4US5A

Crystal structure of apo-msno8
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
329
Chain Sequence
b'HVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSAEAAARLGLPYAYAHFITPQFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
total genus 119
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5A00
1BSLA 5LXEA 1BRLB 4UWMA 2I7GA 3RAOA 1M41A 1NFPA 2B81A 3FGCA 4US5D 4J2PA 1RHCA 1LUCA 5AECA 3FGCB 3B4YA 1TVLA 5DQPA 1LUCB 1FVPA 1YW1A 3C8NA 3SDOA 4US5A 1EZWA 1XKJA 3B9NA 3B9OA 1F07A 1NQKA 1BRLA 1Z69A
chains in the Genus database with same CATH superfamily
1B4KA 3LHZA 4LH8A 4UWMA 3BH4A 1XRSA 3ITGA 2PRHA 2PPGA 1M3UA 1F61A 3P5ZA 3CMGA 3BGJA 1A47A 4W8AA 1NQKA 1GOQA 3BE7A 1JAKA 3H70A 4DZ5A 3SQMA 1U5JA 1T6MA 4QDPA 1ZJHA 1BFNA 1UUOA 1QVBA 1YNYA 2NT0A 2WVVB 4ECLA 1ZP4A 3JS3A 3DI1A 1SUXA 3F4WA 2YPIA 2D73A 5E6ZA 3E02A 3TU9A 4O17A 3M1ZA 5DQPA 4HOXA 2H9AA 3NEHA 4W9TA 2OEMA 4GXMA 3PUEA 1W31A 4HA4A 2Y6ZA 3H23A 3OQEA 2FJKA 4GY0A 5G4WA 4AC1X 3N18A 1TWIA 3BMVA 3W70A 1EF3A 3EX1A 2PRMA 2EPMX 4B3KA 2ZBTA 3R8RA 1EKOA 1GQNA 1NOWA 1O5XA 2QJNA 1F8MA 4F2BA 4MB1A 3PSWA 4KCTA 5HINA 4UZSA 3WLIA 3VNJA 1ITQA 2E4TA 3ZVIA 1J8VA 5LNUA 4O1BA 2CETA 1M7OA 3EGJA 3HQOA 2IQDA 2D69A 3LHWA 3U4FA 1UA7A 1W5MA 4XZWA 3BZGA 2GGHA 3OEXA 3MBDA 4UC5A 4GX9A 2BTMA 1FHUA 1W5NA 1LOQA 5CPQA 4XD5A 1OF8A 2D22A 2BXZA 1H5VA 1SFLA 1GG0A 4KCVA 2FLIA 3EX2A 3NL5A 4DWSD 1VKFA 1Y5VA 3P6LA 4Q4QA 5K2ZA 1VYPX 3OBAA 1TE6A 1OT2A 4G1KA 5AECA 4I8DA 4Q4SA 4S3DA 5EY5A 1LT7A 4U2YA 3FJ6A 3PPGA 4GZ7A 2V3GA 3WENA 3M6DA 1VBUA 3LX9A 4ICCX 3JZEA 1TA3B 4HSHA 3OW1A 3LM7A 5FF4A 1H3GA 2WPBA 1PZ2A 1A5OC 4GKTA 3L4WA 3WELA 3U6WA 1IXPA 3LGEA 1DVJA 3WUFA 5AVNA 3HG4A 2Y5SA 3DKLA 3RG6A 1S2UA 3A3XA 1E4LA 4BZYA 3OIHA 4R34A 3W4RA 2NQHA 1GOIA 3EA2A 1DJWA 3EMZA 3GFYA 3MDUA 1DEDA 2O7QA 3WDPP 3MTWA 4HU8A 2BODX 3NQ6A 4UBPC 4Z1CA 1UR3M 1YXCA 3RPTA 4DO6A 3LV5A 3VD7A 6REQB 3T0AA 1R46A 1DXEA 1ISVA 2VDGA 4HYWA 1W9PA 5HPCA 3IGXA 1XDLA 2YA1A 4CQ9A 4ZOAA 1OFEA 3GG0A 3QBUA 4N42A 5A8NA 3MZ2A 2H8ZA 3AALA 4C7DA 2OSWA 4GYKA 2WLYA 2QDDA 3WDJA 4C6PA 4NKCA 2PWEA 3MI3A 1B3ZA 3B8UA 3B0UX 4EPKA 1I2OA 4H9XA 1S3HA 2Z7GA 1ZGDA 3WQDA 2QZRA 2Z28A 4RLIA 1UD3A 2VNCA 4GQBA 5A8PA 4LNCA 3N9RA 3L65A 5C9XA 1M9HA 5CPSA 5LGZA 4PMQA 3P81A 2YKKA 4UQ9A 4YLWA 4K3ZA 4Y90A 3GUWA 5T26A 1KBJA 4LUSA 4W7UA 2ZZ5A 3WQCA 1J6PA 5G2HA 1POKA 1GEQA 3C2EA 2HV5A 3TYAA 2VEIA 1GJPA 1XM3A 1K9TA 3SZ8A 4OE7A 3FKKA 2PGWA 2Y7EA 2A3BA 1GZJA 3W7RA 1CGWA 3LTPA 3LXBA 1HO4A 4XAGA 3B9AA 4D6IA 4WSKA 4QDMA 3RX3A 2YYUA 5D4YA 2PP3A 2D0GA 2DPEA 3PF3A 3VOJA 1UKPA 3QTPA 3WQ5A 3GXMA 3JRKA 3UR2A 3UXIA 4LUTA 3GE7A 1TSIA 1HL2A 2E5CA 4CNNA 1L6SA 1GOOA 3L21A 3H7RA 4JD4A 1HG3A 4O18A 1KXQA 2EAWA 1VFFA 3SIZA 3KOFA 1ZU8A 2PTYA 2YL5A 3DCPA 2H3BA 1GOKA 2WMKA 2FHBA 4P5UA 4E8DA 1EHAA 3LA4A 4C6BA 2XGZA 1R2RA 2QDEA 2QVHA 2VDIA 4UFLA 4CKQA 3DGRA 5ABGA 3W2NA 1F4AA 3KWSA 3U2ZA 5FAJA 4HHMA 1E5JA 2D23A 2Y5JA 3RPMA 2AMGA 4I8YA 3WBXA 5T8GA 1S1PA 1HF6A 1UA3A 1BVWA 3DKJA 4DWSC 1EGMA 1TYGA 3HGOA 4LUIA 3ZWTA 4A05A 2XFWA 4QG9A 3C8FA 3W0KA 4PUDA 2C0AA 4GYPA 1VB9A 4LRTA 3CL6A 5GNYA 1S38A 4L61A 1RLDA 4N6FA 4ZQOA 1DWJM 3NOYA 3T4CA 3BANA 3CHFA 4GZJA 1T41A 3UGRA 2YGYA 1F76A 2OXNA 4JTGA 2HS8A 4Q22A 2GSJA 4J1OA 1ECEA 1Q7MA 1DWAM 3FEMA 4GG9A 4KH2A 3E2SA 4G7FA 1P7TA 4HMNA 3VKDA 4C7FA 3I4KA 3G18A 2WQDA 1D8CA 3NVDA 1E1CB 4HVXA 1RD5A 4LNYA 1J93A 3H54A 3O0KA 2OLSA 3PBYA 1Q4WA 4ES4A 1IWBA 3TN5A 1WZLA 2GUYA 3H2EA 1W9BM 1WKFA 4AMCA 3EPMA 5H6HA 1HN1A 3RILA 1V6UA 3EZ4A 3MSDA 2B81A 2P88A 1QW9A 2DSZA 1Z6KA 4ML9A 1XIIA 1WDDA 3ORWA 1LUCB 1X1ZA 1J0KA 7ENLA 4PUMA 3CAKA 1N82A 3WQGA 3AIBA 2I17A 1WCGA 4GJJA 4FXJA 2NVAA 2J47A 3FX4A 4JXCA 3NG3A 4DPQA 4PUUA 3GNNA 1F2JA 1OIFA 3AYRA 1UHVA 4M0XA 4LS0A 1PTAA 2Y5EA 1GT8A 1UC4A 2DZUA 2DT0A 3CWNA 2HXTA 1XI3A 4FIQA 2NW0A 1FWWA 3PTQA 4NX5A 1V3KA 5DY3A 1LQ0A 4IGMA 4S3GA 3B8DA 5AYXA 1D7KA 3B0VC 2VEKA 2C3ZA 5DN1A 1ZBVA 1RY0A 1NJJA 4CD4A 1SJDA 1VPQA 1AL7A 1DQUA 2FPVA 1XKYA 4BQ3A 3LPOA 4N9EA 2Z29A 1VYSX 3D0CA 3I3BA 2DU2A 3GTHA 3TKFA 1QO5A 2G5WA 1ZAJA 1SZGA 3LBOA 5A6JA 3VE9A 4X22A 2OELA 2X09A 3E0LA 1QJWA 3EA3A 3KTXA 2WXDM 4AYGA 3KS5A 3S1WA 4N6EA 5AC5A 1B3OA 2Y63A 2QXWA 2OT1A 2I7GA 4R27A 1P1XA 4AVOA 2EEXA 1PDYA 3QOMA 2JQXA 1QPQA 1SMDA 3IEBA 2OYMA 3W7HA 3LCHA 2WHLA 3GR4A 3CZJA 5FEZA 1L6GA 2OEKA 3H53A 4V2XA 5D03A 1E1EA 4AF0B 1CLVA 1O5QA 1T0OA 4TMBA 4DO5A 2UY3A 3M07A 3IJDA 1TV8A 3G2GA 3VIIA 5HWJA 3RU6A 5HMEA 4MJZA 3USBA 1XBYA 4IQLA 1WDQA 3QZAA 5AC6A 3L4XA 3IIPA 3SUVA 2WJZA 1WKEA 4J3SA 4TO8A 2OWXA 4OBRA 3TZNA 4UOZA 3QJAA 2HNHA 1XBXA 1K3UA 3VDBA 5BXSA 2FZ8A 3W72A 1JZ6A 3RGTA 2E6AA 3S47A 4J3VA 8TIMA 3V7PA 4IISA 4CQCA 4GACA 1BG9A 1L2UA 3AS1A 4W88A 1NIUA 1Q6FA 3ITTA 1V79A 3H21A 4HPJA 1UKSA 4NHVA 1BQGA 4M24A 2XHYA 4P2VA 4WSJA 3LSBA 4NNBA 2OOFA 4F2TA 3D3AA 4NAEB 3TR9A 3GS6A 4BQ2A 3E38A 4DUXA 2OJPA 3I4EA 3W38A 2E67A 1FDJA 1KCXA 1V08A 4AHQA 1BYCA 1XXXA 2WNNA 3WEZA 4CD5A 3CUIA 2F84A 4NAFA 1K6AA 1GKPA 3NO3A 1ELSA 4EKJA 3PWGA 3QVQA 2OWWA 2XINA 5LNRA 4Z17A 4C1KA 4FF5A 3ARVA 3OU8A 4E2VA 2I14A 3QW4B 1ZY9A 