 1Z69A 4PMQA 4CNSA 4NXSA 5EGRA 3OBEA 2OWWA 1JUBA 1Z32X 3IK2A 3U7VA 4O0KA 5C5YA 4UR9A 4LNYA 1XHGA 2WSKA 2A0NA 3V3WA 2IW0A 1NDYA 3T81A 4XBKA 3LU2A 4S3KA 4GXWA 3T1GA 1Q6OA 1CGXA 3YPIA 1RXOB 1KO0A 1DJYA 4IIGA 4N9DA 2VELA 4FLQA 1NSJA 1YXYA 4X22A 1MQPA 3ITTA 1IGWA 4O4WA 1D3GA 4BA0A 4KEZA 3A9BA 4LEFA 2FTPA 1QWKA 3VI2A 3AFBA 4HK7A 4B3ZA 4Q8PA 3QLDA 4NVTA 3DFHA 3CWOX 2WMKA 2Q8LA 1I2OA 3KBNA 1S2WA 2QGYA 1I2NA 2VCAA 4FF7A 3N2BA 4UFMA 3LZ3A 2O9RA 1PZ0A 3UR7A 1MXDA 1BD0A 1V79A 2PMQA 2VR4A 3QGKC 2CZDA 3VILA 2WCAA 4OOZA 3ZVIA 3I3DA 3RM9A 5HWNA 4JPGA 1OC6A 5FOOA 2P0OA 4PEKA 3IPWA 4C6KA 3H2EA 3TWBA 1RY8A 4IJRA 5LXXA 2CBJA 4C5ZA 2QVHA 3I3EA 3AIQA 3TTEA 3LBOA 3RRAA 1UG6A 4OVXA 4Y8FA 1J79A 1XBZA 2WV8A 1VYSX 5ABTA 5CJ5A 4NSBA 3OODA 3P81A 4O0ZA 4HK5A 1M68A 3IAQA 3CO8A 1C3FA 4AWTA 2IKGA 1DJHA 2XWEA 4UFIA 3RFAA 1HJWA 1CBGA 4LVBA 4P7NA 4OIFA 4F0MA 2VKZG 1HT6A 3SGZA 1EQCA 4AF0A 1W1YA 2QUTA 3HGRA 3SUVA 1K02A 3H22A 1XC4A 1TZ7A 1XIJA 1Q65A 1IXOA 1Q66A 3R6IA 2HK1A 4ECLA 3GYCA 4X61A 3KUMA 4Q8NA 4DBDA 5IDZA 1W3JA 4HU3A 2Z2UA 2XTKA 2FHFA 3WEZA 1TRIA 4U2ZA 4GOAA 3PF3A 3EMCA 3PZQA 4O28A 4KGJA 4E5TA 1WDQA 1PPIA 4QJ1A 3EWBX 1CXFA 3LNPA 2EG8A 3GNPA 5A69A 1XCWA 2PTWA 1LQAA 1UH2A 3A21A 5C9RA 3ANVA 5SWUA 4MJ2A 2EGZA 1DWAM 3E0LA 4GVGA 4HPHA 1IEXA 3RO8A 1FWNA 1YTDA 1H7PA 1TRDA 3S5SA 1JPKA 1RVGA 2ZRZA 1CLKA 4PULA 2QHAA 3QC0A 4C6OA 3MUY1 1KXTA 1KBJA 3TSBA 3UJFA 3WEMA 3W7IA 2NSXA 3WCZA 4N6EA 4XAGA 5KMYA 1FDYA 5EMKA 3WFZA 4FXRA 1XI3A 3ZLGA 1R2TA 3NL6A 4BWLA 1IZKA 2X1RA 1F6PA 4HZMA 1GQLA 1VBJA 1QK0A 1E1EA 3G3DA 2R6OA 1UD6A 2WW5A 3EDFA 1RBOB 2VX5A 1XICA 1TE1A 5GJMA 4NYUA 4F48A 2B31A 1KXHA 1OIFA 4JZ5A 2PGRA 4WDWA 3S6DA 4D9PA 2V5JA 1XIFA 4Y6GA 3AXMA 4QE5A 4U33A 1OF6A 1BWKA 2WBKA 2YYUA 3T2OA 2Z2AA 1NARA 4HYVA 3E0FA 1S5NA 3CZGA 3AMLA 