4US5A

Crystal structure of apo-msno8
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
329
Chain Sequence
HVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSAEAAARLGLPYAYAHFITPQFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
total genus 119
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5A00
1BSLA 1Z69A 1LUCB 3RAOA 1RHCA 3SDOA 5DQPA 1NFPA 3B4YA 4UWMA 1FVPA 1BRLB 5LXEA 3B9OA 4US5D 2I7GA 4J2PA 3FGCB 1LUCA 1TVLA 2B81A 3C8NA 3B9NA 1BRLA 1EZWA 1M41A 5AECA 1F07A 3FGCA 1YW1A 1NQKA 4US5A 1XKJA
chains in the Genus database with same CATH superfamily
1UH3A 3E1F1 1X96A 3BAWA 1TPVA 1QHZA 1U1HA 1YYAA 5C54A 3RM9A 1GVYA 3BVJA 2PDNA 1B3OA 3LG3A 2XM1A 4JTSA 5K7JA 3P74A 1PIIA 2NLYA 1I2RA 3G8EA 2FPVA 4RR4A 3A3HA 1KGXA 1KM0A 3AWNA 3R1ZA 2YL6A 3SCVA 2YR1A 4PEEA 4F8XA 1JF6A 3N14A 3GS6A 3MP3A 4KCTA 3O6DA 5E6ZA 2WBGA 3OODA 4I8YA 3RGTA 2NXHA 1L6SA 3W85A 1LG2A 3RAOA 4G9PA 5CQ1A 4Y9PA 3NAVA 2V5DA 3KCLA 2OMAA 3G1AA 3B3DA 3PZUA 2JGYA 5I7GA 4DJDD 3NQ6A 1W8GA 4OKDA 5LIYX 1YQ2A 1GZJA 4D8LA 1W3NA 1FHDA 1M3UA 1C29A 3IJ7A 3CGTA 1J10A 3ZLGA 1B9ZA 3EA3A 1V08A 2B7PA 1HNYA 4QDPA 3KOWA 1CGYA 3AXXA 2XVLA 4B5WA 3T4CA 1HG3A 5C2XA 1E4NA 1OD8A 4NJIA 4UCFA 1JDEA 4ADTA 1F6YA 4LANA 1QOXA 1AZ1A 1KKRA 4UQDA 3LCWA 4DJFA 1VZWA 4V28A 4BY3A 2I9EA 2GK1B 1UZDA 2QYGA 3RR4A 3QKZA 5M2FX 4MFEA 4ZE5A 3DX5A 4HK7A 4LVDA 1LBMA 1EBGA 2DIEA 2YCJA 1C8VA 4UTHA 5JBFA 3S0CA 4GQRA 1RD6A 5DBTA 3ITYA 3B8DA 1ITQA 2DW6A 5A8NA 1L6WA 4I9JA 4RE3A 2E28A 1ISVA 1QNSA 1EJ7L 4HNNA 3TYEA 4XVDA 3F4VA 3PUDA 3T0AA 4GYKA 4Q8MA 1Z8AA 4AD5A 2XUCA 2YXOA 1GZ1A 2J24A 5H8PA 1P6BA 1XLAA 4C60A 3OHMB 2CZDA 9XIAA 3A5VA 3MUIA 5AHEA 5MF5A 1EIXA 1XDMA 3CJPA 3UFYA 3NGJA 1K8XA 2Y2WA 4B5SA 3VE7A 3QR0A 4QR6A 4IQEA 3ELFA 3N9SA 4X2RA 5IHRA 1AW2A 1XISA 6A3HA 2XM2A 3KBMA 3UYCA 2AAAA 4M6QA 3CS2A 4QM1A 2FJUB 3MW7A 4IIDA 1UA3A 3BOLA 4GFSA 3GB6A 5FA5A 4J3ZA 3DDMA 3QV8A 4LBUA 1QO2A 4HNOA 3IJ8A 1MDLA 2IKGA 2WNNA 2V6AA 2JIEA 4GO9A 1RCQA 3LMZA 3A4XA 4BQ4A 4G56A 3UG3A 2J7CA 4D6DA 5JQ9A 2OEMA 1B4EA 4XAZA 1HGYA 1WDPA 2QCMA 3HTWA 1IXNA 3CMGA 4FOKA 4L7ZA 5CPSA 3FLUA 3N04A 2O9RA 4JN6A 1VRXA 4A6GA 1A5SA 1LBLA 4WZHA 3MA8A 4PTDA 1GQJA 4E8DA 4CUCA 3DFYA 4K8EA 5CEWA 2Q3RA 3FVMA 1QOQA 1R0MA 1QBBA 3WQEA 2TAAA 3BOXA 1G7VA 1XG3A 1BD0A 1S5MA 1PX4A 2PGWA 4HU4A 5I3GA 4KEZA 1XIBA 4GRSA 3EBVA 3NM3A 3K13A 4NZ5A 3AMLA 4W89A 4ZO9A 3U2ZA 3ZYZA 4WGXA 3WLKX 1O95A 4JL1A 4KIEA 4UIOA 3TUUA 2A3LA 4GOAA 3MS8A 4AWSA 1CXLA 3M5VA 3NPUA 4GXPA 5ABHA 3RPDA 5LA1A 3W6LA 3HPAA 2VDHA 2GQ8A 2P76A 3DHUA 4WCJA 3AHTA 5KSWA 1SFSA 1OWQA 4OBTA 1JYXA 4M1BA 3WF4A 2XIMA 3RNDA 4C65A 3WF0A 1GVOA 2GUYA 2Y0FA 1EGVA 1SW0A 5CPOA 2ACSA 5F7UA 2O9OA 3GUGA 3DG7A 2Z24A 3TAKA 4GGHA 4IP7A 1Q6GA 3TCEA 5HQLA 1Y5VA 1O6IA 4MFDA 1R86A 3Q67A 2Z4GA 2UY2A 2OYMA 1S2WA 3BSHA 4XBJA 3KRUA 1WDQA 4DNMA 1U2YA 2FFCA 4B15A 1CXFA 2PAJA 3M0LA 3LPGA 5D9NA 2WJZA 1Q6CA 4ZR8A 2ZADA 4W93A 3S9ZA 3TLQA 1IV8A 2ATSA 4IL0A 1J2WA 2PDMA 4PA8A 1XD1A 1CXKA 3S9YA 4HQVA 2HEJA 1U1JA 4H6RA 3SCTA 4AFYA 4C7FA 3MV01 4HVXA 1R3RA 2PODA 5A6MA 3EXTA 3QLLA 3EEZA 2VTFA 1E55A 4XISA 5D05A 2GJPA 3A3WA 2E09A 2WMJA 1UC4A 1F8MA 3S8HA 3PWIA 3BJSA 1JULA 1KWKA 3E2SA 1QAPA 3IUIA 4EF9A 3WQOA 2QJHA 2WJEA 2QEZA 5EBUA 4ZQRA 3PY2A 1Z32X 2F2HA 3LHZA 3ZLHA 4M1RA 3D47A 4YWIA 2NWSA 1S38A 2MANA 3UPWA 3AHZA 3VTRA 1VLIA 2HZGA 2FVKA 4LAOA 2ZWZA 3VX1A 1B1YA 2C79A 2V67A 2WVUA 3RX3A 2P50A 1EZ2A 1Z89A 3VNIA 4DBSA 1UWSA 3ABOA 1TPWA 4IMGA 5FSDC 3BOFA 1V4YA 1JUBA 3PPFA 2HROA 5GJPA 3U3HA 2GGJA 3GU2A 3WJXA 4J3UA 4C6JA 1QHOA 5CC6A 2VEKA 4OBSA 3R8GA 1TA3B 4GE8A 5A6KA 1LLWA 2HXUA 3QEZA 1Z6KA 2XISA 2WWDA 3UG8A 1SW7A 2FB3A 3QTPA 3PULA 1O12A 1Q4NX 4YPJA 1TZ9A 1RA5A 1XXXA 1W9UA 2D20A 4KRTA 3H53A 4CVWA 3W07A 1EC8A 3TC7A 3WUEA 3TWAA 1CGUA 4LAUA 3V5CA 2DZBA 1XG4A 3HV9A 3LHVA 5EA9A 3SRHA 1JXJA 4MTVA 2X0SA 1VQTA 2QAFA 3PJUA 3WDPP 1OFDA 1SR9A 4Q8NA 3P93A 3H7VA 1QJWA 1E6RA 2CLKA 4QEEA 5LGXA 3L7RA 5H91A 4O16A 4XAPA 5CH9A 2PUZA 3LBOA 4EP8C 1ADSA 3OP2A 2NUYA 3LQGA 3GNNA 3BW3A 3LSCA 3EX1A 1H61A 4IGSA 2DSWA 4NU7A 4QE5A 3OBKA 4GXWA 2OFJA 1HF6A 2PTYA 1KBKA 1GTHA 1IE7C 1RR2A 4ZQPA 1NF7A 4HNTA 4YTRA 1L2QA 4ZB0A 4XKMA 1K4HA 4DJEA 1ODUA 3UJFA 2DSKA 3NUKA 1VR6A 1EXBA 1XYBA 1V51A 3E12A 4Q8UA 1WBJA 2JQXA 3P82A 2V5KA 3G1HA 3QSRA 3GIPA 2QDEA 4TUFA 1Z7AA 3GSMA 3TQPA 1W9BM 4PEKA 3D0CA 3HV8A 3KTSA 2Z25A 2XTKA 1O66A 4HOWA 4EPKA 1QPRA 1KQZA 2C1IA 1E9IA 1GT8A 2BASA 1UCWA 1ICSA 4F66A 4JQ4A 4D1JA 3JR2A 4PMNA 1UA7A 4QLKA 1KM1A 1Q2RA 1K3UA 3W9ZA 2CBJA 2GVLA 3F03K 2QCFA 1V0LA 3PTKA 3KHDA 4OVXA 3IPWA 4DWDA 1P7TA 1M41A 1KB3A 3OGSA 3ZLFA 1K03A 5CBBA 1O94A 1LF1A 1LRQA 1OJXA 3WMLA 4DF0A 2F38A 1C7TA 2WC4A 4AD1A 5E6YA 1E0WA 5DBUA 2WSKA 4XO6A 5IHSA 3M16A 2WKJA 5KITA 3HG3A 1PPIA 4FNUA 3IJIA 2X09A 2I5QA 1ITXA 3E0WA 1HQTA 5G4WA 4HMDA 2A3CA 3VAVA 2WM1A 3LI1A 2WQDA 4CN6A 3FNDA 5DMLA 4Q6JA 4GY0A 4QAWA 3JRKA 5HR6A 3BAIA 1O5RA 4ZQMA 4JTQA 2D2GA 2VDGA 3MDUA 4MB4A 2XFFA 1OZMA 3VO0A 3TW6A 3SGUA 2FQIA 3HPSA 1WKYA 4RJEA 2C15A 1PZ0A 1MYRA 3XINA 6XIMA 5E9XA 3QHOA 4HTYA 3W3OA 5LNWA 1MW3A 3WH8A 3H2FA 