4US5A

Crystal structure of apo-msno8
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
329
Chain Sequence
HVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSAEAAARLGLPYAYAHFITPQFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
total genus 119
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5A00
1XKJA 2I7GA 1TVLA 1Z69A 4US5A 1BRLA 3FGCB 1F07A 3SDOA 1LUCB 3B9NA 1M41A 1NFPA 4US5D 4UWMA 1YW1A 5LXEA 1NQKA 1EZWA 1RHCA 1FVPA 1BSLA 1BRLB 4J2PA 3FGCA 1LUCA 5AECA 2B81A 3B9OA 5DQPA 3RAOA 3C8NA 3B4YA
chains in the Genus database with same CATH superfamily
4G1NA 3MZNA 2WM1A 2FZDA 2CNCA 1K9DA 1PPIA 4LYQA 3QR1A 3GTXA 4ICMA 4HU0A 4WIWA 1BSLA 3RITA 3TJLA 3GNNA 1AH3A 4QLJA 3IJDA 3K4DA 4KWVA 2EAWA 5I77A 1IT7A 3U5YA 3UVAA 4AD2A 2BWGA 2EKGA 1KTNA 2A6NA 3W88A 1BF6A 1SO6A 4AQLA 3S46A 2J7EA 3UJ2A 3CL7A 3O6YX 1WO2A 3LHTA 4X2PA 2Y7EA 3ES8A 3NZRA 4F4RA 2I1OA 3KLKA 4XISA 2HPIA 3W75A 4TIMA 3DG6A 1KM5A 2BY1A 3IJLA 4UR9A 1MRQA 2V69A 2Q01A 1PCWA 2D23A 4FNPA 3WQ4A 2E6AA 2YOCA 2E9MA 3W38A 4DYEA 3LV5A 1J0YA 3PZOA 1QASA 4BK9A 1GEHA 2B7NA 2BHUA 1NAL1 4CVWA 3HURA 4NIRA 2C18A 3URBA 1B9ZA 4JTKA 2HNHA 5EKYA 1PKYA 4I7VA 1F3TA 4GBUA 1QO5A 4PC8A 3PF3A 1EEXA 4I8DA 1Z3NA 1V3IA 3WEOA 1E3ZA 3RYSA 3LRLA 4MTVA 5BW6A 4UFMA 4A3RA 3FS2A 4IJCA 4RZ4A 1C92A 1D7FA 1VH7A 4BI6A 3G3MA 2NLYA 4DYJA 4NXKA 4DRSA 4HHHA 5ABHA 1AQ0A 2VP8A 1C7TA 5IHSA 5D2XA 4JN8A 4QM1A 2YL8A 2PDNA 1W9UA 1CEOA 4A3HA 1Q6QA 4CVUA 1ZBVA 1QT1A 2AQVA 4AWSA 1KM6A 3VNKA 4FX7A 1DJZA 1ZPTA 3T2PA 5EPDA 1E9IA 1EC7A 2E1WA 2ONEA 4HPJA 3UZ5A 3VM5A 4GUJA 1RD5A 3FGCB 8RUCA 3THQA 4GWEA 3CT7A 1SW0A 3NSMA 1Q6GA 3RMJA 1YRRA 2WXDM 4P7LA 3A4AA 5B7ZA 2P53A 4DBSA 3P81A 1H49A 5HINA 1CLXA 4WQ6A 1F5ZA 3PTMA 1RALA 1LLWA 4HGXA 4D6CA 1O94A 2P3ZA 4XSLA 1WZAA 4H7VA 3RMEA 3O6CA 1S1RA 3PNUA 1QW8A 5AZ0A 1KCKA 4CQDA 4BQ2A 2SFPA 1YDOA 2A2IA 4PTNA 1R7AA 5FJUA 5DCEA 3HGOA 1DQXA 1Q5MA 1XV8A 4ZA0A 3L5LA 3NZGA 4KCUA 1LF1A 3WLTA 1VLWA 3FY1A 5C55A 1KFBA 3HA1A 3VU2A 1OFBA 4J2PA 3IRDA 3H53A 4RZ5A 1J4EA 2W3ZA 4QHRA 1FP8A 4LQ1A 4BJHA 1NOUA 1HGYA 4GY0A 1TPUA 1W1ZA 4UQEA 5F2MA 3W3OA 4QDPA 5FEPA 2RH9A 1NVMA 4QNWA 2DT3A 4MJMA 3LU2A 5D9PA 5HPCA 5CH9A 4AD3A 2PDCA 3NDYA 2V67A 4C6OA 9RUBA 3CQ0A 4MFDA 5F4WA 4C1NA 4ZTXA 3KS5A 5C2GA 1XLKA 4O1DA 1YQ2A 2CETA 3LA4A 2HV5A 3B0UX 4DWSA 1AVAA 2R1NA 1H4PA 1R9ZA 2VFHA 1E6NA 3VM7A 2HROA 3AS2A 4LW7A 1MWOA 1UR0A 3CZEA 1BPLB 4GVIA 1JPMA 3AUOA 1R5YA 1XC6A 3W25A 3TV8A 1OGSA 1V02A 3T0TA 1VFOA 4MVAA 4MYXA 3A5FA 3MUCA 3N6JA 3GNPA 1Z48A 1ADDA 4C6JA 1ZBWA 3QSRA 4FF5A 3R25A 3CV7A 3WZ0E 3CAVA 1Q2SA 4BFAA 4CKQA 1NSJA 3HG2A 1U1UA 1YDYA 4KRUA 4US5D 2WMFA 4IL0A 1UR9A 3QGKC 1FA2A 3EPMA 4LJ3A 1HKJA 2YPIA 1QNVA 3SCUA 4NJKA 3B05A 2CBJA 2OCZA 4FXJA 3NQEA 1DWJM 2QIWA 2CHRA 2ZCGA 3W9ZA 3CWOX 3DESA 1XF0A 3GK0A 2EQDA 5LIUX 2X16A 1EF2A 4H9MA 3TXZA 1LG2A 4MLJA 2NSXA 1PYFA 3IGUA 1W1TA 4ILSA 2R82A 1MW3A 3F4VA 4B15A 4MPKA 3SGUA 5LXXA 3TK7A 3CYJA 2RDUA 3PB0A 3WLIA 1C91A 4JTJA 4I5RA 1R0MA 1NJJA 4LUSA 4UTWA 1P1MA 1EZWA 3VNLA 1NFGA 3V16A 4K2SA 3G1FA 4RPQA 4S3FA 3IGSA 2CKRA 3ZVHB 3H2OA 3G1AA 2FPYA 3B8TA 2E40A 3L4WA 1E6SM 3PHAA 4NX5A 3HPZA 5CZKA 8CGTA 4QAWA 3STPA 3T4WA 2PZ0A 3QQ0A 3DEQA 2B31A 3L9CA 4Z1BA 3A64A 1FWHC 4RV8A 3KL3A 1F4AA 3LCIA 4MAVA 3UJFA 1XG3A 4GA8A 2Z0IA 4MGGA 3A21A 3B8SA 4BF5A 2BHYA 2VHLA 3M7WA 3GFXA 2E5DA 1ADSA 3BSHA 3AS3A 1QOXA 2WMJA 1JDFA 4EKJA 4B4HA 4F0KA 3CIVA 3E74A 2R1PA 3IJ7A 4NNCA 3C8NA 4Z1DA 3QLDA 4YCOA 1JZ8A 3LBMA 4GVHA 1BWLA 3OZPA 1WYIA 5CPTA 1C3FA 5LNRA 2QUMA 4AF0B 2ZUNA 3TQPA 3K5XA 3GXTA 3GH5A 2PDJA 3CM4A 4TVDA 2R1MA 4J3ZA 1MNSA 1S46A 4JIHA 5IOBA 4DLMA 4P8UA 1NH6A 3I6EA 4PN2A 4LVAA 2J62A 2G3JA 3WBEA 1IR1A 2VWSA 4H00A 1LYXA 4CD7A 3E02A 4XAGA 4IIGA 5LGXA 3QW3A 3AIBA 4B2DA 4HK6A 3MSRA 4PCNA 3I10A 2E68A 3RJXA 3TX9A 1V93A 2PDMA 1YBQB 5E70A 4LY8A 4CNNA 2OTDA 3S8HA 1GQLA 3N15A 3W2MA 2O4MA 1CGYA 3GFYA 3E2SA 3N34A 5C9WA 4GNKB 4IIEA 4FOJA 2GGGA 3HQNA 5I3DA 4L6HA 4GI8A 2E67A 3HV9A 4HJFA 3CH9A 3EZ4A 4O50A 3K4WA 1US3A 1P1XA 3EKGA 2J13A 1Q45A 1K9TA 4X0VA 4C6KA 3N4FA 1DHKA 4JKMA 1C93A 4MAZA 1JPIA 2VVSA 1EXBA 2PDYA 1EKOA 3U4AA 2QDDA 1TWSA 3R0DA 2HRWA 1F6PA 3AROA 3ONCA 2XFFA 1S38A 5CZ0A 3C0SA 2WK2A 4J5NA 3H70A 3LCWA 5DX7A 3BK0A 2YXOA 1OCQA 1JAKA 3GE7A 4B5NA 4DEFA 3RM9A 4HPHA 1OG0A 3W1XA 6A3HA 1YNQA 2JF6A 2MANA 1YE4A 3WQGA 3FA5A 1I1WA 2NW0A 4EAYA 1UBPC 3VKBA 1D9EA 3GYEA 3NXLA 4O1CA 4XV0A 1X39A 2NV9A 3IAPA 5CLWA 3WNPA 2PBOA 1OC5A 4E4FA 3VD4A 5D09A 3UBPC 1P6WA 5HATA 3GG1A 3CWHA 3EOUA 1FFRA 1O66A 1UMLA 4ZFCA 1AMKA 2PDGA 1G7VA 2WNZA 3D3FA 6TAAA 1YNPA 3P67A 1MYRA 3GW3A 4KESA 4UB9A 4HPXA 3GNXA 4H6KA 5E6YA 2OYKA 1VFUA 2Q3RA 5JIWA 1R85A 4JCLA 2I5IA 3XINA 2ZUSA 2XZ9A 1OK6A 4O4VA 3RJYA 1GVQA 3QTGA 3O3RA 1XLFA 2XSXA 1TV7A 2NWRA 1AZ1A 1JAEA 3O0FA 4MZ1A 1IEWA 4EVZA 3DN5A 3QQWA 4MZYA 1R3WA 3SN1A 1Z42A 2CWNA 1M41A 4FIRA 4O12A 4GH3A 1BXBA 4GK8A 3TU9A 1A5LC 4FNTA 1V0NA 3VOGA 3GDKA 1D3HA 3HN3A 4YTQA 3BOXA 1PTGA 2PTWA 1H7RA 3FJNA 5A3HA 3QGAC 4X2RA 3N6QA 3CZJA 3M0VA 1YTKA 3E2VA 1XW8A 1B3WA 2XGIA 3JRKA 2P50A 3O16A 3S9YA 4HK7A 4WDXA 