2Y7FA 2HROA 1UR4A 3BSHA 2YL8A 3KHDA 4TO8A 4AIBA 3LRMA 3W00A 1ZGDA 2IPFA 3LTYA 3W7LA 5FEWA 3OBAA 4IH3A 1SM9A 3VFLA 5HQMA 3BLKA 4MWAA 2HE8A 3M0YA 4MY1A 5A3HA 2W67A 2UY2A 3UCQA 2E8YA 1QDSA 2ZTKA 4O52A 4RKAA 3KS6A 3GXTA 1E9ZB 2HCVA 4UQ9A 3S6OA 4EK7A 2HPMA 1I6NA 4AY1A 3MO7A 4DUXA 3MCOA 1TSIA 1WYIA 3DI1A 2ZX6A 2CLMA 4DUOA 3RCNA 4J5NA 3FA5A 3A23A 4M5PA 3RPTA 1D9EA 3PG9A 3MYOA 2E6DA 4D1JA 4C6EA 4H8NA 3WBXA 1ZCOA 4GE8A 3LQGA 4GI4A 1ZAJA 1G94A 4W7WA 1I60A 3SRHA 1PO9A 2PGEA 3GRIA 4TTUA 1WP6A 1FWRA 1AQMA 3IJDA 3BAWA 2GJXA 3VDCA 5GVJA 1HNYA 2QUMA 1EGMA 4W7VA 1US2A 3SN1A 3KRSA 2OKOA 1MUWA 2D2HA 4AU0A 3L2IA 2X16A 2VR5A 2ZX7A 3IK4A 3DFQA 2GOUA 2J8TA 3ZM8A 4H9VA 1P6BA 3PBYA 3WQOA 2Z26A 1I2PA 4Y9OA 1QHPA 3CIWA 3O6CA 1BYBA 4X2PA 4Q8TA 1E6PA 1BFNA 1VYPX 5CC6A 1DWHM 2J74A 5D32A 2J77A 1QT1A 4DIAA 3TROA 2NV2A 5D9MA 4MG4A 3VDGA 1B57A 3AHTA 4IIBA 1JD9A 4G6CA 3QVQA 2JQXA 5BW6A 4HTYA 3KL5A 4LFYA 3POCA 2A6LA 1KFKA 1LRNA 3BLEA 1IEVA 2HK0A 2YDQA 4JY9A 4DF0A 1FXPA 4UIOA 2QJJA 3CLMA 3THAA 2ZUTA 4D8ZA 2PFHA 4GA8A 3HJEA 4JBRA 4L1GA 3EZ4A 3VDAA 2XINA 1GUVA 4Z1CA 1B1YA 5C9ZA 1KM3A 5D4YA 4YJ5A 5FSEC 2XFYA 2YCLB 1MRQA 3VNZA 2ZCGA 4OJYA 4IX0A 3G5EA 2BY2A 1NF7A 3P60A 4D6IA 1ITUA 2UZ9A 4B9YA 4UZUA 4E2OA 4DJDA 1QU4A 5PTDA 1QNVA 3W1NA 2E4TA 4K6AA 3HO8A 2HE5A 4IMFA 4FPSA 1JG9A 1GQJA 2CWNA 5B7ZA 4JIHA 1OCBA 1A3HA 2QCCA 3ITVA 2FZDA 5K9DA 4MJMA 5G5IA 3FNDA 3N2TA 3UWUA 5HWMA 2CKSA 3NL3A 5G4EA 5J5DA 2PWVA 1IZJA 1F3XA 2HTMA 1K8CA 3L2LA 3MB9A 3S2CA 4ZQRA 3L0KA 4QFUA 3CL7A 3C0SA 2WJZA 3TQPA 4QS5A 4H4IA 2NX3A 3T2QA 3HFTA 4MIMA 5ABFB 4GGBA 2DSZA 4DX3A 1DIKA 1JYWA 3BAKA 1TIMA 1W8GA 3SURA 2OYKA 2Z28A 5G2IA 4D6JA 5H91A 2C13A 2W62A 1BTCA 1P4CA 2PDKA 3PPFA 3KP0A 3ZMRA 3WNMA 5HMFA 4JN7A 1G1YA 2V6AA 1RHCA 4TVCA 5HXMA 3N34A 4ILSA 1M53A 2OJPA 4GWEA 