4US5A

Crystal structure of apo-msno8
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
329
Chain Sequence
HVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSAEAAARLGLPYAYAHFITPQFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
total genus 119
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5A00
5AECA 4US5A 3FGCA 1YW1A 1LUCA 4UWMA 3B9OA 3RAOA 1RHCA 1Z69A 3B9NA 1NQKA 3C8NA 4US5D 3FGCB 1LUCB 5DQPA 1EZWA 2I7GA 5LXEA 1BRLA 4J2PA 1BSLA 1BRLB 3SDOA 3B4YA 1FVPA 1M41A 1XKJA 1NFPA 2B81A 1F07A 1TVLA
chains in the Genus database with same CATH superfamily
1XLEA 3W1AA 1FP9A 1GOWA 2EPLX 5KMYA 2QVNA 1QBBA 2EKCA 1UR4A 3GXIA 2PWHA 2W9MA 3VIOA 1KB3A 1HFBA 2ZX7A 1JCMP 3NQ2A 3NQBA 1XFBA 3QMSA 2XM1A 3BCFA 1F6YA 4A3HA 5CZKA 2HROA 3ZJ6A 1EKOA 2VP8A 2BMBA 2YDAA 3UPWA 4FX8A 4KFOA 4PB3A 4RE3A 3BXWA 1Q6RA 2C14A 5I3HA 3GO2A 4P5UA 1ZB5A 3WELA 1QW7A 1B1YA 2HE5A 3MWCA 3M7WA 2GJLA 5I0DA 3URBA 4HK7A 3W1MA 4U2YA 3OA5A 4JOMA 2J78A 2VDIA 3F5KA 1M53A 3LBCA 3M0KA 3ECQA 4NJKA 3QSTA 4LUJA 4IG2B 1XBXA 2A0NA 3AHVA 2DZAA 2WKGA 4DEFA 3BMXA 3ARZA 5BXPA 4O28A 2Z27A 4N0RA 1OFBA 5A6SA 4M81A 4RK8A 1OFQA 2PWFA 3N18A 2D0GA 2NQZA 1JIBA 3B8SA 1ME8A 1FDYA 1XQLA 3P60A 4GIAA 1UKPA 4PR4A 3VDCA 5F4WA 4Z1CA 4GCAA 3D0CA 1XIDA 3RUBL 2TODA 1YE4A 4CN4A 1IT8A 1LBMA 2G37A 3MCOA 2ZWYA 5G2HA 4IUOA 4D1IA 2OELA 2CW6A 2P8CA 4E6MA 4B92A 3QHOA 2J6VA 1C8VA 3LN3A 3ZJKA 1JVNA 1V0KA 3MVTA 4PTWA 4AWEA 1BVNP 1CDGA 1O4UA 1AQ0A 3GDKA 1VRXA 1KC7A 4JIQA 3VNZA 1C8XA 4FIRA 3I7RA 3S5SA 1HJXA 4XZ9A 2FZMA 2J7BA 4UTMA 3UG4A 1TVPA 4U10A 2HISA 3FAXA 4DYJA 3A21A 1M7XA 1ZY9A 1AJ0A 3L4WA 1X8CA 1TTJA 3HV9A 4B5TA 5B7YA 4ZL1A 4GUIA 3IEBA 5H1WA 3VGBA 4GFSA 1VFTA 3CL8A 3ZWTA 3LDVA 4QROA 3KOFA 1TR1A 3WKZA 3VZYA 4GGBA 2V3GA 1VEPA 4P8UA 3OVPA 2O9TA 3W76A 4MHBA 3WNPA 1H5VA 3I4EA 3EWZA 2YL9A 3INPA 3QHMA 5BMXA 3M16A 1W1B1 1BYBA 3LOTA 4DZHA 2OG9A 2ISFA 1DEDA 1GQLA 4KGJA 3RR4A 2P8BA 2CIPA 4Y7EA 4MZ8A 3QPZA 1ZQ5A 2GLKA 1B5TA 2F84A 4HK6A 5G4HC 1XBVA 3GTHA 1BQGA 3H4WA 3KTCA 4XD5A 2C16A 2XGZA 4MOZA 3PJWA 1L6WA 3BOFA 3QY6A 3VD7A 3LYEA 1E4LA 3ITGA 2QJMA 1DJQA 2ISDA 4UOZA 2OO6A 4P7NA 1QU4A 5HJXA 3JZEA 2D0HA 4I9AA 1ZFJA 3EOEA 2OZ0A 3HQ1A 2NXIA 3UGVA 1KTBA 1XRSA 3TQ0A 2J4GA 3XISA 1PPIA 2QGHA 5C54A 3CTLA 3BAIA 4JAWA 3AS1A 3SFKA 2D2JA 3NL5A 1JG9A 2X7VA 1EGZA 1Z32X 1MUMA 4LSBA 4OBSA 4V33A 2QULA 5GNYA 3QF0A 1EJTC 1JQVA 4UTJA 1K9FA 4JTRA 4GQBA 1NDYA 1KFKA 2V5BA 3W7RA 2YL6A 3N73A 3Q58A 1MZRA 1Y65A 3CQHA 3BVJA 4DZAA 3V18A 3TMQA 4Q6JA 3LGEA 4JIEA 2W92A 5AHNA 4IP7A 4TTGA 4ZTXA 3R58A 1W9BM 4O13A 2CLHA 4UTHA 1YNYA 2E7FA 5CJNA 1XV8A 1QAPA 2FTPA 2O0TA 3UWWA 3ARYA 3TTEA 3E2QA 1MO0A 1X6UA 1W17A 3PZTA 2Y8VA 4X63A 2O7SA 4JY9A 3L5MA 2WK2A 4Q33A 2A79A 3DX5A 3A47A 1UCWA 1TUXA 2HSAA 4L6HA 2F9RA 4HK5A 3ZT5A 4R34A 1H62A 4QLKA 1E15A 3TFXA 2DFAA 3CHEA 1XHGA 2NVAA 3HIJA 4O15A 3QLLA 2VX5A 3B0UX 5BZAA 1FKWA 1WBHA 2BVDA 4LT9A 1FWRA 3TYCA 1EWDA 2EJAA 4XZWA 5I3FA 1UASA 1E1FA 4H7CA 5H91A 2TYSA 2OZ3A 1VFMA 3GUGA 4ERAA 2XH0A 3OEXA 5CKSA 1X8FA 1WAUA 5JH2A 4M7SA 4AHOA 1WZKA 4J3WA 4FSAA 3GH7A 1TWDA 2GGEA 4PODA 1V5XA 3VD5A 3WIJA 4AD5A 3DGRA 3EA3A 2CLFA 1VPXA 1VBUA 4C7GA 3V0TA 3TC3A 1SJCA 1EO5A 4ZE4A 2W63A 3SIZA 2I14A 2XIJA 1LP6A 2FTYA 1KBKA 1UKTA 1JXJA 1NQKA 3D3AA 1E51A 3GG0A 1ZL1A 2XFFA 1CENA 4Z0JA 4PTDA 3W2UA 1A4MA 3W7KA 2YLAA 1A4LA 1NOFA 2W62A 3GNXA 4F48A 3DFTA 3QTPA 3S3GA 1IIHA 3TCEA 3GHRA 1B9ZA 