4LB4A 1REQA 3L2LA 2ALRA 4U31A 2NXIA 4GVIA 3HA1A 3IIZA 1UWQA 4RKAA 3ICJA 3L0KA 1P6WA 3GNRA 4ZSTA 1PB0A 3PM6A 1L8PA 7TIMA 1YE4A 5PTDA 3F2DA 4YVVA 3PFRA 2PWFA 3PJUA 2B4GA 3T4WA 2AAMA 3VDHA 5IFPA 3F7JA 3QZ6A 2SFPA 3WQFA 1UR4A 4HA1A 1V0NA 2WAGA 4HYVA 3UW6A 3PTKA 5BW6A 5B80A 3C2YA 3BW2A 5FEWA 2BSLA 1WKDA 3WQ6A 3EXSA 1XL9A 3GRIA 1PJ9A 3PZIA 4PCPA 1OFBA 2ZFAA 3CNYA 5A8QA 3WK0A 4HKPA 3NQVA 3GO2A 3EWDA 4FZIA 3URAA 3VCRA 4Y9NA 1MQQA 2BV9A 3ZMRA 4LTSA 1FHVA 7REQB 3BDKA 4ZB2A 3UQNA 4B3LA 2GDUA 4JIQA 3VKAA 1JF6A 1P5BA 1RHCA 3KVMA 2GVGA 7XIMA 5HXMA 5G1MA 2XDFA 1UKQA 3WZ0E 5REQA 4HA3A 4HK6A 4KESA 4U4MA 3ARSA 1E0TA 3H2CA 1Q65A 4AQLA 5D2XA 2RAGA 1CPUA 3B0PA 4HCHA 3MDWA 1BTCA 2Y61A 4J3WA 4IMEA 1XIHA 1ME7A 2NUXA 2VDHA 2I1OA 3IJ8A 4D6GA 1V3LA 4IMGA 4EF8A 4HA0A 1QI3A 4Q7IA 1RXOB 3N13A 1KC7A 4I5UA 4AY7A 2PS2A 4XWUA 1OD8A 2Z6JA 3BCFA 3GC5A 5CG7A 4GH3A 3BAKA 4FLRA 3SUSA 2J6XA 5AYYA 4LF2A 4F4RA 5DY2A 3N2OA 1VJIA 3W81A 1KCKA 2YBVA 4E4UA 1KBLA 4QE1A 1U5VA 4LX4A 2CBUA 1WUFA 2X0SA 2RUSA 5I3FA 5HK4A 3OG3A 2C15A 4HN8A 5C9RA 5D09A 3TFCA 2V63A 1Z69A 1UMLA 1D9EA 1ODUA 2Z1SA 4B9ZA 3RPDA 2AGTA 3UWWA 3FV9A 5JH1A 5C8BB 3PBMA 2YCEA 2FPTA 4Q7BA 4JKKA 2D2HA 4UTHA 4UMCA 1NF0A 2BX7A 5I77A 1DE6A 2XIBA 4W93A 3M0VA 3TROA 1VEMA 4CNOA 1VS1A 3BAIA 4WIWA 1E9IA 1UC5A 4DWSA 1GG1A 1AA1B 1I60A 3BXWA 1YDNA 3BJTA 1UB3A 3O6DA 2V2HA 4F40A 1TR9A 3WUGA 1Q6GA 4GE8A 3DIPA 1QNSA 3SCNA 4MADA 2YL6A 4AXNA 4M51A 1HQTA 2DZVA 3OB8A 4HCDA 2ZRVA 2E5BA 4F9DA 1R9ZA 1GUVA 3MV01 4YTUA 3U5YA 4Z0JA 3VGBA 3V1HA 1W9XA 4J3XA 3TCEA 1Y5XA 1N2VA 4YU1A 1N55A 1Q6CA 3SRDA 1F73A 3VKJA 3PPHA 1JQVA 3LUTA 5HWNA 1B2YA 3AWOA 3BURA 3WFZA 3ZVHB 4NXKA 1FWSA 1RJRA 2YJQA 1QWKA 5LA2A 4ATWA 1R3VA 1A5BA 1OD0A 3C2RA 8CGTA 4LAZA 4UQCA 4Q6JA 4DXXA 5BROA 1XLGA 3KBSA 1KGWA 3QLDA 1O95A 2G37A 3WX7A 2PWGA 2D2JA 1PTGA 3M0XA 1X8CA 1F3XA 1QK2A 3CUFA 5I79A 1JQXA 2J8TA 2JFEX 2PDKA 2MUCA 1J0JA 2R1NA 1WOBA 3B8SA 1JPDX 3QHOA 1OG0A 1C91A 3CAQA 1KXVA 2FTPA 4BWLA 3LGGA 1OX4B 1X38A 4JTAA 2G96A 4BFAA 4NYYA 3WFLA 2NQLA 3WMLA 3U2EA 4FNTA 3L4TA 4GNVA 1ZLPA 3HJEA 3ZZ1A 4HJWA 4KGLA 1A5AA 2PDQA 4E4FA 1FKXA 3AOFA 5CZJA 3M46A 3HOJA 3P7YA 1TV5A 4H3DA 4A21A 1PL9A 3AHYA 2V2CA 4ORMA 3GU9A 3LV6A 2Z1WA 4PBFA 3WBWA 4KRTA 4MY9A 5ABFB 2QF7A 3MS8A 4IHCA 5XINA 1XLAA 3USZA 1ZFJA 1E51A 3L9CA 1FXPA 2J7CA 2ZWYA 3ZT7A 4INFA 3WDIA 2J8GA 1IHIA 4ZO8A 4O50A 3CV6A 3OZOA 3THCA 5CCZA 1U22A 3S6DA 1WOAA 5EMLA 3NSXA 1MW1A 4GUGA 2IQTA 2NUYA 1C8YA 1EEPA 4CU6A 3V75A 3E49A 2YDSA 1SFTA 1EWDA 1B5TA 3CZ8A 4BF7A 2Y7GA 3T09A 2GJLA 3QGVA 3VNKA 1SW3A 1RUSA 2C1HA 4ACZB 2PRLA 5E0KA 1ZBWA 1QI0A 2FGZA 1YBQB 3LTSA 4UMAA 2G3NA 4BI7A 3S3GA 2IUZA 4UNKA 4DAFA 4IP5A 4TVDA 3P74A 4K1WA 2FMNA 4LBUA 1BLIA 5FJJA 2XM2A 3SGUA 4IG2A 2WLZA 4A8NA 4IUGA 3S1VA 5IHRA 5FD0A 5E09A 1MI3A 1G1YA 4XD4A 2WC4A 1CIUA 4XAPA 3GZ3A 2XFFA 3C0SA 2H3DA 1V3HA 3DC0A 3IJ6A 1EEXA 1CB7B 2CLKA 4Q32A 4H9VA 4CQAA 1IEIA 1KV8A 4QNWA 1DTUA 1VEPA 5HQEA 3VNLA 3VDAA 4KCUA 3S4TA 3ELFA 1OYCA 4IF2A 4B15A 3E74A 1JGMA 3WDRA 2PGEA 2ABBA 3PNZA 4V1YA 1B9BA 1KW1A 2AL2B 2XFYA 3EX4A 1FCQA 1OF6A 3T2QA 3WEOA 1T99A 5A6SA 4JTKA 3S0CA 5E9XA 1PUDA 2FPYA 4JQAA 4BF5A 4WY0B 2BY2A 4DVOA 3W37A 4ZOBA 4NG3A 1OY0A 4LYRA 5BWFA 3NCOA 1H1NA 4NL1A 3NSMA 2NX1A 3R8HA 3CHVA 1RV8A 3MMDA 1LQAA 3WF2A 3WK1A 1KV5A 3UETA 1KRBC 1VPXA 1XJBA 2DH3A 3QV7A 2C0HA 4G6CA 4PCTA 4GPNA 5C5YA 4JAWA 4WCJA 4GI4A 5DCEA 3LCIA 1E0WA 3AMKA 4PA8A 1KLZA 4D1JA 1DJNA 4YPJA 1O94A 4ZQCA 1BWKA 2O7SA 2P50A 1J0HA 3GR8A 4CCZA 2RHGA 1GW9A 3T07A 4TVUA 4ZO9A 1O7AA 2QDHA 1CDGA 3GHTA 1EA0A 4FR6A 3ARXA 3GXNA 3RLHA 1GORA 4HHHA 2ZA1A 3IK2A 2Y4SA 3I7SA 3OZMA 5E1QA 4NASA 3DHDA 3QMRA 2WKLA 2XPKA 2Y70A 1TVPA 1LOLA 4FOJA 3ZJKA 1PX8A 1LG1A 1U2YA 5D30A 4K7VA 4CCDA 2GWGA 4JTCA 3F4NA 3XIMA 1W3IA 1NP2A 3RCMA 2ONEA 1VBRA 3N2XA 2Z6IA 1M03A 1F07A 3WD2A 2A1YA 5BRBA 1DHPA 4H4IA 4RZ6A 1Z42A 2X8RA 3AROA 1CLXA 3OGRA 1C3FA 2O4QA 3K1DA 4AWSA 1I0BA 2J9ZA 2XIOA 1VFOA 4H7VA 4KQNA 5FF7A 2CXGA 3UZ5A 1HW6A 3BOFA 4I3GA 1P0DA 4MTVA 2ALDA 3VOCA 4GGHA 1NAL1 3BLKA 3UD6A 3WF4A 4Y9OA 5IFTA 1DORA 4ICMA 4DF1A 5A2BA 3VKBA 3H6OA 4GRSA 2J7FA 3M0JA 3ABQA 2PBOA 2REQB 3ARUA 2YCLB 2NXHA 4N9CA 1XIBA 1L6WA 1B1YA 1CYGA 4ZQPA 4KFOA 4FX7A 3L2MA 3S5SA 4JNMA 3EDEA 1TELA 1V6WA 4KETA 4LVAA 1SJAA 2CBIA 4DZIA 5I0DA 4LV4A 2PDXA 3BSMA 4ZEPA 1R47A 4JTSA 2WZEA 2PTWA 1UD2A 5F1VA 4A35A 1TPUA 5LKYA 3A21A 2VC6A 4A8RA 3K8LA 3W74A 4FXFA 1A80A 1H49A 1AW1A 1XYBA 2XVLA 2VR4A 2P5NA 2V5BA 1VH7A 2WMIB 3M0LA 2OO0A 2HROA 3K13A 5CH9A 3NQEA 5KMYA 3DAQA 4UTIA 3RIKA 1XX1A 5GQBA 2WZTA 4UTUA 3AXMA 4PN2A 5A6BA 4PUEA 5H8MA 4W85A 4X61A 3E6EA 3NR0A 4C6QA 4GNJA 1YEYA 1RQBA 1ZL1A 1BEUA 1CT5A 1HKVA 4DJDD 1P0EA 1CENA 2WVUA 3NL6A 1HVXA 5D33A 1H60A 3HPFA 4JIEA 1QBBA 1YXDA 2E8YA 2GVJA 1L0PA 1LLOA 2QJGA 1E6XM 3CHDA 4NUWA 2RH9A 7PTDA 1E6RA 1W1IE 6XIMA 4IIEA 2GDVA 2Z2UA 4ENLA 4J5NA 3T0BA 4RJEA 5CPNA 3KLKA 5H91A 5CZ0A 2GLKA 3PK7A 1ZAHA 1XYCA 4KF1A 4V28A 5J5DA 3M0MA 5EFDA 4KIEA 1EOKA 3S5OA 5HJLA 1QMLA 3HG3A 4K7YA 4DUOA 2Z24A 4ZGYA 2PDIA 4MY8A 2NUWA 5GJNA 5AYIA 3OTRA 3CLWA 1RPKA 