3UD6A 3E2QA 2YSWA 2HE5A 4E5TA 1C29A 3ARQA 3LB0A 1J93A 3ZS4A 1TTJA 2PP0A 2C1IA 4NKCA 3L7RA 5G4WA 3SIMA 2GVEA 2XN2A 3CHFA 5HXMA 3GXPA 5AB3A 5D2WA 2MUCA 4JQ4A 2J77A 4HMDA 1GEQA 4IISA 3VCNA 1B3OA 3TQVA 2Y24A 3GFZA 3SADA 2GUYA 1YXCA 4JIRA 2DGAA 3N11A 2X0HA 3RGTA 1VJIA 3H6OA 3HTWA 3LDVA 5LZLA 1UWUA 4UR8A 2C91A 3AALA 3CUXA 4Z2JA 2A3BA 3OLEA 2NQ5A 4R88A 1UIOA 4TVCA 1UD5A 3U2EA 2HS8A 3NQGA 3U5UA 4UTWC 4ADUA 2W6RA 4ATDA 4HZMA 3AHYA 2QAFA 5A5WA 1Q6FA 2FTWA 1V7AA 2NZLA 3ZWSA 1O5KA 3G1RA 1Q4NX 5HOSA 3T05A 1NDZA 3M0HA 2WC4A 4EIVA 5I23A 3PG9A 4PRWA 1DIEA 1WAWA 3MUZ1 4U3AA 1A49A 1TQJA 3ERPA 3WKZA 3GNOA 1K03A 1MZRA 1VFTA 1REQB 7TAAA 2A1YA 3S9IA 3GR7A 4IGSA 3AHVA 2OEJA 3MYPA 1VBUA 2J6VA 1SZEA 2YW4A 2QVHA 3OLIA 3WBYA 3S2NA 1KRMA 1FVPA 1VQTA 2X05A 2W9MA 2X41A 4L4LA 1NDYA 1TZ9A 3TJ4A 3UY8A 1E9YB 1I0DA 1QHZA 3L67A 3KBJA 3W53A 2OOFA 2PGRA 5LA0A 3HQOA 3H2EA 1KXTA 3STFA 3H55A 2Z25A 3DFHA 4K8GA 3AIQA 1UYQA 1CI1A 3DFYA 2HDJA 4H7CA 3A23A 3UG8A 1OY0A 1JNDA 3MI2A 2VELA 4ZSTA 1Z32X 4DY1A 2QJMA 5MKGB 2BSLA 4MWAC 1KV8A 4HA0A 2G50A 4E8GA 4F2TA 1MXDA 1T96A 3LCLA 4H8UA 3UG3A 4K6AA 4MZ8A 1B5TA 1VAHA 3DI1A 2LLEA 1NWTA 2ZQ0A 3PUEA 1W5PA 1H1NA 1MW0A 1OADA 4AIOA 2BASA 1VEOA 2WPGA 3VNYA 4M7TA 4U2ZA 4XO6A 1DV7A 4JTAA 3TOPA 3VD9A 4Y96A 3SZ8A 2HXUA 2YCLA 1OFRA 1V08A 3RPTA 4JTSA 2BFGA 3L2IA 1NIUA 3N4AA 5EL1A 3UCQA 2BTMA 3WBAA 1VR6A 3WH9A 4DWSB 3ARYA 2ZDRA 3CAQA 2YA2A 4HNVA 5RUBA 2EJ1A 6PTDA 1MFVA 1HNYA 4JTCA 4ZO6A 4H01A 3WD3A 3G5EA 4L1WA 3W7QA 3AZRA 3TONA 1TPWA 3SFWA 1LRNA 2HVOA 2ZUTA 2QPSA 3UY7A 1YXDA 4FS9A 4Q8OA 1ITXA 2BOFX 4R7OA 4NI8A 4XD4A 4Y2WA 4F0LA 1EHNA 3KOXA 3B4UA 3TSMA 3B9EA 3N9RA 1EZ2A 3L5MA 1DJHA 2FVKA 3BG5A 1IYXA 2P1FA 3PJTA 4AVFA 1WUEA 1HFBA 1WDQA 1VBJA 4DHGA 3NNTA 3LLDA 1ZZMA 4B2DD 3IJ8A 1H11A 3E38A 1QW9A 4KGLA 4EF8A 5I2UA 3MU7A 4LVGA 2J9ZA 1A5SA 4FNUA 1TYGA 4FXFA 4PCSA 3P61A 4OQVA 4IPNB 4M6UA 2F61A 3PJXA 1FHDA 4MNJA 4BY3A 4L4OA 3MI3A 3K46A 4HNOA 4A8LA 2TODA 1T99A 4UZSA 3KRUA 1EL3A 1PHQA 5C8BB 1T6MA 2GSHA 3LHZA 3RG6A 1XISA 4KETA 5E0CA 4DJDA 4M0XA 3G3DA 4HYVA 3TZNA 2WC3A 3P82A 5FJPA 4E38A 1W56A 4IFOA 3WY1A 1WOAA 4N2YA 1RK6A 3T78A 3ARPA 3F03K 4NYYA 5LYRA 4EANA 1OX4A 2GYIA 3D5HA 1XIJA 3FDGA 1GVYA 1TZZA 1K7XA 4CD4A 3ONBA 4N42A 3VA8A 1V02E 1N8FA 1K70A 1W6TA 3BLFA 2XZ7A 4BQ4A 3QKZA 1HL8A 3W73A 1OFPA 3NSNA 2QNEA 1D7KA 1W31A 2BX7A 3S2LA 3PWGA 2VGGA 4LCQA 1JCNA 2BY2A 4B9ZA 4H7ZA 2IQ0A 4W86A 1V5XA 1P0KA 3W1LA 2NQJA 3U7BA 1MW1A 1E4LA 3HPAA 3CO8A 1JRBA 3W1PA 4JTUA 2CLIA 2IKIA 4JTHA 1SFTA 3NO1A 1KKOA 3JU2A 1DQWA 2PCEA 5LGZA 4JX4A 4L65A 3KL0A 3RCMA 2E25A 1IWPA 4CU6A 1RCQA 5AC8A 1XICA 3O6DA 3AMKA 1GQIA 1XX1A 3O7UA 4L80A 2JIWA 4B5WA 3TSDA 4AG0A 4EWND 8XIMA 5DRIA 5CSRA 3B9NA 2DW6A 4FSAA 4WF7A 3CHVA 1TE1A 1TTQA 2YCIX 3SY5A 2CZDA 1EJXC 1I2PA 5F2LA 3E0WA 1RQHA 4OBSA 1TWIA 3BLIA 4CCCA 3G6LA 1G94A 4UOZA 1GVIA 4B3ZA 2QJJA 2YW3A 3GH4A 3KTXA 1ZFJA 3RLVA 3R79A 1R9YA 4QSHA 2WYSA 1GOKA 1VD6A 2OWCA 3DC0A 3W01A 3E0IA 3W4RA 1S5WA 3U6WA 1W1VA 3RX2A 4FEZA 4AY8A 2G4JA 3ITXA 4REQB 3UPBA 4J35A 2VO5A 3WD4A 1XLHA 1KM1A 4AY7A 1DKWA 3TQKA 3W85A 4S3EA 5DBTA 3FDKA 3V0TA 3A47A 5IBXC 3N9KA 3S83A 5EBUA 2A3HA 2R8WA 3SJNA 4UFIA 4EPDC 1BFNA 3LHYA 1V6VA 2AGKA 4BEQA 1W2PA 4DB7A 2ZUVA 4EK7A 3GC2A 3SCOA 5D37A 1HQTA 3ZIZA 3UWUA 1H60A 4MUPA 4Q33A 5BOFA 3FEMA 5G2IA 4AZBA 3LUTA 5BXSA 3BW3A 4Y9OA 3A9BA 1L6YA 3QR3A 4QRNA 3K4AA 3Q67A 2JALA 3QPEA 4TO8A 1LM1A 4H9ZA 4B3KA 5I3HA 2RDTA 1RLDA 1X8CA 4CCDA 5D33A 3WJZA 4C5YA 5DCBA 4UBPC 3NOEA 3OVGA 4NSBA 2DJLA 3WBWA 3D0CA 4ZZ9A 4O53A 5M03A 4JTDA 2VEFA 4ACZA 3AJ7A 5A6AA 4YMZA 2WZTA 3CMFA 4JTTA 4W7WA 4DAFA 1SW7A 3U2OA 4PBGA 3GVGA 4DO6A 3E1F1 2CU0A 4V33A 2YL6A 2ADAA 4LRTA 4MYAA 3OVPA 2W67A 1TR9A 2W66A 4X9YA 2OOGA 5FL1A 5DXXA 2CLFA 1PTDA 2QCEA 3GR4A 4AB4A 4PMOA 2TMDA 3N73A 3S6TA 2UBPC 1W5NA 3CNYA 3V0SA 5FL0A 5HWJA 1FWWA 4AWEA 3WUBA 1EJVC 3PZTA 1OGBA 4QSFA 5DT7A 2WVVA 4KFNA 4LXFA 3VKJA 4DQWA 1DVJA 2OB3A 5CBJA 2Y8UA 5HPOA 1Q8AA 3CAKA 3HFTA 2OLHA 1PKMA 1QI5A 3BMWA 2F7FA 1XLDA 3NPUA 3GIQA 3L4TA 3TDFA 3TNBA 4YHEA 4LOCA 3ZSTA 3WLJA 2KX9A 4ORMA 2DIEA 3BCDA 4JHMA 3U2ZA 5CSUA 2VRKA 4F0RA 3KRZA 4IUGA 3RNDA 2AKMA 2OEKA 3UR8A 3UNDA 2WSRA 4OV4A 3H12A 3L4YA 2Y0FA 3EWZA 1GHSA 1UUOA 2QPUA 4XZIA 3WLNA 3MMDA 3IVUA 1CYGA 4K36A 4JX6A 2A3CA 3CB3A 4GGHA 1OZMA 5CKSA 4AVNA 3WK3A 3AQUA 4HT3A 4LWWA 1I75A 1HP5A 1DXIA 2PLJA 3AZSA 3ABOA 3LHVA 1W1PA 1M3UA 2J7BA 3L2LA 3WLKX 4FX8A 1AG1O 3GVWA 4G56A 3IJQA 5FJJA 1QWKA 3EOOA 4MKSA 3PPFA 1NOWA 3NA8A 3PTDA 1UZHA 2DSWA 1BXCA 4P7NA 3ANUA 4DJEC 2ISDA 2XISA 1S5MA 1TPB1 3CHEA 4UZUA 1JDDA 4NL1A 4PMJA 3M0MA 3NOYA 1HJVA 2G97A 2G5WA 1TIWA 2VC9A 4IMFA 4H2CA 3QV9A 1YDNA 2WSKA 4D6EA 4JQAA 1JPKA 1WV2A 2QXWA 8A3HA 4B5UA 1UD2A 3H26A 3CV1A 3ABQA 4HIBA 1S2CA 1XLMA 1SZNA 2OSWA 1OHLA 3EDEA 4FXSA 4UTUA 3T9PA 3KBVA 2P3EA 3GUWA 2H9AB 2Y88A 3PZMA 1WZLA 4KCTA 3WJYA 2G3IA 4GH1A 4IHCA 3CUJA 5IXEA 3NFUA 3UF9A 3EWXA 1GW9A 4EAMA 3VCCA 4HHMA 4DX3A 1HG3A 2X7VA 4HHPA 3LTPA 1J0HA 1VS1A 2OO6A 1CXHA 3BSGA 4V1YA 5A2BA 2HPMA 2ZRYA 2BGNE 4Q4SA 1E4MM 1PXGA 1LZOA 1A47A 1JZ5A 