2ZUUA 1RQHA 3MB9A 1RSCA 1PEZA 2H9AB 3G1RA 1WB0A 2X7VA 4A8LA 4MUPA 4QG8A 3VM7A 2C0AA 3ZJ6A 4CNUA 4JTRA 4NT0A 4PZVA 1LL6A 3PF3A 2DSUA 4IM4A 4WJ8A 3DH7A 1EHAA 3WK0A 4AHQA 4JNZA 3MMUA 5IOBA 3W27A 1UMLA 2MNRA 3GIYA 2DZXA 3MSRA 2A0NA 1US0A 2CBVA 5C9WA 4H9ZA 4NUWA 1TVLA 5E0CA 4JCLA 3CV1A 4CVUA 2HBVA 3M0MA 2ZVIA 2RDTA 3AOFA 4A29A 2QW5A 1H11A 3I6TA 4PUEA 4KBXA 4GI4A 1TQXA 2B7OA 3R8HA 2HSAA 2X1UA 4XG1A 2ZQ0A 4URIA 3BC9A 2Y70A 2P88A 1E9YB 4EXBA 1EUNA 4JTHA 3PPCA 1J4EA 4TV5A 2P10A 1HW6A 5J5RA 3P3BA 1I9CB 3CQIA 1O5XA 1DORA 1RJPA 3FN9A 5D02A 3KEHA 1XS2A 4EXAA 3L4VA 1V6XA 4YS1A 3H2EA 3NYZA 1OYAA 3SI9A 4XBSA 1OD0A 3VD7A 3S46A 4XD4A 4L1WA 4AY1A 1HJVA 1YXCA 6ALDA 2Z1SA 3SUSA 2PZ0A 3FSTA 5HAOA 5JIWA 1F3WA 3TE9A 5DN1A 3NOEA 1R2SA 3VKBA 3SCWA 1R9YA 1LWJA 4LV9A 4LB3A 2UZ9A 3H54A 4PB3A 4S39A 3M0KA 4HNCA 1HN1A 1R7OA 3L0GA 4L9ZA 1DYSA 3JW7A 3N1AA 2PLKA 4LY4A 1JCMP 5LSMA 1J0IA 1V0MA 3RCMA 3G3MA 3IIVA 3BXWA 2DVUA 1OK6A 4R5EA 1DP0A 5LNSA 3UGRA 1W31A 5HNRA 3HFTA 4GH1A 4ZQNA 2D24A 4NZ3A 2VGFA 4MWAB 2GUUA 4MF4A 3GZ3A 1ESWA 3CEUA 1S3HA 3GUWA 1V3KA 1B90A 3VI2A 3K8KA 1X98A 4L65A 3Q37A 4W7WA 4MWAC 3VU2A 3H22A 1N8IA 5C5YA 3G3DA 1FXQA 2PURA 2X16A 2VWSA 4INFA 3C2RA 4Y9MA 4GYPC 1GHRA 4GY7A 2YFOA 1KXQA 2IMRA 1UR4A 1E0XA 4XWUA 4ALDA 2CLEA 1JAKA 1G5AA 2E1WA 2BODX 4XUGA 1RH9A 1K77A 1V0NA 2P8BA 2QUVA 5CZJA 4LOCA 1YE4A 3CLMA 4AC1X 1JZ3A 1ZBCA 3ABRA 1VHNA 4BHYA 4CGTA 1CDGA 3GC5A 5KZMA 4ZOCA 3IVTA 3W25A 4PMYA 2DEPA 4UOQA 1SO4A 4LRSA 3STFA 3L0NA 2DORA 2Z27A 1AD4A 1VFMA 1KRAC 4JIEA 4NZ4A 1HIZA 4ZEPA 4GCXA 1I45A 3A5FA 1UR9A 5A6BA 3I10A 2UY5A 4BF7A 4EK7A 3DOPA 5DQPA 3WY1A 1KFLA 2CKRA 2BLEA 4EOUA 3HGOA 3AIBA 3NQ2A 1IZJA 4NASA 1TPC1 2UV8G 1E5NA 1VBUA 3K4WA 3DBPA 4ZFCA 3TWBA 2XH0A 1Q3NA 3CPGA 4RZ5A 5CG0A 3NEVA 4F0RA 5CSSA 1WZAA 3B9EA 3SJ3A 2PLMA 3LPFA 4KWUA 4ROPA 3PJXA 4XIAA 4MY8A 5BRQA 4US6A 1R6WA 3K8LA 3T2PA 1XRVA 2G5WA 3W2UA 3QFWA 3OBAA 4F4RA 1OC5A 4HMNA 3TDFA 4UTLA 1LTDA 1RUSA 2CFFA 3RUBL 2PRLA 3DC8A 3GDTA 4PB4A 1H1NA 5HNUA 1EO7A 4Z08A 2REQB 4NVTA 4E2OA 4UTTC 3TJ4A 3BV7A 4MWAE 4PFMA 4GQ0A 3TW9A 4L6HA 1UOZA 3W7PA 1VRDA 1H7NA 4AVOA 1DIKA 2Y62A 4I5UA 4YIWA 3D3AA 3OG2A 2FH6A 3LXBA 1J6OA 1UH4A 1IIHA 4U3AA 3GNOA 3I4KA 1SU5A 6TAAA 1XIEA 2VHLA 1QTWA 3CQHA 4Z17A 5LXXA 2IPJA 2VZSA 3SY5A 4CEUC 3UG4A 3N6JA 4WXZA 3BCJA 2XPKA 1LT7A 1LCOA 1W3TA 3C86A 3S9IA 2FZBA 3AMDA 2XN1A 1AL8A 1ZJAA 4CN4A 3VD4A 4IIBA 5C9UA 3WLLA 3VDCA 3SIZA 4B2DA 1H4PA 3KOXA 3DU0A 1OC7A 4OUEA 2WPBA 4ADUA 3GTHA 1TQJA 4MKSA 4D9PA 4AXKA 1J8VA 1K8CA 1QU4A 4J2MA 2I57A 1TFVA 1WAUA 3DGBA 3YPIA 1AMYA 4K1GA 2HMCA 3UXIA 1NH6A 1XH1A 2NQZA 3M47A 4DZ5A 1EGZA 7PTDA 4Y6GA 2PF8A 4HSNA 4Z0JA 1EJRC 5DANA 1V8EA 2DSVA 3M7SA 1D3HA 5FJTA 5K9XA 5G2IA 5CXPA 1IEXA 3ONBA 3OJGA 4PMZA 5T91A 1J0JA 2WC7A 1W17A 2YBVA 1YTDA 1C93A 1TB3A 1VFFA 3EOOA 4I9MA 3EKLA 4I7WA 5D30A 3NXLA 3GR4A 1LL4A 3WJSA 3NQ7A 3W7QA 1AW1A 2V2DA 1AJ2A 3AS3A 3OLEA 4XZHA 3GXPA 1HT6A 4DBWA 4PBGA 1W3IA 1F07A 2V69A 3GVWA 4LUTB 3TH6A 1ZBKA 5IXEA 3VKKA 4MWAD 1ISWA 3RX2A 1OGGA 5KMYA 1RV8A 3EOSA 2Z1WA 1TMHA 3OLGA 1ZAIA 3DYMA 4FR1A 4FI4A 1W5MA 1UR3M 4Q4OA 1HJSA 1AA1B 2QVNA 4Q7BA 3AS2A 4EPBC 4N9BA 3AFBA 3MSGA 4D1IA 5CZ0A 4DJDA 2A4AA 4FLOA 3GNRA 1ME7A 7ENLA 2PI6A 3TZFA 2XU2A 4HHLA 3PS7A 4NZFA 1Z42A 4QGCA 2YCLA 5E93A 3WQ8A 2WM0A 2YIHA 2D23A 4LUIA 5HQMA 1V3HA 1XLMA 4M7TA 2HK1A 4I7UA 4V33A 5FJOA 2NX9A 4WOQA 3OEXA 4LALA 2C8NA 4PMQA 3IARA 4WDUA 3WK2A 4NP7A 3GO2A 2PDUA 7TIMA 4B91A 3L5AA 3QMTA 4LUSB 3RIKA 3T4WA 3UWVA 4CN1A 3LRMA 3HGJA 4X60A 3VOGA 4D6FA 5C9RA 2WWCA 1FWJC 3S42A 3IRSA 3T8QA 1TRIA 3JU2A 3WLHA 2UY3A 2Z1VA 1J18A 1TV7A 4O14A 3W7LA 4OTKA 4ZQCA 4CD8A 1NWSA 4UB9A 3CC1A 1FP9A 1GK8A 3SDOA 2J8TA 3J7HA 1F73A 3W70A 3W86A 3R13A 4MPKA 1IT0A 1SMDA 1QWKA 2PDQA 2GOUA 1EIBA 1RVKA 1IZKA 3WFAA 4PULA 1H62A 3MTWA 4MJZA 3UPMA 3TAOA 1A80A 1XPYA 2QLYA 4LC6A 3ME3A 5F2GA 3H26A 3N29A 3N2BA 3VDAA 3M46A 3BSGA 2NT0A 2IUZA 5H1WA 2GQ9A 1N82A 2WHJA 3QZAA 4GBDA 3I3DA 1VBGA 2PDCA 4HCHA 1J0YA 4BWLC 3LU2A 1JPIA 3NPXA 2ACRA 3WYZA 1RHCA 4AHOA 1V77A 3PFMA 2Z2BA 2OCZA 4BI7A 4S3GA 2G4FA 1OYBA 4Q8PA 4R34A 4YCOA 3FK4A 2WSYA 1TPFA 3UXLA 1Q6RA 2DZWA 1P0EA 2V30A 5LIXX 2V9DA 1CWYA 4GQGA 1XLFA 1JIBA 4WD0A 3THUA 3ISIX 3F4CA 3IEBA 2F84A 4OBRA 1XRTA 1OFOA 3LGDA 1ZY9A 3QV6A 3TVAA 5T26A 4V1YA 3AUJA 2XWEA 3NXFA 2ZA2A 3LRKA 4LPCA 2G3NA 1OZQA 2P53A 2X41A 1OG0A 1W8SA 5CAHA 4L4LA 3BMWA 4OIFA 5A94A 3PBMA 3E0FA 4ZXLA 1RY8A 2BHUA 3LV5A 1W0MA 3CZEA 4YYCA 2ACUA 1LZOA 3AHYA 4C6EA 5BCAA 4RCXA 3IRDA 4HA4A 1KBBA 3GLCA 4W8BA 3NOYA 3EA2A 4YTTA 1XQLA 2EBNA 2QCDA 3P60A 3LXAA 1XYMA 3BK0A 4AB4A 4P7OA 2Q71A 4QLLA 5FESA 3U6WA 4GXMA 3LLXA 3EAUA 1ISXA 2ZA3A 1Q7MA 3MSDA 1UPMB 1US3A 4A3RA 5HPCA 4U10A 3U4FA 3U48A 4UR7A 1W1YA 1H50A 1E43A 4GINA 1WYIA 4KGLA 1A5UA 1R3VA 4AZ6A 2F8QA 3FJLA 1KGUA 1DJNA 4Z1YA 3WK1A 4XD5A 5A6LA 2W5FA 4K3ZA 3GYCA 5CLTA 3PZTA 3QC3A 4GI6A 4C5ZA 1EQCA 2DUXA 4H4IA 4CD6A 4BF5A 2W3ZA 1AD1A 1ZPTA 5AOUA 4C7GA 4BEQA 4HJWA 3PNUA 2EF9A 1MO0A 3IVSA 2WO5A 4R3UA 2VI0A 3CHDA 2X1TA 3WBYA 3WQVA 3WBWA 2C13A 1SZRA 1V02E 1V3LA 3PWGA 4LVGA 