3UBPC 2ICSA 1W5MA 2VZVA 1EZWA 4UFKA 1S5MA 1JJKA 3H2MA 3NQGA 4QQUA 3O63A 3B06A 1KXQA 3NPWA 2YIHA 2RGMA 1XH0A 3LXAA 3VAVA 5E6ZA 3ZJKA 3LV5A 2X7WA 4AFYA 3APTA 3B8IA 4PBGA 4NAFA 4ML9A 3KWSA 4S3CA 2DUAA 4K36A 3BH4A 3ZIZA 1A5BA 4RW3A 3NJ3A 4MZ1A 2VHLA 4REQB 4F79A 4AZ7A 3O0FA 5LKYA 3CUXA 5D03A 3CBWA 2UV8G 2CETA 4WKHA 4MHBA 4GFIA 4OUIA 1EJUC 5FJJA 2BWGA 4HA3A 8XIAA 4M80A 1TV2A 3GO2A 2RH9A 3W02A 3SADA 2OQYA 3MBFA 4UTTC 4Q7NA 1XRTA 5A8GA 4JEJA 4BF9A 2WWCA 4JTRA 2VEPA 2HPIA 4I8YA 4LF2A 4QR6A 2Q01A 3VO0A 1M7XA 2YYTA 3EDEA 3EBVA 2XFFA 3WDQA 4QNEA 2GDVA 2ZDRA 4UMBA 4XWUA 4S3JA 1R9YA 4DJEC 2PAJA 2PLKA 2I57A 2V68A 3WNOA 4O57A 3R2GA 2AAAA 2VUNA 4Q8OA 3ARXA 4RLIA 2JEQA 4D6DA 1CI1A 1PUDA 1I45A 2LLEA 3N25A 4DM1A 3MY9A 4DWSA 1SZFA 2FGBA 2WMFA 5ABFA 5TBOA 3T78A 1GPFA 1B4EA 1X1OA 2J7DA 1YPIA 3I4EA 3KBVA 1AJ2A 2DSVA 4GVHA 3MC5A 3TWAA 2OQHA 3Q2DA 4HMCA 1LOSA 2A3EA 4M6UA 2F6XA 3OVQA 1VEOA 1VAHA 1OFBA 2BFGA 3F03K 2HZGA 3II1A 1UOZA 4X3ZA 1W9XA 4NIRA 3MU7A 4B5XA 2XIOA 2FKPA 5FL1A 5LNVA 3JUGA 1NDZA 2WMGA 5DBUA 2QW5A 1ICPA 2CNCA 3IWPA 1Q6FA 4KRZA 1TR1A 1BRLA 3RNDA 4C60A 1KRMA 4XO7A 3KVJA 3HA1A 1VPYA 2GK1B 3FDKA 3UJRA 4KQNA 3SGUA 4UTKA 5AC4A 2VMFA 3RLGA 1PKNA 4PL1A 4A8LA 3S3GA 2XU2A 3ARSA 2ZRUA 1KB3A 3VVGA 3U2CA 1VCGA 2RJGA 3P5YA 4PMDA 1XPYA 4LYPA 1P0BA 4O1BA 4D6EA 2XIIA 4GINA 3G1YA 5FEPA 3F4CA 1W56A 1QHOA 4JTDA 2Q3RA 4UMAA 3UY7A 3OBKA 3UT0A 1KV5A 1EF2A 2ADAA 2FZ9A 1VYRA 4ENLA 1Y5WA 3T0AA 2E7FA 1W5OA 3G0UA 1GNXA 3VIJA 4NKCA 3GTNA 3RU8X 1JCXA 3TN4A 1VLIA 4HNVA 3AIRA 3NQ7A 4GQ0A 3AROA 2E5BA 3VK5A 4NX0A 3GKAA 1W54A 5LSMA 4LC6A 5T8GA 1P1XA 2PDGA 1A5NC 1UD2A 3IJLA 3MS8A 4QJ3B 3EB3A 2Y88A 3V16A 3O3RA 2VI0A 1XYCA 5E93A 1EEXA 1EP2A 4HP5A 1PYFA 3DG3A 3L4WA 1UBSA 3RN6A 3T2PA 3GVWA 4NU7A 1Z41A 4JFTA 3MV11 3MSRA 5CCZA 2V67A 