3TCSA 1OK4A 4A2SA 1HW6A 5G1YA 3QPZA 4CCZA 4RE0A 1S2AA 7ODCA 1E43A 4PTDA 3UPMA 4GY1A 4D8LA 4DPQA 2CERA 3TYAA 1RVKA 3QZAA 4F8XA 1OX6A 3MZ2A 4DWDA 4IIHA 3ZYZA 1ISVA 2A7RA 4J3UA 4H6EA 4DJDD 5JIPA 4LEQA 2C15A 1X6LA 3B8VA 4WGXA 1DIDA 4GE8A 4IFKA 3CIXA 3W7IA 1TTPA 4AISA 4BCEA 4FR6A 5CJMA 2YCLB 1FWSA 3VGEA 1U5JA 3BOFA 1VBGA 3MP4A 3W1RA 1SO3A 1UPMB 2GQAA 3QW4B 4M82A 2QUTA 4KF1A 1XBVA 3CAWA 4GG9A 1JXJA 2XPKA 4A8NA 3HGRA 3CZGA 2G95A 4S3KA 5FAGA 1E0VA 1R2SA 2XM2A 2Y4SA 3TW6A 3KVJA 1V51A 1B3VA 1R3QA 3VPLA 2ZRZA 1AA1B 3NGJA 3HPFA 3FYOA 3T2OA 3OA5A 1ZAIA 4O0QA 3UWEA 1QI2A 1D3CA 3DXIA 2FTPA 4DI9A 5LA2A 5DELA 3EWDA 2V9DA 4EXBA 2CLMA 1SM9A 1LQ2A 4H2HA 5HJLA 3PSVA 2OWWA 1CECA 5EGRA 1XD0A 1XUUA 3EWUA 3KVKA 5CC3A 5EA9A 4IZGA 2Z1WA 4L9YA 3HQ1A 1O7AA 6XIAA 3TAOA 3WH6A 5I3IA 1ZBKA 3L65A 1QDSA 3UXLA 1UZDA 4AZ7A 3SO7A 1VRXA 1PKNA 2XHYA 4EXAA 2Z2UA 1TWDA 2BVTA 3ZT7A 1HJWA 4PR4A 2OODA 1E0UA 2PZNA 1BVZA 3PZVA 1XCWA 1OM0A 2INFA 2YDRA 1J8VA 1FDYA 3U0HA 2WPBA 1KD0A 2WZIA 3L4VA 1JCYA 1TJ0A 5EBAA 5K9CA 1S5TA 4GLEA 1YIXA 3M0JA 3DECA 3FOKA 1A5UA 3EX3A 2ZZ5A 4A3YA 2JFEX 1AH4A 2C14A 3U4FA 4O28A 1TPVA 4LAUA 1XCFA 3EOLA 3BG3A 1NFBA 1NDVA 1UPPA 4WJXA 2QIIA 2PTDA 4L4MA 1VZWA 4S3AA 3I3DA 2GGJA 2GLKA 4PE8A 4FO4A 1VPYA 5DANA 3SEPA 4G1KA 4M80A 3R10A 1GJWA 4J3SA 5MF5A 4YWIA 1S2UA 3RX3A 3F5KA 1TE6A 4JYDA 1RJPA 1A5OC 3WK1A 1ONWA 2GSEA 4QE4A 2Q3OA 2J79A 2P8CA 4JFWA 2EPNA 1ZGDA 3ZLHA 1OX4B 5F1VA 4WSJA 4QDMA 3IIXA 3XIMA 1TRDA 3PPHA 1Q8JA 4CD6A 1C8XA 4YPJA 3GVQA 4XWUA 1WXJA 3R6IA 3T0DA 5M5DA 4AIUA 2ON3A 4YTRA 2VZSA 1GYLA 1IQ8A 3WQOA 1PE1A 1IHIA 4PTXA 4DUOA 1IGSA 2GQ8A 4YWSA 2EF9A 2VJXA 3RIKA 4AWTA 3WFLA 4FMVA 4HB7A 4KEMA 1LUCA 4ICNA 4CGTA 1WZMA 4US6A 1P6CA 4HZ7A 3VIMA 4LTSA 1TVNA 2PDFA 1P7TA 3W24A 1J96A 4F3HA 1CZ1A 3KCOA 3CL6A 3ORWA 5K4ZA 1EJWC 1J0ZA 5BWAA 1CGVA 1VYPX 3MJYA 3KDNA 3EDDA 2HTMA 3IUIA 5DEZA 3OB8A 4JOMA 3K1GA 3I7QA 1MUWA 4PB3A 4IQDA 1JULA 3AXIA 1QNPA 3GC5A 5HR6A 1IEIA 3O05A 3GHTA 3CGTA 4QEHA 3NVTA 1PIGA 3SGZA 1W8SA 1VHCA 1AL8A 2B7PA 4JQ2A 3QMTA 5BOOA 2HK0A 3TMQA 2VEIA 3NZPA 2GUUA 5A6BA 3DBPA 1Q7MA 4V28A 1H5VA 3M5VA 3RR4A 1W8GA 2OR2A 3LNMA 4ROPA 4OZOA 3W2NA 1QR7A 1PAMA 1C9DA 3ZSSA 1H1YA 4U33A 3DH7A 1RY8A 3S5OA 4PULA 1KR0A 1KXVA 4U2YA 3BJSA 4HK5A 2ZUUA 2O7SA 4W5ZA 4RJEA 1R6WA 2ISVA 5LSMA 1WPCA 1PB0A 3W1MA 3A4XA 5BMXA 3NQBA 4QLLA 3W37A 3QZEA 1KFKA 1MQPA 4OOUA 4MDOA 1BYAA 4TV5A 4HYWA 4E0CA 1OFDA 2J8GA 1ICSA 1UBSA 2REQB 3AU2A 4NQ1A 5AHFA 1Z6KA 3VGHA 2I16A 2QV5A 3L23A 4M19A 2FJKA 3VIGA 4WRHA 2QJHA 2QMJA 5REQA 1EHAA 2RHGA 1R3YA 1ZAJA 3GDMA 4HP5A 3MO4A 1XBZA 3R58A 2OLAA 4OTKA 1W1A1 3OBEA 4Z2GA 1LWJA 4LRSA 4ZMGA 3QC3A 4C1LA 2JE8A 5AKQA 4LYRA 3T2QA 3JW7A 1YPFA 4AYGA 4RW5A 2W79A 3BV4A 1XH2A 1SU5A 3INPA 5GNYA 2GOUA 3FNDA 4N6FA 3UZYA 5FESA 1GVOA 2WAGA 4QE1A 1OYAA 3KL5A 2VD8A 1Y5VA 2XH4A 1CB2A 4TOQA 1V7YA 3V3WA 4HN8A 4W7VA 3E96A 1NWSA 1EDTA 3RX4A 2Y7DA 1XIFA 1DJXA 4R53A 3T0CA 4IXHA 3HO8A 2HXTA 3GG7A 2H8ZA 3WLRA 3CUFA 3BGJA 3FYYA 3JVAA 4RNJA 4KEVA 2QCMA 4PMDA 1ZTVA 3AMGA 2CHNA 4BS0A 4WGHA 1VYSX 3H4WA 3LK6A 4RR4A 1GQJA 2AQOA 2PDPA 1KM2A 1JZ4A 2OQYA 3M0ZA 3N4EA 4AZ6A 4GQ0A 3WF1A 3DFQA 1Q6LA 3NCOA 4JCMA 5D02A 3WYZA 1ZCOA 4J27A 1KRCC 3APYA 1D3GA 4GOAA 4O4WA 1UP0A 1RY0A 4LCRA 1TJ2A 1VRDA 3OODA 3W7JA 4FNSA 4JKLA 3PTKA 3OHMB 1O1ZA 4HU4A 3ZR5A 3CWNA 1TFVA 2CITA 3C61A 1JF5A 3W87A 1MRAA 4J3TA 5F1UA 3B9OA 4PSRA 3NGFA 1B2YA 1FP9A 1Q7QA 1QHPA 2CZ5A 1W1YA 2CLPA 2V5DA 1D8WA 3WF0A 1E6PA 5A8PA 2V30A 2V3DA 2AL2B 2IMRA 1PS9A 4PZVA 3VKAA 2YYTA 4Q8UA 4DM2A 3BV7A 4KEUA 2GJRA 5AC6A 1W1B1 4UR7A 2E6YA 1OF6A 4NAEA 3I65A 4PEKA 2WZMA 3B9AA 4QLKA 1GUVA 1ME7A 2WNNA 3NQAA 2VNCA 2OZTA 4DUVA 3VMNA 4DJFC 1YYAA 1P48A 1I2RA 3DFTA 3RLUA 1JZ3A 3AIWA 1JDAA 1EGMA 1H5YA 3WLSA 4FNQA 1M04A 4CNPA 3CUIA 2YX0A 4O14A 4NJJA 7PTDA 3T08A 4FOUA 1GYNA 1MEHA 2PU1A 2C6QA 3VFCA 2EHHA 1JYXA 2AQWA 3CB8A 3LHUA 3V75A 1WE5A 4OOZA 5ABFB 3LCHA 1DP0A 1UIPA 4Y9NA 1VGAA 3N12A 4DXVA 3UWWA 3WSUA 2OKTA 2G41A 3BG9A 3UG4A 3H4XA 2FFIA 3SCTA 1YADA 1OGGA 2XINA 3WNOA 1K6AA 2J25A 4U3CA 2DV0A 4J2MA 1TV3A 2AMGA 2DSZA 1JXKA 3TN4A 2WQDA 4QEEA 2CLOA 2QS8A 5D38A 1ONRA 2NWSA 1TUFA 2WBKA 3I6TA 4QS6A 3QSTA 1ZUAX 5A8GA 5T8GA 1XHGA 1SW3A 4LX4A 3NDZA 4CQBA 2YZRA 1WB0A 3SQSA 4IP4A 3N3TA 1E5NA 4DJFD 5D05A 1HF6A 5EU9A 1OINA 1A5AA 1KW1A 4A22A 1VKFA 2A3LA 4ZBCA 3OA3A 3SURA 3MV11 3FFSA 3LSCA 2AMXA 4QDWA 3SCPA 3CV6A 2XSBA 2XIJA 3UXDA 2BG5A 1I45A 4H04A 2CZVA 5I03A 1E51A 2PDQA 5HNUA 3S4TA 1FWTA 5DRCA 1OBAA 3ZJ8A 2QGYA 1UD8A 2VX4A 4HMEA 4QXIA 4DO7A 2VRJA 4RE2A 2DZTA 5FJOA 3KBSA 3SI9A 2A85A 2ZX8A 2P10A 4AZGA 3VC6A 3W7LA 3E49A 1QK0A 3VTRA 2FPVA 1UH4A 3W74A 3GYCA 3KZPA 3BDKA 4HSHA 4QAIA 1WQ5A 4GC3A 2DVUA 1W91A 2DUAA 3TKFA 2H3BA 3AYTA 3GU1A 1UD6A 4H9VA 3EXRA 4XAYA 1PWMA 4L61A 2XN0A 4P8XA 2DT0A 4HZ8A 5EFDA 1E6XM 1A3HA 3WF2A 5KZDA 3WK0A 2PLKA 1GOMA 2P0OA 3U3HA 4DF0A 1SJAA 1W0MA 1UWRA 2HBVA 1OQFA 1ELSA 2CBVA 1UR4A 3O0KA 4IIDA 2VZTA 4MWAB 4PUWA 3TC6A 5EMYA 3AXXA 1RA5A 1ZU8A 3T81A 1FHVA 5K3VA 5C54A 2B4GA 4W84A 1K77A 3UCCA 2V5LA 4G7FA 1PIIA 2ABBA 1CLKA 3RRAA 4N6EA 