1WXJA 1CXHA 1GOWA 2QJIA 5E0KA 4NZ1A 3DHFA 3RJYA 4DPQA 2VFGA 1E4IA 4AWTA 2AMGA 4KWOA 3DFTA 5FJIA 1TX0A 3MCNA 3MUXA 3SCUA 3A47A 3RM4A 4PUMA 1A3WA 3TSBA 3L66A 2YB1A 3AALA 4F48A 2E5DA 3LHYA 2OPJA 1EYWA 3FW6A 3N9KA 4TX6A 4IZGA 3C61A 1IEVA 3LQLA 2VX5A 4FXJA 3DC0A 2ZUWA 3MP5A 5FAGA 3AS1A 4OOZA 1U5VA 3B04A 4RX0A 2GK1A 3M0XA 3HG2A 2J75A 3AO0A 1DL3A 1SZFA 4NZJA 1R5YA 4HJFA 3WBAA 4F9DA 1SYTA 2YPIA 3I4EA 1CX9A 3SFKA 1Z9AA 5H6HA 1EJUC 4I5RA 3NURA 5D03A 5AB3A 5BRBA 4MY9A 2KAUC 4Q4QA 3F2DA 4NNBA 4N4PA 2PTZA 4FS9A 1FWWA 2ZYFA 3SRDA 2Y7FA 1N8FA 1KCXA 3OVQA 1U83A 3I7SA 3M7WA 2RKXA 1BYDA 4ENLA 4A3HA 1OEPA 3VC5A 1XRFA 1Q6OA 1R8LA 4JQ1A 3HO8A 3P61A 4HD5A 1XIDA 4C5YA 1H0GA 4DVOA 4X0VA 4JQAA 4CD4A 4LUJA 1M01A 2OT1A 3IGUA 1RXOB 6ENLA 3F5KA 1NP0A 3WEOA 4S3DA 3F2CA 4KCVA 4IISA 4ZTXA 2VELA 3ARRA 3LTSA 4JTKA 1P1XA 2FZ9A 4ATDA 3W7JA 4DEFA 3GRIA 3IAPA 3PG8A 1UD5A 4HCDA 1YIXA 3KS6A 4JX5A 4DLFA 1JCNA 3G24A 4LT9A 2PCQA 3I7RA 3AYTA 2DIJA 2J25A 3DG3A 3KZPA 3VKDA 2ZFAA 1GYLA 3BMVA 2RUSA 1PDYA 1XW8A 1ML1A 2NVCA 1EJVC 4UBPC 2E7FA 3VVGA 2QGHA 4F2UA 4RXFA 3XIMA 2X0YA 4UNLA 1OG6A 2ZCGA 1ITCA 3FAXA 3G18A 3O63A 7REQA 4UZUA 1QW7A 4JBRA 5K4XA 1XLBA 3CU2A 2QMJA 3LPOA 1YE6A 4RXGA 2Z1XA 2TRSA 4R85A 4DB7A 3D5HA 4XTIA 4JIRA 1J0HA 5AVHA 1FWDC 3ZR6A 1EP2A 1GQIA 4PRRA 2PWEA 1U1UA 2WLZA 4AY8A 2JFEX 4QP0A 3LD5A 5D8WA 3AXHA 5EMKA 4DF1A 3KS5A 4DYJA 1BWVA 1XH2A 2YDQA 3AMCA 3O6YX 3W6MA 4EPEC 2W66A 4OE7A 5HXMA 3QH2A 3NL3A 5C7VA 2DP3A 2G3JA 3VDBA 1XLLA 3KZSA 2B31A 4CQDA 2J66A 3D46A 4FXSA 4WVXA 2QUUA 2AL2A 4LRTA 3TK7A 1T6MA 3KVMA 4XVEA 4AC7C 1YX1A 4TU1A 1OVDA 5A3HA 2QGYA 2VKZG 1FCQA 3BQ6A 3L2MA 1QVBA 1UHVA 2RGMA 4MJMA 3CV7A 3M44A 4H6QA 3VFCA 2NVAA 2WVVA 3NGFA 4E3VA 1PWMA 4K6AA 2DIKA 4GY1A 2W61A 3KWSA 4RNFA 4AIOA 2OOGA 1X6LA 2VP8A 2DT0A 2IKIA 3VK5A 2YL8A 4RV3A 2DT2A 4LEQA 1AQ0A 4IQLA 4MB5A 1VHCA 3NQBA 2UWFA 1JZ2A 3AZSA 3GDMA 3IGHX 4MSSA 2J78A 3UD6A 4HT3A 4LW7A 1E5JA 2YL5A 2G50A 3W6YA 3FHQA 2WVTA 4ZA0A 3EKGA 1NTHA 3GKAA 1JD9A 2CW6A 1QFEA 4IUOA 4HKPA 4XAYA 3EA1A 3B8TA 3CBWA 1ONRA 2QAPA 2DFAA 3QRHA 1W56A 1BQCA 2A3AA 4DO4A 5C55A 3KL0A 3S2NA 1TWIA 3PJWA 3NYDA 2E3ZA 1A47A 1VCGA 3TX9A 1EWEA 1CLKA 3FGCB 4R9OA 3NQEA 2PU0A 5BXTA 3O06A 3BW2A 1E4MM 1I4NA 2VR5A 1A5NC 4JL2A 1T96A 4TQTA 1FA2A 3MI2A 1QR7A 4QFUA 3T6CA 3ZXWA 1V3JA 2XVKA 1X8FA 3CL8A 3L67A 4KCWA 2EEXA 1W91A 3ALGA 1TPH1 1MXSA 1CB7B 3R11A 4UFKA 4V2XA 4AEOA 1BVNP 3L4UA 3TCSA 4KQNA 3WJWA 4HA3A 4PH6A 2V3GA 3DYOA 4MJ4A 4MZYA 2FPTA 4QEHA 3WLTA 2GOKA 1QPKA 3LTYA 1TA3A 3I6EA 2BS9A 4JKKA 5AVNA 3G8RA 3LA4A 1M7PA 2J4GA 4HU3A 4UNIA 2YA1A 4N9EA 2HISA 1ZJBA 2V68A 1CCWB 3QC0A 4KFPA 1FVPA 1OY0A 4M0XA 1H09A 5HDRA 1WZKA 4LF2A 1FWNA 3LS9A 4CQBA 4X9SA 3VYLA 4L5ZA 3BW4A 4D6EA 3IV3A 3W1LA 4ZCWA 2C0HA 3DKLA 4LB4A 5T9BG 3HOJA 1E56A 1SW3A 4HU0A 3QOKA 2J74A 6REQA 1YMYA 2NX1A 3KBVA 1JVNA 3S5YA 3NQ8A 3GG1A 3D3FA 3E3HA 4C6NA 3K5XA 5BOOA 1W37A 5I09A 4XV0A 2O55A 1OX6A 3JUGA 4CCDA 3HQNA 2BVYA 2H8ZA 3IAQA 4Q8VA 4FB7A 3SBFA 5EMYA 4IMFA 4WF7A 4JTLA 3EDFA 2R94A 3GXDA 2OELA 4DLMA 4J40A 1BG9A 4DBEA 4M8UA 2J62A 1M7OA 3SCNA 5GPRA 1EPVA 1GVQA 2VUYA 1LOQA 3G1SA 2FTPA 5ABTA 5DXYA 4AZCB 1JRCA 1KO0A 3FAWA 1FWIC 3ZWTA 2XHYA 9RUBA 4KERA 1M65A 3N19B 1OCNA 1W9XA 2YJQA 1C90A 1VFLA 2GSEA 1RVGA 3WQ4A 4AG0A 3M6DA 4QRNA 3QKEA 4JTIA 1PHWA 4I8DA 2TPSA 1SQ7A 1UQZA 3AUOA 3N6QA 4I90A 4JNYA 2PDFA 5DFAA 1TJPA 3PBVA 2QCEA 3N2MA 1SJAA 2YCKX 3V0SA 2X2YA 2GVJA 3AMGA 1R38A 1F9CA 3DHDA 5H8UA 1JGMA 4RKAA 4LC8A 3M4HA 3POCA 1KKOA 3EX3A 2G8ZA 1XLCA 3OVGA 3S2LA 1FWHC 4JR5A 3RILA 1DQWA 3R25A 4IPPA 1WXYA 3LNPA 4FF7A 3W1UA 3OU8A 4ZXOA 3WNKA 4W8AA 2ISDA 1P48A 3VOCA 3EWZA 1EJSC 3VNLA 1MW0A 3SECA 2ABAA 4EPDC 5MKGB 2CBIA 2ODOA 4JIHA 4ECLA 3IJ6A 3MKVA 2Q6ZA 2ONEA 1F2JA 4X2PA 2HQAA 1DE6A 3GH4A 1FWTA 3KTXA 1SFJA 1EDGA 3ANVA 2YSWA 3U7BA 1PZ3A 3CZGA 4YLWA 3E2VA 5G4HC 1O5KA 3G5EA 2OKTA 4EWND 4H7VA 4QQUA 1KM2A 2EXOA 5I07A 2YYTA 4FNTA 1TZZA 1PJ9A 1ICPA 5I06A 1FWBC 1YXYA 4FF5A 3POHA 1FY6A 3UY7A 1NFGA 4LNCA 4O15A 2V38A 1Q63A 1GJUA 1TRDA 1Z48A 4C6BA 4AY7A 4DXKA 3XISA 2I14A 4K37A 3TTSA 1UKOA 4M6PA 3N25A 5AHFA 4PGLA 4WSHA 2XIQA 4ZOEA 1S5WA 3LOTA 3MHGA 5A6AA 2ZXAA 1FH9A 2O9PA 2BV9A 2PBOA 5BNKA 2FGZA 4HHMA 3FA3A 4MGGA 2VEIA 3MJMA 1LRTA 1NELA 2ZDRA 2CLFA 2XDFA 1J96A 3MT1A 3OW1A 1X8CA 3MO4A 5G2WA 3AAMA 4I9TA 4K8GA 1ZQ5A 4C6DA 4IX2A 3ARSA 2Y7DA 4W5ZA 1F6KA 3MY9A 4E38A 3Q2DA 4QX4A 4GC4A 3O8AA 3P2VA 3MKKA 1EC7A 3ARUA 2GVGA 4NXSA 4Z2HA 1SFLA 3BAKA 3CAKA 2BHZA 2Z28A 3SR7A 3NSMA 1ECEA 1G1YA 3V35A 3UCCA 1XBYA 3PWAA 2OKOA 3WIJA 1IF2A 4LEFA 1JI1A 4HHHA 3BG5A 2CERA 1B3YA 3Q94A 2QJJA 3SN4A 4O52A 4DUWA 1U5HA 5FIPA 3WQGA 3IGSA 4LAKA 3L5MA 4MWAA 4C1NB 1SZEA 3AZTA 2YLAA 1LWHA 2VFHA 4GYPA 3B0XA 2E6AA 3AWOA 3EX2A 2PDIA 2IXUA 4PTMA 2Y7GA 1OFEA 4WRHA 4GI9A 5G5IA 3E02A 5D9OA 1PX3A 2ZZ2A 1A0DA 4NRSA 1UP0A 5B7YA 1BSIA 2XSBA 3M0JA 3R0DA 1ME9A 1H1ZA 4HBKA 1TV2A 1XC4A 1GQKA 2QJGA 3EWXA 1EDTA 4C6QA 1C7SA 4GVIA 4U3CA 3DENA 1Z3NA 1YNQA 2GJRA 3KX6A 1A5OC 2BXYA 1ZENA 4FALA 3GVGA 5FF2A 1A5KC 2NWRA 1Q45A 5LA2A 3UQNA 3ZSTA 4JICA 1P4CA 1X6NA 3FEQA 