3BW3A 2WZHA 3V1HA 3UWZA 4ADTA 4F66A 3H6OA 4D2JA 3W84A 2PBGA 1T5AA 2EG7A 4JXCA 5LNRA 3IACA 3UF9A 2DVXA 2WCSA 3MBDA 5LGXA 2FH8A 4ICCX 4K7YA 4JD4A 5REQB 2JEPA 4JTQA 4XSLA 1XJBA 3CASA 4S2CA 5FF7A 4LGXA 3MW7A 3WJZA 1BG9A 1GZJA 3OB8A 2C8NA 3IS4A 3K4AA 3Q4DA 1Q6DA 1MXGA 1G6CA 2GVLA 1M3UA 3WLRA 2AKZA 4PCSA 3V5FA 5DO8A 3ITOA 3DXIA 1PJ9A 5D2TA 1E4IA 2YLAA 1W9VA 4C6JA 1NFPA 4TOQA 3TK7A 5C2XA 4KBXA 5MKGA 4C6PA 2PEVA 4JICA 3VMPA 5CBIA 4JTHA 4E2BA 3BZGA 1XIHA 5I02A 1QCWA 1GW1A 3WLQA 2DPEA 5A6JA 1EYEA 1N8WA 4AAJA 5D09A 3H70A 4UCGA 2Z6IA 3QQWA 4DJFA 2A2IA 2VJXA 4MKVA 5I5RA 3LOTA 1LLZA 1B0IA 3C6CA 3UXDA 4CCDA 3B8WA 3C8NA 1WV2A 1UWAA 2OYMA 1OX5A 1KGUA 2YW4A 2DORA 3UGVA 2DT1A 2PDYA 2FB2A 2WHLA 2VDGA 3BG5A 2HS8A 4OWGA 4DBUA 2OGJA 2PGWA 1RPXA 3FJ4A 4DJDD 5IFPA 1O1HA 5AYBA 2H9AB 2XFRA 2OLSA 3AMKA 1QXLA 4O17A 4Q4PA 1K9DA 1LLWA 4F0HA 3CAKA 1NQ6A 4ZB2A 1VJZA 3GVQA 1HVXA 1DE6A 2PTDA 3IVSA 1V3LA 1HKIA 2FZMA 1PZ2A 1ICQA 2NXHA 3VA8A 1ZB5A 2OTDA 3B0UX 1WOAA 3UVAA 3CM4A 4K39A 5LA0A 2XM1A 3C4UA 2PU0A 2J9XA 1G9HA 3STFA 1SJDA 1UWUA 2EHHA 2QCNA 4JQ4A 5BXSA 3G6LA 2ZADA 2QS8A 3WFAA 3G1VA 2VRQA 4PUDA 4US6A 1VRDA 1QFEA 3BURA 4QITA 4PE8A 3DH7A 1UKPA 2VFDA 1BYDA 3TJIA 1W3LA 1E51A 3TNBA 2A3HA 4DZHA 4GIAA 4NJIA 2ZKMX 3LCHA 4P8WA 2MUCA 4WLCA 5DCBA 3GXDA 1YPXA 5EFFA 2AAMA 1WB0A 2PB1A 3VIHA 1VKFA 4PTNA 2OX4A 1FQ0A 3BQ5A 2Y61A 4GUHA 3GK0A 5CG0A 2DJXA 2Y85A 1TMLA 1QK2A 9RUBA 4YU1A 2XDFA 1L8NA 1H7OA 2GJPA 3SRKA 1XDLA 1H60A 5T26A 5DEZA 2WNNA 3PBGA 3RU6A 3SRDA 2HXUA 4O14A 1R8LA 3KTSA 1G0CA 5FIPA 3W2MA 3VDBA 5D37A 3H8AA 4IISA 4BQ2A 3B9NA 5M17A 4L6HA 2QVNA 4HCHA 3AZRA 4AVFA 5XIAA 3W82A 4OE7A 3GNOA 3AALA 3FSTA 1YX1A 4PB5A 3TW9A 1EFZA 2DDXA 4JTFA 3QFWA 5DFAA 2FVMA 4U31A 3VZXA 2NQJA 2HDJA 3SQSA 2FFIA 5BU6A 4C6IA 3CHDA 5HWJA 4JQ3A 6TAAA 2R1NA