3I6RA 1QU4A 4LYPA 4UFLA 2Y63A 5BXTA 5A8NA 3ARUA 1XI3A 1W9DM 4JTGA 2PBGA 3V7PA 2D2OA 2R6OA 1L8NA 4JYFA 1E73M 1JCXA 4ZXOA 4D6HA 3G22A 3ZR4A 3HOJA 3PWIA 1EYEA 3BLDA 1E3XA 1M68A 2OZ8A 4JHZA 4K7YA 2Y5EA 3EWCA 3W81A 2WZEA 3KP1A 1E5JA 1LOQA 3N1AA 2QLYA 3WLQA 2WNWA 1OFQA 3NL5A 3MUY1 3TTSA 4GX9A 1EBGA 3W7MA 4E4PA 3EGJA 3CQHA 3U8GA 4IP7A 3BANA 3FVMA 4FALA 3JZUA 1KLYA 2PRMA 2DY3A 3A22A 1KGWA 1GJPA 1ML1A 1XIMA 4A6GA 4O13A 4S1FA 4GX8A 4XKYB 2ZFAA 1VP5A 3MWCA 5FOOA 4W8BA 3VD5A 2YIHA 3L12A 3UJRA 1F8IA 3KFTA 1ZAHA 4JD4A 2BY0A 1A5KC 1M01A 1A5CA 1W3IA 3FGCA 2NXGA 2PTXA 1XL9A 1W3HA 3REQA 5C70A 4R33A 3CUGA 1YPIA 3C56A 2WVTA 1P43A 3I7SA 5AY7A 3LMZA 4E4UA 1R86A 1XH1A 3TXVA 2VEKA 1ZP3A 2CYGA 3URNA 4E8CA 1F3XA 4A29A 1XLAA 1KM0A 4GQQA 1TV5A 3VOCA 1KC7A 3NTYA 1W5QA 2POTA 3IJ9A 3K30A 3U2CA 2OVLA 2F6UA 4U10A 3BOLA 1OZQA 3QY8A 3TMLA 3M43A 2GJNA 4OVXA 2JKPA 4ZODA 4YXGA 2XVLA 5I02A 3WQ8A 3KVLA 3V36A 1FH7A 4DUWA 4LNCA 3UXIA 1E0WA 5KZ6A 5C7VA 2Y89A 2VGIA 1H63A 1ODZA 3KDOA 2VVNA 2W92A 5EMJA 3SRHA 3LLXA 1J2WA 5DMLA 5JBDA 5TQLA 1G01A 3VGDA 2XIIA 1FKXA 1SUXA 1QI4A 1T40A 3R0UA 1HKKA 1A53A 5BNKA 3EX1A 2XGBA 3LQGA 4YTTA 3M6YA 4UMBA 3TC7A 4HU8A 1E0TA 3H2NA 3F4NA 1V3HA 5T9BG 4KGJA 4C6NA 1XDLA 3VZXA 5BWFA 3RM8A 2OQLA 4LU0A 3THUA 2X2GA 3HU7A 1ZQ5A 5FCZA 4UQCA 1ZENA 2NX9A 3CYVA 3P80A 3BSMA 3OQ8A 3BAJA 1SGJA 2PF8A 2XIMA 3EX6A 3MUIA 1JF6A 1Z7AA 5CZJA 1QI3A 1XBYA 2VZVA 3QHMA 4UTKA 4JNMA 3FAWA 3LGGA 2VDHA 3KVMA 1DWGM 2WMHA 1GT8A 3OLGA 3NM1A 5REQB 1TMLA 1T0OA 1HXJA 4ICCX 5CPMA 4XZWA 1DJNA 3FCPA 1XDMA 1BHGA 3MBDA 4AC1X 4NJIA 3WNKA 1KB3A 3PUDA 1IZCA 4E6MA 4L7ZA 4NASA 2PDWA 5LXEA 3HBLA 3BCFA 2PWUA 1TJRA 4I6VA 2WSYA 3W2LA 4CUCA 1A5NC 3QLLA 1C9WA 1C8VA 4WJEA 4NRSA 1QJWA 1E6RA 2XVNA 3EB3A 2YBVA 1POJA 4F2UA 1EJ7L 2PFHA 1UJQA 1Z89A 3B8IA 2PGWA 3GXDA 2F9RA 2V0TA 4RXGA 2ZVIA 4UTMA 2IPFA 5BXPA 1FWDC 4JY8A 2D1ZA 3EWBX 4Q8QA 3ANYA 3RHGA 1P5BA 1M65A 4GI9A 1YNYA 4ZCWA 3GHSA 2D2HA 1QOQA 2PDBA 4PUMA 2XYLA 1N8WA 4A35A 4OKDA 2ZRXA 5L6UA 5TBOA 5C9RA 3A3WA 2QDEA 2OT1A 4AAJA 2D69A 3B0VC 4GIRA 1RJRA 3ARVA 1XSKA 5XIMA 3RCNA 1CW2A 4B90A 5J8LA 1WAUA 2ZUWA 2PLMA 2YLLA 1OCBA 4K38A 3POHA 3CH0A 4IX2A 2OGJA 4WCJA 3MWAA 3QY6A 1HL9A 1R3TA 5DT5A 3MTWA 2VGFA 1A4MA 4XBSA 2PURA 4B91A 3GLCA 2VWTA 5BOEA 4KW2A 3ITYA 3AICA 3AMDA 4UTHA 2YFNA 3Q2DA 3NPWA 5A8MA 1HKVA 2ZC8A 4L56A 4LAMA 1AZ2A 3KZSA 2XVGA 2Z1KA 1JFHA 1RP8A 3W76A 3SCVA 3N6HA 2YL9A 1RUSA 3NUKA 2OZ3A 5JUVA 3ITCA 4NAEB 3ZVIA 4OJYA 1Y7VA 1IE7C 3PZQA 1G0CA 2FLIA 3FJ4A 3Q94A 1AQMA 4KIRA 4JQ3A 3K13A 2HZGA 4O8RA 2D2JA 2IUZA 4PEEA 4F9DA 3M47A 2QCDB 2ASHA 3WLLA 3AIEA 4JIEA 1VB9A 3MV01 1K8ZA 1DYSA 3MCOA 3WJWA 3UR7A 3S5YA 4DBEA 2ZXQA 3GKAA 2Z24A 2ZE0A 3KX6A 2BP1A 5BYWA 4HSNA 3EOSA 3B04A 3F5LA 4EPBC 1OJXA 4TQTA 4YVPA 1CXFA 4KEZA 4KWSA 4Z0JA 2BXVA 3E5BA 2Z2BA 3IUHA 3W0KA 3F4WA 1UR8A 2QKFA 3LXAA 1Q63A 4IMCA 3NO3A 3VINA 1W32A 3MI6A 3MSDA 2DZWA 2WQPA 5BMWA 2F8QA 2NQ9A 3LZ5A 4XZ9A 3B97A 4EPKA 2HSAA 1UP3A 2B0MA 1FWEC 4GCAA 3SRFA 2FMOA 1TUXA 2PGEA 3JUGA 3LCFA 2GJXA 2PP3A 5DMMA 1F7BA 4TUFA 2WLZA 3FK4A 3PK7A 4DZ5A 1QATA 5I5RA 4GIAA 4GNVA 1XGDA 1IZJA 3V18A 1CGTA 1BF2A 2ZZ1A 3B0YA 1BWKA 4MMWA 1FXPA 4L9XA 4M6QA 4I9MA 3BURA 3QOMA 2QYGA 3UR5A 1HJSA 3SGGA 2VFFA 3OGVA 5I3KA 4S3DA 4MSSA 5I06A 2RGLA 2CESA 3GUGA 1TPDA 3WNLA 2B81A 1XRFA 3SY8A 3H23A 2IKHA 1UD4A 2PDHA 3IS4A 3PVFA 4MY9A 1L9WA 1V03A 4BA0A 1ZJHA 1DXFA 4Z0SA 3LX9A 4HOXA 3WDIA 4Z2HA 4L4PA 3WENA 5KZEA 1HVXA 4M5PA 4W8LA 1ZL1A 1LQAA 1NOFA 1W3JA 2BHZA 4F2BA 4UWMA 2QV4A 4I3GA 1L6WA 1V0KA 4LANA 4WX2A 2Y8VA 5A95A 2FIQA 3TP4A 3NQ7A 1V6TA 3WD1A 4IICA 2E7FA 3UGRA 1ZB5A 1RR2A 3QY7A 2W63A 1X96A 3VIFA 1AD4A 1K1DA 1QPQA 2D3LA 4KFPA 7TIMA 3DAQA 3K8KA 4HA3A 1D8CA 4KPLA 3WFZA 3R5EA 3O9NA 1V3KA 2QCGA 2HVMA 5J5DA 4AU0A 1JYNA 4BI5A 4QS5A 5DO8A 2OX4A 1R87A 4N02A 1EGZA 4E2OA 1FH8A 3P3BA 1GYMA 2FH8A 1VF8A 5M17A 2BDQA 1MDLA 1EB3A 4M29A 1SQ7A 4CD8A 1XGZA 2R94A 1V3LA 1AMYA 2A3EA 2WCGA 4LH8A 4J9JA 3V35A 2D22A 5KSWA 3VOFA 1BTMA 1FWBC 4IIFA 1DXEA 5E0FA 4FX6M 3W07A 3SCSA 4U31A 3H2AA 3CK5A 4PB5A 2QJGA 1JEZA 2GDQA 1XINA 3IAQA 4R3UA 3DFPA 3MDUA 2JGQA 1IR2A 4ZQMA 2NQZA 4WXZA 1F61A 3G1XA 2VL4A 3P62A 2KAUC 2PDLA 3GG8A 4C6CA 4DO5A 3C2EA 3S2JA 4UNIA 2IPWA 1EIBA 3DKLA 4Q6JA 4KFOA 3EA1A 3DHDA 3UJEA 3DFOA 4IT1A 4UCFA 4RPPA 3QC0A 6XIMA 4L1XA 5AOUA 1KRBC 3EEGA 1RBOB 4IM4A 2J7HA 7ENLA 3WH8A 2QCNA 4AEEA 4FI4A 1QVBA 5CPSA 2XFRA 5CPLA 3REQB 4NU7A 1REQA 1T5AA 4NX0A 1IGWA 3U9IA 1KXQA 1WBJA 3FA3A 2CC0A 1DIKA 3QGVA 5GNZA 1Z9AA 5IDIA 2ZTJA 3PP7A 1UR3M 1LJYA 4FXRA 2HJPA 1RH9A 3TAKA 3TROA 2YYUA 2DQXA 1T41A 4GZJA 1JCJA 4ZOBA 3PN8A 1ZCCA 9XIMA 5TNVA 2DORA 2H6RA 3B3DA 3OTRA 3WMBA 3W02A 5IDZA 3EAUA 2XTKA 1RZMA 3R8GA 1SSDA 9CGTA 3TLLA 1XLLA 3ITVA 3N2MA 1A0CA 1XLCA 2E6FA 1BEUA 1QFEA 5MKGA 1CX9A 1VCFA 1SR0A 3BJTA 2WWCA 2R24A 4JDBA 1GPFA 1IXPA 1E40A 2EPLX 2VGBA 4Z1CA 2GPTA 2Z1SA 2HS6A 2QW5A 4JNZA 3OO2A 2CWXA 1Y5XA 4TTUA 4UTTA 2ZZ7A 4N9DA 4WJ8A 4Q8VA 3AFBA 1XH0A 3QBUA 4NZ1A 2V8ZA 3DCPA 2NV1A 1KM3A 2E09A 3DDMA 2NVCA 3QYSA 3EX2A 4NT0A 4JFVA 3W1AA 5E93A 1RQEA 2D20A 3NQ2A 