3HU7A 5K4ZA 1LZOA 3N2CA 4ACYA 3GNOA 1KB3A 5KZEA 3W7MA 3WDQA 3KWXA 4E8GA 4OTKA 3WL1A 3AC0A 2PU0A 3NQMA 3P80A 3S2NA 1TVNA 4EACA 1V51A 3KDOA 3KS6A 3EA1A 4Z0SA 1TWSA 1X1OA 5GVJA 2GGGA 2W9MA 3C2OA 1LROA 3OG2A 4MG4A 1XBVA 4OUIA 4O28A 2YDRA 3GVQA 1IXNA 1UP2A 2BY3A 4GZIA 3MJMA 4AU0A 2DIKA 4MKNA 2EHHA 1J5TA 1QHZA 2HDJA 5DMYA 2H9AB 1LBMA 1FCVA 5BRPA 4M6PA 2WCSA 3R11A 2G0WA 4L6HA 1TV4A 3NYDA 4QGCA 3VNYA 3WO8A 1A0EA 1KFBA 4TTGA 1H7OA 2CESA 2OYKA 3AAMA 2PODA 4EPBC 1R87A 1WV2A 5AKQA 4GYFA 1TV2A 1ITCA 4WGXA 1AD4A 1W1A1 2A0NA 5D8WA 5KEZA 1SFSA 1GHRA 2QUTA 3MI6A 4NT0A 2GOKA 3K8KA 2XIIA 4WZHA 3VPLA 1DIKA 1H4PA 3LSCA 5D04C 3NOEA 2CW6A 3GC2A 3WUBA 3ANVA 4JDYA 2IS7A 3IANA 1E9ZB 2C7FA 3KP1A 4TR9A 1Q13A 4DM1A 5C6MA 3UZZA 2F7FA 1H51A 2E28A 1NFPA 1J96A 3B8WA 4F8XA 1E0XA 1WP6A 1SGJA 1G4PA 3RFAA 4Q33A 3AHZA 5KTLA 4Y96A 3WF1A 1QNPA 4NX0A 5A8MA 1HP4A 1VFHA 4CNUA 3EKLA 2PU1A 4O0QA 5FSDC 4GY1A 1N8WA 2BY0A 3IJ9A 3NGFA 4JTRA 5CAKA 3AIEA 2VZOA 5EKYA 1KGUA 3MKKA 3LBMA 3UZYA 1EBGA 3FSUA 4JN8A 4A2SA 3LK6A 5DCBA 2PWUA 4P8UA 1B9ZA 4ILSA 2AGKA 4PZVA 1A0CA 3CV7A 3A22A 2BOGX 2WMJA 3SECA 1TKKA 1GCYA 4F66A 1XLLA 4QXIA 3W7IA 2F2HA 5CZKA 2G3MA 1C93A 4AZGA 1E9LA 2P1FA 3KRUA 4R88A 1TUFA 2GVEA 2I5QA 3G1AA 4MNKA 3ABXA 3TVAA 3TAOA 4DJDC 5LXXA 4F0KA 4KCWA 2DQWA 4V33A 2OLAA 1JL8A 1L6YA 1MO0A 4MZ8A 4H41A 1TB3A 3FCPA 1XINA 3NPXA 2Z2BA 3G8RA 4FNQA 1XUUA 1A5CA 2DUZA 1J9YA 3W7KA 4GIYA 4XAZA 3A5VA 2OFJA 2A3LA 2Q09A 3MQTA 5DBUA 3RM4A 4JFTA 3GW3A 1QK0A 3MW7A 1JRBA 1OK4A 2P10A 1ZRQA 2NX9A 2D0HA 5IDIA 4GYJA 2CC0A 2MANA 4K36A 4JTIA 1R30A 1UH4A 1KRCC 4YNGA 4RV8A 2ZUNA 2QJJA 5XIMA 5H1WA 1RAKA 2R6OA 4IPPA 2ZRWA 2CHNA 1LQ2A 1BGAA 4I7UA 1XC4A 1GOWA 3U7VA 3TQVA 4IZGA 3THQA 3S83A 1ZTVA 3R12A 4LUSB 3AQUA 3CK5A 2PD9A 3FEQA 1GTHA 1EDTA 4MVAA 1NM9A 3FOKA 3AI0A 3SUUA 4L80A 4RZBA 4W7VA 4GBUA 4QLLA 3ENLA 4ZTXA 1M68A 3KFTA 3AHXA 1OK6A 1ICPA 4JZ5A 1GQIA 4NZCA 4LCRA 4MNLA 3IRSA 1Q6LA 1N8FA 3N14A 1E40A 2CLHA 2X1UA 4LUTB 3N6HA 3MUCA 4QG6A 1ZS2A 1M1BA 2ZX9A 3HPXA 2XISA 3TV8A 4M6UA 3UJ2A 1XYMA 1YLVA 2Z25A 3DFTA 3WY1A 2O4MA 3II1A 4GMEA 3IGHX 1XW8A 1FWFC 2X16A 4U5IA 1RVGA 2J62A 3IIVA 1JJKA 4F48A 3WJYA 4YTSA 2OKOA 3EXRA 1Q66A 3UF9A 3KL3A 3QR3A 1RCXB 3R25A 1M53A 1XRTA 4DI8A 4PB3A 2A7RA 5C0QA 5EMUA 4A3HA 4BR1A 3U57A 3CUHA 3QEZA 4HPGA 5E0FA 1TMQA 2Z1VA 4MMWA 4ERAA 1F7BA 3IGUA 4LAKA 3UY8A 4KMQA 1AZ2A 4ALDA 3R5EA 4HNOA 5A6AA 3W1XA 3Q65A 4H7CA 1VLIA 3W86A 1ZAIA 3VGEA 1G7UA 5E6YA 4QRNA 1VAHA 4UCFA 3BV4A 1DWIM 3NL3A 2XVKA 1E4IA 5I3IA 2VX5A 2YL9A 4TV5A 3UWYA 5HOSA 1XRFA 5HUOA 4I9TA 2OX4A 3N17A 1TCDA 3MSGA 3NQ7A 3BQ6A 2VZVA 3GU2A 1EWEA 5AB3A 1XIMA 1Z32X 1UR1A 3ABOA 3GDTA 4YMZA 1ALDA 3EOOA 1XGEA 2D3LA 1GZGA 1P7TB 4E8CA 2DJLA 3PWAA 3TC6A 4YN5A 4CCCA 3BLOA 2CLOA 2RFGA 2XGIA 3ZJ6A 4GX8A 4Q4KA 1BGGA 4FLOA 2E9BA 2GDQA 1RZMA 3AXHA 5F2GA 1K1DA 2C1GA 3ISIX 1M01A 4EWJA 4HB7A 5I6SA 3TW9A 1LTDA 2VX4A 2F6XA 4PEEA 2DSUA 3U0HA 4B5UA 4XUGA 3BPWA 2Z1BA 3ID7A 4ZFMA 1Z8AA 4OV9A 2YFNA 3ITYA 2W79A 3UP8A 3RO6A 4DYJA 3TNBA 3QC3A 5GJPA 1QRQA 1VPYA 1RJQA 5IBXC 4Y8FA 3W1NA 2P53A 2YXOA 1EDGA 1PDZA 3FYPA 1C8XA 1NWRA 2D1ZA 4MZYA 4HNCA 3BL3A 3TQKA 3TMLA 3TW7A 3P2VA 4DBSA 4BY3A 2I9EA 4MIMA 9XIAA 3VOFA 3COTA 3BW3A 2QCCA 2A6NA 3WQ8A 4PMZA 3NEVA 1WDRA 1LJYA 2FH8A 3A9BA 3GXIA 4G7EA 3LI1A 4Z1DA 3BMWA 5C70A 1W1VA 1SMAA 1FH7A 1Q7QA 3OGSA 4F2UA 1KLYA 4WJ8A 3V0SA 4S23A 1MQRA 5CGTA 2ZA3A 3SGGA 4KT2A 1VYRA 2R82A 5AHFA 4JKLA 3NSNA 3S1GA 3F03K 4PSPA 4JIIX 4O10A 3U48A 3T8LA 1EP1A 3WYZA 3GDBA 3L66A 1VRDA 5HNTA 1OCBA 4OT7A 2HSAA 1POJA 4DAIA 2DP3A 3ZR6A 2GOUA 3EKZA 4PB4A 3AZRA 3CAVA 4AHPA 1MFVA 1UIPA 4Q4OA 1PYFA 3O2LA 3CQJA 6ALDA 2POTA 2XTKA 4XB3A 1XLFA 4MKVA 3O6CA 3QYQA 1SO3A 4RX0A 3DHPA 2V3EA 4J3ZA 3PC0A 1JNDA 2A5HA 1Q8AA 1J0ZA 4I90A 5I07A 4NZ4A 1UIOA 3LMZA 3QTGA 6CGTA 1OINA 2J27A 3MT1A 3ONBA 2J8FA 3BG3A 3CHCA 4ZQRA 1CXIA 3LPGA 3FSTA 3MY9A 3UNDA 3VIKA 3CEUA 4ADSA 1EZ2A 3I6EA 1GOXA 3GHRA 2DVUA 3SCVA 4AIUA 4C5YA 2ICSA 3FN9A 1LWHA 4QHRA 1W5OA 3PUOA 4MSSA 4ZB0A 1PVNA 3PZTA 2WCAA 4A4AA 2DIEA 3CZEA 1QU4A 5I3HA 3SQSA 4FA3A 4KFPA 1O66A 4G1NA 3WLTA 1TPFA 4ROQA 2WNWA 2OMAA 4NF7A 3AU6A 3PTMA 8XIMA 2HCVA 4C7GA 4IJBA 3P93A 3WUEA 1IIGA 1A5MC 1X7FA 2F8QA 4LALA 4E6MA 2V5DA 1HKKA 1XDMA 3IK4A 4IX0A 4UXDA 3VA8A 4Z1YA 6TAAA 1THFD 4OECA 1VBHA 2ODOA 4F79A 1DIOA 4I9JA 1IIHA 4DZHA 4H6QA 2OZ0A 4EK7A 1XF0A 3AYTA 4TX8A 4NAFB 3BG5A 5AHEA 4YTTA 5DANA 1D3CA 1A4MA 4Y6GA 3CYVA 1V02A 1U30A 4BEQA 5HULA 2CCRA 3WK2A 3WNLA 1WXJA 3N6JA 1CWYA 3OPSA 3VD4A 2CLIA 4HZMA 3SQLA 3GKFA 3TQPA 1RH9A 1REQB 4Y7EA 2Y24A 2WMGA 1E0VA 2CLLA 2YZRA 2OTDA 1TWDA 5AC8A 3L68A 3WH9A 1LRQA 1VBJA 1LBFA 2V3DA 3RYSA 5MHBA 4H6EA 2OGYA 5U4NA 4HYRA 5CSRA 2GVYA 2VTFA 4AX6A 1WZAA 4LEQA 1UR8A 4M7TA 2PAJA 4XZBA 1Q6DA 3WLPA 3TNOA 3DERA 1OZQA 4JTLA 4DJDA 3AYSA 3KRBA 1TJRA 1E73M 3B0XA 5ABHA 1GQLA 1P0BA 4J28A 3AXXA 3WH8A 5D2VA 2CHOA 4O53A 2R14A 3BOLA 3GG7A 1PBGA 2DZTA 4A29A 3DEQA 1G4EA 4TOQA 3UR8A 1YMYA 2BP1A 1A5KC 2OVLA 2QCDB 3EX6A 1B3WA 2CIPA 1TPWA 1JPIA 1Q6EA 2G3IA 3IUIA 4ZOCA 4H8UA 1BG4A 5EPDA 3UT0A 5G4HC 4BF9A 2QPSA 