2V69A 5LNRA 2NUXA 1Z3NA 1B9BA 4QS6A 3NG3A 4XZMX 2R14A 2FKPA 4W7WA 2QDGA 3WMSA 3P61A 1ADOA 5ECUA 2CWNA 4L64A 1MXDA 5HXMA 1RLDA 4LAMA 1Z42A 4AISA 1QO2A 2E68A 3EB4A 2C8NA 3L2LA 1EP1A 2ACSA 3DCPA 4KKXA 3I6EA 4J3UA 4MB3A 1E3ZA 5LNUA 1OD8A 4S3BA 1LDCA 4GUJA 2WMIB 2ZA2A 4K38A 2YX0A 4ZO8A 1E6QM 1F73A 1ITXA 1B90A 2QPUA 3B40A 1UWTA 1EO7A 2YBTA 3S6TA 4AX7A 3H12A 1B3ZA 1KO0A 4YYCA 3NVDA 4Q8WA 1TZ9A 3AHZA 2DW6A 2QJIA 3G1FA 1FP8A 3MQTA 2FVMA 4F0HA 3RX2A 5HUPA 1UR8A 1LQ0A 3NWRA 3LHTA 5BWFA 1W3KA 4HPHA 3TH6A 3VGEA 4HSHA 3V75A 5I23A 4GKTA 2ZZ2A 2A2IA 3PTKA 5BW6A 1XXXA 2VVNA 2G8ZA 4R85A 3GHTA 4R53A 3GR4A 3VKBA 1Z69A 2HBVA 3MW7A 3WFZA 4YCPA 3GIYA 1A5AA 1GK8A 4JIHA 4DIAA 4KCWA 2H90A 3WH5A 5DX7A 2OSYA 1BEUA 4DPPA 1ZJIA 3ES8A 3UJ2A 1FWIC 4WEVX 3CH0A 4O0QA 1FCVA 3MKVA 2OT1A 3II1A 1K1DA 3IJ6A 4CNOA 1K8ZA 3HGJA 1NH6A 4QE1A 4LXFA 1XYCA 3A4XA 1UD2A 4CNSA 3QM3A 2BBFA 3PF3A 1K7EA 1BLIA 4NNCA 3POCA 5T26A 1HIZA 5EU9A 4E2BA 4YWSA 4QIUA 3LHZA 1W56A 1GG1A 3AUJA 1JCJA 3MZNA 4GNJA 3ZS4A 2PA6A 3C0SA 3L0NA 5DANA 3SCUA 2Q3RA 1O5RA 4GVHA 3CAKA 4PULA 3BLEA 3EX4A 3T07A 5C8BB 1XR2A 2ZRXA 4FALA 3VGGA 2GJXA 2TAAA 5E6ZA 3VE7A 4ZXOA 4PUMA 4NIRA 1UQZA 1L6SA 4AAJA 5LA0A 3A9BA 3NYZA 4RZ6A 4DWSC 3O1NA 2PTDA 1UUMA 1EC7A 1EUNA 1HKKA 1TWSA 4S39A 2XIMA 1H51A 3JW7A 3GSMA 5AY7A 3T55A 3VIKA 4O10A 1AODA 4F9DA 1OK6A 1TZ7A 4G7EB 2PGWA 2J9YA 1PCKA 4LBSA 4IJCA 2A4AA 3ITXA 4KEVA 1D2KA 3C2YA 1KM4A 1ZAJA 5MHBA 4TIMA 1QNQA 2I57A 3LD5A 3LV5A 4W85A 5FJJA 1VEOA 3V35A 1KFLA 3S2LA 5HNRA 1WB0A 1WUEA 4DUWA 3W74A 1RHCA 2YDQA 3SY8A 3OGRA 2CLPA 2X0HA 4JIIX 4AQLA 2EPNA 4NZ5A 4MKSA 1P7TA 1ODUA 3BZJA 4FXFA 5A8GA 5I02A 1KBJA 1GOMA 3KCLA 4C90A 1PZ0A 4A3UA 3PPCA 3D3FA 3LGDA 3VIHA 1UP2A 1UPMB 1SR0A 3UWEA 3MP5A 4AW7A 1WDPA 1KV8A 1MEIA 3M5XA 1S5MA 1QI3A 1VCVA 1XPGA 3EWUA 2OB3A 3SCNA 4DF0A 2A6NA 4FHAA 4NAEA 1QI0A 4DXVA 4OT7A 1QK0A 3RILA 1MQQA 2QR6A 3PJUA 4C6QA 2W67A 4C6DA 2VZVA 3F5LA 5TAOA 1KR1A 3DU0A 4L65A 2WHMA 2VOMA 1WZLA 4MAZA 3RM4A 5K4ZA 4Z2HA 1H60A 3R43A 4DO7A 4NXSA 3ITOA 5KZMA 4DAFA 2RJGA 3R89A 3UPBA 3TC6A 3OIHA 4O1FA 4IIBA 4ML4A 4C6NA 4AEOA 2VDHA 2GDVA 3FY1A 1KQYA 1UWUA 4Q7IA 3SQLA 3WNMA 1DXFA 3WLLA 4XZBA 4Y90A 4DBSA 3CWHA 2DUZA 4OUIA 4R27A 1P4CA 2ZRWA 2OQHA 1BF6A 3GU2A 2XJ7A 3GXMA 3JS3A 4DZIA 2XN1A 3D5HA 1WOAA 3PWAA 3L21A 1Y7VA 1V3HA 2XVGA 3USZA 2Z24A 5FF2A 2GYIA 4WY0A 3WD0A 1AA1B 1CEOA 5L6UA 1J9YA 1EXPA 5FOOA 4HOXA 4W88A 1B4EA 4H8NA 3PZQA 5FCZA 3K5XA 1FHUA 4DYEA 4TX8A 3ZFHA 3U7BA 4CU7A 3WENA 2ZZ7A 1H5YA 1XKYA 1DWIM 1E73M 1XCWA 1NU5A 3RDKA 3KEHA 4W8BA 5I79A 1T40A 3S1VA 3QOMA 2Z7KA 4I9TA 3S0CA 3WQ5A 1S46A 1OFEA 3TZNA 2VVSA 4OTKA 2JKAA 1KGWA 4GC4A 2X1UA 1ELSA 5D33A 3KCJA 2ANUA 2WC3A 1IEIA 1BVWA 4D1JA 1YQ2A 5K9XA 1TELA 2B7PA 5BU9A 3GW0A 1FA2A 4UFJA 2PDJA 3VXGA 4C65A 1NF7A 1VJSA 3I68A 1M68A 3BLIA 1RXOB 4MDOA 1OC7A 1W3NA 3MDUA 3VNIA 4TMCA 1P0EA 4QQUA 1L6GA 1A47A 3GG1A 2E9BA 4M24A 1XIBA 4XZIA 3VIGA 1T5AA 1SO4A 1JZ3A 3POHA 3GW3A 3AOFA 5M17A 2DSVA 3LU2A 1KRAC 4QM1A 2P88A 1JCNA 2DVTA 1KWKA 2CZVA 1OJXA 1Q6OA 3GNDA 4GZJA 3UXLA 3NJ3A 4J40A 3WH9A 3R11A 4LPCA 3TAKA 2FDSA 1VIWA 1EBHA 1QXLA 1HO1A 3WDJA 4IMGA 2WKJA 5CAKA 3WQ8A 4NHVA 4LVGA 3U3HA 1YXDA 1A3WA 2ZUMA 3UG5A 4FNSA 1V7AA 2IKJA 5D4YA 2ZUTA 1MSSA 2XPKA 3SRHA 2OQLA 1IXNA 3OBAA 4IIHA 1UR0A 3AHXA 3LHWA 5I3KA 1F07A 4QSHA 3T05A 5PTDA 2R6OA 3ZVHB 4K7YA 5D03A 5K7JA 4AY7A 4O50A 1J79A 1Q6QA 1QW8A 1RP8A 1TPDA 