2I14A 1I4NA 3WN6A 1PKLA 4WVXA 3VIPA 3W23A 1GKPA 3P0XA 3LPOA 3PZIA 5I3GA 3HGSA 2W61A 4GHRA 1EP2A 4JQ1A 3GR8A 4PL1A 1V6YA 2QCLA 3PBUA 1I9CB 3VZZA 4B5XA 4J7RA 2CKSA 2A6LA 2O0TA 1AJ2A 1BRLB 5AFDA 2O9PA 2O7QA 4LGXA 3GXIA 2DIKA 3WX7A 4UQ9A 1NU5A 3DI0A 2VEPA 4C7DA 1VIWA 1VBHA 2HISA 1YPXA 2XU2A 4QX4A 1M7JA 4A8IA 1GKRA 1JNEA 4YS1A 2Z1BA 1P0DA 3MP5A 4HYRA 2GUBA 2WKLA 4TMBA 2BNJA 3R2GA 3A3HA 1E6QM 1A0DA 1SFSA 4H9TA 2Y5SA 3SBFA 3WJXA 4RXFA 2WHKA 3OBKA 1E4IA 2HEJA 4CLMA 5D2VA 4D9PA 4MKVA 3OGSA 3SN0A 2VC7A 2ZZ6A 4JS3A 2EG8A 4GUGA 2XUCA 3HJEA 3GTHA 2FZ8A 1JI2A 4MDPA 5JXQA 3MBFA 4MUZA 3ZJ7A 4JFTA 2DJXA 3MMTA 3OLDA 2XIQA 2G3NA 1OB0A 1KFJA 4E3TA 1SSGA 2WJZA 4HHLA 1XIDA 4BI7A 4LPCA 4F0SA 5C2XA 4YVVA 2B7QA 4IPIA 3STEA 3V1PA 2V5CA 4JTFA 1SPQA 2ZICA 4UFHA 2DSUA 4C60A 3IGXA 4E3VA 4FOKA 4XD5A 5H8UA 1A3XA 2EKCA 2DZBA 4B4FA 1MMFA 2OZ0A 3DFNA 4F0MA 1KLZA 2R1LA 4GKTA 3GH7A 3H2FA 3OG3A 3STGA 4AZIA 4D6DA 4ZQNA 1QBBA 3GDLA 4S3CA 3BAKA 3C2YA 2ZZ2A 2L5HA 1QAPA 1DORA 1O60A 3B8UA 4QBXA 1GHRA 1OD8A 3THDA 3W72A 3RU6A 3CXOA 2EXOA 3ID7A 5U4NA 4O54A 2C1HA 5HMSA 2ZWYA 4LAZA 3P74A 2IPJA 3CQJA 3ECQA 4Q8PA 3DHPA 3NIYA 4EACA 4QNEA 1FY6A 2PC8A 1YLVA 1TA3A 7REQB 1HT6A 4JX5A 4M56A 5FF0A 1GG0A 5HBFA 4EPEC 4TX6A 3VDAA 4C7FA 2VD9A 2INZA 4LC8A 1CTNA 3TW7A 2J27A 1SZGA 2C0AA 3VNIA 3MPGA 5EB8A 3UW6A 4HCHA 1PJ9A 4HNLA 3SUWA 4GD0A 4AZHA 3P93A 3E0LA 3H22A 4RW3A 4DXXA 4F66A 3SCRA 5A1AA 5DCDA 3S1VA 1BSIA 1OEPA 4IXXA 1CXKA 3QTPA 2DU2A 3NSXA 3TCEA 3BZGA 3FJLA 4S2CA 4N7QA 2FB2A 4J28A 3GU2A 2C8NA 1ZNNA 5T91A 5A6JA 1ADOA 3S2MA 3C2VA 3GXMA 3MJMA 2JEPA 2ZXDA 5H8MA 4UFKA 3DYMA 1SYTA 4D1JA 4RNHA 3ES7A 3T55A 1EX5A 2V3EA 3VVGA 5CGQA 4L9ZA 1G69A 1JDCA 2J7GA 1OG6A 5D03A 2WOQA 1JYWA 1EDGA 5FEXA 3RO8A 5KITA 2PWFA 1KBLA 1EPVA 3FEQA 1PX4A 4WEVX 5DY2A 4REQA 4WXYA 5AVHA 2NUXA 2J47A 3RUBL 3G1DA 1AJ0A 3LLFA 4JGDA 2YJQA 4LAOA 3KLLA 1XYMA 1RPKA 4RDVA 1YX1A 2DEPA 3QVQA 1TV4A 5D4YA 2EPMX 3A12A 2Z27A 4AIBA 1R3SA 1YDVA 2NX1A 2ZXBA 2TAAA 2XIOA 5C71A 1YKWA 2GJXB 1TRIA 3P6LA 4GBDA 3ZT6A 2DT1A 2PRLA 4WOQA 1GZ1A 4B5VA 2J8TA 3UVIA 3WD0A 2BGSA 3L4ZA 2NT0A 3WIJA 1XQKA 1DWAM 1B9BA 1M7OA 1W54A 3M0YA 1QW7A 3C3UA 4GYKA 3W86A 1TR1A 2PDUA 3MT1A 5AYBA 2X30A 1MFUA 2I57A 2XFYA 4JIIX 2Q6ZA 3UP8A 3LBCA 1VENA 2I7GA 4L64A 1ESWA 4ZO7A 3Q65A 1XLEA 4LUIA 1BGGA 2J78A 1FBAA 2VXNA 4UMAA 2GSJA 1XUZA 1W5OA 1U1JA 4JFSA 3EXTA 2D24A 1OFOA 2J9YA 2DH2A 4HMCA 4C6QA 1OCJA 4I9JA 3GAYA 2QCHA 3QKEA 3V4BA 2QMKA 3L21A 4ALDA 2J74A 1O12A 1JD7A 2WANA 5BCAA 2Y61A 4F40A 2P0IA 2BVDA 3UT0A 4N9CA 3R4IA 4Q4PA 2OSXA 3AXHA 3M5ZA 1K8YA 2GK1B 1TCMA 4O1FA 3M1ZA 3SB0A 4HN4A 4QQ3A 4M7SA 4HOZA 4DWSC 3HV8A 1K4HA 3OZMA 5LIYX 1PDYA 1IEQA 4IMEA 3W7HA 3W7RA 3N17A 3Q45A 1S2TA 4D1IA 1X1ZA 4JFUA 1C90A 4KBXA 4QG6A 3E0FA 3ARRA 5F2IA 3DYOA 3GB6A 2G0WA 4XUYA 5CBBA 2BODX 3NZQA 2V3GA 5LKYA 1HN1A 3ZOAA 3FKRA 3APTA 1HJXA 3WEZA 4GMEA 3WUEA 4YJ5A 4NZCA 3ITLA 4O57A 4AY1A 4IPJA 2YDQA 5HAOA 5C0QA 4PRRA 5M2FX 3TVAA 3NPXA 1V77A 3C2OA 1FWAC 3LPPA 3IV8A 1KM4A 3ME3A 4IMGA 2XSAA 2ZX5A 3B06A 3BLOA 3OU8A 1OVDA 5HQMA 1HKWA 4LNYA 5HNRA 1MO0A 3PBYA 4TTGA 4LUYA 4WSHA 4G9PA 1JFXA 4N9BA 5AYZA 5H2ZA 3TYUA 4XG1A 1AQFA 5TAOA 1HJUA 4MLRA 1RP9A 4FPSA 4AD1A 3RPMA 5EFFA 4KIEA 3WCZA 3IEBA 3ZJKA 3VIOA 1V6XA 3BO9A 3GBEA 5XINA 3MP3A 2WM0A 1PO9A 1OABA 3ISIX 5CBIA 2X1RA 1XDJA 4W7UA 4RNIA 1I60A 4UIOA 4ZE5A 4ZGYA 2YFOA 1UZ1A 3OPSA 2QHAA 4KWUA 2PAJA 4DWSD 2UY4A 4ZQCA 4JEQA 2V2DA 5IFTA 2CHOA 3WL0A 3LY0A 1UP2A 2FVMA 2DQWA 3R13A 5G1TA 3WLPA 2VQUA 1VCGA 1XSJA 1ITUA 1ZRQA 2O55A 4GQRA 1OX5A 1Q6DA 1XKYA 1QHOA 1XFBA 4H19A 2ISSA 4PCTA 5F4SA 3GD6A 4CNSA 2JQXA 4WD0A 1RV8A 1G67A 3T40A 1LLOA 2J7CA 1SO4A 4DXKA 1GVEA 2FDSA 3HGJA 3UEQA 2ACQA 1Q65A 2Z1VA 3NQDA 4AIEA 5CJNA 3BZJA 3CLWA 4PTMA 1G6CA 2PE4A 1EJSC 3VAVA 1QNOA 4JL1A 3BAWA 5HULA 2H9AA 3W2UA 4B5TA 3QZ6A 2J24A 3GO2A 1XRVA 4KERA 2EG7A 2PD9A 1DJYA 3CEUA 5KMYA 4K68A 3RLGA 1ECEA 3A5VA 3C8FA 3GDTA 1VFSA 4W93A 4O11A 3KP0A 1SJDA 3W1QA 3UPWA 1EYWA 1UMYA 3N25A 4YYFA 4C6BA 2AKZA 4KCWA 2XGZA 4RCXA 3WJSA 1XSIA 5E0KA 3PZNA 3H8AA 4H9YA 5I07A 3OYXA 2E3ZA 3ALGA 2AL1A 3PULA 5HA7A 2H8XA 1UWSA 2VENA 3ENLA 2C71A 3HFYA 4UXDA 1ECQA 3AHTA 4DN1A 1UR2A 2Y7GA 2VM8A 1XYFA 4ZEPA 2O4QA 3CU2A 5KEZA 3E12A 5CCZA 3MUXA 4QG8A 3PM6A 4OFCA 1HP4A 1BXNA 4XD3A 5FA5A 3QH2A 3PZUA 1PTAA 3DG7A 2NSOA 5BU6A 3P8IA 4WLCA 5CZSA 1U33A 3S0CA 1JCTA 3B40A 2HCVA 3RR1A 2Z6JA 1V0MA 4HKPA 3TJXA 3AWOA 4PMYA 1GCYA 2GOKA 3IIZA 3RFAA 3PBVA 4GI6A 1JDEA 4NP7A 4K39A 4HA1A 1SVDA 4K3ZA 3EKLA 2BLEA 2QULA 3TW9A 2IXUA 4ACYA 1DWHM 4BZYA 2EJAA 1K8XA 2WSQA 3MYOA 3S42A 2G3FA 1TTIA 3W29A 4NNAA 3NVDA 1DQUA 3IIVA 5FF3A 3FJ6A 4AVOA 1WKYA 3LI1A 2PUZA 2VCCA 4XB3A 3W7PA 1S5VA 4Z2LA 5FD0A 5A6KA 2UY5A 3ZXWA 1EA0A 3W84A 1A5MC 1JZ6A 4R34A 2JK2A 4JKKA 2OT0A 1KXHA 3V5CA 1US0A 3R7MA 1Q4WA 4DZHA 2QCCA 4FZIA 1H7NA 1XWYA 4JAWA 2WZHA 4FLOA 4S3GA 5E5CA 1MVYA 3ATYA 2DT2A 4X0NA 1EQCA 4HJWA 4JIQA 4WK9A 1KGXA 3QN3A 2AGTA 2JEQA 4NVTA 2ANUA 4Z17A 2DZXA 1H7OA 3GW0A 1UWAA 4CEXC 1L8PA 1VEPA 4DM1A 2CFFA 3SUTA 2VTFA 4Y90A 4XZHA 5LIWX 4B5SA 1TJPA 3PJUA 1W3KA 