1RCQA 2EKCA 4PMUA 4I7WA 4E4PA 3T0TA 2AQWA 3W73A 2D0FA 5SWUA 1JUKA 1NF7A 8XIAA 3CASA 3W02A 3NXLA 3LY0A 2XUCA 4ZZ9A 2V3FA 3WDHA 5REQB 3NJ3A 4GZEA 1OHLA 4H2HA 4UOQA 3OA3A 2YSWA 1FWGC 1XQLA 2KX9A 2QNEA 4HOWA 3KXQA 2ZXAA 4PL2A 4UTTC 5AVHA 2HS6A 4EIVA 2W3ZA 4GD0A 2FZNA 3T08A 4TTUA 1KM0A 3DYOA 1YRRA 3VCCA 5JBDA 2A85A 3M0HA 3NYZA 1PZ0A 3NZRA 3RCYA 1ADOA 4A8IA 4DI9A 2PP0A 2ANUA 1B31A 2DEPA 1ZJBA 3LBCA 1XYLA 3AHTA 3DU0A 1W0MA 4MWAE 4OZOA 2BG5A 4JFWA 2VC9A 2WVTA 3ZQ9A 1J10A 3UZJA 5G2IA 3ZSSA 3ARTA 4PMNA 1UYQA 2PLCA 6PTDA 2QUNA 4LSBA 3ZOAA 1EBHA 4PSRA 3FVDA 1DL3A 3VGDA 2OPJA 1LOSA 3WH6A 4DHGA 4RDWA 3V5FA 3WL0A 5CC3A 1GKRA 4Z08A 7CGTA 1KR0A 2VENA 2QVNA 8RUCA 4ADTA 3B4UA 3R0UA 4HN4A 4C6LA 3E2RA 3FHAA 1PIFA 2BWGA 5LNWA 2XVPA 3IAPA 1SJCA 1JUEA 3PJWA 2FFCA 3THDA 3T0CA 4C1LA 3T44A 3ZJ8A 1W9DM 3CTTA 1Y5WA 1RA0A 4DWSB 4NNCA 1UZ4A 2WHKA 1US0A 2WSYA 3T42A 3BLDA 3DENA 5E0CA 5AHNA 3B8TA 1W1ZA 3DHFA 3DGBA 4FHAA 4K38A 3MVTA 5MF5A 1UQYA 3ARQA 5CSYA 1OGGA 3VD3A 2JKAA 4AIEA 3D47A 2A3EA 5TD4A 2AKMA 1HP5A 4UR9A 1PO9A 3MB9A 3OVRA 1UASA 1PKYA 2QPXA 1OVDA 3RJXA 4DNMA 3VNMA 3M5ZA 1BHGA 5F2IA 4WQ6A 3CU2A 3RF9A 4Q4PA 3BLLA 3C61A 2VGIA 4LVDA 4XIAA 2VI0A 2INFA 5BYWA 4IMFA 2WJDA 3W2LA 3M44A 4JQ1A 1PE1A 2OOGA 4AZCA 3EOUA 3L23A 1QNRA 3N2BA 3LDVA 4S2CA 1H2JA 1XIGA 1QHPA 4HGXA 3WMBA 1GYMA 3EDKA 1EL3A 2JEPA 2ISFA 2VX7A 2O9OA 3QYSA 3BLPX 3GBDA 4LB3A 1EIBA 2QV4A 2CERA 3RLGA 1GVEA 3KAOA 3AHVA 4G5DA 3BG9A 1GQJA 2H6RA 3BC9A 4XX6A 1P1MA 4GJ1A 3NFUA 1DKWA 3WBEA 3GLCA 1KM2A 3POCA 3TZFA 3PZOA 3SGZA 1S1RA 4UFKA 1LG2A 1VGAA 1VRXA 2IKJA 1VJSA 3NZ1A 1F3WA 4AX7A 1K9EA 3HGJA 4UFHA 1HL9A 4W8LA 3N3MA 3IS4A 4AXKA 3HO8A 2WSKA 4IPLA 4NI3A 1VFUA 2HEJA 4XQ6A 2NWSA 3EXTA 3CZLA 3R94A 5M2FX 4F0RA 4IL2A 3W71A 3CBWA 2OR2A 3NWRA 3VO0A 1MEIA 1DJHA 1JAEA 2CHRA 2X0HA 5KETA 3G0UA 3R7MA 3L0NA 1EX5A 1FFRA 1C8QA 1XLBA 2BOFX 1WZKA 5IOBA 3I6RA 3R43A 2CLMA 4IG2B 4XZNX 4FIRA 1LL4A 1SFJA 1SZNA 3T05A 5FJOA 2ISSA 3HQPA 2ZCGA 1Z89A 4QEHA 2TAAA 2G95A 3MP3A 2JF7A 4AZIA 3TN4A 1CXEA 3H2MA 3QN3A 2FIQA 4B5TA 4H01A 1TQXA 2TODA 4K8EA 4N7QA 3GXPA 1HJVA 1XH1A 2ZE3A 4ATLA 3LXAA 1GWJA 1UWSA 3ECQA 4JNYA 4CVUA 1EXBA 3AZTA 1Q63A 1UH3A 4IQEA 3N2TA 1GVYA 3DC8A 1DXIA 1MUCA 2FGBA 3UU0A 3N3TA 2E8ZA 3PHAA 2QCFA 4O14A 2PF8A 1MEHA 2NLYA 3N4AA 4HU0A 3TK7A 4UUIA 3WLMA 4H6RA 2OZ3A 3S9ZA 1D8WA 1UH2A 1IGWA 3NDOA 4PEKA 3G3MA 3MWCA 1IEVA 4JTQA 4BHYA 1ONWA 1BKHA 1XKJA 3L67A 1P43A 4LXFA 3B9OA 1BF6A 2NV9A 4GI9A 3L4ZA 3DFYA 4IPIA 3E9AA 2B7PA 4OOUA 5I7GA 3PANA 1FP9A 2F9RA 3HQ1A 1LRTA 5DLCA 3EOLA 1JDAA 4L9ZA 4CEXC 2ZWZA 2FVLA 5C2XA 3KOXA 5GPRA 4ROPA 4NZ5A 5K7JA 2PBGA 1OFAA 3SBFA 4HD5A 3SCUA 3H4XA 2XG9A 3TLQA 1KTCA 4KWOA 1TPEA 3F5LA 4REQB 4HSNA 1UWIA 1HX0A 4N4PA 4LW7A 1LP6A 1QPOA 2VFEA 3NAVA 4S3KA 3OLDA 3STGA 3RM9A 3W1UA 2E5DA 4B5VA 3Q58A 1UWAA 1VHCA 4L4MA 1EC7A 3FVMA 4DY1A 3QY7A 1D3HA 4KERA 2YCKX 3VIPA 4AD3A 1VP5A 2FFIA 1U1JA 4LY8A 3M16A 1TCMA 1MQPA 1VLWA 1YNPA 1XCFA 3R89A 1NSJA 4AWTA 3KVLA 3R0DA 4LAMA 3ALGA 2OLHA 4O0KA 2YCJA 4GIRA 2G50A 1HL8A 1TPVA 1UROA 3WH5A 5I3KA 1RALA 1VZWA 2X1IA 4EWND 3A6OA 2PSNA 2GJXB 4W8BA 4UR8A 4AZ6A 3KUMA 1AQFA 2HPIA 1X7IA 1Q6OA 5ECVA 5I23A 5EYWA 4GABA 4QIUA 3N73A 1Q5MA 1KFWA 2C16A 2V68A 4N0RA 3PBWA 4PMOA 1DWGM 1PS9A 4S3FA 1ITXA 3C56A 1RR2A 1NY1A 3QQ1A 3FA4A 3EPNA 2JEQA 5BOFA 2VQTA 4HPHA 3G1HA 3LXCA 2VFHA 4IIHA 4OBTA 4QDWA 3E12A 5EMYA 2F61A 4E3VA 2FMOA 4FNPA 2W61A 1YIXA 3PPCA 4CD7A 1ECQA 3O63A 4NRRA 1EGVA 2GVLA 5EL1A 1W32A 4FR1A 1ZB5A 4A3UA 3TCSA 5L6UA 1MSSA 2PEVA 2DVTA 5CC5A 3BSHA 4MWAA 3E1F1 2ZVIA 4Z2HA 4KWWA 1W5QA 4I6VA 3LHTA 2E6YA 2PGFA 3VNZA 5FF3A 3NTYA 2QIIA 3W07A 2VL4A 4PB5A 3JZUA 2X42A 4KW2A 1M7PA 3KBVA 3SSJA 3T6CA 4Z1AA 4YWSA 4TU1A 3VZYA 3A4XA 4GFIA 1CGYA 5DRIA 4M5PA 4GC3A 2YB4A 2ZZ1A 4GCXA 3AMLA 2QDGA 4UMBA 4WJEA 1DYSA 3UPBA 4GWEA 2YBUA 4J3UA 1IF2A 1F9CA 1QAPA 1ZCCA 3CYJA 3GH7A 2F38A 5DMNA 2YOCA 2Z1KA 3QKZA 4HZ6A 3QQ0A 1O1ZA 4QLKA 4DJFD 3SRHA 5LIWX 1VCGA 4K1GA 2C13A 1JRCA 3UVIA 3UXDA 3OLEA 3IPWA 2EO7A 3VINA 4L1GA 5D2YA 3TIMA 4PTNA 1F3EA 4AF0A 5L9FA 2G3JA 1OCQA 3HFTA 4Q7NA 1ENUA 3C52A 3IAQA 3W7NA 3ZWSA 4D72A 1ONEA 3BAWA 1SSDA 3F5KA 3UXKA 4Q6XA 2QAFA 2QCGA 4H9MA 1Q6QA 3RM8A 3UG5A 3SRFA 4US5D 5D32A 4MFEA 4S3JA 4IGHA 1UKTA 2YYTA 3MKCA 1M65A 4UTKA 3BLEA 3GVWA 2F2KA 4BI5A 4CQDA 1E71M 3NVTA 4YXGA 3OODA 2DORA 4RPPA 4N02A 1F5ZA 1EFZA 2GQ9A 4DEFA 3VC6A 4CU8A 5IRPA 2JKEA 1G6CA 3UXLA 4LVBA 2GYIA 4H7ZA 2ACRA 2FGLA 4DQWA 3DXIA 5BCAA 3KP0A 3N25A 2DZWA 2I57A 2YLAA 3HG2A 1T5AA 4M80A 4P8VA 4H9UA 3ZS4A 4LBRA 3TYCA 2DT3A 1QO2A 3S46A 4D8ZA 2ZDRA 1XRVA 4XD6A 1JZ8A 3LB0A 4FNUA 3PNUA 2R1KA 1YTKA 2DVXA 4IJCA 4JQ3A 4GO8A 4IFOA 4ZODA 1UJQA 2POZA 1J5SA 2A3HA 2VXNA 4RNFA 5LXEA 3LQLA 2UY2A 3NPVA 5CJMA 3NM1A 1WYIA 1H50A 3MMWA 3CWOX 3MV11 3PB0A 4RPQA 1A5NC 3WEMA 2NQ9A 1GQKA 3QMSA 5BXPA 2ZX5A 3IRDA 1M7JA 2OSYA 2YXGA 3CQHA 1XP3A 3O9NA 2ZUWA 3VAVA 1XYFA 3HGRA 1WAUA 2XIJA 4KWUA 1W2PA 3BOXA 2O0TA 2ZDSA 4DXVA 1K7FA 4U10A 2ZUTA 1X6UA 2O9TA 3EWCA 1W1B1 3GYEA 1ITUA 5LIYX 2QGYA 4PH6A 3W7EA 4KGJA 1EOMA 3CB3A 1OG6A 2BFGA 1X6NA 5CSUA 