4AYSA 5HK4A 4KRZA 4L80A 1E43A 3F4VA 3O9NA 5EGRA 3LNPA 4RNFA 4U31A 1C90A 2Z2AA 1IIGA 3KP0A 3RMJA 1E1CB 2WW5A 2WM0A 3A5VA 3LSCA 2F6UA 3DI0A 2AQOA 2KX9A 3GR8A 3W6LA 1QR7A 5BRPA 3VNYA 1XLAA 4AU0A 4FNUA 4HPJA 3WDIA 3MYPA 1X6NA 3WQWA 4QQ3A 3IJQA 3WQVA 2PDLA 4QITA 2OWWA 3WUBA 4WSHA 3W23A 4H2CA 3W7DA 3CUJA 3EDKA 3ITVA 4PFHA 4CNUA 1IT7A 1UD6A 1W8GA 4IPNB 3DHUA 3G1VA 3W7HA 2WSRA 3IWPA 2ICSA 2O9RA 4OWGA 4GUHA 3TSDA 3RPDA 1OX5A 4AEFA 4Q4QA 1M5WA 2DIJA 3LZ5A 3FHAA 2VD9A 3WQPA 5CPLA 2QUNA 1QHZA 1NWSA 3RRAA 4C6IA 1TG7A 4QNWA 3B06A 1JYWA 2JALA 3QOKA 3NM3A 3KWSA 2ZXDA 4E8CA 3LV6A 3CZKA 1S2VA 3AO0A 4ZQCA 2H6RA 4CCZA 4P61A 1XSIA 1VD6A 1W3LA 4TOQA 2HNHA 3PZIA 4C6PA 5J8LA 4H9TA 5DMMA 4H83A 3XINA 4JNYA 3WMBA 2VZTA 2X1IA 1GPWA 4I9MA 3DENA 4NZJA 2PWGA 4P2VA 4ZZ9A 2Z1WA 2Q6ZA 3KDNA 4WR3A 3C2FA 3S47A 1W9UA 1X6LA 4PL2A 3V4BA 4Q8OA 4PUEA 1I2RA 2X16A 4MM1A 2C1GA 3R0DA 2VZUA 2XGBA 2A3EA 1TO3A 4IQDA 3KP1A 3ABSA 4DJEC 2WYSA 1H7XA 3VINA 3W7LA 1XSKA 4UZUA 3AYRA 2X0YA 2GQAA 5FJOA 5HA7A 2QCDA 3ONCA 1ISVA 4H9XA 3V5CA 1ME7A 4D9PA 1CECA 2WAGA 5D9MA 1R5YA 3IUHA 3GDBA 3RLVA 1R87A 5CQ1A 2WLZA 4ROQA 2FGLA 1RSCA 1PZ1A 3PNZA 4ACYA 3PVFA 4S3GA 1W9XA 2Y62A 4XB3A 3FSTA 4ASTA 4XZHA 2VEIA 3CWOX 4HA3A 4W89A 1O5QA 2OSWA 3EXSA 3FEMA 5TQLA 4JICA 3PPFA 2NV2A 4LGXA 4N2YA 1K4GA 1TV8A 3NXLA 3R0UA 3FDGA 2J77A 2ALRA 4A3RA 1REQB 4UNIA 4JDYA 3SI9A 2PP1A 5DELA 3RNDA 2Y24A 2QDDA 4GQGA 2Q01A 3PNUA 2NLYA 4LOCA 1C92A 3GVRA 1AMYA 2J9XA 4GZ7A 2DIEA 3Q67A 2GVLA 5CG0A 3VMNA 4N02A 4WJXA 3WJZA 1OBAA 3TN5A 2Y7FA 4FOKA 4EVZA 5LIWX 1UR9A 4OECA 2V82A 3PB0A 5LGZA 2WNZA 3WDQA 2B7OA 2VWSA 3ICJA 2G96A 1S5NA 2D3LA 4KT2A 1EF2A 5A6JA 1R2SA 1SSDA 2BP1A 1E6XM 2I5QA 3SJ3A 4YLWA 3WLKX 4FNTA 4H8VA 1HG3A 1OINA 1YDVA 2PGRA 3E0VA 3LX9A 2V2DA 3LENA 3W7MA 1EP3A 3W82A 3B9OA 4GQQA 3NO1A 1HKJA 4GE8A 3ENLA 1RCXB 3UYCA 5HPOA 3UY7A 5LXXA 4GNVA 1UZHA 5JXQA 1KKOA 4IG2A 4P8XA 1PYMA 1Z41A 3EWXA 1HJSA 3R10A 4W7VA 1LL7A 1NVMA 2X41A 1TWIA 4RZ5A 3B8WA 4WGXA 3NPWA 3EMCA 2R9RA 1EF3A 4IQJA 4IFKA 3KL3A 5ECVA 3EZ4A 3U2OA 1KM6A 3AMGA 3DEQA 1T99A 3NQEA 4Z1DA 3QR0A 1NP0A 4NL1A 1Z44A 4MZ1A 1NWRA 2PDQA 4O53A 3OB8A 1RK5A 5D02A 1BFNA 2A3HA 1KKRA 3LERA 4PUWA 5CPNA 3BSGA 3W2KA 2WM1A 4B2DA 4D8AA 1O6IA 4QTGA 3SUSA 2C0HA 1NDZA 4R9XA 1RCOB 1RQEA 1DWJM 4P8WA 4PTMA 5IXEA 2ZDSA 3VX0A 4DRSA 4D6EA 4AVNA 4MKNA 1VB9A 4IP4A 1P7TB 1GKRA 3EDDA 2ZVIA 3I3EA 4F79A 2I5IA 3THUA 3HGSA 1PTAA 2DT3A 2WQDA 2C7FA 3HGOA 3LQGA 3T2QA 3MYOA 1GJUA 3NURA 3UA3A 2HK0A 3U57A 1C9WA 1REQA 4I3GA 3P80A 5C5YA 5AYXA 1PZ2A 1XJBA 3SBFA 1W1TA 1Y5XA 1VYRA 4Z1YA 1UQYA 4TQTA 4XKYA 4MNMA 4ZVJA 3QVQA 4JPGA 7TAAA 5CAHA 2Y85A 2FHCA 5K9DA 1IXPA 4BI7A 3PUEA 3KM8A 2HPMA 3FAWA 1I75A 2DJXA 3H8AA 1LWIA 3EWCA 3KHJA 1F2JA 1EBGA 3IJIA 4Q4OA 1PIIA 4AC7C 4KERA 1IWAA 2CITA 3DUGA 1GTEA 4L1GA 1D3CA 2PFHA 4Y8EA 3WBEA 4ADUA 3UESA 2CZDA 4DJDA 1PX8A 1S1PA 3H2OA 4Z2JA 2NQ9A 1QPNA 2ZUWA 3KL0A 4S3JA 3W01A 4X2PA 4QJ1A 3PZVA 2F2HA 1B3WA 1WV2A 3WLPA 2FPVA 4IM4A 1XIHA 1KM2A 1ZJAA 3UNTA 4Q4MA 3STEA 3KOXA 3USBA 1QASA 3R5EA 4YTQA 5TBOA 3DG3A 4PBEA 3QR1A 3VVGA 1J12A 3T8QA 3Q94A 2XYLA 1OABA 1IHIA 4H2HA 3FDKA 3N2OA 5A6TC 4N6EA 1AQMA 3DOPA 2CPUA 3ALGA 3CV6A 3CXOA 1F8IA 1JR1A 3P74A 1DXEA 4A4AA 1W32A 3E0WA 3H23A 1VS1A 2C18A 2NW0A 2PLKA 4G5DA 4LUTA 1RA0A 2CXEA 2DH3A 3OVQA 5C55A 1OADA 2GDQA 1OB0A 3W84A 3BSHA 4LYKA 4D6FA 5LGXA 3S83A 1LQ2A 2IUZA 3APTA 3PZNA 4L4MA 4JX6A 3DHFA 