1J18A 1BYDA 4A3UA 4UCGA 1TPFA 1DJWA 3MHGA 3O6AA 4KS0A 1P0BA 1K7EA 2VDIA 4KH2A 3H2CA 5PTDA 2HMCA 1LBFA 4G7EB 3KUMA 2YXXA 2JKEA 2Z26A 4CQAA 4NYUA 4I5UA 4XAFA 1BTCA 1XPGA 3JS3A 1ISXA 1L2UA 2IPGA 1XLJA 1NFPA 2O56A 2ACSA 4E2VA 3ITGA 1G4SA 4TR9A 4V27A 4W87A 3N2TA 3MCMA 2F6KA 1XYCA 2G37A 1QRQA 3S6OA 2CXEA 1X6UA 2ALRA 4MNMA 5FJRA 1BWVA 3BVJA 2PRHA 5FSEC 3EMCA 1M7XA 1RJQA 4J1OA 4DBDA 4ZOEA 4YIWA 2WJEA 3W28A 1TA3B 2FYMA 3KOFA 3PC0A 4UTFA 2D0FA 3TA9A 4BQ3A 1IXNA 4FR1A 3DGBA 4LYKA 2PSNA 2NXIA 3LXCA 4LUTB 4RNFA 3GM8A 3FW6A 3TYEA 1J0KA 1J11A 1FDJA 3I4KA 1TVLA 1J5TA 4KQNA 3CUHA 4PBEA 2CZEA 3RILA 3ZWTA 1UC4A 1J79A 1LL4A 5BROA 1ONXA 2VI0A 4IUOA 1QPRA 1F6KA 4RZBA 3OZYA 1DL3A 2DFAA 5D30A 2I56A 3IRSA 3A3XA 1XYZA 1MZHA 1G7UA 2DVXA 3BE7A 3W7KA 4B92A 3D46A 5ENLA 4JTIA 3SUUA 4LVFA 1DBTA 2OXNA 3WLMA 3EDJA 1H62A 3VIJA 3SM0A 3GIPA 2E4TA 3WH5A 1WP6A 3WQCA 3CUZA 2BOEX 1RLCL 2I5QA 4H3DA 3C2RA 3MANA 4IFRA 3ZFHA 1M53A 2C19A 4MKNA 3UCDA 5E9AA 1BVWA 3GS6A 4GQBA 3WQFA 3EBVA 4GGBA 2VYOA 4GRSA 1VFLA 3N2BA 3FSTA 3LRKA 3LN3A 1UKOA 1WCGA 3BMXA 2A7PA 1RK5A 3ABZA 1MDRA 3FSUA 3H7VA 1AK5A 4I9AA 3VD7A 3LMYA 5CAKA 1ZALA 4DF1A 3ALFA 2REQA 4GZIA 4GY7A 2CXGA 5FJTA 2XVKA 4F0HA 1BKHA 1THFD 3CHDA 3NQ6A 3DBNA 2Z00A 3BCJA 4IG2B 5ABEA 1HO1A 5FIPA 1SO5A 3VDBA 2XH7A 1QCWA 4JDYA 1A0EA 2I9UA 3CQIA 4UTJA 1EJRC 2F6XA 5CXPA 4O15A 2R14A 1XC4A 2X8RA 2ZADA 2C13A 4C1KA 1ALDA 4Q7IA 1E9LA 3ITTA 4M1RA 4BEUA 1W9VA 3DKJA 3PWAA 2J9XA 5LNSA 1JUBA 2WLYA 1Q66A 1C8YA 5D2TA 1Y8BA 2Z7GA 3QJAA 1PCKA 4D71A 3K8LA 1E72M 3QV6A 1U1HA 3UU0A 1FCQA 1F2JA 4GUHA 1S5NA 4WKHA 5IM51 1SMAA 3WDJA 1W37A 1VC4A 1XLBA 3OGRA 4LS0A 4A8RA 2OPJA 5LNWA 2GWNA 4ZVJA 4H8NA 1XLGA 4JN7A 4IL2A 1YXYA 4ML9A 4L5ZA 3MMWA 3LM7A 4Q4RA 1LWIA 4J3XA 3CC1A 1H1ZA 2KZHA 4UNKA 1R8LA 1J5SA 3DERA 5CG0A 1O68A 4EX4A 1KCLA 1F3WA 3E9AA 4K8EA 2BV9A 1NDWA 3GQYA 3TTEA 3IWPA 3ARZA 2WO5A 3KS6A 4ZOCA 4WSKA 3GY1A 3BLKA 1HL2A 3MVIA 1CT5A 1H41A 1K02A 3A4JA 3MDWA 4JL2A 2ZZ4A 1XD1A 3C52A 5A69A 1ME8A 3KW3A 3STCA 3FXGA 3RN6A 1PHWA 3V5OA 2AL2A 3HG4A 3S5ZA 4PMXA 4CD5A 2EBNA 3S3GA 3TEVA 3I4EA 4R9XA 3F4DA 3W7DA 3HIJA 4NZFA 3ARWA 4H41A 1GTHA 2GGEA 4NNBA 3O15A 3BGGA 1GJUA 1IF2A 1GZGA 4ZTYA 3AHXA 4C90A 4CU7A 5HMDA 1ZJBA 2G8ZA 4O1BA 4GXMA 3TYBA 6ALDA 1B57A 2BBFA 3NDOA 4AD0A 3P84A 5TIMA 4IPPA 4EWJA 4C6LA 3ATZA 2ZRVA 4AZCB 4N4PA 3LXBA 2FGBA 4DLFA 3WQ5A 5GJNA 3PBGA 5ABFA 1GVSA 3EDFA 2Z1XA 3O63A 4MOZA 1WKDA 3FX4A 3RDKA 1DE5A 4DJDC 4TX9A 1L2QA 2YKKA 3SN4A 3OHIA 5FJIA 1G4PA 5DY3A 5SWUA 3WDPP 3M9YA 5I6SA 4S23A 4PSPA 2QZRA 4ZR8A 1UWIA 5I00A 4Q7BA 4BQ5A 3WMSA 2Z7KA 5GQBA 3VILA 4GINA 1Y0EA 3SAZA 1TJ1A 3W82A 4O0KA 3W83A 3MS8A 1WDDA 3KTSA 2CW6A 3EDKA 3NG3A 3AXKA 3LSBA 3SRDA 1QNQA 3WF4A 4MY1A 3DGRA 3CV2A 5FI8A 5G1MA 3CZLA 1UOKA 5AHLA 4FIQA 1X7IA 3QPYA 3W6LA 1EO5A 2OKOA 3XISA 5BRQA 1RBAA 3AHZA 3LENA 4ORIA 3OJGA 3R0KA 3F7JA 1FCBA 1NQKA 4Y9AA 1YMYA 4RLIA 3DENA 1PYMA 1HGWA 2VCBA 2OJPA 1EF3A 1H61A 2D2GA 3FHQA 5G2HA 1QBAA 1B0IA 1DE6A 1GK8A 6REQA 5DN1A 1V3MA 2EO7A 4H8HA 4NAFB 2V81A 4AMAA 1TMHA 1GVFA 1PDZA 4Q7NA 1GVRA 2NXHA 4CN6A 1EJTC 5C7HA 2D73A 1IZKA 3LRMA 3IV3A 2HBXA 4ADSA 3D3AA 5M1TA 4PUKA 1WXZA 1GWJA 4JNYA 1UKSA 3NEHA 4R7WA 2VUYA 3CTTA 2CLLA 3MW7A 4O16A 4GJIA 4LCSA 2WJFA 2E8ZA 4P61A 1TX2A 2YA0A 2QUUA 4MB3A 1E1CB 1I0BA 3IVTA 1RPXA 2NX3A 4N0RA 3RK8A 1T8QA 1ZP4A 3TR2A 1KWGA 4FLQA 3BMVA 4XAPA 3C5QA 3G18A 1OIMA 1EH9A 1LBLA 2W91A 3BLPX 4WKAA 4AYSA 3VGBA 1P6BA 4MWAA 4YYCA 4D2JA 4K1GA 3W7EA 1TPH1 1SJBA 3ZJ6A 5EMLA 4AX7A 1SR9A 1B31A 4K8HA 5CJ5A 4AHOA 4NILA 2FZNA 3W7NA 1WKEA 3BC9A 2WC7A 4G5DA 4IPLA 1CGXA 1ITCA 5BRBA 1FXQA 2E6DA 4Q8WA 3VI2A 3BLEA 3TWAA 3PJWA 4NHVA 1LORA 2C0HA 3M07A 1UROA 4RDZA 1UW9A 3W27A 5CSSA 4UQBA 4W4QA 2Z2AA 1QXLA 3H7RA 3MHUA 2X42A 5C5YA 3R89A 3TNOA 3BWWA 3TFXA 4PCFA 4ASTA 3LEPA 1GOQA 4X63A 4Q4KA 1KGUA 2OYLA 2VRQA 2TYSA 3NL6A 4INFA 3LGEA 2A21A 3EYPA 4PMNA 2RDWA 1DJIA 1L6SA 2V5BA 5CQ1A 3QFEA 3KOWA 3SDOA 3V1HA 1JCLA 1BQCA 2J66A 1RQBA 2I5GA 3M0IA 2E5CA 4XKYA 4QE5A 2H90A 3KBWA 4NZ4A 1HX0A 1MXGA 1S1PA 1QK2A 4WY0B 2A7NA 4IQEA 2PP1A 3K2GA 4GNJA 2YL5A 3LGDA 3RXZA 2EGZA 2NUYA 1GZJA 3W1NA 4AUBA 2VR5A 3OW1A 3W7GA 3WFAA 3MKCA 5H6HA 4JR5A 3O06A 2XH0A 1JYVA 1F07A 1SFJA 5F7UA 5C9UA 1LDCA 5KINA 1EOMA 1VFFA 1FH9A 2QEZA 3VOIA 2G96A 4E2DA 4GJJA 5JU6A 3IK4A 4NXSA 4PMZA 1TVPA 3EOEA 2ISFA 1KBIA 3RF9A 2PA6A 1BAGA 3M41A 4H9UA 2Y7FA 5HWMA 2PTYA 1XIIA 1VCVA 4NZ5A 4H6RA 5HMFA 3AU6A 1LBMA 1VJSA 1GG1A 5G5IA 1VBRA 4KRTA 2X7WA 3RM4A 3CS2A 3UJSA 2IXVA 4YLWA 1B3XA 2EPHA 2Y5JA 1Y65A 2W5FA 4XZNX 3RAOA 3IK2A 4C6MA 1TCDA 4P7RA 4OT7A 3PPCA 3THCA 4H6QA 5I3JA 2ZX7A 3GX9A 2HVNA 5HNNA 2C3ZA 2JKAA 3PG8A 2X1UA 2YA1A 2WHMA 4IX0A 4R5EA 4AXKA 1W3TA 3L0NA 1X6NA 5AYXA 3W70A 1B90A 3N04A 4IQJA 4L1GA 1A3WA 5GJMA 4O19A 4Y9PA 2IW0A 2GJLA 3KCLA 3AXMA 4M51A 3LCGA 4AX6A 4X60A 4C5ZA 4TXEA 2QF8A 3MA8A 3N2CA 2XIBA 4X61A 3VABA 3GTNA 4P8VA 1G4TA 5EMKA 3PFRA 4GFIA 5T9CE 1LT8A 2DIJA 5D9OA 3Q37A 4GISA 3UZZA 4FLSA 3G2GA 1RA0A 5DMNA 1YEYA 3IGHX 1BG9A 4OHQA 5AHNA 4Q8TA 2Q8XA 3GNDA 1A4LA 1S3HA 3G8EA 2POZA 1H0IA 1WDRA 