2O9PA 5AFDA 1JIBA 4UOJA 3U8GA 3EYPA 3FHQA 3HQNA 5CG0A 2WB5A 3W1MA 5D02A 1W9UA 2X2GA 3PPFA 1G7VA 4JTJA 1LDCA 4L65A 1XH0A 2VHLA 4RL3A 5A6MA 1H7PA 3N34A 3OHMB 1A53A 1ZZMA 4Q4MA 4ZOEA 3AIVA 3TONA 3WQVA 1CZ1A 2AMXA 5K4XA 1OIMA 2VC5A 3MUZ1 3IVTA 4AYSA 1QASA 1J2BA 4Z2IA 3URBA 1C29A 2I16A 3H12A 2EPNA 3TX9A 5JIPA 5A5WA 3GW0A 4F0HA 5I5RA 2IPGA 4M6QA 1Y0EA 3W7GA 4ZO6A 3POHA 1HNYA 1W3LA 1XGZA 4LCSA 2EG7A 2J79A 3SJ3A 3V4BA 3MCOA 3CQIA 3ZT6A 3QFEA 1GNXA 4C6KA 1W5PA 1NWTA 1NDWA 1R3RA 5BU9A 4PRRA 1EXPA 5H2ZA 4C6MA 3E5BA 4R85A 5ABTA 4JIPA 3A12A 4O19A 2VM8A 2PTDA 3O15A 2P0OA 4DF0A 1UQZA 5HMSA 5EA9A 3GIQA 2V8ZA 3I7RA 4B2DA 3Q45A 1PCWA 1JCXA 3LLDA 4W5ZA 3UYIA 2VR2A 4LV9A 1UZHA 3ANUA 3WBYA 1GONA 2QW5A 3WD1A 1TV3A 4LANA 1T8XA 3W1LA 4AUBA 1NFGA 3N9KA 4F3HA 1PKNA 2VKZG 4CNTA 2FJUB 3L4UA 3APYA 3M4HA 3OIXA 4GUIA 5IXEA 4NZFA 1TIWA 1L6FA 4RW3A 1DP0A 3TH6A 1FCBA 2Q8XA 1XIFA 1GVRA 4CVWA 3HPAA 2XIMA 2G8ZA 1Q2SA 1GVQA 3WBAA 2QHAA 3SB0A 4JHZA 3MSRA 4OQVA 3IUHA 3SRKA 3UYCA 4RW5A 2WC3A 4U3CA 2QCMA 1IEQA 3MHFA 2XGBA 3O16A 4A22A 2IKHA 4AMAA 4XD3A 1W1PA 1I8JA 4LF1A 1PYMA 4JL1A 4ERGA 9RUBA 3V0TA 2VX6A 1IWPA 1MDRA 1AMKA 4MNMA 1OC6A 2GJRA 3N1AA 1QOQA 2Z2AA 1NH6A 2VZSA 1HT6A 3MP5A 1I45A 1BSLA 4QS6A 2H8XA 2WK2A 3WNMA 4GVGA 1JR1A 1S2WA 1Q6RA 2Z27A 3GHSA 4OU1A 1XSIA 1H63A 1QNQA 4QJ1A 3P0WA 4RE3A 1JGIA 3GY1A 3RUBL 1PX4A 2ZUVA 4S3CA 3T78A 1XV8A 3KL0A 4RZ5A 3CV1A 2CKRA 3KVKA 1OGBA 1G4SA 4GIAA 1IEXA 3C2FA 3PAOA 5I3DA 3GH5A 1XIEA 2FB2A 3CH9A 3BV7A 3E3HA 5CZTA 2IKIA 4M8UA 4ZO7A 1NWUA 3GR7A 3RR4A 4CNPA 4H9TA 2HMCA 1UOKA 2ZUSA 2YL8A 4W87A 1JCLA 2YA0A 4D1IA 4ZXOA 4DPPA 3F2BA 4K68A 2Z26A 4M3PA 2ZXDA 2VOMA 3UERA 3S2LA 3RITA 1AG1O 5EU9A 2ZXQA 3XINA 2XIQA 2DH2A 2GGEA 1BYAA 2C6QA 2R1MA 4DO7A 4IMDA 5CPTA 3NA8A 5DFAA 1MDLA 3PJTA 4MB3A 2JK2A 3PVFA 4NRSA 5DT5A 2HXUA 3T7VA 3TC7A 4AIBA 3MBFA 4KEMA 4NZ1A 4OFCA 2D24A 3MYPA 3G1SA 4FNRA 1KR1A 3SR7A 2BY1A 1OX4A 4D8AA 3N6QA 1SYTA 4AY1A 1BF2A 3HFYA 2JIEA 4PMDA 5HMFA 4B92A 4DN1A 5HAOA 2F6UA 3QSRA 1OWQA 4JR5A 3H4GA 3KLLA 2PFHA 1QPRA 2FTYA 3O3RA 3BJSA 1QT1A 2YFOA 1TPC1 4Q8QA 4AY8A 4MB4A 5EBUA 3WJZA 5E93A 1Q85A 3MA8A 3UA4A 2J66A 1Z9AA 1JZ3A 4GFSA 5CAHA 2VUYA 1EJXC 4KFNA 5BOEA 1UD8A 2HWGA 1N8IA 3L5MA 3ZR4A 2BLEA 1M41A 4G7EB 5FIPA 2PDJA 1WNOA 1DQXA 3ABZA 2UBPC 4LYKA 3CPUA 1EPXA 4L1WA 2VRJA 3BAYA 2UY4A 3RCNA 3SUWA 4JICA 5A69A 2E9MA 2PDGA 3QZEA 3GIYA 4H6KA 2XN2A 4GNKB 3FJLA 3D5HA 1IT8A 4GUHA 3HIJA 2AKZA 4C60A 3O8AA 3SFWA 4LUJA 3QY6A 3VIGA 1SU5A 5I00A 2Y89A 1K4HA 4AD5A 2BVTA 2Y8UA 4LAOA 3HPZA 5M3WA 1WUEA 4R33A 2IPFA 3T81A 3CUGA 4L64A 1QPNA 3SCTA 3STFA 1LWJA 3AS2A 4GO9A 4GJIA 4GXPA 3PZ9A 5DT7A 4DYKA 1MYRA 5HR7A 1MNSA 1R38A 1HJUA 2FHCA 2WM0A 1D3GA 1LWIA 2EBNA 3LHYA 3M0ZA 2ASHA 1Q7ZA 1S46A 3U3HA 1A5SA 4X3ZA 3P67A 4ZQMA 3VCNA 2V69A 1E15A 2TRSA 2BBFA 5DMLA 3IJLA 4AWEA 1C7SA 2WSRA 3DFNA 1NP0A 1H1ZA 4XIMA 4UQBA 3AUOA 3KEHA 3WN6A 1J01A 4YS1A 2ZADA 1VIWA 3FAXA 2R91A 2CEQA 3GVGA 1J11A 4IPNB 3M64A 1PZ3A 1EJVC 1RCOB 3W6LA 2OG9A 6ENLA 3HMJG 3R10A 4C1NA 3NGJA 2EJAA 1H7RA 5JUVA 2CZFA 3P0XA 3GNPA 4FOUA 5JVLA 1WX0A 3VM5A 4R5EA 1YTEA 1XSKA 2EQDA 4LYPA 3B8VA 2ZZ2A 4XV0A 3HBLA 4WD0A 3SJNA 4AVFA 3L12A 4DXKA 4UCGA 1DV7A 1QFEA 3DFHA 3GC4A 1TIMA 1BRLB 3R4IA 1XH2A 4LGXA 3NDZA 1EDQA 4JN6A 2Y1HA 4AZBA 1V6XA 3LRMA 1EP3A 1VFTA 1XG3A 3LCGA 4NJIA 2PTXA 3U9IA 3W1QA 1JG9A 4H8NA 3OQ8A 4PODA 2GUBA 3AFBA 1BSIA 4DYEA 4FX8A 3AJXA 2WBKA 3QM3A 4HT3A 1TPDA 1KQYA 3T8QA 1ZJIA 4ZFCA 3WNPA 2EPOA 3TXZA 2J13A 1F4HA 4XAFA 2NV1A 5IM51 2AQOA 2E6FA 3XISA 1UBSA 4GUFA 2J7DA 1OCNA 3VILA 4F0LA 3CL7A 8A3HA 4CGTA 4R9XA 3VIFA 1IZJA 4RK8A 1QBAA 1BYBA 3V3WA 2VP8A 2DW7A 3TN6A 4WLCA 1XLIA 1K8YA 4M1BA 3KBMA 3ANYA 3IIOA 3TSDA 5A94A 5TQLA 3PB2A 1VENA 2XZ9A 1X97A 1W3TA 1NDZA 3EB2A 2V67A 3OZYA 2CFFA 3OA5A 1UZDA 3S9IA 3TSMA 5RUBA 4WDTA 3VXGA 2BMBA 1HKMA 3CZKA 3VUSA 2C91A 2KAUC 1YHTA 1EUNA 3G1RA 1RA5A 1V77A 1FWBC 2ZQ0A 3NO1A 1QI5A 1J18A 2CYGA 3G1VA 4D6DA 1PPIA 4PTVA 2Q6ZA 3W88A 3I10A 2J6VA 2AAAA 4KEZA 2OCZA 4AG0A 2VVSA 5D37A 2WQPA 3IVUA 1SR9A 1KFLA 3GTXA 4IL0A 2DZSA 1Q4NX 1MXGA 1MNZA 4GC4A 4HMDA 1JCMP 5LHFA 2BVDA 3ZM8A 1TRIA 4JPGA 2ZRZA 2IQ0A 4MYXA 4U2ZA 1BAGA 4AEOA 4B5XA 2XH7A 1HFBA 4J27A 3BWWA 1DTNA 5U7SA 2QCHA 1X98A 4O4VA 3THAA 4JHMA 1OADA 3O6YX 2NZLA 2J7EA 3QKEA 2FQIA 2ZRYA 5CEWA 1HZYA 2IMRA 2EPKX 1ADDA 4MFDA 4XVDA 2HNEA 3UESA 1FOBA 3UCDA 2PZ0A 3VABA 1JCJA 2PDFA 3E0VA 5BXRA 4PBEA 3H22A 2W91A 5A8OA 4US5A 5FJRA 4IJRA 1BPLB 4S3AA 3DYMA 2PWVA 2Z7KA 1IWAA 1AZ1A 2ADAA 1A5UA 5HNUA 3A47A 3NL2A 1K4GA 1ODZA 4Q3MA 3W01A 2JF6A 1FFQA 5BZAA 3WJSA 3WD0A 4W84A 5KZDA 1MVYA 4XK2A 4UFJA 3NZPA 3KZPA 3CEPA 4DBUA 2VELA 4GVHA 3MPGA 4C90A 5JH2A 5FJPA 2YXXA 5D9NA 4HSOA 1Z41A 1QW8A 2FVMA 5C7VA 1R86A 1W91A 3PTDA 4GGBA 4FNSA 1E55A 1ZALA 4P7OA 1SW0A 2G4FA 3MMUA 3F2CA 1P0KA 1XPGA 4J2MA 4X0NA 5FF0A 2CLFA 4C6CA 3CGTA 3G1DA 2ISDA 1PV8A 4RNHA 1EZWA 1JDEA 5EFFA 3PAJA 3ITCA 3Q67A 2EPLX 5JU6A 4YIWA 2JGYA 4ZBCA 3VOGA 1T7LA 2X7WA 2ZRXA 3AXKA 3BJFA 2GPTA 2VC7A 4PCSA 2FDMA 5HQLA 1VBGA 2ACQA 3V36A 4Q8WA 1XR2A 1UG6A 2QKFA 5FL0A 2WKJA 3EBVA 