1P0DA 4WDUA 3B8VA 4BR1A 2J7EA 1BRLB 1TMQA 4Q7BA 3S2JA 4J2MA 4LWWA 2IPGA 1VFFA 1ZS2A 1EQCA 3CZ8A 2AMGA 3TIMA 5HR7A 3W22A 3QJAA 2E6AA 3PSWA 4W8AA 5AC5A 1IGSA 4UZSA 4C6MA 1B3XA 3IVSA 4X9SA 1EXBA 4A3QA 3CBWA 2PUZA 1R8LA 3ZVIA 3GDLA 3BLLA 4LANA 4FMVA 5LIUX 4NYYA 3MUXA 2PPGA 3K30A 3WMLA 4DM1A 3FW6A 3C8FA 4DVOA 3AMDA 3U4AA 1RPKA 4A8RA 4PTXA 4LBUA 3SADA 4NI3A 3DGBA 1HT6A 2ZOXA 3BAWA 4DN1A 3W1PA 4RNHA 4HPNA 3A9IA 3R12A 1I1WA 3RPMA 3R8RA 5FESA 1GYMA 5HMFA 1KBBA 1JPDX 5CPQA 5ABEA 3VIMA 4H41A 3S5YA 2Y1HA 1RH9A 2KAUC 5AHIA 3NO3A 2REQA 4B5SA 1OX6A 3F4DA 4MIMA 1NWTA 4QJ4B 5EMUA 2QW5A 4FEZA 1HL9A 3O6AA 2X2YA 1H50A 4MF4A 4YVXA 2PWUA 2A3LA 2EPOA 3PJTA 1H09A 1HO4A 1XLCA 1EDGA 1K03A 2H9AB 3M0YA 4JQ4A 4X61A 1CLKA 1B3YA 5ENLA 1R3RA 4I9JA 1R85A 2PURA 1XICA 1HVQA 1MYRA 3SCSA 4N9CA 3AWNA 4AMAA 4EK7A 2HS8A 4A2SA 3P7YA 1A5SA 3MV11 1QWKA 1E1CA 4UQCA 3CIXA 2B4GA 2O56A 4BY3A 2DZBA 1TPB1 2QCHA 1RBLA 3GHUA 2O55A 2GFTA 4N4QA 2Y8UA 2WMGA 3W3OA 4IOTA 2X42A 4LAOA 3WEMA 5E0CA 2Z2UA 4FAMA 5CZJA 3VMOA 2NX9A 4GIEA 1RV8A 3CUGA 5CJMA 5AB3A 1G69A 3BJSA 3UR2A 8TIMA 1PXGA 3MP3A 2OMAA 1ITCA 3W02A 3CWNA 3R8GA 1MNZA 5HUOA 1HN1A 2XVKA 1CGUA 4AF0A 1R47A 3TSBA 1HF6A 2RDWA 1M65A 1Q63A 4GYJA 5EMLA 1MQRA 4UBPC 4O54A 4GC3A 2GZXA 3AHTA 3SB0A 3N9KA 5LXEA 3UXAA 2DSUA 1E3XA 4KRTA 2V8ZA 2YB1A 3WNLA 3F5JA 4LTSA 2CKRA 3KBVA 4AZBA 1M04A 1EA9C 4OQVA 1DWAM 1VLWA 2FLIA 1SM9A 2WZEA 4WRHA 1D3GA 1JZ2A 1OCQA 2Z4GA 1TRDA 4O16A 2WO5A 3WFLA 2PDFA 2VZOA 3JRKA 3W1RA 3OOQA 3BG9A 3NL2A 1M01A 1OT2A 5D9OA 3S2NA 1EHNA 1RLCL 2JEPA 4L9ZA 3N04A 2OCZA 3DFHA 4JFWA 5A6BA 1TPWA 1JZ6A 4WQ6A 1JXKA 2PMQA 4YWIA 1RBOB 1ZJHA 1ZJBA 4IHCA 3H26A 4UUIA 3V7PA 4GI9A 5EMKA 2ZTKA 2NSXA 4NF7A 3LSBA 4BHYA 5HNTA 3WLIA 1PX3A 5MF5A 3V16A 4D2JA 4QE4A 1VIZA 3KBJA 3GQYA 3AC0A 3WL0A 2Z1KA 3GFYA 4GNKB 1EYWA 2MUCA 3EWYA 6ENLA 1UD4A 3QY7A 3TA9A 2VRJA 1QWGA 4RW5A 3SCTA 4Q8PA 4PUNA 3PWIA 4XWUA 5D09A 3EWBX 3LUTA 4HJWA 3W86A 5IFPA 2X1TA 4NQ1A 4RLIA 4B90A 1SZGA 5REQB 4MJZA 1H41A 1H7WA 1TSIA 2GGIA 4JL2A 3NVTA 4JTGA 4TVDA 1AH4A 1RUSA 4DLFA 5HPCA 2P0OA 3JVAA 1A5UA 4BI5A 3UZYA 4K3ZA 3CB3A 1F74A 1KD0A 3OW1A 2VCAA 3L9CA 3MSYA 4AD3A 1UMYA 5A8MA 1EDQA 1XUUA 2VEFA 1QRQA 3CUIA 1EP2A 1WCGA 4GYKA 3HPFA 3OA3A 4R33A 5A69A 1R0MA 1Q6LA 3FJ6A 2CESA 3GTFA 3SIMA 3NYDA 3K4AA 3IRSA 2RH9A 3KS6A 3UG8A 4U4MA 1E6PA 2GJRA 1QPKA 4D8LA 3KBNA 2JF6A 5LA1A 3UF9A 3UXIA 3W81A 4OKDA 1PIGA 4CQAA 5AC4A 3W7CA 1CWYA 3M44A 1WZMA 1HKWA 1TPVA 1G9HA 4PMYA 1A0DA 1A53A 1E5JA 3U2EA 3UJSA 4MDPA 3DG6A 4E8DA 4FLRA 4IXHA 4JXCA 4M6PA 1BYDA 1KXTA 4AHPA 2DEPA 5CJ5A 3VDAA 4NZ4A 2AKMA 1MUWA 1H63A 3AXXA 2WPBA 2G3NA 2ZA3A 3NGJA 5AOUA 1SYTA 3TCSA 2YZ5A 4IMCA 1EJXC 2YA1A 1VJIA 4GFIA 3KFTA 4GYFA 1Q66A 4IT1A 3M6YA 4CUCA 1LTDA 1AD1A 4I7VA 2QQ6A 3ARSA 3EEZA 3BCJA 2Y70A 4DXXA 4E4UA 2OZ8A 1WUFA 3TZFA 4R7WA 4ZEPA 3NDOA 3E02A 3UNDA 1TQJA 1LF1A 3SCQA 1J6PA 2RKXA 4J4KA 3TTSA 1WX0A 3OGSA 3RXZA 4JKMA 1N2VA 1RAKA 5CCZA 1V0NA 3WEOA 3QGKC 3HB9A 4DJFD 3N3MA 1K77A 7ODCA 3NQAA 4MYXA 1UKOA 2Q8ZA 2HPIA 3DYMA 4UQ9A 3ZLGA 1KCXA 3IIZA 3PBMA 3NQGA 3M41A 2J74A 2P76A 1PAMA 4D8ZA 3HQOA 3EWWA 3MMUA 5CH9A 3VKAA 3CQ0A 4R9OA 3PS7A 4LF2A 1TRIA 3I3DA 5A3HA 4ADSA 3N4EA 1AH3A 1XRFA 4C91A 1H61A 3EKZA 1TCMA 3VKJA 3UETA 2VELA 3QPYA 1XC6A 3NM1A 2HCVA 1YMYA 1BGAA 2Z7GA 4CD6A 3C3NA 4JGDA 3CS2A 4WD0A 3T42A 1FY6A 4H1ZA 4FXSA 1NOWA 4ZO6A 2ONEA 4G7FA 4RKAA 3MVIA 4KWSA 1VENA 2W91A 4P7OA 