3WQWA 4AW7A 4DI8A 2DZVA 3VUPA 5BRPA 4CQCA 5T26A 3NR0A 4EE9A 1BQGA 3VCRA 5HJXA 3NXFA 4M1BA 3URAA 4DAIA 3LNPA 3ITOA 1X1OA 3THAA 2DPEA 3NQCA 2PDXA 4MY8A 1I2OA 1ZJAA 5I09A 1YTEA 3N3MA 1GW1A 4N9EA 5A6MA 4HNUA 4QCFA 5L9FA 5K9XA 4KCVA 3G1HA 3VE7A 2V3FA 5G4HC 1PV8A 2CLKA 4HCLA 4MADA 2J7DA 3S47A 1L6GA 4NJGA 1CLVA 4HSOA 2Q8LA 5AHIA 1HTIA 1IWAA 1VFMA 2RDXA 5IBXA 4ZO9A 4HOWA 1EJUC 3OOQA 3AOFA 3T0AA 2AOSA 3PTQA 1DJGA 3SCQA 3KWXA 2GGIA 3FV9A 3VDGA 3V5FA 2WWDA 1EIXA 1UWTA 2PWEA 2OYMA 2O9RA 4XTIA 5AC4A 3M5XA 3KOZA 4ONVA 3BGAA 3WLHA 3PANA 2XH2A 3BW4A 2D0HA 2Y70A 2VEMA 3S1WA 3UZWA 1PZ2A 3MC5A 2IS7A 3USZA 2FTYA 1KNWA 2EPOA 3AJXA 2JGYA 2NUWA 2BVYA 5A2AA 4ZL1A 5AN7A 1FWNA 3WNNA 1Q6EA 1CIUA 1NM9A 2P5NA 5HQLA 3MSYA 2HE8A 2EG6A 2ZZ3A 3PUOA 5H91A 3PPGA 4O1EA 5KTLA 1FWGC 3DUGA 3GHRA 1FWRA 3LYEA 3WL1A 5AHMA 4H83A 1MEIA 3DYPA 4I6KA 4NJHA 2DZUA 1AW5A 4WKFA 3QMRA 2ZRWA 1W3LA 2P8BA 4S3JA 3C86A 1XIEA 1JPHA 5AYIA 2V5JA 1JG9A 1OYBA 2J88A 1YW1A 4D72A 4FB7A 3O1NA 1NWUA 5DXYA 4LB4A 1W5MA 3CL8A 5CGMA 3TUUA 1NY1A 4GVGA 1CPUA 2FZ9A 4YHGA 1MNZA 1OFAA 4W8AA 1WKFA 1S2VA 5HNTA 1JQVA 1HO4A 1UJPA 4LBUA 4C1NB 3VE9A 4QJ1A 4PCPA 2QCDA 3TWBA 3QFWA 1E0XA 1R2TA 3G6MA 1OFEA 4GYFA 4IGHA 5KETA 1E4NA 3VKKA 2BS9A 4DO4A 1FKWA 4ZENA 1M1BA 4WOZA 4GUFA 4IQLA 4DNHA 4LT9A 1GORA 1YTDA 1GOXA 1U5VA 3OG2A 5K7JA 1VFHA 4JIPA 3AS0A 2E8YA 3ZO9A 2O92A 3PAJA 2NVDA 1JZ7A 1M7PA 4PTVA 3WO8A 3VIIA 1JR1A 2E0PA 2V82A 1HZYA 1DTUA 4W9TA 2FPTA 3KAOA 3GTIA 3W1TA 2UZ9A 1QI0A 2YR1A 2RAGA 3ARXA 2CIPA 4BWLA 4DZIA 3M16A 4N4QA 5B80A 4DZAA 1XIHA 4ZXLA 2ACUA 1TSIA 2WKJA 1R3VA 3AIRA 3M6DA 3T8QA 5BZAA 2E28A 2J75A 1GTEA 4Y6GA 3AYVA 3VDCA 2QF7A 5D9MA 1A5BA 4XBJA 4MWAD 2BXZA 1LQ0A 1R47A 4NRRA 3UXKA 3IIOA 4NF7A 1RBLA 3RPDA 2OFJA 4PFMA 4LF2A 1NTHA 3EB4A 4P8WA 3P2VA 5M3WA 3L2MA 2BGQA 3LPFA 3GTFA 3VX1A 1XS2A 4WUIA 2ZDSA 3TYZA 1KFLA 1JCMP 2JBMA 3AMLA 1W9BM 5HMEA 3AMCA 1LRQA 3LG3A 3V0UA 3PY2A 4DJEA 1FWJC 3K8MA 4LUSB 2QR6A 3I7RA 4GFSA 3PR2A 3ICJA 1F4HA 1O95A 1IWBA 4B16A 4XTDA 5AHEA 4KT2A 2PWVA 6REQB 2WNQA 3SW6A 1GQKA 3MUAA 3PZGA 4Q3MA 4AC7C 4W5UA 4IF2A 4CU8A 3PBWA 1DPMA 1OC6A 4Z42C 3BJFA 4WDWA 1X1NA 3UWZA 5EYWA 2Z4GA 2WBGA 4CN1A 2GQ9A 1VJZA 4MG4A 1KRAC 1UCWA 3SIZA 4E2BA 1NARA 1FTXA 1FWFC 2XFWA 3H7UA 1NP2A 1QPNA 1US2A 3C0LA 3DX5A 4UQDA 2HK1A 2DW7A 1P0EA 1M9HA 2PS2A 4IWWA 1Q3NA 4UFJA 4IP5A 1J9YA 3WQ6A 1H3GA 2JF7A 1PZ1A 4XIAA 3TTYA 1T7LA 3KRSA 3Q4DA 3G8RA 2CLEA 3CZ8A 3ABXA 3NAVA 1EO7A 2GZXA 5JMUA 4LV4A 1XIGA 1VLIA 2NQLA 3GSMA 4AD5A 1B30A 5CC7A 3TFCA 1CBGA 4M24A 1UH3A 1PIFA 2RJHA 3COTA 5D8WA 1JZ2A 1VIZA 3WDQA 3G1VA 1HJQA 2ZA3A 1N55A 1XGEA 3T09A 4HPGA 2GJPA 2DZPA 1QO2A 1EOKA 4K1WA 1I2QA 1DWFM 3RO6A 4Q32A 5I24A 2FDMA 4X3ZA 3OBAA 5AZ1A 5DF0A 4ZQOA 3GXFA 3FN9A 4LAKA 3TYCA 2WSPA 4AMCA 1Z44A 1BKSA 2YLAA 4S39A 2ZYFA 2A79A 4AFYA 4PUUA 1I6NA 2V68A 3NM3A 3AIUA 1FWIC 2YGYA 1TPEA 4ES4A 1L6FA 4KWWA 2V38A 4CQ9A 3AC0A 3TJIA 2BMBA 2VX5A 4RL3A 4D6IA 1YHTA 1PL9A 3QEZA 4AXNA 1OCNA 3LS9A 1XLIA 2J6XA 3VXGA 3QF0A 4Z2KA 4CCEA 2QDHA 2MNRA 1R38A 3B4YA 3UZJA 4CNUA 3VMOA 5A6BD 4J3WA 3B03A 1BG4A 5HR7A 2D0GA 1WZKA 2OMAA 5B7YA 3R43A 4IGNA 1Q85A 2VDGA 1EP1A 3G0SA 4UTIA 4EP8C 4DYKA 4AHQA 1NELA 1MUCA 1SFLA 1UA3A 3BUVA 3AISA 4L6OA 2F2KA 1UQZA 5GNXA 1FDZA 2GWGA 1E1FA 3MVTA 1J2BA 2DUXA 2X2YA 4W85A 1KFEA 4M6VA 3BAIA 4NUWA 5JQ9A 5BXRA 3OEXA 4OECA 3HMJG 2RKXA 3E0VA 4PUEA 4TU1A 4MWAE 2X09A 2C16A 1F9CA 5HANA 5HDRA 3VC5A 1CXEA 3OZOA 3BAYA 2PI6A 3VDHA 5A6LA 1OF8A 3L4UA 2YB1A 4XUGA 4ERIA 1R46A 1KR1A 2Q02A 1O5XA 1UB3A 1UKTA 1DHPA 2PWDA 3CZKA 4HPNA 3M46A 2YCJA 1XCXA 2ZKMX 1SZRA 3L4XA 2ZWZA 1OT1A 4XQ6A 1GONA 1AL7A 3PUGA 5BU9A 1JRCA 4WZHA 3GXNA 3CBWA 5G4EA 4PMQA 2WMKA 4JZ5A 1MQQA 1LOLA 4RDWA 2E9BA 1JD9A 4I7UA 5FF7A 5CC5A 3AWNA 3CLMA 4QFUA 1A50A 1J6PA 4JXCA 4IOTA 3PSWA 5LHEA 1CGWA 1PZ3A 1EC9A 4QQUA 2R91A 1T8XA 2I9EA 5KZMA 5HJYA 2XG9A 3TIMA 1RHCA 2F38A 4POCA 4HA4A 2YCEA 4XZMX 4GXWA 4Q22A 4PH6A 5K2ZA 1TWWA 5JH1A 4NG3A 3DHUA 4NY2A 3T7VA 1JVNA 1TIMA 3KTCA 1Y5WA 2VQTA 4BWLC 3T44A 2FQIA 4F79A 2ZIDA 4H4IA 3NEVA 3VZYA 4ERAA 1XBXA 1O5QA 3UESA 1TO3A 4JHOA 3E6EA 4WDTA 4Z08A 1NF7A 1RVGA 1WDWA 4C6PA 1VPXA 2TSYA 3L0GA 4IGMA 2TRSA 4JICA 1BRLA 3GBDA 4MJZA 1FCUA 4G6CA 4FLRA 3N9SA 2RGMA 4EOUA 3LM3A 2OGYA 4W89A 3LQLA 3E5PA 4DIAA 1KKRA 3C2FA 3ZQ9A 2HWGA 2X1IA 2ZA1A 1Z69A 5CC6A 2XVPA 5JBEA 3ZLGA 1MQRA 4FA3A 2ZUMA 3KWSA 1UH2A 3DU0A 3ANVA 3AIVA 3AAMA 2VR2A 3M0XA 1FUYA 3QQ1A 3G0UA 3WDRA 3H4GA 1GOWA 3CPUA 2DZAA 3LHWA 1ENUA 1BYCA 2FFCA 1W2VA 2VR4A 2BOGX 4WY0F 2VFEA 2J4GA 1ZY9A 4LV9A 4Q8NA 2PPGA 1AQHA 2OEMA 2ZTKA 2ICSA 1PSCA 3HJZA 1TMQA 4XAZA 3VGFA 5CPNA 4EF9A 3LPGA 5DLCA 5HUOA 1G1YA 4EXQA 3F2DA 1VYRA 1IXQA 1U30A 4YU1A 1KWKA 4LSBA 4O1AA 3USBA 3BQ6A 1FQ0A 2VX6A 3SUSA 3IUDA 1XM3A 4ADTA 2XWDA 2QGHA 3EB2A 4R27A 3KRBA 4PMUA 4LALA 4L6DA 3VNJA 4GCXA 1WDSA 3OVRA 3T07A 3S6DA 3GVVA 1UR1A 1M5WA 1TV8A 3TH6A 4C6FA 3LOTA 1CXLA 4MFEA 1H51A 3RCYA 2PU0A 5FKYA 3N18A 1TPC1 3VOHA 3VO0A 3U7VA 4ZB0A 4ZQPA 1Z8AA 3MY9A 1EWDA 3F1QA 2CBIA 1AUSL 4R9OA 2VOMA 4XSMA 2GVJA 2TPSA 1P4CA 7REQA 2F2HA 4DJED 3P0WA 4BR1A 