1WBHA 4QBXA 4YYCA 3UJFA 1DWHM 4I9AA 5D2TA 4WSHA 2VWTA 5G5IA 3ZT5A 3EWYA 5HNRA 1Z3NA 3IVSA 4N9DA 3WIJA 1XIDA 1CXFA 1RD6A 3CUZA 4LC8A 2NSOA 3C0LA 2VGFA 4LS2A 1AH0A 4GK8A 4PTWA 1HJXA 1K7XA 3IGSA 1JFXA 4DRSA 1MMFA 2ZVRA 3T2OA 3QV6A 4PUKA 1I0DA 2RDWA 1JYWA 4Z42C 3UPMA 2YBTA 2YW3A 1NVMA 2RJGA 2YLLA 2WMHA 2Z4GA 3BCDA 5G1YA 4GQQA 2HE8A 3ZLHA 1UD6A 3W1RA 2EF9A 3B3DA 3LN3A 5HNNA 3FXYA 3V5CA 1Q3NA 3S1UA 4D71A 1W1YA 4UTWC 4L5ZA 2Q8LA 3VGGA 2Y2WA 3D46A 2XWDA 3UFYA 3WQOA 4BI6A 1FWTA 5JXQA 3EWWA 4WXYA 3AXIA 2E6DA 1F8IA 3SM0A 3GD6A 3PP7A 4GQRA 4RXGA 1Y8BA 2WNZA 3ARPA 4AZCB 4HTYA 1DQWA 3C5QA 5I06A 5E9AA 4O4WA 2E3ZA 2QCNA 3A3HA 5CPMA 4HJFA 5D38A 5LA0A 3UY7A 3H26A 2VQUA 4J40A 3WLSA 1HGYA 4DBEA 4BK9A 2W4XA 3FKRA 4ZR8A 3V18A 4L4OA 4I7VA 1R5YA 3PG9A 1J0IA 1G01A 1TPH1 2QPUA 1E4NA 4CLMA 4RR4A 4E2OA 3TOPA 3IARA 2WVSA 4DWDA 3SN0A 4QSHA 3AJ7A 3LHVA 5ECUA 2AOSA 3BLIA 4PYSA 3ZLGA 2QJMA 2GGIA 3GNDA 4HPNA 3VMNA 4FSAA 4FB7A 3H8AA 2Y62A 2O92A 4DUVA 3P8IA 4QJ5B 2ZZ6A 4E38A 3I7QA 1PEZA 1XUZA 3UG8A 2VD8A 3BK0A 2HVNA 1SO4A 1S2AA 2D2OA 3S5ZA 3TTQA 2WSPA 3PFMA 1JXJA 1TRDA 2CITA 2WHMA 3VVGA 5A2AA 4B3ZA 3TMQA 3TA6A 2PDHA 5AC4A 4ZTYA 3F5JA 3BAJA 4P7NA 3HM7A 2DGAA 3GM8A 4QCEA 3RLVA 1S5NA 1FWAC 1ADSA 4TX6A 1P48A 4S38A 5KZ6A 1Z48A 5CPOA 5FOOA 1US3A 3KBWA 4S3EA 4UTJA 2XWEA 2F6KA 3GWQA 3B0YA 2UY5A 3ONCA 4H19A 3AUJA 4I5RA 1TTQA 4FO4A 3RO8A 4IIFA 5HR6A 2B7OA 2C18A 1OYAA 4D6HA 4NSBA 1OGSA 4JIRA 3R0KA 4A3YA 1H1YA 5IDZA 2WKGA 1HJWA 3B06A 4M29A 1E3XA 5CGMA 3M9YA 1IV8A 1XLEA 4M1RA 4D9PA 1IQ8A 2PTZA 3FGCA 2GGJA 5EMMA 3UWVA 1U33A 1B57A 1LL7A 3TSBA 3TEVA 4JIHA 3S9YA 1UUMA 3K46A 2VFDA 1XIJA 1OFQA 4BS0A 4TXEA 3TFXA 2QYGA 1H5YA 1OCJA 4XZLX 2GK1A 1DE5A 3TYEA 1YTDA 1MW3A 1E0UA 4LYQA 2DZXA 3B9DA 2CLPA 3UXAA 2VO5A 1RLCL 4KS0A 3VDCA 2HJPA 3AIUA 3BLFA 5FEPA 4QNEA 4QQ3A 3RHGA 1XLMA 4PUNA 4P8WA 4O16A 5I24A 3M0IA 3AMDA 4WOQA 1FWJC 3H55A 3MCNA 1A50A 1W1TA 4ONVA 1RQEA 4CU7A 3EB4A 4EPDC 3WLJA 5C7HA 3CPRA 4L4LA 4O11A 4ML4A 3UWEA 3W2JA 4PR4A 5G1TA 3MC5A 4F0MA 5LHEA 1NU5A 1R0MA 4D6EA 3QHMA 1XQKA 3M7WA 3NQGA 4QLJA 3WQEA 4GI6A 1K8XA 3GG8A 2XYLA 1JZ5A 5HJYA 1SSGA 2VVNA 1IXOA 2CWNA 3SAZA 3BGAA 3E0FA 1V3JA 2A3CA 1FDZA 4X9YA 1W9VA 1H7WA 4IP7A 4XTIA 4ZA0A 3DECA 1AODA 3NZQA 4GH1A 3WK3A 4WJXA 3DDMA 1XGDA 2PCQA 3TOYA 2QMKA 3H7VA 4MUPA 3TLLA 1W8SA 3NDYA 5A6TC 1DJGA 4WHBA 3TP4A 3KCLA 4MJ2A 4V1XA 2Y0FA 4QR6A 3VOHA 1EP2A 3LD5A 2QUUA 5C2GA 4IGSA 3TC3A 4D6CA 4XZIA 1H62A 4WUIA 2VURA 5CJ5A 3TQ0A 3VD9A 4K8GA 2X7VA 3MHUA 2W62A 3QGKC 3SW6A 4XBKA 3AWNA 2DIJA 3SN4A 1I1XA 3O7UA 3HF3A 2VWSA 1LORA 3F4DA 3QF0A 3UVAA 2I56A 3LPPA 1K7EA 3H4WA 2TSYA 1LLZA 2ZRUA 4NXSA 1UW9A 1U5HA 1JCNA 1JPMA 1TJ2A 5B7YA 4WKAA 3KDNA 3GH4A 1EJ7L 5GNZA 2FZBA 5C71A 2WZIA 2Q71A 1KFEA 4MPQA 1EJWC 2XH0A 3M6YA 2VZTA 2OZTA 3G0XA 4C6OA 3GQYA 3C0JA 1QW7A 1KBBA 2PDWA 4ZB5A 2Y7FA 5CJNA 4XBSA 2J77A 3DYPA 1JD9A 1TFVA 1CGUA 1GEHA 4OOZA 4FF7A 1AJ0A 3QV9A 4WEVX 4FP1A 4NQ1A 4S39A 1HKIA 2WNQA 3EWBX 1JPHA 3N15A 2ACSA 3DBNA 1K70A 1HUVA 3TE9A 5TAOA 3CUXA 4L1XA 3WMSA 3DG3A 4L4PA 3C8NA 3GZAA 1QHOA 3D6NA 3G6LA 4MPKA 2NVCA 4QJ3B 4PTDA 3PZUA 2GQ8A 1IEWA 5CQ1A 1DJIA 3REQA 5ABEA 3W28A 2HTMA 2I5GA 2PDLA 3AMGA 3MJYA 3T55A 3PBUA 4BWLC 3ZYZA 5T91A 4H83A 4WRHA 3SADA 3KW3A 2X2YA 3OO2A 3LCLA 4U28A 3W27A 3PUGA 4QCFA 1UD4A 3WSUA 1NOFA 3MSYA 4MWAB 2BDQA 1E56A 5FAGA 3UCQA 3MP4A 3RXZA 3MVIA 1KWKA 4B5NA 3BZJA 4WDWA 1C90A 1EX1A 3EEGA 2J78A 2J25A 5DXXA 1UPMB 1MWOA 3APGA 3IV3A 4CCEA 1JDFA 3E0IA 2JALA 3VGHA 1K77A 1MEWA 4O1DA 5AYZA 5K9CA 1Z44A 3WNOA 2OWCA 4R3UA 2C19A 3CO8A 5K9DA 1T8QA 1NFBA 3ES7A 1V02E 1W17A 1EHNA 4EXQA 3GX9A 1JNEA 2XN1A 4XTDA 3PUDA 3A4JA 1KM4A 4AZ7A 3AS3A 5DCDA 3SSZA 4IX2A 4R9OA 2OODA 4HU4A 2QCEA 1SZEA 5LGXA 4F0SA 5FL1A 3MUY1 5DMMA 1W3JA 4WXZA 2O55A 3OJGA 2W92A 4ZENA 5J8LA 1B3YA 2G4JA 5BXTA 2O9RA 5KINA 4EPEC 3URQA 3LERA 4IGNA 5FEXA 3KX6A 3APTA 5DO8A 5DX7A 4PRWA 1E1FA 3EOEA 3ZSTA 3NQFA 3K4WA 3QC0A 2PLMA 2JGQA 2V38A 2PCEA 4QG8A 4RXFA 2VGBA 3GAKA 4O13A 5F4XA 3Q4DA 2BHUA 4PTXA 4QISA 1RK5A 3OP2A 3WJWA 1FWRA 3OBEA 1U83A 1OSEA 2DT2A 3SCOA 2WW5A 1T96A 4PL1A 5D9OA 3RJYA 3IWPA 2YDAA 4V27A 2HVMA 4IICA 4XG1A 2BZNA 4LOCA 3GTNA 3EEZA 4HMEA 2ATMA 3CMJA 3W87A 1EJRC 4EAYA 4RDVA 4AZ5A 1S3TC 4LT9A 1NTHA 5A6BD 3N11A 3RLUA 4JL2A 1TX2A 4XISA 4HZ7A 4UTWA 3QSTA 4MNJA 4IXHA 1PTDA 4O0ZA 2DZPA 2EG6A 1ZNNA 3ITXA 4XO6A 1ZBCA 1W3KA 4DNHA 3B97A 2WJFA 1JULA 1E6SM 1XLHA 4IQDA 4WKHA 1IR2A 3P5YA 3VFCA 2DT1A 4WK9A 1H7XA 2NSXA 3HTWA 2YCIX 4H9YA 2HVOA 9CGTA 3QV8A 4MOZA 1R3WA 4YHGA 4I9MA 1G4TA 3O07A 4FLSA 1XCWA 1WO2A 3W00A 3QMTA 1AW5A 1V0KA 1MUMA 4XKYA 2PUZA 4UQEA 5GJMA 4BA0A 2XSXA 4HTBA 4PGLA 3QRHA 2Y8VA 1H41A 2Q3OA 4O1CA 1HTIA 2ZX8A 3FJ4A 4IP4A 1KBIA 3N4FA 3CZGA 1YADA 1I9CB 2P3ZA 1EH9A 2PDPA 4NZ3A 4O1EA 1HJQA 1GVIA 2OB3A 2A4AA 2RGMA 3NQBA 2NWRA 1W56A 4DJED 4CQBA 4HPXA 4P7QA 1W3NA 1R9YA 1U1HA 1T40A 2FTWA 1FX6A 5CLTA 1S5WA 4KWSA 1BVZA 3W7DA 5A1AA 5C2CA 4OVXA 1S2CA 3R58A 3LCFA 3LEPA 2WANA 1OZMA 4C6DA 4YHEA 1O60A 2VFIA 3G0SA 4PC8A 4GXWA 2NQJA 4A2RA 4BEUA 4H8VA 1J4EA 2J7GA 4JTDA 3FA5A 2IPWA 4J3TA 