3O16A 1E6ZA 2Z1BA 4HU8A 1J0HA 3M5ZA 3OLEA 4AG0A 2Z2BA 1SFSA 4O4VA 4TVCA 1TWZA 4H9ZA 3GBDA 2IQDA 4HIBA 4M6VA 1RK6A 1G4EA 4WKHA 4ZTYA 4IXXA 2VMFA 4J28A 4GXPA 5CC5A 3NQCA 3GC5A 1TQXA 3RJYA 4IMAA 3FK4A 1TVNA 1TV4A 2QAPA 4AEEA 4O57A 2HNEA 2Y4SA 2JGQA 3NQ8A 2EHHA 3T40A 1KFWA 4K37A 2Q71A 3GH4A 4CD5A 1NEYA 3VGDA 3VCNA 4JL1A 4M56A 3LTPA 3MBDA 3WLQA 5EB8A 4Q8UA 4JX5A 1ZRQA 2EO7A 2QS8A 4JTIA 3W1UA 2Z1SA 4CN6A 3NSXA 1U5HA 3NA8A 1TR9A 4W87A 2PU1A 1PWLA 3FA5A 3AAMA 1EA0A 1C8QA 1XGZA 1HL8A 5HWNA 3IRDA 3TJ4A 4HA0A 1LT8A 2EPHA 2XDFA 1MW2A 2BGQA 2OJPA 3FHQA 2VGIA 3KBWA 3WBYA 3GS6A 5CC7A 4TUFA 1ZP3A 3CPUA 4UTTC 1KXQA 2IXVA 2FHBA 1R38A 4X22A 5M3WA 4WSJA 3QKZA 4ICNA 4INFA 2VC6A 1XL9A 3EPNA 2QCNA 4PFMA 4GH1A 3BV7A 2ZZ5A 1E4MM 1SFJA 1SFTA 3B9AA 3E5BA 4PMUA 3IPWA 4LCRA 1WKEA 1ZGDA 1L8PA 3UW6A 4F0MA 1JAKA 4OBRA 5HQEA 4QEHA 2G4FA 2VCBA 2OGJA 1YTKA 3MZ2A 4QG6A 4CQDA 5KSWA 2D24A 3EPOA 2R91A 3DH7A 3IVTA 3M7SA 2LLEA 1HX0A 1UYQA 1BSIA 2WNWA 2Z1VA 1DJXA 5D04C 4QDPA 3GC2A 1H7OA 2FTWA 5LIXX 1I45A 4MWAA 1EDTA 4GQRA 3KTSA 3WJXA 3H2FA 3WLJA 2GPTA 4TX6A 2DT1A 1KFBA 1ONXA 3VMPA 1WBJA 4NX0A 2CCRA 2PDGA 2PZNA 3W7QA 5AZ1A 3VM5A 3I3BA 2BGSA 1FFRA 2G3JA 3OGVA 4DM2A 4XISA 4ICMA 1W5MA 3TTOA 2DT2A 5FEZA 5AC6A 1DPMA 5EPDA 4DQWA 5A2AA 1DP0A 4GXWA 1RALA 1Z7AA 4NRSA 2SFPA 3DESA 3HMCA 4B3ZA 3RPTA 1WP6A 3H24A 4HPGA 2VEMA 4JYEA 4DX3A 1YBQA 5JH1A 3OG3A 2EXOA 1UWRA 5A8PA 4K1WA 1YE6A 3KAOA 3PBUA 3APYA 3NCOA 5EBUA 3W83A 4AFYA 1GZGA 1U22A 3I6TA 4GACA 1GPFA 1A50A 3H2EA 2RHGA 3WUEA 3N15A 2Z1XA 5EMJA 2C0AA 4J2PA 1LG1A 1WAWA 5FKYA 1G4SA 1V51A 3GIQA 4GWEA 4IMEA 1O1HA 4QR6A 4W93A 1IXQA 3MUZ1 1DIKA 3NPVA 4MNJA 2GGJA 2GDUA 1NJJA 3CAWA 1C9DA 2D69A 1J6OA 3UXKA 1JCLA 2QDEA 4OE7A 1XIJA 5M2FX 3GAYA 3VABA 2BSLA 1TMLA 4QCEA 1P5BA 3BQ5A 5DRCA 3EA1A 5JU6A 5IHSA 1Q5MA 2WVSA 3G1HA 1UKSA 2Z00A 1A5KC 3MU7A 4L6DA 4J3XA 4LF1A 1JEZA 3UP8A 1WDRA 1K02A 1S5VA 1PE1A 1SO6A 2R94A 2POTA 5LZLA 3WF3A 1XIMA 3BDKA 2ZQ0A 3CUHA 3WN6A 4U33A 1LOSA 3RIKA 4GX8A 3FV9A 3SGUA 2NSOA 5C9UA 2VWTA 3CIVA 3D46A 2WBKA 3KRSA 1YPIA 3NZGA 1S3TC 2WC4A 2YCEA 4MB5A 5BXRA 1Z89A 3KLKA 2BODX 1DOSA 5E1QA 3NSNA 4JZ5A 4N7QA 1K9DA 3W6YA 3B8UA 3B0VC 2FFIA 1RJRA 1OCNA 2VZSA 3AIUA 1W3HA 4QHRA 2PDIA 1I2QA 5DXXA 1EPXA 3N12A 2PE4A 4WGHA 2ZZ1A 1R3VA 5HINA 3RM9A 4UTFA 3HV8A 3CV2A 3TYZA 3E38A 1UP3A 4UFHA 5CZTA 4LAKA 3FCPA 4WJ8A 4WLCA 3E96A 3TAOA 2HBXA 4IGNA 4RW3A 4OV9A 1XLBA 1QFEA 4M0XA 3B8IA 2G3MA 3T4CA 3TP4A 4N4PA 3PG9A 4WIWA 7ENLA 4YYFA 3WX7A 1V3LA 1MWOA 4IISA 1V02E 4B5WA 2H9AA 4WKAA 3AIRA 1XDJA 3V0SA 1NAL1 3G1YA 4S3DA 1EEPA 1NFGA 3TYAA 3FX4A 3IGSA 1PBGA 3S8HA 1KLYA 1V3KA 4S1FA 1DWFM 5AYYA 3T81A 4KH2A 3E5PA 1ZBWA 2DDXA 3HF3A 5JBFA 3ISIX 5D30A 1H49A 1J11A 1RPXA 4WY0B 2PTWA 4UIOA 3RRXA 2FZDA 4O8RA 3EMQA 4RDYA 3W28A 4QJ5B 2VGGA 2GUUA 1L0PA 2E4TA 3VFLA 2CKSA 3G8EA 4QBXA 4REQB 2WCGA 3CZEA 2ZKMX 2INZA 2R1MA 4TV5A 4ZENA 1GJPA 3QMTA 2WJZA 3HURA 4RJEA 2OT0A 5BNKA 1N8FA 2JBMA 1O94A 3LCFA 1MQPA 5BCAA 4XSMA 1DIDA 5CC3A 2BG5A 1DHKA 4XZLX 1EJRC 3CPGA 2J7GA 4QLJA 2E5CA 2Q8XA 3HG2A 3KWXA 4TTUA 1V6VA 3V3WA 4LV9A 2V3FA 4AUBA 4AZCA 1PEZA 2C13A 2HK1A 3QLDA 4CD8A 4B2DD 5AC8A 1W3JA 2E6FA 3H54A 1TUFA 4H3DA 4RE0A 3WD4A 3O6YX 1FX6A 3CHFA 5T9CE 3LPGA 3VD9A 2IMRA 3OO2A 3CMFA 5LSMA 1IEWA 1T6MA 5I5RA 4IPJA 1MMFA 3L7RA 1JF6A 3VD4A 4N9EA 3TVAA 3UT0A 4FLOA 3JZUA 3FVDA 3E9AA 4W5UA 1HL2A 4DAIA 4O0ZA 3KVJA 2BWGA 4H9VA 3HJEA 