4B5XA 3GR7A 4PTNA 2YGYA 3B4YA 4HPHA 4RUBA 3B0YA 1KWGA 3WKZA 1BWLA 1IIGA 4AMCA 3GG7A 2PZNA 3WZ0E 5ABFB 4KWWA 3E2QA 1B0IA 1ME8A 3ZOAA 1F3TA 4J1OA 3UETA 2QJMA 1UBSA 3LEPA 2FTWA 1JPDX 2D22A 3SCSA 5IM51 4XK2A 2QIWA 3KAOA 1XUZA 5C9XA 3GFZA 1XUUA 1A5BA 4F9JA 4U31A 4BQ2A 3G22A 2BTMA 1RJQA 4UTTA 3WD3A 2ZUSA 3P5YA 1K6WA 5CAKA 2PP0A 2TODA 1CENA 4JTJA 3WJZA 3HPZA 3TP4A 2REQA 3W75A 4OECA 4X3ZA 2VFFA 5CSUA 3WDHA 1WDRA 1TWSA 1JF5A 5FOOA 2YW3A 3KOZA 2P0IA 5D4YA 3QZ6A 5DRCA 3W1MA 3WX7A 1QI3A 4LS1A 1K8ZA 4PMJA 1OFAA 4NZCA 2QCNA 4NQ1A 1XFCA 1VKFA 2WNZA 5A6TC 3UNDA 3W26A 2EPMX 2XFRA 4O53A 3UP8A 1W1VA 1KD0A 3W2NA 3OQ8A 3QZEA 3TR9A 4C1LA 3WJYA 1A3XA 4Q6XA 3VNZA 4EVZA 2HNEA 1GTEA 4HYVA 3BAJA 3WLSA 2HK0A 5C6MA 4DWSB 4L6OA 5CSYA 1TJRA 3ZWSA 4Q4RA 1L0PA 2I5GA 3CUXA 3THQA 1Q6FA 1JG9A 4GVFA 5ABEA 4XBKA 3UNTA 1UIPA 5CZSA 4HGXA 4DWSC 2W67A 4KEUA 4IJRA 3VZXA 2GDQA 4QNEA 3ZT7A 3BCDA 1MQQA 1DQUA 2IKHA 1D3GA 1IEIA 3P81A 1Q85A 1XCXA 3GDKA 4ADSA 1F4HA 1FWFC 3SRKA 3AMKA 4P8UA 4Q8WA 2BZNA 1VFUA 3OGVA 2YFNA 2WC3A 2YBTA 2ABBA 3WDIA 4DBDA 2ZIDA 2QV4A 1S5TA 2ISVA 2PD5A 4ASTA 1EPXA 1FUYA 3IVUA 1YHTA 4FLQA 2E9BA 1DWHM 2BVTA 1R3TA 1TR9A 1ZJHA 3G1DA 2CITA 5DMMA 1ZCCA 1VJIA 1E0UA 6XIAA 1XLGA 1K9FA 4HZ6A 2PLJA 4HSOA 2CESA 4LUTA 3QHNA 3N2CA 3BANA 1GOOA 4AF0A 4O8RA 3I65A 4O4WA 5E0FA 2CIPA 4KMQA 3AU6A 2EKCA 4IPIA 1H7OA 3V75A 1K7EA 2BY0A 2FMOA 4UTMA 4WY0B 1LP6A 3MMDA 3NL6A 2B4GA 1M03A 2H6RA 4BFAA 1NFPA 3E9AA 3WUBA 4YMZA 3CXOA 4CCZA 4E8GA 3E38A 3C0JA 3GQYA 5I23A 4E4UA 5HWNA 1QNVA 4AU0A 3U9IA 3CT2A 1C9WA 1FH8A 3T08A 3S47A 1ZGDA 4CLMA 3OVPA 4Q4PA 2WZMA 1TWZA 4OZOA 5A2CA 3AJ7A 3ARQA 4IMAA 1FX6A 3NQGA 3TQKA 1VPQA 3LBMA 4H8UA 5LYRA 2WCSA 3V3WA 3I7QA 3W84A 5BRPA 1A5AA 1TV4A 4JQ3A 4F3HA 4L4PA 4PTXA 1IT8A 2XSXA 1KFEA 3W29A 1EJTC 2J7BA 4N2YA 3FDKA 2V63A 3M64A 3QGVA 2Q8XA 3RLGA 1I8JA 1CECA 1FFQA 2AKMA 1H41A 1QRQA 4WDTA 3EOEA 1I6NA 4IMCA 1JPHA 1OX4A 2E6DA 1XGDA 1GVFA 1PHQA 4OU1A 1JZ8A 2DUZA 3AIUA 4TTUA 3RYSA 3W71A 3QTGA 1FRBA 1HJQA 2OT0A 1R3WA 5C2GA 1WDSA 1PVNA 1XCWA 2YDSA 1VD6A 3M0IA 1RZMA 3PZ9A 4UTUA 4F0SA 2NV1A 2FHCA 3LCIA 4GJJA 3ZS4A 5FCZA 2INZA 1OT2A 5IRPA 2CYGA 4BWLA 1VP5A 2HTMA 3DGRA 4WOZA 2V2CA 2VC6A 2EO7A 4QROA 2J7DA 1XLJA 3R0KA 4FXRA 1MFUA 1HL2A 3T44A 4MIMA 4S3CA 2E5CA 3CQKA 5I0DA 1PCKA 4MAZA 3MYOA 3VCRA 1X1ZA 1CLVA 1DE5A 4NF7A 1HKWA 4JN8A 5IFPA 1UUQA 4IPNB 1V02A 4JTEA 2D2OA 4NL1A 1PE1A 3ITTA 1LOSA 3ABSA 3H4GA 1S39A 4IT1A 1TVNA 3KHJA 5KZEA 5JH1A 3GHSA 3VINA 1A3HA 1H3GA 1G0CA 4PMXA 3TYAA 4LVFA 3ZT5A 3G77A 1OSEA 2NV9A 2BY2A 4FSAA 2R1NA 4JX4A 4DWSD 4UTFA 4HPJA 2BY1A 1Z69A 2OO0A 2W9MA 1H7RA 4PRTA 1UR1A 3P0WA 4RDYA 2OLSA 1NF0A 2ZZ4A 3PM6A 4Q3MA 1BF6A 2EHHA 3CTLA 4UZSA 2DH2A 2ZX5A 3QW3A 4NIRA 3U8GA 1VCVA 4AX6A 2IXVA 3GU1A 2C6QA 1CI1A 3VX0A 3KVLA 4FEZA 2QDHA 3T09A 2VWTA 2YKKA 5AHMA 4OOUA 3KM8A 3LNMA 3PG9A 2QPSA 3EPOA 2Q02A 1ZL1A 4UMAA 3GXIA 4F0HA 1VYRA 3L68A 1XV8A 4LUYA 1BGGA 4N42A 1DJXA 1I2NA 1RCXB 3VNYA 4AH7A 3T42A 1A5LC 4DYEA 4DO6A 1SJCA 1JFHA 3K4AA 1YBQA 5F4XA 1XBXA 1BWKA 4GHRA 1AL7A 1XH0A 3RXZA 2YZRA 4IX0A 3NSXA 3GXTA 2BFGA 4H7CA 3AISA 3ITLA 3ZMRA 5I02A 1GG0A 3SW6A 1MZRA 1OCJA 1F74A 1OX5A 4LBSA 4TVCA 1SFTA 2J9YA 3KWXA 4Y9OA 2C91A 3SN0A 1V6WA 4NJGA 3DESA 3MBFA 3NM1A 3M0YA 2D2JA 2D2HA 2Z7GA 1FTXA 4HNUA 2PD9A 1IR2A 3VNKA 1OHLA 3BLLA 2V2HA 2TMDA 2R1PA 4N9DA 2DZAA 5AN7A 3BGAA 1HUVA 1UP3A 1HVXA 3I68A 1GKQA 1WE5A 1VBHA 3GC2A 1NDZA 4TO8A 1MUWA 4N7QA 4O50A 3RU6A 3SUWA 1IWBA 5M1TA 3NZRA 4I7VA 5CJMA 3GH5A 3SUTA 1OIMA 1H7XA 1QATA 3LCGA 2J77A 1GG1A 5CLWA 3BGGA 4J27A 1FDJA 2EKGA 5ENLA 3TSMA 3ZQ9A 2W0UA 5DY2A 1IYXA 1GYNA 2QDGA 5E09A 1EF3A 4C6MA 4AHPA 3W87A 4ICCX 5F2LA 5K4ZA 1AODA 3E96A 3ITCA 1QUMA 3P62A 3NQDA 3CH9A 2PMQA 1QPQA 2NV2A 3O9NA 4S2BA 4IG2A 3L4YA 1RD5A 3GR8A 4UQCA 2J79A 3QYSA 2NUWA 3UWUA 2PDJA 2FMNA 5I3JA 4ZB5A 3N3MA 1JZ7A 4GGBA 4CD5A 2OSXA 3CUZA 5GJNA 4OJYA 4DM1A 4O13A 4AZ5A 3NQFA 3TN6A 1E15A 4FNRA 1KXHA 3IJ9A 4Y9AA 4J9JA 4ZL1A 5DELA 3TN4A 1KFKA 1PIGA 3PZNA 3PUEA 4GKLA 3MI6A 3RR1A 3GFXA 4YVXA 4W84A 2QZRA 4HIBA 4Q33A 1GJPA 1A5MC 1CBGA 1EP3A 2A3BA 2B0MA 1DIOA 2XIIA 3VIJA 2BY3A 4M19A 2GVEA 1M04A 4BI6A 1D8CA 2E67A 4MUZA 3INPA 1R85A 5GQBA 5EPDA 2VZOA 1W1B1 3SJNA 2VFDA 2INFA 4QIUA 4OGZA 4QITA 3UR8A 3MHUA 1SO5A 4HHPA 4UOZA 3NDZA 3CO8A 2VFIA 3OIXA 1TTIA 7REQB 3KXQA 3VGEA 1O68A 3SCRA 4Z2LA 2RDWA 1DJZA 2VZVA 3WFLA 3JZUA 1E6ZA 1L6FA 1OCQA 2HS8A 4NG3A 2Z00A 5LIKX 4M82A 5FL0A 2GWNA 4UC5A 4UNKA 3W74A 1RQBA 4WDWA 2IS7A 3VIHA 4C6OA 3WQCA 2VEGA 1OGBA 3WFZA 1K1DA 3BCFA 1F4AA 5REQA 2W91A 4Q8OA 1B2YA 3MUY1 3A4WA 4O11A 1HKJA 2DJXA 2HDJA 2VYOA 1TVPA 2OZTA 4GPNA 4N02A 4MB3A 3T1GA 1MI3A 1UWIA 3K2GA 4JIIX 1BKSA 3GTNA 4B3KA 5HPOA 4ZMGA 3VILA 1DWIM 4GYJA 1GKPA 2NZLA 4TV6A 2AL2B 3IS4A 3EWDA 3WF3A 5FAJA 3RFAA 3VD9A 3UCDA 4ZZ9A 4A21A 4AMAA 4O1AA 1ALDA 3S5ZA 1I60A 1VAHA 3LDVA 2OZ8A 7A3HA 3VZYA 2A3HA 4X22A 1Q8AA 2PWGA 1GVEA 4QJ3B 1UKTA 3GM8A 4GO8A 4Z2JA 1W1PA 1XSKA 1GQLA 4ZE4A 2F6KA 2WVVB 2DGAA 2FHFA 1ZP3A 4P7QA 1HKVA 3QXBA 4EF8A 1DJIA 1TPEA 3T8LA 4KIRA 3MUZ1 2WZIA 4P5UA 2J7FA 1PIFA 4XX6A 