2NQZA 1V0MA 3FIGA 3CH0A 3EWZA 3FS2A 3FDKA 3OYZA 2G41A 2ACUA 4A6GA 1DIEA 2FYMA 3DX5A 4X2PA 1AQMA 1LLWA 1TTIA 4AISA 2ZC1A 4NI8A 3ME3A 4QS5A 1QI4A 3E2VA 3EOSA 1H61A 1EA9C 4GY7A 3AICA 1OFRA 4Z2KA 2NX3A 2PA6A 4CN4A 2P76A 2WSQA 2QCDA 4IH3A 1UMYA 4L6DA 4ZSUA 5AYBA 2ON3A 3RK8A 2X30A 2CZDA 3BAXA 1OC5A 3KTCA 1ISXA 1NDVA 3TYUA 3MZNA 5XIAA 3M5VA 3ATZA 3N04A 2L5HA 3CT2A 3CC1A 4Q4RA 4NVTA 3W22A 4JFSA 1MRQA 5T9CE 3IJIA 1YW1A 4XSLA 3VI2A 3BGGA 4GVFA 1V4YA 3LLXA 3ITLA 2HBVA 1YE6A 4AW7A 3K4AA 2NQ5A 1ISWA 2V2DA 5DXYA 1MW0A 1E70M 2B7QA 1MXSA 4DO4A 2R1PA 3WMCA 4C91A 4FPSA 4EX4A 4P8XA 1RP9A 1XLCA 1RK6A 1RSCA 1ZUAX 3VNDA 1I2PA 3JU2A 2BHYA 3EMQA 3SCPA 3LLFA 3HURA 4FAMA 2UV8G 4XO7A 1TPB1 4C65A 4B16A 4DBDA 3MI2A 1TE1A 1N7KA 1YPFA 4K37A 1G94A 2ZA2A 5D9PA 3UJSA 2XM1A 1AH4A 1RVKA 4JX4A 1P0NA 2V5JA 1JXKA 3DH7A 1G0CA 4WVXA 3TXVA 4HBKA 3J7HA 4L6OA 4HU3A 4GQGA 1X39A 1XFCA 1CLKA 2P3EA 1U1UA 6A3HA 5LIXX 1XYAA 1C92A 3H2AA 1JFHA 2V5LA 1GOMA 1EYWA 2A7PA 3W84A 4YVXA 2QGHA 3ARRA 3UNTA 3UPWA 3A4WA 3ZR5A 1R85A 4WDXA 1BXNA 3N9SA 3F4CA 4H1ZA 3W76A 4GIEA 2PLKA 4IFKA 3KZSA 2IPJA 3UA3A 4FALA 4PMVA 1WAWA 1JD7A 5AHMA 3PZMA 3ERPA 1B0IA 4AHOA 1MRAA 3TTEA 4K39A 2B31A 3GUGA 4IUOA 4PFMA 5MKGA 1S5MA 4RNIA 1GVOA 1R3TA 5LSMA 1KFJA 3BUVA 1CEOA 5FI8A 1W2VA 3RX4A 2DQXA 3GDMA 4JQ4A 1VCVA 1NELA 3LNMA 5C54A 1V93A 2QMJA 3TTYA 4YTRA 5D9MA 4DJEC 1CXLA 3Q37A 3TTOA 2HBXA 5DRCA 4DELA 4HIBA 4WX2A 5A3HA 3VX1A 3FY1A 4HNNA 3DHUA 3EMCA 2FB3A 4LVGA 3C6CA 5AHLA 2OU4A 3Q94A 1G67A 2P8CA 4Z2LA 5LNVA 2ZC8A 3B04A 1K8CA 1NARA 4P61A 1CXHA 3UWUA 1E5NA 3PZQA 3UGVA 1KKRA 2VCAA 2E25A 2X1SA 4LWWA 3ITVA 3MUXA 5DF0A 2JBMA 1OFDA 1J2WA 4EOUA 5CKSA 3BVJA 3S8HA 3QPEA 1L9WA 3W7LA 4JQ2A 4M6VA 5BRQA 1PZ1A 1DBTA 1C9WA 1KD0A 2VR5A 4QAIA 3LGDA 2QF8A 1CNVA 1V6VA 1FWIC 2PE4A 3F4VA 3OLIA 4UTLA 3TJLA 4AFYA 2GQAA 4MF4A 1M04A 4NNAA 3TUUA 1S5TA 4EVZA 1K6WA 1WDWA 1TR1A 4YTQA 1I1WA 3W1TA 1ME9A 3QH2A 3OVGA 3U2OA 4ATDA 3A23A 1UKOA 3TYBA 3SURA 1YNQA 3BW4A 1FVPA 4LS1A 4JTUA 1G5AA 1JCTA 1ZCOA 3F1QA 3U2CA 4E3TA 2HK0A 1KQZA 1V0LA 1EF2A 3OBKA 1K9FA 3R2GA 1FH9A 3K30A 5BOOA 4DUWA 2V5CA 3KOZA 2QQ6A 1KRMA 3NQAA 4PUWA 2ISWA 1OX6A 5J5RA 2FZ9A 3QHNA 3T9PA 1GYNA 1AJ2A 1WKYA 3W3OA 4D6JA 2Z00A 4LUYA 1JEZA 3B9EA 3EWUA 4ZXLA 4CQ8A 2INZA 3GK0A 1TTJA 4OWGA 4UB9A 3W29A 2BVWA 5DELA 3PN8A 4J35A 3W23A 3OLGA 3W9ZA 1FKWA 4X0VA 3WNNA 1YX1A 1KCZA 4FXSA 4HNLA 4AD4A 4ZMGA 5A2CA 5LIKX 3TR2A 3CHEA 3LPFA 2DFAA 3G8EA 3UJEA 1A3XA 1XWYA 1AJZA 3CMFA 1QR7A 2ESCA 5AZ1A 7A3HA 3W2UA 4W7WA 2DZBA 3VK5A 4AD1A 3PWIA 2CZ5A 1XFBA 4FMVA 1O1HA 1CGXA 5EMJA 1FWHC 1C9DA 3LQGA 1R7AA 3AISA 1ML1A 1BYDA 1TVLA 4LRSA 1EC8A 4HNVA 1I75A 1AVAA 4XAYA 2WM1A 2GWNA 2VFFA 2P8BA 3UJRA 3M0YA 3VKKA 3NNTA 1UWRA 3NIYA 2X0YA 3W2MA 4RUBA 4C6IA 3SCSA 1FWNA 4TV6A 4GCAA 3GVVA 3C4UA 1C8VA 3CWHA 1DJXA 3WLHA 4MGGA 1ICSA 2YB1A 5CC7A 2ZTKA 4P7RA 3EAUA 4IIGA 1JZ2A 3U7BA 3GG1A 3G1XA 3VMOA 4LAUA 2XJ7A 4H2CA 1SJBA 3FA3A 2XN0A 1YDVA 2FVKA 5I78A 3HN3A 2IW0A 4KWVA 1KA9F 1HO1A 1YYAA 4PMRA 1JZ7A 5C55A 2R24A 4C5ZA 4C1NB 4JBRA 5BU6A 1F6KA 4S2BA 1A49A 1WPCA 1KTNA 4Y9PA 2RGLA 2CBJA 1TMLA 2FHFA 4JHOA 4BCEA 3STEA 1PHQA 3HG5A 1FTXA 2XSAA 4W5UA 1XC6A 1B90A 4JFVA 3AYVA 1LT8A 1D2KA 1GPFA 3ABSA 3T2PA 1IXQA 3CL8A 4CN1A 4B4FA 2VGGA 3DFSA 1DHKA 2WMFA 3DOPA 1E6QM 5BMXA 1WDPA 2TPSA 1B3XA 3RMEA 2AQVA 3WCZA 2PP1A 1TG7A 3SY1A 4ZVJA 1NOUA 2PDNA 2E1DA 3GIPA 5JMUA 3GHUA 4S1FA 4IOTA 5A95A 5M03A 3CPGA 4REQA 2HE5A 2EGZA 1AFSA 3O05A 1OT1A 3PZVA 1ICQA 2PMQA 4PUJA 3W2KA 1KKOA 5AN7A 4NY2A 1CTNA 2PWHA 4Q8PA 3PULA 4GQ0A 1AW2A 1R9XA 1IZKA 5HDRA 1XICA 1V5XA 3DG7A 3O1NA 1DJZA 2ZOXA 3SFKA 1H0IA 3VD5A 2Z1XA 4PTMA 4LJ3A 5EGRA 3B40A 4KEUA 4D6FA 1JYVA 1TJPA 2GL5A 1K8ZA 3FAWA 2Y88A 4MY1A 2PI6A 4H9ZA 1GK8A 4J2PA 2EG8A 3NPWA 3E5PA 2YIHA 3MO4A 4IMCA 2QR6A 1QDSA 2B7NA 4Q8TA 4WY0F 1UR2A 1H09A 1CB2A 1RBAA 1DJYA 2VCCA 2VRQA 2WVVA 2XH2A 1TUXA 2G97A 1BXBA 2GJXA 2RDXA 2Z0IA 4OGZA 1ZP3A 5I3GA 1QOPA 4MLRA 1XLDA 1QATA 4MM1A 4KPLA 2ZUUA 1KGXA 3WD4A 1EGZA 4Y2WA 1RY8A 4JCMA 2H90A 3VE7A 5E70A 4O1AA 2PDMA 1UPPA 4XKMA 1JCYA 3QR1A 1MUWA 5H8UA 3BMXA 4URIA 4FK9A 1A3WA 3S2MA 2VCBA 4Q8VA 4O52A 1GJUA 4OJYA 1UR0A 4RE4A 2DW6A 1EO5A 2JE8A 1K03A 2E40A 3SN1A 3KRSA 1IT0A 3U5UA 4DB7A 1TJ0A 5J04A 2GJPA 4MZ1A 2OYLA 2WZMA 3G5EA 1F05A 1F6YA 4UR7A 3CM4A 2PB1A 2HK1A 3FJNA 4MLJA 3G6MA 3IJQA 3QY8A 4POCA 1TTPA 2OQLA 1OM0A 1P4CA 4RV3A 1YDYA 4HK5A 4B9YA 2PLJA 5A6KA 3LHUA 5IBXA 4WKFA 3NQ2A 2BS9A 4P7LA 4E0CA 2RDUA 3ARYA 3M43A 1BQCA 1R7OA 4MB5A 3SCQA 1I2NA 3WH7A 2A6LA 1IT7A 3WLNA 1EC9A 1HKJA 3WFAA 3STCA 1XS2A 1FDYA 4LBSA 4TMCA 2VEMA 4QE4A 5C9UA 1QOXA 1UWTA 3JW7A 1HVQA 1OC7A 3NQ8A 4UIOA 1ISYA 3CIWA 3HJZA 4RE0A 3VIHA 3ATYA 3FXGA 4QFUA 1XD0A 3PR2A 1JI2A 1GGOA 1TA3A 3QPZA 1EIXA 5CGQA 3LRLA 1OB0A 4UZUA 3SI9A 4ADUA 3TJIA 3FW6A 4HQVA 3RDKA 1VFMA 5I3JA 3KCJA 3O0FA 3I6TA 4UQDA 4O54A 1ISZA 3TW6A 3B4YA 1J12A 2Y7DA 3KL5A 2BASA 3DFQA 3LRKA 4ZCWA 2GUUA 3EPOA 1IYXA 2BB0A 4RDZA 5BMWA 2NT1A 4MDOA 4DJEA 2PDCA 5TNVA 3AMCA 1JI1A 2FDSA 2PURA 3GXFA 5K9XA 2GQ3A 1W8GA 4JX5A 1XLKA 6REQA 4KEVA 1DXFA 3NQCA 4YWIA 