1KNWA 5A6LA 3WJYA 3WQFA 2QZRA 3LI1A 1GQNA 3U2CA 1V02A 1KM0A 2FJUB 1OYAA 2A21A 4C7DA 1XX1A 4NJJA 3S46A 2ZRVA 3WQCA 1LT7A 1TCDA 2YXOA 1MW1A 2QUMA 1UZDA 3T0CA 3PTQA 4G56A 4HVXA 5CEWA 2XSAA 5H8MA 5KEZA 2GK1B 1JNEA 1O5KA 2VYOA 1PIFA 4EAYA 6XIAA 3BW2A 1VFUA 1TPEA 5E9XA 4DWDA 3SGZA 4U3CA 4YVPA 2HJPA 2FZBA 3WJWA 3U0HA 5DBTA 1AJ2A 3EB3A 1P1XA 4RPPA 1OFAA 2XIOA 3MCMA 5REQA 3T2PA 3GNOA 4MUZA 4OUEA 1D7FA 4JTSA 3AS2A 1E72M 1OZQA 2REQB 1K8XA 4DLMA 1W1YA 2GK1A 3BSMA 5DRIA 3O06A 5IHRA 4J9JA 4LYPA 2WNQA 5CGTA 4M7TA 5G1TA 3TDFA 4IWWA 2NX3A 2ZRYA 2DSZA 3MV01 3R79A 2WXDM 2TPSA 3SEPA 3W85A 3RR1A 2RDUA 3DECA 4DJDD 4OJYA 1AQFA 2E0PA 3FYOA 3G0XA 4I6VA 1WXZA 4E2DA 3C2VA 1MRAA 2WQPA 4R7OA 3MDWA 2BOGX 4PCFA 3MUY1 4I5RA 1QBAA 2OODA 3G8RA 4CLMA 3WF4A 4F9JA 1CB2A 1IZKA 3BLPX 5F2GA 3PAJA 3URNA 2ZZ6A 4S38A 4M19A 3SRFA 1QUMA 5D2XA 1LYXA 1C93A 2V6AA 4Z42C 1OCBA 3M0IA 3W7PA 4Z17A 4A6GA 4LY4A 5LHEA 1UB3A 3IVUA 3OLDA 4IPIA 4OOUA 2VEPA 4WX2A 4F4RA 2ZDRA 3IK2A 4GOAA 4N9BA 2NXHA 3STGA 1BHGA 2DSKA 3TJIA 2ALDA 3OZPA 3ABRA 4FS9A 2X8RA 3BAJA 4J27A 4S3KA 1OHLA 1TX2A 1IZJA 2GVEA 1VFOA 1A80A 2UZ9A 1RJQA 4HTBA 1H11A 4HSNA 2QF8A 2GWGA 4YL2A 1W2PA 1JJKA 3VIFA 3WK3A 1CXIA 4AD1A 5M1TA 3AXHA 3VA8A 3T78A 4FF7A 1V6WA 1SGJA 4MAVA 1CXHA 2EG6A 4RDWA 4OGZA 1IV8A 3SCVA 1UG6A 4JTAA 2VFDA 4JTDA 1O12A 2YCKX 1ZP4A 4MYAA 3EA2A 4Z08A 4LRTA 4GG9A 4Y96A 2V30A 3E12A 2V63A 2J7DA 3BARA 4K36A 3HBLA 4LVBA 1JNDA 1PZ3A 3ARRA 4ACZB 1VFSA 2FVLA 3B97A 3AMLA 5I09A 2QPSA 4H00A 3UVAA 1RD5A 1SSGA 3MI2A 3DFYA 4U2ZA 5E70A 2AL1A 4YTSA 1CX9A 1GGOA 3K13A 3LLDA 3WG6A 4K1GA 1W9PA 4GBDA 1J0YA 1ZHAA 4B5UA 1K70A 1AW5A 3HFTA 4ML9A 4ZQMA 3G1XA 2BY3A 4ILSA 1VFHA 3RLHA 2XFYA 1JUKA 3NPXA 4A29A 4O1DA 4TX9A 2QUUA 3R8HA 4KW2A 1BF2A 4K68A 1XLLA 4PRTA 1Q3NA 3MS8A 1G4TA 4V27A 2PS2A 3AIBA 2R1PA 3RO8A 2WZHA 4BWLC 2VRKA 1W5OA 1I2NA 4X60A 3CUXA 2FPYA 4ZOCA 3NQDA 4G1NA 3LHYA 4HP5A 3S5OA 3GB6A 3B4UA 2CHOA 3R1ZA 1PKYA 4KCVA 2OYKA 5HATA 3KL5A 1UWSA 5CC6A 3E2VA 4B91A 4RV3A 1WXJA 3NZPA 1K4HA 2DV0A 1DQXA 3ZQ9A 3UFYA 4PCNA 4NYUA 4GZIA 2Y5SA 5FA5A 3CHCA 4LYQA 1UC5A 5HQLA 2WMHA 2D2OA 3HTWA 1WXYA 1ZSXA 4MPKA 3WD1A 1OWQA 4O18A 3H7VA 3ZWSA 3EKLA 1C8YA 1O68A 2VFGA 4NAEB 3DI1A 3P5YA 2QCCA 5HMSA 2DZWA 4JCLA 2NQJA 2E09A 2QJGA 3VE9A 1VPYA 2NWSA 5CPSA 2YBVA 3TXZA 4HSOA 4DJDC 4KWVA 1U1JA 1Y5WA 2V3EA 3M6DA 4DZ5A 1DORA 3ONBA 4S23A 2CETA 5LA2A 5HMDA 1KRMA 4UTWC 1RA5A 1KRBC 1UKQA 1JCYA 3PTDA 1XCXA 3HPSA 1D8CA 4S2BA 3VIPA 3QR3A 3AIWA 3WBAA 2JIEA 2VT0A 4XBJA 4AIUA 1CCWB 4XSLA 3EOOA 1Q4NX 3KX6A 3N2BA 3GIPA 1GYLA 1LRQA 1XG4A 3K46A 4WHBA 4ZO9A 4HZ6A 3BZGA 5I7GA 4DNMA 4WCJA 1DJHA 1CGTA 1YNPA 1XH2A 2I9UA 3G6LA 1EH9A 3DG7A 4C6LA 1ZTVA 3AFBA 3NR0A 5C2CA 5FF4A 4L4PA 3QZEA 5I77A 3EX2A 3VOHA 2F7FA 5JBDA 2W3ZA 3B0YA 2HZGA 1HKMA 3RO6A 4ZQRA 1TA3A 1VC4A 4XO6A 4KESA 2DPEA 1DJYA 2V67A 4GBUA 4C6BA 2EPKX 2WKLA 2C91A 5CBIA 3GYEA 5K4XA 4XKMA 2BTMA 2MNRA 4V15A 2UBPC 2C79A 3U5YA 3A64A 4CD7A 3VOFA 1LOLA 1CGVA 4DWSD 1PHWA 1V6XA 1EHAA 1K8YA 1GWJA 5L9FA 3HMJG 3ZIZA 1US0A 4GI8A 3P81A 1FWGC 3MY9A 4DF1A 3AYVA 2R82A 3UU0A 4GVGA 3LCLA 1FVPA 3ABOA 4E5TA 4B3LA 1CT5A 2Q3OA 4Z1BA 1VH7A 3B8TA 1F7BA 3TUUA 3UWZA 1YBQB 2AAAA 4C60A 3V5FA 2DSWA 1GCYA 1IWBA 1YX1A 4LCQA 5LIKX 3GWQA 1FCUA 1LL4A 4GJ1A 4LNYA 2FH6A 9XIAA 3R6IA 2VR5A 1PKMA 3R13A 4XD3A 4IF2A 4OVXA 3GAKA 5AN7A 3IV3A 3P67A 2WMJA 1R9XA 2CZ5A 3QRHA 3REQA 2YW4A 3CIWA 1PHQA 3U8GA 1OG0A 