3REQA 3C8NA 1CTNA 4AX7A 3NJ3A 2C3ZA 1RPXA 1K6AA 1HTIA 4KESA 1GUVA 2BBFA 4CNNA 1QI5A 4PUNA 2JF6A 4C6IA 3VMNA 3OBEA 4Q4SA 4MAVA 1SR0A 3ENLA 1EH9A 5LGZA 1HP5A 2PWVA 3USZA 3HBLA 1BYAA 2PP3A 3GAYA 3THDA 4KKXA 3AXKA 4JFSA 3VGDA 2C14A 4GC3A 1VCFA 2WCGA 3W2LA 4UQBA 1A0EA 3W53A 2GSJA 2Z6JA 3S5SA 4PB5A 2OWXA 3HQOA 4A8NA 5G1TA 4MNKA 3HIJA 3TJXA 1LDCA 3N4FA 1FWRA 1KFBA 3WCZA 2WV8A 5J5DA 2E6FA 3FGCA 2CZ5A 4REQB 4B16A 1LYXA 1KV8A 3WEMA 1SSDA 3AICA 3OA3A 3TQ0A 3TU9A 1EX5A 3T2QA 4WSKA 1EJWC 5CPMA 1RALA 4U28A 4HPXA 3HG5A 5FJRA 5JMUA 1FHVA 1OF6A 1HKIA 2GPTA 3ORWA 5CCZA 5LZLA 4GX9A 5FKYA 3LZ5A 3HZ3A 1J93A 1C8XA 3LRLA 2OVLA 3QW4B 3PFRA 1TUFA 1TMQA 2XH4A 2QCGA 1UW9A 2XH2A 1FKWA 3W1AA 1PYFA 4LY8A 3ARWA 1GW9A 2J88A 4I9AA 1TWDA 3RMJA 1QNRA 4XZBA 2Z6IA 3SCPA 3NQMA 1KBIA 4O12A 4WLCA 3SY8A 1QPNA 3EZ4A 1FHUA 4ZSUA 5E9AA 3QYQA 2PWHA 2AGTA 1VB9A 3T81A 2VC5A 3BLIA 4UQEA 2BGQA 5EMLA 3UGVA 4AZIA 1S2VA 1M7XA 5I3KA 4M6UA 4PTWA 3CK5A 1KA9F 4QSFA 2DSZA 2ZX7A 3TKFA 2NX3A 2WMIB 3A3XA 2Z2UA 1TPUA 5D38A 2OLHA 6REQB 3L2IA 2XIBA 2ESCA 2XVGA 3LV6A 4JFWA 3H8AA 3SGZA 1CW2A 1G69A 1YTKA 3U2CA 3V0TA 1PYMA 3WD0A 4UFJA 4LCQA 5HJLA 3TQVA 2FHBA 2NXGA 2F7FA 4EE9A 2YW4A 4GYFA 1CGXA 3GBEA 3DG6A 4YTSA 4BI5A 5K3VA 1S46A 1F5ZA 3PK7A 1B3WA 2O4MA 3JS3A 3E6EA 1SJBA 2WHKA 2DW7A 4WR3A 2PRMA 3F1QA 3G6LA 4AUBA 3BJTA 2XH7A 2DZPA 2GZXA 2HS6A 2YZ5A 4GVHA 3S1UA 1XI3A 3H55A 4DN1A 3BZGA 5BU9A 1W9PA 1RP9A 3MVTA 4S3FA 4LVAA 2GJXB 1US2A 3T0TA 5AC5A 4W88A 3GU9A 1B3VA 4AZCA 1JPKA 4CQCA 1IGWA 1TR1A 2JEPA 3IANA 3STCA 2VNCA 3CHVA 4IP4A 3CV2A 3RCNA 4M81A 5FEXA 3LI0A 3IJDA 5F1UA 1DTNA 1C9DA 4ZOBA 4Z0SA 1G9HA 4GJ1A 1H7WA 3ZVIA 1OINA 3SGGA 4U4MA 1TJ1A 1FWGC 4D6JA 3AC0A 5BMWA 3NQAA 1HXJA 2E8YA 4HPGA 2X1SA 2VR4A 2ZUMA 1GOQA 5E70A 4B4HA 4QISA 5M3WA 1UC5A 1ISYA 1GEHA 4MADA 3LN3A 3E0IA 4XO7A 1HJUA 1PB0A 2XWDA 4P7NA 3TYUA 5FACA 1CEOA 3O07A 4R53A 2V3EA 1V3IA 4JQ2A 3AXIA 3PANA 4O4VA 1TCDA 1Q7QA 4NI3A 4P2VA 4RL3A 1Y65A 5A2AA 4JIPA 2X1RA 1B54A 2J8FA 2VD8A 4M6VA 3GDBA 4JDBA 3NO1A 4IXXA 5MKGA 1Z44A 3UYIA 3CIXA 5HOSA 3N6HA 3W01A 3AZRA 4L1XA 4ZFMA 4L61A 2BVDA 3CL7A 3A4JA 4JS3A 4JTCA 3APGA 1IHIA 1MWOA 1AFSA 4QJ1A 1G01A 3C2YA 3HA1A 5D32A 4FNSA 1RP8A 4PCNA 2CPUA 1F3XA 3U57A 3EDKA 1BTCA 1JYVA 1P43A 5EGRA 1VFHA 4A3UA 4AD3A 5CBIA 4W87A 4I5XA 2V5JA 5CGMA 5BZAA 3DFSA 4FXFA 4QLJA 4KW2A 4GG9A 3GYEA 3WLQA 3LCXA 2HRWA 3UXAA 4PC8A 1UZ4A 3N73A 5TAOA 3EB4A 1V7AA 5A1AA 2PLCA 4DI9A 3HMJG 4UTWC 4H9MA 3CNYA 5T9CE 4OQVA 2CETA 3MV11 3AJXA 3OO2A 2FZNA 3B0UX 4O1DA 4RE2A 3VKCA 2GJNA 1DEDA 4IHCA 3ITVA 3WH6A 3VOFA 1D3CA 3TR2A 3MYPA 3GNXA 3WELA 1EA0A 2WKGA 3WLNA 1E70M 4BKNA 4ILSA 3JVAA 5FEWA 3FFSA 1F76A 3IV8A 4JPGA 1TIMA 3NFUA 4KWVA 4GKTA 4GUHA 1V7YA 3SRFA 3FKRA 2GSHA 4OV4A 1NFBA 2FZDA 3VKJA 3W28A 1S5NA 4MKVA 4DI8A 4JNMA 2C19A 1BF2A 4IJCA 1DHKA 4B9YA 5AYBA 2CLHA 1B57A 4ICNA 3KCOA 4RDZA 3H2OA 3BH4A 4X0NA 1PTGA 3B97A 1UKSA 4QS5A 3UZ5A 3EX4A 1D9EA 2DT1A 4EXQA 3CWOX 3MANA 3II1A 4HYWA 4B5TA 3CIWA 3VE9A 3M41A 3GDRA 3CZKA 1FWAC 1XIGA 4OV9A 3VUSA 4KFOA 3BV4A 3NO5A 1BRLB 7ODCA 5JIPA 2ZRUA 1YTEA 2AL1A 1WDWA 3VOIA 4NYYA 3W72A 1EB3A 3O6CA 4O0KA 3NZPA 4AVFA 1EUAA 3KL5A 2OR2A 2ISWA 3TYCA 3B0PA 4J28A 4MG4A 1GW1A 3G6MA 1NQKA 3A13A 4C1NA 5DX7A 5DMNA 5M03A 1IZCA 5I3FA 3O0KA 2VENA 1E9ZB 4KH2A 1VIWA 2VZUA 2VVSA 4J2PA 5U4NA 2Q8LA 5A6SA 3HGRA 2HVMA 1XGZA 1GGOA 4JIQA 2CNCA 1XF0A 4Q7NA 5CGQA 1DJGA 3G1XA 3ATYA 1GVIA 2FFIA 2QKFA 1SGJA 4NNAA 4B5UA 2O56A 4DJDC 1GVSA 3N18A 1LLOA 1KM3A 2ZXQA 2EG8A 3SUUA 3UWWA 1XKJA 4AXNA 4XSLA 4CNOA 2PDWA 1CGWA 1QW8A 5TQLA 4FK9A 3LYEA 3GVRA 2P1FA 2B7QA 4IIHA 2OZ0A 3W00A 2EJAA 5CZTA 3NTYA 4ML4A 3M9YA 3WNMA 4ICMA 4E4FA 3URQA 2F61A 3RLUA 1KR1A 3URNA 4FP1A 4PUUA 5ABFA 1O60A 1O1HA 1TE6A 1POJA 1NAL1 3C56A 2IW0A 4AWEA 4XSMA 3QMSA 3VDGA 1L6GA 4JTAA 1RBOB 1EXPA 3V16A 5FJJA 1SO3A 1EZWA 4F0KA 1EOMA 3BJFA 2ZBTA 3NL2A 1E6NA 4M3PA 5KETA 3IJQA 4GZ7A 2W62A 3ARZA 2POTA 2OQYA 3GK0A 1LQAA 1MNZA 1S2AA 4FX6M 5DY3A 2L5HA 4R7JA 4LS0A 4QJ5B 4B92A 5D2WA 2C16A 3R89A 3MI3A 4KPLA 4TTGA 3VMOA 2WQPA 3KUMA 5D9MA 2F9RA 4CKQA 2QF7A 2VOMA 2GGHA 3IIPA 2H90A 3WQPA 2Y5SA 4F79A 1TYGA 5D2YA 3HB9A 3T0BA 1KCZA 2WZHA 2WNQA 1JDAA 4XKYB 1PSCA 1HGWA 1UKQA 4E0CA 4HZ8A 3WMCA 3G1FA 3NL5A 1XYCA 2YL9A 4UMCA 5CC5A 4O10A 1P0NA 4RE0A 3LUTA 3MWCA 2VC9A 2PFHA 1UUMA 4QHRA 2E25A 2WW5A 2E8ZA 3BURA 3QBUA 4RNJA 4PE8A 3WLMA 5TF0A 1EWDA 1VFSA 1R47A 3SCOA 1AH3A 3PBWA 5DCEA 1QOPA 2PTXA 4DWSA 4A22A 1I0BA 1NEYA 1H5YA 1UR2A 2ZXDA 4TR9A 3W7GA 3FYOA 4CU8A 3QHMA 3SUVA 3B05A 4C1KA 4H9VA 4YNGA 2YBUA 2G95A 1NP2A 4QE4A 1T7LA 1FHLA 1ISZA 1Y8BA 4O0QA 1BXNA 2X2GA 1FKXA 3WO8A 4QG9A 5CG7A 1ZBVA 3KDOA 4H2HA 4GFIA 4GVGA 2CBUA 3NVDA 6CGTA 4F0LA 3VABA 1J5SA 4G1KA 3GC4A 2E5BA 4L9YA 2R14A 4QG6A 2FLIA 3VIKA 3GHUA 5HR7A 1NWRA 1GYMA 4AD4A 4XUYA 1VENA 3SM0A 2VEMA 3Q58A 2WYSA 4WSJA 1PKNA 1V93A 1E6XM 1XKYA 3C2VA 3TROA 4ACZA 1AQFA 2GYIA 2IPFA 3BLPX 3T78A 4NYUA 4JYEA 1WDDA 4PL2A 1WKFA 2QCLA 4AF0B 3APYA 1QO5A 1W5QA 2D0FA 2QPUA 4KF1A 3KVKA 2VL4A 1GCYA 3V0UA 4WY0A 3WL1A 4H9UA 3WLJA 3B9OA 4IIFA 1UWTA 1C91A 3GXNA 3W81A 