3H2FA 3EDJA 1ONRA 2QIWA 1XISA 2E9LA 2E1WA 3NUKA 1OFPA 3TWBA 3ZO9A 2D2GA 1XD1A 4AWUA 1LM1A 3UG4A 1FHDA 4HNUA 3MMTA 2FH6A 3EX3A 3LYEA 1SO5A 1A0DA 5M17A 3GXDA 4UFMA 2X41A 2PGRA 1M5WA 3K8MA 3HPSA 3R1ZA 1J0YA 2ZIDA 1A5LC 3HMCA 2NLIA 5FJUA 5G4EA 3C3NA 4JX6A 3QQWA 4UNLA 1OABA 4JCLA 1M6JA 2BOEX 4ERIA 4YJ5A 4JDBA 3QW3A 3KOYA 1PWLA 4O15A 4B91A 4AZHA 1X96A 2W5FA 3QR0A 1RPXA 4MUZA 2WWCA 3FLUA 3MUAA 2Q01A 3WQWA 2WO5A 4OUEA 2OZ8A 3FDGA 3GBEA 1J79A 3W6MA 1DIDA 1BKSA 1JUBA 3M5YA 2C8NA 3L4VA 5AC7A 4LEFA 4EP8C 2B0MA 2I5IA 2TMDA 1E72M 3VC5A 4J9JA 1H0GA 4W89A 4MDPA 1PXGA 2ABAA 1AQ0A 4HHPA 4EF9A 2GSHA 4HHLA 3H2OA 3AIRA 3HV9A 1YKWA 4LU0A 3SEPA 3CQKA 4O1FA 4M7SA 4NJJA 4GBDA 1PSCA 4MAVA 5HWMA 1QXLA 1FBAA 3V16A 1R2TA 5I09A 2DSWA 4EXAA 4UQAA 2VMFA 3H24A 3L5LA 3DG6A 3W7CA 2QUVA 1DJQA 3WJXA 1KXTA 1KRAC 4NZJA 4C6EA 3PBGA 1CGTA 3QFWA 5LYRA 3GAYA 2PD5A 4JOMA 2X05A 1KO0A 1R3SA 2NV2A 4O8AA 3NZGA 1ESWA 1QNOA 3JVAA 4J4KA 1VIZA 1FWCC 1BWLA 4K8HA 3WKZA 4J7RA 2J88A 4UNIA 3P82A 2E0PA 2UWFA 1R8LA 4CEUC 1RJPA 3CB8A 5BNKA 1R3QA 1BXCA 2Q3RA 3GFXA 3KHDA 2YR1A 4UTMA 1SM9A 4FEZA 2VEPA 2VUNA 1TX0A 4OKDA 3TTSA 3H2NA 1OBAA 4PE8A 4X63A 1LCOA 4GUJA 4NYUA 3ZXWA 3I65A 6XIAA 1PWMA 2QUMA 5G2WA 3V1PA 4BQ4A 4NJGA 4DX3A 4BKNA 3VKCA 1LRNA 2IXVA 3IUDA 1E1CA 5CBBA 5I2UA 1RBLA 4GHRA 4AEEA 2PC8A 2VFGA 5M1TA 1YXYA 4RZ4A 3TJXA 1GPWA 4AD2A 5F2LA 2XVGA 3KCOA 3LCXA 3FGCB 5LA1A 2CZEA 1EQPA 4B5WA 3E0WA 4PFHA 3PJXA 3OOQA 4NIRA 5HUPA 1B4EA 2A2IA 5LZLA 3T1GA 2R8WA 1E6NA 3WD3A 3NPUA 5CLWA 3URNA 3JR2A 1SVDA 5C9WA 2QJIA 4E5TA 1LUCA 2GK1B 1KCLA 1SPQA 3AO0A 4G8TA 4UTTA 3TDFA 1A4LA 4MJ4A 2PC4A 4JKMA 5TIMA 5I02A 4A8LA 1EYEA 3KM8A 4Q8UA 2PDBA 3VU2A 4EAMA 1TZ7A 1TMHA 1LF1A 3GDLA 4IM4A 3SIMA 4YYFA 1YDOA 3ZFHA 3KHJA 3M41A 2YZ5A 5IHSA 1EQCA 5JBEA 1Q45A 4NJHA 2XH4A 1FHLA 3G24A 4K6AA 5KSWA 4NILA 3G77A 1B3VA 1I4NA 4M81A 3ABRA 4S3BA 2X40A 4HZ8A 2EKGA 1QWGA 4V15A 1XG4A 3E2QA 1IR1A 3YPIA 1S39A 1K02A 4ZQNA 4Q8OA 5KZMA 1TZ9A 2XVNA 4HMCA 1TWWA 5HPOA 4JS3A 2ZXBA 2R9RA 3THUA 3N2MA 1Q2RA 2E68A 3UR5A 1AMYA 1EB3A 4NJKA 3PY2A 3VTRA 2QJHA 3NM3A 1F6PA 1H11A 2IKGA 3GSMA 2WPGA 3CIVA 2HRWA 7TAAA 1KBKA 2A3AA 4CNSA 2J4GA 4AIOA 2ZX6A 4Z1BA 4YCOA 1W3HA 5FCZA 2J7HA 4YCPA 4JEQA 3KBJA 1O6IA 1X6LA 3G3DA 2ZYFA 4JN7A 3TA9A 2OEJA 1OYBA 3CV2A 3B8IA 4H04A 2CPUA 3KOWA 1WDSA 3HGSA 4LY4A 1FA2A 4CD8A 3KVJA 4C6JA 3C86A 4B5SA 1CX9A 2GZXA 4AC7C 5D05A 4JYDA 3UWQA 1WXZA 4JTFA 4N2YA 4LCQA 5HANA 4PCNA 1KM3A 3C2VA 5FSEC 3LZ5A 3SCWA 4CN6A 3OYXA 1AL8A 4Y9MA 2DSVA 4HOZA 3L2IA 3SO7A 2DV0A 1FCUA 1S2TA 1BWVA 1NQ6A 1VD6A 4JYFA 1M7XA 2WOQA 3I3DA 2OT0A 3BSGA 1O68A 3PSVA 2GJNA 2V5KA 4G56A 4O57A 1CECA 2QV5A 2R94A 5AZ0A 4L7ZA 3WLRA 4U33A 3T0DA 3SDOA 2C1IA 5CBIA 3B9NA 3GNXA 3M0KA 5TF0A 4AB4A 4XUYA 3W75A 1GJWA 2PDUA 2PZNA 3OZPA 2CWXA 1V6YA 3K2GA 4B90A 2XFRA 3UWZA 1K9DA 3K1GA 3DN5A 3WLLA 1LYXA 3CUJA 3KE0A 1G9HA 2WV8A 4MKSA 4NAEA 4Y8EA 2W27A 4DZAA 4DIAA 4E2DA 1UBPC 3REQB 2WCGA 3RRAA 1O4UA 2CLEA 2QCLA 5AY7A 2QAPA 2RDTA 1FY6A 4XZMX 2BXYA 1QPKA 4NP7A 3N12A 5A8GA 1P6BA 1BVNP 2WJEA 2BGNE 2CZVA 4X60A 1J6OA 3B03A 1E6ZA 4L9XA 3CS2A 3CTLA 3UG3A 5C9ZA 1PIIA 3VZZA 1UWUA 3A13A 4HP5A 4Z2JA 2DUXA 3M5XA 3FK4A 1E4MM 4IIDA 5AOUA 3A24A 4U3AA 2E77A 1EUAA 3ZJ7A 3GB6A 1BD0A 3W82A 1YPXA 4D8LA 1Q8JA 1VC4A 1OQFA 3M47A 1JF5A 1O5KA 4KKXA 3DZ1A 2OQHA 3B05A 3UZXA 5T9BG 4MYAA 1PIGA 1MZHA 3W85A 1EPVA 3ARWA 4AD0A 4JEJA 4TX9A 3RX2A 4FLQA 1E9YB 3G22A 3LS9A 2X1TA 2EXOA 5AHIA 1ME8A 2IXUA 2QT3A 1PKMA 2A21A 4X9SA 1A3HA 3AU2A 4EE9A 3BICA 1ZPTA 4PMYA 3VNIA 2WWDA 1V7YA 1B30A 4QQUA 4F9JA 3R8GA 4N4QA 3RRXA 5JQ9A 2BGQA 1ZJAA 1BTMA 2EPHA 1O5RA 3TYZA 3S6TA 4EANA 2R1LA 2V9DA 1VF8A 3IJ7A 2ZZ3A 1LBLA 1QUMA 7REQA 4JTTA 1SO6A 2VRKA 3INPA 1JDCA 2OQYA 4ORIA 3EDFA 1V3MA 4O12A 7ODCA 3BO9A 3MCMA 4Q8NA 4XSMA 3G1YA 4JTEA 2ZX7A 1KM1A 4MWAD 5GNXA 1S2VA 1OEPA 1GHSA 2J9YA 1XLJA 1GKQA 3PS7A 5K3VA 2RJHA 1IGSA 3VUPA 3ITOA 4DJFC 1AUSL 2WBGA 1FQ0A 1RBOB 5I03A 2BXVA 1MW2A 2VEFA 1AK5A 3I3EA 3TJ4A 4I6KA 1HJSA 3W7QA 2OSXA 4M19A 3VDGA 1D7FA 4KRZA 4UTFA 5CZSA 5F2MA 5FF2A 1L8NA 3VIOA 2CBVA 4Z2GA 1UZ1A 4YL2A 1GYLA 1XSJA 1SQ7A 4LC6A 2C79A 2DY3A 1BRLA 3MO7A 4GA8A 1XDJA 3W7PA 1AQHA 2ZUMA 5HBFA 2UZ9A 2BNJA 2E7FA 1CXKA 1W37A 3DFOA 1FXQA 3BTNA 3VYLA 1XCXA 3OVPA 1PCKA 1YQ2A 1CW2A 2DZAA 3UEQA 5FJTA 1H7NA 5FA5A 3RR1A 1EJTC 4XKYB 4WR3A 1L2QA 3WQPA 3MKVA 3LNPA 4HNTA 5EB8A 1UOZA 4QAWA 6TIMA 2WZHA 3MANA 4IFRA 3W24A 3LENA 4G9PA 2DDXA 3QLLA 3FYYA 3R13A 4FXRA 3S5YA 5ENLA 2OO6A 2XZ7A 3O06A 4DM2A 4JY9A 1X8FA 1VEOA 1ZENA 3GTFA 1ZBKA 4JTHA 2DJXA 1VFSA 4GI8A 4JNZA 5B7ZA 1W6TA 2J7BA 3E96A 1KM5A 4MHBA 3NURA 4CUCA 5JBFA 2ZICA 4OV4A 5CC6A 1MZRA 4XZ9A 4R53A 1P6CA 4JFUA 3MHGA 2OX1A 1DPMA 4M82A 4IQJA 3QPYA 3NQDA 1SZFA 4C6NA 1DWFM 5M5DA 4CD6A 2V0TA 4U5KA 4BQ5A 2HPMA 1TQJA 1PHWA 1KTBA 3GTIA 3TWAA 3K5XA 1AD1A 1FUYA 4MJMA 1FWDC 1AH3A 1DOSA 3WF0A 2WC7A 3GKAA 2ZKMX 3ARZA 1EJSC 2NVDA 2W6RA 3DI0A 4IPJA 2HQAA 1NDYA 3QGAC 2INEA 3DUGA 1CBGA 3RMJA 2P0IA 1V03A 5FJIA 4XBJA 4FOKA 2J24A 2DSKA 3LTYA 2ATSA 3FFSA 4BJHA 3RNDA 3WG6A 3BARA 3ZVHA 3FNDA 1GW1A 4FI4A 2BGS