1FQ0A 4XAGA 4YTUA 1XIGA 2D2HA 4RDZA 5HNNA 5JBEA 3WQ4A 1I9CB 4LQ1A 5I3DA 3O15A 1B31A 1IEXA 1FHVA 4JFTA 4WDTA 3BW3A 3GU1A 3DKLA 2OPJA 1ZBCA 3H2NA 4UR8A 1FKXA 2WMFA 1PS9A 3UJFA 1OF6A 1UROA 3STFA 2RFGA 1TTIA 4KRUA 2P0IA 3P3BA 3W24A 4LFYA 3CYVA 3GRIA 5HAOA 4AH7A 1XIIA 3DBNA 3F4WA 3COTA 1QTWA 1PB0A 4IP5A 4MSSA 2FB2A 5KETA 2JF7A 1FXQA 1PX4A 4LH8A 1HP4A 4DY1A 2ZE3A 3RU6A 4AIOA 1DBTA 5F4SA 3SGGA 3HG3A 2ATMA 1E1EA 4FLQA 1S3HA 2H3BA 5T9BG 5I07A 5M03A 3HPAA 4YU1A 5D2VA 3M0XA 1O66A 5CZSA 1XD0A 2RGLA 3P82A 3AISA 3G5EA 4WDXA 3KCOA 4I8DA 2P53A 1LWHA 4HU4A 1BXCA 1H3GA 3BJFA 2A5HA 2RUSA 2Y2WA 3A23A 3LM3A 4RL3A 4HYRA 1W54A 3C2EA 4G8TA 1W2VA 1OIMA 2CLLA 1WKYA 2EBNA 3CQIA 4HHHA 2CXGA 3C0LA 5F1VA 4EACA 1VYSX 5KITA 2GJNA 4H6EA 4AIBA 1NIUA 3EOLA 1I0DA 1VKFA 1PTDA 4EAMA 2J25A 3EEGA 3RLGA 1XC4A 5E5CA 4E4FA 1EJVC 3WMCA 4O52A 2J6XA 2V68A 4QEEA 4W84A 4PTNA 3W7JA 3TJLA 1B4KA 4V1XA 3MC5A 1UD5A 1V93A 3W25A 3KRZA 4FNQA 1MDRA 3TOYA 2PC4A 4PMNA 1BG9A 1EB3A 3CH9A 7REQB 4JKLA 1JYNA 1JGMA 1Q45A 1Q8JA 1SJDA 4GCXA 1MVYA 4RE2A 3PY2A 4HHMA 4BQ2A 4JTFA 1JAEA 4C6JA 1N8IA 4Y9OA 3WO8A 4HBKA 1RVKA 3NEHA 1HP5A 3CZLA 4GABA 3W88A 1IZCA 4Q8NA 2YDSA 4JTEA 2VX4A 4EANA 1XG3A 3HQNA 4HT3A 2DUXA 4EPEC 2UY4A 1Q6GA 4XBSA 4IPLA 2PRMA 1TPH1 3REQB 4FR6A 2VDGA 1E5NA 2WVVB 3O6CA 4AXKA 4ORMA 4REQA 4WSKA 5IBXA 1M03A 4AZ5A 2XISA 3VPLA 3P84A 3SUTA 1BYCA 3LCIA 1B57A 2YYTA 3W71A 2P10A 2P1FA 4CCDA 3UBPC 4HTYA 4AZHA 2NZLA 3VO0A 3PK7A 2BY2A 1JF5A 2G3IA 1PO9A 1XPYA 2BZNA 1H4PA 4V2XA 3A5FA 5AVNA 1FHDA 4AZCB 1BPLB 4I6KA 3FYYA 4PB4A 1LQAA 4M51A 1E56A 3OBEA 2PLJA 3DFNA 1W0MA 4JYFA 1DIOA 5ABFA 3L0GA 1VRDA 3OQEA 5BOFA 4S3EA 1J93A 2B31A 3OZOA 3GYCA 1WDQA 1VBJA 2CC0A 4H4IA 1SQ7A 4MWAE 3L67A 2B7QA 4D6CA 2A3BA 3UWVA 4NSBA 4AXNA 3NQ7A 4GY0A 3AXMA 4UXDA 1GJWA 1FWWA 1W1IE 3M0HA 1L6YA 2Y7EA 5EMMA 1FDZA 5I06A 4ZOBA 3OLGA 3VC6A 3ARTA 3TOPA 2OEKA 1UUOA 1EGMA 2Y63A 1F5ZA 2DT0A 3B03A 3GKAA 1M9HA 2GL5A 3O0FA 3GX9A 5LHFA 1JQXA 2XH2A 5AVHA 3LHVA 3O7UA 4HCLA 3SW6A 3PBVA 2VO5A 4R5EA 3LS9A 4W4QA 3TW9A 1P48A 4RE4A 2KZHA 1OGSA 3AZTA 2X7WA 1MEHA 3H7UA 3OZMA 2G5WA 1UBSA 1LLOA 1BG4A 4N9DA 2QIIA 2PTXA 1CZ1A 4Z2IA 3GVWA 1W3TA 5F4XA 3EX6A 4I5XA 1IXOA 4MWAD 1UWQA 4L4LA 3SSZA 4YHGA 2A7RA 4CEUC 3AXIA 4HYWA 1TVLA 2CFFA 3OYXA 2PDMA 3QQ0A 2J7CA 1Y5VA 3LRKA 4CCEA 2VQUA 2I5GA 3M0MA 2XVPA 3CC1A 2YCIX 5CG7A 1HQTA 4RNJA 2NX1A 5D8WA 3LG3A 2FMOA 4GIYA 4XUYA 2NT1A 5E9AA 4UQEA 2VM8A 4NRRA 4QAWA 4LS0A 2AQWA 1F9CA 1KXVA 3EPMA 1D7KA 3SSJA 4UNKA 1XYAA 3WLMA 1LRTA 3PBYA 5FF3A 4Q4SA 3A6OA 3M07A 4RR4A 4JTQA 2Y7GA 4L1WA 2E9LA 3VIJA 4HNTA 4M8UA 2QJHA 3WCZA 3A3XA 1QK2A 3ZR6A 4UR9A 4I90A 3S9IA 5CSSA 1R6WA 4HJFA 4KGLA 3VOCA 3WQOA 1VLIA 4NX5A 7A3HA 3S9ZA 3IGXA 3AIVA 5EFDA 4HCDA 4MADA 2G41A 3QC3A 3WEZA 5E0FA 3UCDA 3M0ZA 1GVYA 1X7IA 2DZUA 1EWEA 3N25A 4HNVA 3SUVA 2EAWA 3TW6A 1DJZA 2BOFX 3U48A 2C1IA 2W79A 4O19A 4NZFA 5D37A 1J8VA 1DV7A 3AYTA 1AL8A 3TFCA 4PBGA 2QCFA 3MUIA 3AXKA 2PBGA 3LHUA 2OWCA 3O6DA 2ZX6A 1BRLA 3AHYA 3UVIA 5JMUA 4ICCX 4AY1A 3BG3A 3P2VA 4O1CA 4FNPA 4PC8A 5CSYA 4LX4A 4F0LA 2HRWA 3BAYA 2DZTA 4GISA 5AZ0A 2VC5A 1K6WA 2D3NA 5HJYA 2E1WA 1XLHA 3M47A 3O8AA 3CEPA 2HTMA 4KFPA 2CZEA 3P5ZA 4KEMA 1HUVA 3AICA 5D2WA 2FDMA 3QGVA 1AG1O 1RJPA 1FFQA 2GVYA 5GJMA 2CZFA 4IX2A 4H7ZA 3WY1A 3UEQA 3R2GA 4IQEA 1JZ8A 2OEMA 3QPEA 4HNLA 4ALDA 2W5FA 1HW6A 1QNVA 1UJPA 1YPFA 3BV4A 3P93A 3U5UA 4CVUA 3H70A 1OGBA 3ATZA 1R46A 