1H49A 3L4XA 4HCLA 1Q66A 4RDVA 1CIUA 3VOJA 1BEUA 4K36A 2D0GA 3FX4A 4IFRA 5E1QA 3WLIA 2HNHA 1XLIA 2HCVA 4I6VA 3KLKA 1EP1A 2EG7A 1DXEA 3EWUA 3MMWA 2CKSA 3N4AA 1P6WA 4NX5A 2P3ZA 4POCA 1K8YA 1GPFA 3ZJKA 8TIMA 1V0KA 4H6KA 3TA6A 2XN2A 1H0IA 1LL7A 2OGJA 2J9ZA 2XGIA 1IXPA 2VD9A 3DFHA 4Z2GA 1YLVA 4C6LA 3WG6A 1SUXA 3E2RA 1Z41A 3CZJA 3O1NA 3V18A 3QFEA 1RCOB 1RK6A 1UWQA 1X7FA 1KRCC 3R6IA 4GWEA 3ZSSA 2VDIA 1MFVA 4UWMA 2GUBA 1EA9C 1VFTA 2R8WA 2ZUVA 3CH0A 1XM3A 2E4TA 3G1YA 4H3DA 3F5JA 2CLLA 3VGBA 3W1TA 3O05A 3T05A 1J12A 3PTDA 3L2LA 1OX4B 3ZT6A 1E40A 3KFTA 1JZ5A 1JD7A 2NQJA 3FSUA 3ZVHA 5HANA 4XZNX 2WB5A 3LLFA 1D8WA 3V1PA 3KW3A 4L6DA 1AW5A 4IQDA 3H21A 3AIWA 4S3EA 3PNZA 4AZHA 5HWMA 4GJIA 3HMCA 3UXDA 3VGHA 4XD3A 3HF3A 2CLOA 1WP6A 3CUFA 4EAYA 2VOTA 4LYRA 3FXGA 1FOBA 1YDOA 1Q2SA 1BVWA 3KTCA 4E4PA 3R43A 3O15A 4N6EA 3DZ1A 4GBUA 3P14A 1V79A 4E5TA 4X9YA 1DJYA 3WQ5A 1AG1O 1XIFA 1EL3A 3VIFA 3PZIA 3NO3A 4DZIA 4EIVA 3LTPA 1JDDA 1W3JA 1EOKA 2NSOA 3P0XA 1K9EA 2X40A 2Z7KA 5F4SA 1VF8A 1JNDA 3VDHA 1MDRA 1JJKA 3CZ8A 3H4XA 4BQ5A 1XLKA 4E2BA 2ZWYA 2Z1BA 4H2CA 1T8XA 2RAGA 3PSWA 1XX1A 1JYNA 1S2TA 4R33A 1Q7ZA 1DWGM 1OADA 5A8MA 2QXWA 3EMQA 3BAXA 3TJLA 3KDNA 1JDFA 1V6UA 4RZBA 4JY8A 3VOHA 5K9CA 3CT7A 3AHXA 1UMYA 3N15A 5EKYA 3M5ZA 1J0KA 3SAZA 4D72A 3PB0A 2F6XA 1PDZA 1EF2A 3P8IA 5C8BB 2EPNA 3SO7A 2E68A 2PDHA 3TV8A 3W38A 1X7IA 5LIWX 1AMKA 2Y1HA 2ZZ1A 2ZRZA 2R91A 2OZ3A 4ONVA 4WHBA 1HO1A 1ZUAX 1PS9A 4MYXA 1DBTA 5EFFA 2QUMA 5CZKA 1JCYA 3ZFHA 2A85A 4H7ZA 2DPEA 1U33A 4A2SA 3AI0A 5JUVA 1HZYA 4OFCA 1E51A 1G4EA 3CASA 2QVHA 1CPUA 3FS2A 4WQ6A 3BLEA 4MVAA 2ZTKA 3DYPA 3BG9A 5G2HA 2ZRYA 1AK5A 1Y5XA 1K70A 3PUGA 1YBQB 1P0DA 4LJ3A 3GD6A 4Z42C 9CGTA 3TA9A 2VC7A 1E6PA 5D2VA 3OZOA 4LX4A 4HK5A 3AQUA 1EGMA 1ZHAA 2QUTA 3NA8A 3QVQA 3VM5A 4WJEA 4L4OA 4PN2A 2H3BA 4GI8A 3WF1A 1UQYA 5A8OA 2FGLA 3EPMA 3TLLA 4LYQA 5F2MA 1A4MA 1TV3A 4XZIA 5HJYA 2VCCA 4XAGA 3PPHA 1GPWA 4ZO7A 2O92A 1P6CA 5CPQA 2YB4A 2JK2A 3UJSA 3DFOA 1LQ2A 3TZNA 4N6FA 1NIUA 2WZTA 4UR8A 1MSSA 1PUDA 3QLDA 4H04A 1O4UA 1ZFJA 1XPGA 2XIOA 1JYWA 5XINA 3W7RA 3QSTA 4MPQA 4UQ9A 4CU6A 3W7EA 5TD4A 2NW0A 1XYLA 2WMFA 1RLCL 1MEWA 2G97A 2GDVA 1BFNA 3UZJA 4JZ5A 4XD6A 3PHAA 3AU2A 1GONA 1QNPA 3AYRA 2FH8A 2PDYA 5G4EA 3LM3A 3M5XA 3GW0A 4ZODA 4M56A 3H2NA 2ZRWA 5IDZA 2I17A 4UUIA 3IUHA 1RBAA 5GNYA 4FA3A 3DN5A 3ECQA 2E0PA 4J3XA 5RUBA 4JKMA 3C3NA 2PWFA 1TV8A 2UBPC 3KLLA 4K8HA 2GJLA 1PL9A 3UWQA 1JAEA 1LT8A 1SVDA 2CWXA 1ENUA 2I7GA 2C1GA 4IG2B 4BR1A 4ZTYA 3CUGA 3W7NA 3WN6A 1E4LA 1W1ZA 2DT3A 1ZRQA 3OZYA 3A4AA 5JVLA 2F2KA 2I56A 3TN5A 4QAIA 1U30A 4MJ2A 1S1RA 4GUGA 4BQ3A 4IIGA 4W7UA 1REQB 4GH3A 3FYPA 4EACA 3H2MA 4LH8A 1ONEA 2EAWA 4B90A 4ZO6A 5F4WA 5AHIA 4BK9A 3UZYA 2PWDA 3V4BA 3O3RA 1VJSA 3L23A 4ZGYA 3UJEA 2FZ8A 5BOFA 1UJPA 3ARTA 4Y7EA 4N4QA 3UW6A 3LXCA 1H5VA 4GCAA 1YNYA 4WEVX 1TX2A 5DT5A 2G3FA 1TUXA 4MOZA 2YOCA 1J9YA 3MP4A 4J3WA 2C1HA 2VM8A 2ZKMX 3B4UA 3F4NA 2P5NA 3D6NA 3K8MA 1WCGA 1WXZA 1XIMA 5EMMA 4NKCA 1ZS2A 2Q09A 5DO8A 4DELA 1LJYA 3MQTA 1NJJA 3HJEA 1Y0EA 1A4LA 2O4QA 4AW7A 3BDKA 1FWSA 2RJGA 1IR1A 3RJXA 3MDWA 4O1EA 2NQ9A 3TTQA 2EGZA 2ISSA 3EB2A 3HURA 1MQPA 3O7UA 1BSLA 7TAAA 3PZMA 1EDQA 2IPWA 3TC6A 2YCEA 2JGQA 1UR8A 3QR3A 3RN6A 3VC6A 1UD8A 3BARA 5HNTA 2BVWA 3ERPA 3WL0A 4AIBA 1T99A 3TW7A 4H00A 2Y8VA 1TTQA 3EOLA 4YWSA 2XZ9A 2PEVA 3L5LA 4ZVJA 1K9DA 2BWGA 2XJ7A 1VEPA 3LX9A 2J47A 3VMPA 3VGFA 4BZYA 1GOXA 1DXFA 4HA0A 1TTPA 5REQB 3STEA 2EPKX 3RHGA 2CXGA 3WD2A 4HZ7A 1P0KA 4Q22A 1H7PA 3VA8A 5I78A 2WJDA 1VLWA 3GNPA 1WO2A 5LNVA 3MBDA 3P8JA 1UKPA 2V82A 3PJTA 2VGBA 2CU0A 1BYBA 3R58A 3SB0A 4HOXA 4FO4A 3C4UA 1UYQA 3ABZA 4Q4MA 5A8PA 1F05A 3A23A 3W7HA 2BX7A 4FOJA 1B31A 3TFCA 3VXGA 4A05A 2RHGA 3BZJA 4GIRA 2VEPA 1JNEA 3QM3A 4JD4A 3KP0A 3DCPA 4F2BA 4JHZA 1E72M 5DT7A 3EGJA 4IL2A 5BW6A 4JAWA 4E2VA 4H8HA 1E1EA 1ITUA 4RK8A 3CB8A 3F7JA 2ANUA 1RQEA 1TE1A 4HNVA 1Q6LA 5GNXA 2EJ1A 3G2GA 3ZIZA 4DUVA 4DHGA 3A12A 3LENA 2G0WA 4HMCA 3EPNA 3SCQA 3K46A 4IFKB 3C0SA 1UD3A 3PZGA 1T8QA 2R6OA 3G1VA 3REQB 3IUDA 3WK3A 3LHWA 4P7LA 3LHUA 5L6UA 2Y7EA 1F61A 3CAWA 1FDYA 1PWLA 3H7RA 4QS6A 3OZMA 3GE7A 3UWYA 4MDPA 3M0HA 1XLEA 1P1MA 4LU0A 4RLIA 1KLZA 3CHEA 1DJQA 3FVDA 4U2ZA 3W2KA 2OEKA 3GVQA 3N13A 3VNMA 1OCBA 4TOQA 2DZVA 1AJ0A 4PUJA 4NJKA 2V5LA 1LORA 3L0KA 3GTFA 4GIYA 1UOKA 2GDUA 4D8ZA 1HJXA 5CC7A 3VUPA 2VRKA 3G0SA 5I5RA 4REQA 1FP8A 2Q8ZA 1KM5A 3P7YA 3WBEA 5M5DA 4GNKB 1R7AA 1T40A 4PR4A 3R5EA 4FAMA 1K02A 1W3HA 3GAKA 1FQ0A 2ZX6A 4YHGA 2FZMA 4QXIA 2OU4A 1VPYA 5BXRA 1ZAJA 2G3IA 4WKFA 1W5OA 3VFLA 1UG6A 3EWCA 4M51A 3BWWA 1XIIA 1Q6EA 5BOEA 4C6KA 2BMBA 4U33A 5A69A 3M1ZA 1DWJM 2ASHA 3KRBA 1NU5A 3IACA 1KFJA 1XP3A 2GL5A 2CLMA 4UR9A 3CQ0A 3WLRA 3W7MA 4OUIA 2W63A 3UU0A 1ECQA 3FY1A 4Y9NA 1S2UA 3DKJA 3BMXA 3UJ2A 4GLEA 2A7PA 2DZSA 3SURA 1UH2A 2WSQA 4G7EB 3QV9A 4RE4A 3TNBA 1YADA 4X63A 3FJ4A 3S5NA 1BG4A 1BXBA 4PUDA 1L8PA 5K9DA 3NDYA 3R94A 1RPKA 2JKPA 1TZ7A 3O6AA 1Y7VA 2R9RA 1W5NA 2DV0A 2NQ5A 4BJHA 8XIMA 3B9AA 5AKQA 1FH7A 3ZR4A 3W7IA 1OFQA 5I03A 1XBVA 4AYSA 5LHFA 1FWCC 2QR6A 2WXDM 4LVBA 5A6JA 1Q13A 3S6DA 5MHBA 2A21A 