5K9DA 4DELA 1XIBA 3WELA 3CEPA 3BARA 2PEVA 1U5HA 2PDIA 4ZO8A 1VEMA 3NZ1A 4LBRA 3H24A 3TSBA 3VGGA 1PUDA 1ODUA 3SQLA 4IIBA 5C9XA 3NO5A 3M64A 2GDUA 4YTSA 4V15A 3G1SA 3GIYA 1PEZA 5H8PA 2X0YA 4JN6A 1LL6A 5CLTA 2V63A 1EC8A 3DHFA 1WOBA 1XRSA 1N8IA 4JY9A 1E1EA 4ZB2A 3MMUA 3O2LA 4IJRA 1Q7ZA 1KQZA 4LB3A 1IIHA 3UYIA 5HUPA 1XRTA 1EEPA 3CPRA 2FHBA 4R85A 1WXYA 3EMZA 4MIMA 1OC7A 1XP3A 3JZEA 4QROA 4OUIA 3M0LA 1KBKA 2E77A 3LTYA 2ZXAA 2OQHA 4CNTA 3UGVA 1H7WA 1UC5A 3QHOA 4KMQA 2V5KA 4GYJA 2NQHA 5DBUA 3EA3A 3NURA 4OWGA 2WJDA 3ZZ1A 5F4XA 3KEHA 2VKZG 3BPWA 2XWEA 1F6YA 3GU9A 3SECA 3DIPA 4XVEA 3PBMA 3EWWA 1CCWB 3URQA 4PGLA 4C91A 4RZ6A 4DJFA 1DTNA 5I78A 1QNRA 4NZJA 3G0XA 3BLLA 2D3NA 4DPPA 4C6DA 3E2RA 3GZ3A 4MB4A 1H09A 3PZ9A 1KV5A 3NL2A 1K9FA 1OD0A 4RE4A 4D8AA 5FACA 3TR9A 4OUEA 3L0KA 1GPWA 4URIA 2CCRA 1V6UA 1FHUA 1UA7A 4GVFA 1J6OA 3UA3A 3HG3A 2A3AA 5EMUA 2Z6IA 3P14A 4PUJA 1ISWA 3TE9A 4ZB5A 5EY5A 4F9JA 4A05A 2Y85A 1DJQA 1GKQA 4E8DA 3CJPA 7XIMA 2YBTA 3ARSA 3F2BA 3S1XA 1ZHAA 4RUBA 2F84A 5LIKX 1IXOA 4Q4MA 4PUDA 2VURA 1Z41A 1N7KA 1UKPA 1DWIM 3GDRA 2IQDA 3M5YA 3BAXA 3NQMA 2CEQA 2YBUA 3GRIA 4QGCA 2VX7A 2NLIA 4P7OA 4F48A 4NZ3A 1TQXA 2WMGA 1QPKA 4K7VA 1NWRA 5FAJA 2FHFA 3TN6A 3HF3A 2QUNA 3GDBA 4PFHA 1S3TC 4PUNA 5FEZA 2I17A 4YN5A 4HMNA 3TTQA 3CTLA 2GGHA 1ZS2A 1RXOB 3P60A 3FIGA 2GK1A 2WW5A 4RX0A 3YPIA 3R1ZA 1H0GA 1EPXA 4GIEA 4RV3A 4JEJA 4MNKA 1AW1A 3FYPA 1YE6A 3II1A 1O5RA 2PCQA 3WG6A 1N2VA 3VOJA 1KTBA 1A80A 3N2XA 3H21A 1R30A 4GO9A 1Q2RA 1UHVA 1XYLA 4GC4A 2DP3A 3WQEA 3TA6A 1VPQA 2UY3A 1B3ZA 4PMRA 1JIBA 3CIWA 1PVNA 3EWYA 3R94A 1R9XA 2WVUA 4B9YA 2CLHA 3UETA 1QMLA 3LI0A 5D32A 3N14A 4XK2A 3SUVA 2VC5A 4QR6A 4MJ2A 1HKMA 5C9ZA 2WMIA 1JPDX 2R1KA 3W00A 4UMCA 3TZFA 3QHNA 4WR3A 4DUXA 3RLHA 1JI1A 2ACRA 3WMLA 1PZ0A 5AC7A 1EP3A 4XX6A 4YCPA 1CNVA 3HM7A 9XIAA 3QXBA 1MSSA 5IRPA 5AYYA 3ZLFA 4FAMA 2QQ6A 1HVQA 4A4AA 3WQDA 3ZR6A 1GQNA 2DDXA 2ZVRA 1F8MA 3CPGA 3QMSA 3HMCA 3W6MA 1Q6OA 1D2KA 5G2WA 1LT7A 1SZFA 5A8OA 4A3QA 1EA9C 5TD4A 3FA4A 1ZBCA 4AEOA 1MI3A 2GDVA 4BF7A 2EPKX 2VUNA 1G5AA 4FHAA 1KTCA 4CEUC 3NJ3A 2P88A 4HU3A 2YB4A 5FSDC 3FLUA 2NT1A 2VT0A 1CWYA 4AHPA 3UWYA 4YTUA 4I5XA 1H2JA 3EMQA 4GYPA 3IIPA 4O18A 4S38A 5CPOA 1K9EA 3DZ1A 1AH0A 4ZOAA 1U83A 3SSZA 3P5ZA 3TQ0A 1WDPA 4PBFA 6ENLA 4U4MA 3VNMA 1XG4A 2QJNA 3VK5A 1BD0A 4K37A 3I3BA 4RE3A 2YCKX 2BZNA 4HTYA 4KKXA 3W2JA 2BB0A 1HUVA 2ALDA 1JJKA 1J01A 1VHNA 2VFIA 4ACZB 4Y9MA 3UG5A 4PODA 3GVRA 5CEWA 1E15A 3SJ3A 4JBRA 1BGAA 1R7OA 3RU8X 2AAAA 1UZ4A 2VFGA 3MQTA 1XFCA 4XIMA 1OWQA 1TWZA 1SJCA 1RCXB 1U22A 2Y2WA 4P7QA 1IEVA 3WMCA 5IHRA 3IACA 4XD6A 1FFQA 1OSEA 1O6IA 3VIKA 3BQ5A 2IQTA 4JPGA 3DFSA 4QJ4B 4PB4A 3WLOA 1NP0A 1RD6A 4Z1YA 1KCZA 1UUQA 3H2MA 2FB3A 3NL3A 1B4EA 3EPOA 1J0JA 3LTSA 1XPYA 5I79A 2ATSA 3VFLA 2WVVB 2WKGA 3AS1A 2C79A 3VD3A 1R3RA 2BY3A 3UWVA 2V2CA 1LRTA 1AODA 1AD1A 3CO4A 4IH3A 1QNSA 4G2DA 3KCJA 3WNMA 4X22A 2WV8A 4I9TA 4OBRA 1E6ZA 3T4CA 5TF0A 2E1DA 3CT2A 1C8QA 4LFYA 3WF3A 2GQ3A 4HNTA 3T6CA 3BTNA 3UR2A 2QJIA 5CPQA 3HPXA 2VMFA 3MB9A 5JBFA 1CB7B 3T8LA 3VYLA 3LZ3A 3HQPA 3NQ8A 3QRHA 1UASA 2C7FA 4OV9A 1PBGA 3AZTA 3WH7A 4D6JA 4Y8EA 2QVNA 1G9HA 3VNZA 4LEFA 3KHDA 3T0BA 4GQGA 2OSYA 1L0PA 5A8QA 5K4XA 4OBTA 3W7CA 4BF9A 3KE0A 1PWLA 4LVDA 4HBKA 4JTQA 4MHBA 3HPSA 2CPUA 2FZBA 1F76A 2UWFA 5HWNA 1E9ZB 2IKGA 3M4HA 1QWGA 3TLQA 4CN4A 1B54A 3TOYA 2B7OA 4I90A 2PWHA 4TX8A 4D8ZA 2W0UA 3FVDA 3ARTA 2CBUA 2YDAA 3L66A 3LCXA 5CGTA 3SCNA 5CZTA 1M6JA 4JTLA 5H1WA 4QITA 2PGFA 1EX1A 2VC6A 3N2OA 5C2CA 2QCFA 1V8EA 2PC4A 2ZC1A 1GGOA 2IKJA 1V79A 5DMYA 4GUIA 3VKDA 1XJBA 1TV2A 3R11A 5ECVA 4IJBA 1ITQA 3NYZA 5LIXX 4M81A 5E1QA 2FKPA 3W2KA 1JUKA 4GO8A 3MO7A 3QYQA 1F74A 5I7GA 2OLSA 3SFKA 3A24A 2NVAA 2ZA2A 4DNMA 2FJUB 3UWQA 1IT0A 3IJ6A 2ZOXA 3G1YA 4W88A 5DQPA 1IV8A 3HZ3A 2WCAA 2PF0A 5GVJA 3B9DA 3EKZA 1KBBA 1RSCA 4GABA 1KQYA 4G7EA 4MB5A 3OIXA 1HIZA 1UG6A 3NQVA 1UOZA 4HD5A 3OP2A 3W6YA 2PLCA 2V2HA 2AAMA 1I2NA 5JH2A 3WQVA 1UKQA 4QISA 2OELA 3LERA 1C7SA 1Q6CA 1WNOA 5IFPA 4H1ZA 1J0IA 2ZX6A 2X0SA 2VOTA 1QPOA 2HNEA 5GPRA 5FF2A 4C6EA 3S2CA 3NYDA 2ZBTA 4QCEA 1F73A 5LA1A 3WK2A 4LUTA 1P0NA 4P5UA 5LHFA 1AFSA 5A6SA 4FP1A 1TB3A 2OU4A 3CASA 2GL5A 1UWQA 3TN3A 2J8FA 3LV6A 3MSGA 4IFKB 1KCXA 1LTDA 3W7OA 4JTEA 4QP0A 1JQXA 4HTBA 4P2VA 1MUMA 1LLZA 4Q6XA 3C0QA 1ZJIA 2PTZA 1MEWA 4ERGA 3GC4A 1UUMA 4WHBA 1EFZA 4O17A 4XZLX 3ZT5A 4AD4A 3AI0A 2QT3A 2WHJA 2OO0A 5DFAA 1CXIA 2VCAA 2UY2A 5D2YA 1GOOA 4MM1A 4D6FA 3SRKA 1GNXA 5E6ZA 4KWOA 4CNOA 2XDFA 2Z29A 5FEWA 1QUMA 1X98A 5LNVA 3JR2A 3UERA 2ZRUA 2ESCA 2OG9A 4MJ4A 4WDUA 2DSKA 5AECA 1EXPA 3TN5A 3AYRA 3VNDA 4MF4A 3N13A 4DBWA 1TKKA 1EQPA 2W62A 2ZE3A 4ROQA 4R7JA 4QJ3B 3NWRA 1LG1A 1N82A 4M8UA 5FF4A 2BXYA 3D47A 3N29A 2PMQA 1ME9A 5J5RA 3EA2A 4HCDA 2QAPA 1XYAA 3ZM8A 1RAKA 5HK4A 4C6IA 4QG9A 3WDHA 3KM8A 2E5BA 2Q71A 3G77A 1R2RA 1H50A 4GYPC 1B3YA 3BICA 4IG2A 4O10A 3VX0A 3A6OA 4C65A 1OYCA 1M03A 3ABRA 4I7WA 3NQFA 3W26A 3U57A 3AUJA 1SMDA 3RRXA 3VUSA 3WUGA 3EPNA 2H3DA 4LF1A 1DIOA 5U7SA 3SCWA 3IJIA 3FAXA 8XIAA 1K3UA 4Q8MA 4XKMA 4Q4OA 3APGA 4GIYA 1H7XA 4QTGA 1TREA 4MPQA