1RY0A 2OXNA 8XIAA 2PGRA 2WMIA 2YDAA 2JF7A 4P61A 3OYXA 3MZNA 4RZ4A 3UT0A 4BA0A 3S6OA 2RDXA 4AD2A 4BEUA 1H1YA 4KRUA 5FF7A 2Z0IA 2BXVA 3RDKA 1OFBA 1X39A 2KZHA 4XZMX 3NZ1A 4P8WA 3RPMA 1CZ1A 3SN1A 3CAQA 4JN7A 4PCSA 5CSRA 4IP5A 4LNYA 3B9DA 3V7PA 3C8FA 4ATWA 1MXDA 4ATLA 4HN8A 1KLYA 3CMJA 3UWEA 2Y5EA 3RRXA 2XG9A 3ANUA 3WUFA 1KM6A 1DVJA 2FIQA 2GWGA 5LHEA 2BXZA 2CHOA 1MUCA 3BL3A 4A8IA 5GVJA 4F40A 5FI8A 3W2MA 1W2VA 3L4TA 1W3LA 1ZALA 4U5KA 4GUIA 2CLPA 2Q01A 1ZSXA 2BOEX 4LQ1A 1JEZA 1OF8A 4US5D 3WH9A 4KETA 4KCUA 1JPMA 2GJXA 1XYAA 2WSPA 4FNQA 4HN4A 4CEXC 5DRIA 2G37A 3UXKA 1HO4A 5I00A 4DAIA 2BP1A 3G0UA 5A5WA 3KBJA 5C7HA 3UBPC 3DEQA 2WAGA 3P67A 5M17A 4FIQA 1C8YA 4A2RA 2ZUNA 1GOMA 1GORA 1RAKA 3Q65A 3AHVA 3W0KA 4C7DA 3VIGA 3GG0A 1DWAM 1UWRA 1W1TA 5G1YA 3QPYA 1LUCB 3S4TA 1T0OA 4ERAA 3W73A 4XQ6A 1KBLA 1C3FA 1Q6DA 1RBLA 5GNZA 4NI8A 3GG8A 5ECUA 1V03A 5TBOA 1GOKA 2V5BA 3GWQA 3PTMA 4W85A 1NM9A 4UXDA 4GUFA 2PSNA 1R30A 1GQNA 4F0MA 2AMXA 4O1BA 1KFCA 4FLRA 4H9XA 1P0BA 4AZBA 2R1LA 1DKWA 3MHFA 5DMYA 1BXCA 2BOFX 1DQXA 1ZAHA 1XRSA 3IJLA 1PTDA 1BHGA 2HV5A 1E1CA 4W8LA 3HGSA 4XZ9A 5LIUX 2QS8A 2BSLA 3QPEA 1UIOA 1QMLA 1WZLA 3FCPA 5HBFA 5CPTA 3Q4DA 4H83A 3GFYA 4MYAA 1QASA 3LCLA 5GJMA 3W7KA 1LRNA 5C9ZA 2WPGA 2BNJA 1I2PA 2PDLA 1AUSL 1V5XA 1BPLB 1DPMA 1OGSA 3LCHA 2CZEA 4NAFA 4UTWA 1THFD 2MUCA 3H2AA 2RH9A 2OO6A 3C2OA 3R2GA 3KBSA 3S3GA 3LZ3A 2O7SA 4RPPA 3APTA 2SFPA 2WBKA 3PVFA 1DHPA 5IBXC 3ES8A 3QY6A 3OTRA 1AH0A 1EX1A 1TPB1 2C7FA 5C71A 2O0TA 2PDGA 4NRRA 2VT0A 3KBNA 2AOSA 2CC0A 1KM4A 3K1GA 1CYGA 5EYWA 3HM7A 4JXCA 3SSJA 3MC5A 5C2CA 2ZZ6A 3BLFA 3A9IA 2DZTA 1MZHA 2XN0A 4DO5A 3CPRA 4AIEA 4AWUA 1HFBA 4G8TA 3T7VA 3DXIA 5AZ1A 3FKKA 1B30A 1POKA 1M53A 4UOJA 5A95A 1JZ6A 2GFTA 1NWUA 4WJXA 1RLDA 2OYKA 2PDKA 2J7EA 4LCRA 4IICA 4D6CA 3QQ1A 4J3VA 3UVIA 4B3LA 3VIOA 2ALRA 1OIFA 2W79A 3C6CA 3DFNA 3RK8A 1GHSA 4WX2A 3ID7A 5FF0A 4JHOA 3R8RA 3T2OA 1LOLA 1ICQA 3L21A 1N2VA 3MZ2A 1A50A 3WUGA 1EJXC 3WF2A 1MRAA 3HFYA 3TOYA 5D2TA 2HPMA 1OBAA 8RUCA 4JDYA 2QT3A 4YHEA 5BYWA 2WMHA 1ZLPA 1TELA 5HATA 3F4DA 3LHTA 1GZGA 3EKZA 1FBAA 1BRLA 3KOFA 1MNSA 1GNXA 1FXPA 3TSDA 1WUFA 3VD5A 4H8NA 2E9LA 3UG5A 1I0DA 3RITA 4CNTA 3HU7A 3NCOA 2OWCA 1PCWA 3KRSA 3S2CA 3RM8A 5FEPA 2PGEA 3N4EA 3TTEA 1WAWA 4FOUA 1KTBA 4W4QA 2A6NA 3GW3A 4KT2A 1UBPC 1DIEA 1J0ZA 4C90A 1QI0A 4H8VA 5AECA 2EPOA 2DZUA 4MHBA 1E73M 3S6TA 3FXYA 1JUKA 2JKEA 4LTSA 3BQ5A 3C3UA 3BSMA 4IPLA 2PDBA 3T0CA 3HN3A 3QR1A 2PTDA 1C8QA 1IXQA 2Y85A 3OHIA 1TCMA 3QN3A 2CHRA 3UJRA 4DUOA 3SFWA 1JCTA 3OA5A 4E6MA 2R82A 4CU7A 3TYDA 4NSBA 1QBAA 2IQ0A 4JTUA 4S23A 2X30A 1YDVA 5J8LA 8CGTA 4IMDA 4DO7A 4HPNA 4GISA 2OQLA 2DQWA 2GLKA 3GDLA 3B8IA 4FLSA 2HPIA 5TNVA 4O0ZA 1MEHA 2ATMA 3VNJA 2PDPA 2ACQA 5FL1A 2YCIX 3WNNA 1PKMA 2WLYA 5KZDA 3TMLA 2W27A 4IIEA 3SIMA 1SMAA 4NJJA 2QHAA 4AVNA 3LM7A 2XVPA 5EL1A 1KXVA 3KVJA 1L6YA 2W92A 1IGSA 3MO7A 3ONCA 2HE5A 3CV6A 3OLIA 3THAA 3ARPA 1UP2A 4Z2KA 3OGRA 1NY1A 3S1XA 5I79A 4G1NA 2A6LA 2X42A 3RX4A 3DHPA 2AAMA 4HYRA 4JGDA 2X7WA 5BU6A 1H2JA 4XTDA 1ODZA 2OYLA 1KCLA 5SWUA 1PZ2A 3K1DA 3MMTA 4JTFA 4PMDA 7XIMA 3UWZA 1O5QA 2YDRA 3UR2A 4NAEA 3U5YA 4U2YA 5CGTA 1TIWA 1CGTA 5B80A 3M6YA 4A4AA 1M68A 5JH2A 2V0TA 2IQTA 2X1IA 4D6GA 2WHLA 4DQWA 3T40A 4YU1A 2ZVRA 4D71A 2Y5JA 1X6UA 4IGMA 3SQSA 2FDSA 4V1XA 2WANA 3TC3A 4Y8EA 4CNPA 3QPZA 4XKYA 4DY1A 3EOUA 3ZJ7A 3B40A 1TWWA 2Z1KA 3IIXA 3R12A 1WQ5A 3VIPA 2PGFA 1YDYA 3H24A 2ZOXA 1L9WA 1M1BA 2J27A 4KFNA 4HU8A 4EWJA 3NIYA 1WV2A 1AQHA 4RW3A 3ABQA 4Z1AA 3GY1A 4DXVA 4P8VA 1Q65A 3VPLA 4J4KA 3FJ6A 2CWNA 3MUCA 4ERGA 4KS0A 2VURA 1OT1A 3LERA 2QQ6A 2QDDA 1F3EA 1IT7A 3DUGA 3NZGA 1VYPX 3DERA 1YW1A 3GXMA 2BB0A 2PWUA 3TYBA 4R7WA 5D37A 3V36A 2Z26A 1J2BA 2CZFA 3BGJA 3GHTA 4Y8FA 1E3ZA 3NZQA 1CXEA 2WK2A 3UVAA 3C52A 1VPXA 3CQJA 2J9XA 3QGKC 4PUWA 2HWGA 2YXXA 1ZP4A 1HL8A 1ZJIA 4L1GA 2PPGA 2VX6A 4W9TA 2QIIA 2YYUA 4QSHA 1UD2A 1WUEA 4ROQA 1KRMA 3LSBA 2A3EA 2XVNA 1HL9A 3E0VA 3RMEA 3WLPA 3GHRA 3H4WA 3C5QA 3F2BA 1IXOA 1ADOA 4J5NA 5DEZA 1W9DM 3DIPA 3NQVA 2PE4A 2OWWA 1MUMA 1R9ZA 1W2PA 3W83A 5ECVA 2VRJA 4YXGA 3GTXA 3OVRA 3WH7A 5AZ0A 2AKZA 1YRRA 5C70A 4MKNA 2DVTA 4OWGA 3W4RA 1XC6A 3LMYA 4LAZA 4K7VA 3FYYA 3OQEA 1W5PA 3HG4A 2D3NA 3GIQA 2DQXA 1LQ0A 4PSRA 2V3DA 2CHNA 1XSIA 2KX9A 5EMJA 4CCEA 1CB2A 2ZA1A 2HJPA 1T41A 4HA1A 1AZ2A 4ACZB 5AHNA 3S1GA 2NUXA 2TYSA 3WQDA 2BGNE 4PCFA 2AQWA 4Q7IA 1E1FA 3W1XA 1A53A 1XJBA 1X1OA 5K2ZA 3SEPA 4J35A 1ONXA 3CUHA 3WQ6A 2P3EA 4S3BA 3MUAA 3TTOA 2RDUA 1ZB5A 3CB3A 2CCRA 1LWIA 5AY7A 3ICJA 2QPXA 5DCBA 2DY3A 2YX0A 2VVNA 1CLXA 4DNHA 5JBDA 4YTUA 3S1WA 2CZVA 3DFQA 4PSPA 1R46A 5TIMA 3E5PA 1JFXA 3PZQA 5JBEA 5KEZA 1R3SA 3B8SA 3W1RA 1TTJA 4V27A 4CQAA 3I3EA 4WUIA 2RGLA 3PBYA 1HJWA 3L4WA 2FDMA 1BVZA 2O9TA 3FDGA 2OLAA 2ZE3A 2WZEA 2A7NA 4AZ7A 3IK4A 2ZUTA 4DJFC 1R2TA 1VGAA 5AYZA 3RLVA 1M7JA 1E6SM 4ERIA 5JXQA 4AAJA 4QE1A 1XIJA 2C18A 1G6CA 3BLKA 4IMEA 3S83A 3T9PA 1A49A 3HJZA 4PCPA 3VCCA 3SQMA 1UUOA 3STPA 1GVRA 2D1ZA 4EAMA 1UR0A 1OFRA 1JCLA 5FD0A 5G1MA 5KINA 1VS1A 1YPIA 4IF2A 4GABA 5XIMA 5EBAA 3ZVHB 4IGNA 4C6PA 1FDZA 3DBNA 4H19A 1MVYA 1XINA 4E2DA 2VFEA 4L9XA 1X97A 4PFHA 1C92A 2EPHA 4WK9A 3BLDA 3UCQA 2XYLA 3PPGA 3H6OA 3PTQA 3E49A 3LB0A 2C71A 4MB1A 3AIQA 4U5IA 3I3BA 3PUOA 3HPFA 5FF4A 2VX7A 3BO9A 4IGHA 5LA0A 5EU9A 3TMQA 1WKDA 1NARA 4UFIA 3LPPA 3RO8A 1SM9A 5HULA 2GQAA 4MZ1A 1E71M 4H41A 1KCKA 3EB3A 1M9HA 2D69A 3N12A 3S1VA 1UD6A 3N17A 3QY8A 3OYZA 2QMKA 2V81A 3MVIA 3E0LA 5DCDA 4HTBA 3U0HA 3PB2A 3CM4A 1PO9A 1W3KA 1JDCA 4WDXA 2ICSA 2VQUA 3DI0A 5IFTA 3O16A 2DDXA 1B3XA 2AQVA 3WQWA 1XCFA 3UA3A 3EDJA 4B9ZA 3WNOA 4N9CA 4ZB2A 2E40A 3L65A 4AQLA 4O54A 5E5CA 3V1HA 3I6RA 1XGEA 3B06A 3AYSA 5AHLA 4AYGA 2FVLA 2OX4A 3WEZA 3C2EA 4Z1BA 4AD0A 5HMEA 5D9PA 1TG7A 4WY0F 3WNLA 3FEMA 5F2IA 2EG6A 5EFDA 3OOQA 3CUJA 3VCNA 2X05A 4QTGA 6PTDA 3CHFA 4XAFA 4QQ3A 4RV8A 1TMLA 1TV5A 4K38A 1LLZA 4GMEA 5D8ZA 4AIUA 4LBRA 1TJ0A 3CL6A 2QCHA 3GH7A 3EWWA 4TX9A 1NSJA 1NDYA 1L8NA 3URAA 4K2SA 1MW2A 1KV5A 4UQAA 1H51A 4MLRA 1QK2A 1S1PA 1B4KA 4S38A 4F2TA 5AYYA 2WMGA 4H01A 4YL2A 1K9TA 3L4ZA 3CUIA 3CIVA 1XICA 4DZAA 1QI2A 3K30A 5IDIA 5D2XA 2H3DA 1UWAA 4LAMA 4Y96A 3BUVA 3W1QA 4GA8A 2JEQA 2YXGA 1YPXA 3THCA 4JEJA 3CZLA 4OHQA 1YNPA 4PL1A 4YVVA 2DJLA 3LCFA 3FJNA 4R9XA 3QGAC 2B7NA 1TREA 1QDSA 2D73A 1DWFM 1WX0A 1BAGA 3S5OA 3H70A 4MZ8A 4C6CA 4ML9A 3WH5A 4DIAA 2ZX9A 1NVMA 5FEZA 3VNDA 1RA0A 1N55A 6TIMA 1SZGA 2VO5A 1WOBA 3F4WA 4P8XA 4LS2A 4PRWA 1ZZMA 5HINA 3STGA 3FOKA 2GGIA 2QJNA 3R79A 4NXKA 3WD4A 3EDEA 1FWEC 5HNNA 2ON3A 2NXIA 1D7KA 1W32A 1G4PA 1UZ1A 3MSYA 2ZC8A 4HMEA 1AH4A 2V8ZA 4UTKA 4DJFD 3ES7A 1TPDA 3AIVA 4GIAA 1VIZA 3QQWA 1R2RA 1R3QA 2XINA 5AYXA 4I6KA 2R1KA 4L64A 4WXYA 2FB2A 4TVDA 4O57A 2PC8A 2NVDA 1O1ZA 3QV7A 5AC6A 4WKAA 2A2IA 4LWWA 1NDVA 1QNQA 3VKAA 2XGBA 3RF9A 1KC7A 5F1VA 4QBXA 4QNWA 5XIAA 5I2UA 4B5NA 3IWPA 3QY7A 1I75A 4YVPA 3BPWA 4XB3A 5CPNA 1DJWA 1K7FA 1IWPA 1VH7A 3C2FA 3H12A 2DVXA 1G4TA 3N9RA 4Z1CA 4Y90A 1E9LA 3PZVA 2P8CA 3UZWA 3VGGA 3NWRA 3BE7A 2POZA 3H23A 1EHNA 4FR6A 3AIEA 3RO6A 4B4FA 3DI1A 3E5BA 4EANA 4IH3A 4O19A 3UZXA 1REQA 1RK5A 2HXTA 1EEPA 1QPOA 3M5YA 1ADDA 2ZE0A 2J8GA 1HP4A 3VZZA 3RCYA 3AXMA 2X0HA 1J11A 1SJDA 2VXNA 2PTWA 4FZIA 2J7GA 1CNVA 3O2LA 3BAYA 4PTVA 4JFVA 1J6PA 3WQFA 1NOUA 5HUPA 4QDWA 4PCTA 1XQKA 4N0RA 2G3MA 2BGSA 3ABXA 3NSNA 2ZTJA 4HSHA 1TKKA 1SO6A 1J5TA 2FTYA 8A3HA 3TNOA 3W24A 3P84A 5FJPA 3W7DA 3MU7A 2Y6ZA 1E0TA 1ZBWA 2WVSA 1KBJA 2D0HA 2I5IA 1W54A 4M24A 4GACA 4JTTA 3AS0A 3N2XA 3EWYA 3F5LA 4FX8A 3RLHA 2QCCA 3P5ZA 2CEQA 3OLDA 2J6VA 4H9YA 4E8CA 3BTNA 3A24A 5CPLA 1JGIA 1S2CA 4NHVA 5I77A 3A21A 5LNUA 1KFWA 2WKLA 2PA6A 4GUJA 1D2KA 1KQYA 1V6VA 4MNJA 5I6SA 1WNOA 3WNPA 4CQ9A 5L9FA 2QUNA 4Q32A 1BTMA 3GZAA 1G94A 4DJEC 2B81A 2J7HA 1JI2A 4EX4A 4Z2IA 4FIRA 1OM0A 2Y89A 1S5VA 2YA0A 3W22A 5HJXA 1VYSX 4US5A 2PP1A 1JR1A 4IXHA 3KRZA 4GQQA 1O7AA 5A2BA 1UROA 2J6XA 3GVVA 2JALA 1MXGA 3CMFA 1NQ6A 4KEMA 1WZMA 3KE0A 4O17A 2GQ3A 3UPBA 4GIEA 3BG3A 1U5JA 3GX9A 3A9BA 3T0DA 3W23A 2I9UA 1WOAA 1IEQA 4K7YA 1I2QA 3RPTA 3NQCA 1YDNA 5BXSA 5CKSA 3TEVA 1P7TB 4CQ8A 3M0VA 1GKRA 3CLWA 1SZNA 3N2OA 2WMKA 5D09A 3ATZA 1OK4A 1KW1A 4HOZA 3HPXA 3FA4A 4BS0A 2JIWA 3CO4A 1YXDA 3MPGA 1TJ2A 3L9CA 3JZEA 2OSYA 3K4DA 4IFKA 3RU8X 4XZLX 3ZJ8A 1F8IA 1HVQA 3GXFA 1DV7A 2G96A 3U7VA 3FHAA 1F6PA 1UPPA 4NY2A 4MNLA 4PBEA 1NDWA 4X61A 2FYMA 3QQ0A 3V5OA 5ABGA 1PV8A 5AC4A 2FVMA 4A8RA 1GJWA 1JQXA 1W1IE 4UCGA 1QXLA 4JCMA 4O1CA 5DF0A 2OTDA 1PBGA 3LK6A 4R27A 4WIWA 1AVAA 1JQVA 1PAMA 1TSIA 1PZ1A 3QMRA 2R1MA 1CT5A 4HNLA 5B7ZA 1X1NA 2CLIA 2E1DA 2FPYA 4YYFA 3B03A 5A8QA 2FJKA 2Y8UA 4S3JA 1XLDA 2IPGA 2H9AA 3DECA 4LF1A 1JUEA 5BWFA 3U4AA 5LKYA 2Z2AA 4RW5A 3WMSA 2RFGA 5LNRA 3CWNA 4QCEA 1E0VA 3OB8A 3ZR5A 4B3ZA 3HQ1A 2X8RA 2Y88A 2ZZ5A 1FCUA 3SQLA 3WLOA 3ANYA 1UASA 3RG6A 3WD1A 3M43A 3QF0A 5KTLA 1MRQA 1BKHA 1TO3A 4DZHA 3ZO9A 5CC3A 1M6JA 4LFYA 1K7XA 5BWAA 1AJZA 3E74A 5EY5A 1EO5A 4QCFA 3GNDA 1XSJA 1Q8JA 4GZJA 3B8UA 3PP7A 2Q3OA 2HVOA 2HE8A 2NQLA 3G0XA 3BICA 1ZNNA 3EXSA 3AROA 1EC9A 3WDQA 5HK4A 5H8MA 2ZC1A 4RNIA 4XZWA 4G7EA 3B8WA 2OG9A 2HBXA 4JYDA 4IQJA 3UZZA 4I3GA 2PU1A 4PMRA 1LBFA 3ITXA 3N11A 3FA5A 3A6OA 1BYCA 2YA2A 4DUXA 4DX3A 4JX6A 1P5BA 3EEGA 3KOYA 2ZX8A 3W2JA 1QNOA 4LCSA 1KRBC 3M07A 4RNHA 4DRSA 4M5PA 3KCJA 1QW9A 2ISFA 4MMWA 1XD0A 1XDLA 4JTGA 2XFWA 4L4MA 4W5UA 2QULA 4A3YA 5DLCA 3TOPA 5AFDA 4M29A 1PTAA 1EKOA 1OQFA 4LYKA 4M80A 1JXKA 3SY1A 1CXIA 3PR2A 4Y2WA 3TYZA 2YLLA 1Q5MA 4PMVA 3ITOA 1J79A 3WBXA 2NLIA 1V6TA 3W82A 3PBUA 2Y63A 4WKHA 3TXZA 3VIIA 4DJED 1KXTA 2ZICA 3W7CA 1XWYA 4CD7A 3MCMA 5HUOA 3Q45A 2NT1A 4IJBA 1VEMA 3W88A 1ONWA 1XL9A 2VZTA 1UB3A 3OPSA 2NQHA 2QNEA 1SPQA 3OIHA 1Q6QA 2PBGA 4M7SA 2OX1A 4HP5A 1ZTVA 1NOWA 1KTCA 4B5VA 1OC6A 3FIGA 1R3YA 2INEA 2ZRVA 1G67A 2J13A 1KNWA 3H2CA 4S3AA 4LYPA 3SSZA 1YEYA 3EYPA 3EXRA 2XFYA 4GZEA 4IFOA 1VBRA 1NOFA 1I1XA 4GX8A 5HMDA 5BMXA 2OSWA 2PRHA 2VCBA 1H60A 1MW1A 1LM1A 3R7MA 2WOQA 3PZOA 4D2JA 4DBUA 1JRBA 1ZCOA 1OB0A 3PAJA 2EQDA 1VJZA 2FKPA 1QT1A 4E3TA 1LUCA 1XYFA 4G7FA 3M0ZA 2ZDSA 1JCXA 4BF9A 2QV5A 2IQDA 5D33A 1R87A 4RPQA 1KR0A 4RDWA 2BG5A 1DIDA 2P0OA 1KGWA 4O8AA 4S2CA 1A0CA 1OABA 3VIMA 4C6FA 1EQPA 4G2DA 5BXPA 2VUNA 4TVUA 4GD0A 3GKFA