1WA3A 1S2UA 4TR9A 3N6JA 1FUYA 3UCQA 5DMYA 5RUBA 8XIAA 2V5JA 4DBEA 1W1VA 4YS1A 1FWTA 5KINA 3G1RA 3NSMA 1ECEA 2YCJA 3PN8A 1BXBA 3HG5A 2CBVA 4PMVA 1PDYA 3AUOA 3T4WA 2INEA 4BZYA 3QBUA 3QH2A 4YCOA 2BY0A 2NV9A 3VKCA 1ONEA 4QJ3B 4U3AA 2XZ9A 4US6A 5TF0A 3UJEA 3W7GA 3VI2A 3BGJA 3EDJA 2YZRA 4JX4A 4FP1A 4KMQA 4QISA 3N6HA 3B9EA 3BJTA 2QGYA 3RLUA 1POKA 1Z6KA 4IMDA 2GGGA 1OGGA 2XVLA 5A8OA 1E0UA 3KBSA 1GUVA 3BLKA 2EPMX 4FX7A 4HNOA 1ZZMA 3PR2A 2VR4A 3QW3A 1TA3B 1UJQA 2ZX9A 3SO7A 5I3GA 3N29A 3W38A 1VEMA 8CGTA 1RY8A 2XIIA 2VD8A 3T0TA 1M7JA 2GQ3A 4ZE5A 1GW9A 4G6CA 4L1XA 4A21A 5J5RA 4XAZA 3PSVA 3WDHA 2GSHA 3B9DA 3D47A 4I7UA 2FGBA 2CLKA 4QCFA 1B2YA 1E40A 4DJED 1KWGA 4KWUA 2GSJA 4WK9A 4OFCA 1E6RA 5HJLA 2B7NA 3BL3A 5FAJA 1J2WA 4Z2GA 2P5NA 1UR3M 4MB4A 1YIXA 1KRCC 2XUCA 2OGYA 2BGNE 3GKFA 1W5PA 1TJRA 4RV8A 3WUFA 1HJVA 1BWVA 2FMNA 3TK7A 1A49A 3E2RA 3WLSA 1LWJA 4PSPA 3UWUA 3KZPA 1MUCA 3DKJA 5I3JA 1RZMA 1KCLA 4PB5A 1F3TA 2FYMA 2OLHA 5FF0A 4NJHA 3P0XA 1UD8A 1GT8A 1U33A 5C7VA 1QNSA 2PDBA 4ACZA 5DMLA 3CV7A 2FHFA 4K6AA 4DJFA 2BVTA 3NEVA 3P6LA 3M43A 1NOUA 4CEXC 4ZFCA 1IQ8A 1XLFA 1CGYA 4AZGA 2RAGA 3QW4B 3K4WA 3F2BA 3VTRA 4H9YA 4GMEA 1JI1A 4LUSA 1OIFA 5D2TA 1E6NA 1FXPA 4H9MA 1YXYA 5M5DA 1VJZA 2VEGA 5BXTA 1PVNA 3SURA 4GA8A 5SWUA 2DP3A 1EPVA 3W00A 4M3PA 1BQCA 1I2PA 2PDKA 3W2LA 2TSYA 2ZUSA 4D6IA 4JN8A 2ZUUA 2ACUA 1UOKA 2Y8KA 4RPQA 2OLAA 4B4FA 4NAFB 1E0WA 5H2ZA 2VOTA 1A5CA 2PDCA 3C0JA 3DDMA 1X38A 3VCCA 1Z48A 4GRSA 1QHOA 4JTJA 4YNGA 2PRHA 3I7QA 1EJWC 4XO7A 1XISA 3CMGA 4GGHA 4AZ6A 1M1BA 3VUSA 1X96A 4JN7A 2ZE0A 3ARVA 2Q8LA 5BU6A 2ZUNA 2EJ1A 1SU5A 1ZAHA 1XYLA 5FEPA 1EIXA 4QDMA 4B9ZA 4UC5A 3H7RA 1ZBVA 3KVMA 4L61A 4DWSA 2IPFA 1DKWA 3GZ3A 4UOQA 4CKQA 3C6CA 2CHNA 1Q2RA 1G01A 1XH0A 2XTKA 3VOGA 1KCKA 1V0MA 1PV8A 1V6YA 4JQAA 4B5XA 3ELFA 1W8SA 3G6MA 4DF2A 1H1YA 1E0XA 1YPXA 3H53A 1JZ5A 2YYUA 3OPSA 4CU8A 2PDHA 2AGTA 3CASA 4IMFA 3IIPA 2I9EA 3VNJA 3CGTA 1KTCA 4QP0A 5DT5A 4XG1A 3K8KA 2XIBA 3NFUA 1LBLA 3WH8A 1V0LA 1AL7A 3F7JA 1AZ1A 1XKJA 4NJGA 4U5KA 2UY5A 1H7PA 1QNOA 1SMDA 2JQXA 3UXDA 1RQBA 2P50A 3ZZ1A 4LEQA 1UMLA 2OVLA 2QUTA 1JUBA 3BAKA 3NDYA 4LW7A 1DHPA 5I2UA 3ZT6A 5CBJA 2TMDA 1CW2A 2R8WA 3RU8X 4B3KA 4CGTA 3I6RA 4O8AA 1GVRA 3B8DA 3NQ6A 5IM51 5T91A 3V0UA 2VGFA 3MANA 1GVFA 4LUTB 1F6KA 4HMDA 2GGHA 1E9YB 3PTMA 1S5WA 3F4CA 1VGAA 4S3AA 2CWXA 5I6SA 1AH0A 4E0CA 3K8LA 4DI8A 4KCUA 2GVGA 3L12A 4URIA 3QV9A 1O60A 2BASA 2R24A 4KEZA 5FJUA 1QCWA 1FWCC 4GD0A 1Q2SA 3K1GA 3DYOA 1HKIA 5HBFA 3IARA 1YDNA 4BK9A 4Q4PA 2E77A 2A3AA 3RCYA 4IIDA 1SR9A 5CGMA 3U7VA 1JD9A 4LCSA 5FI8A 1ZU8A 3TN3A 3VOIA 4H8UA 1A3HA 5F1UA 4ZCWA 4GHRA 3GHSA 3RCMA 2V9DA 3B4YA 3FJNA 1AW1A 2E8ZA 4O14A 2NT0A 4GUFA 3JR2A 2ZZ3A 3MCNA 4CD4A 3H2AA 1W37A 1CLVA 1XBYA 2E9MA 2WWDA 4IX0A 4BF5A 3IJDA 2XHYA 4J3TA 2YXGA 4YXGA 2WLYA 4QFUA 1Q6EA 4RZ4A 3KOYA 1ME9A 4RUBA 1V77A 3DERA 3M0VA 2E25A 1EFZA 3GDTA 3IJ7A 5G5IA 4US5A 3KBMA 3CAQA 4Q4RA 4PZVA 5TIMA 1EX5A 3EXTA 1QHPA 2AAMA 3UJRA 3QYQA 4HMEA 4AWTA 3OHMB 1DIEA 3GK0A 3O63A 1T8XA 5DN1A 3DFSA 2NUYA 3EDEA 4JNMA 3G22A 4EPKA 4IJBA 5IOBA 3SN4A 3EBVA 5EL1A 3VGHA 3N2CA 2F38A 3IIXA 4PEEA 4XUGA 3UWYA 3FXGA 3DZ1A 1UZ1A 5JIWA 2OKOA 3WBWA 4JIPA 3TNBA 3CEUA 4HCHA 5LNWA 1ZALA 4PCPA 4F3HA 3G24A 2XM2A 3S1XA 1GQJA 1YADA 3ZR4A 5U4NA 4PMDA 2DZXA 3VIIA 1LRNA 4BA0A 1CPUA 3CU2A 1XRTA 1QPRA 1A0EA 2C15A 1SW0A 2J79A 1IT0A 3LA4A 4HA1A 4Q32A 3NIYA 1W3IA 3FKKA 3NDZA 1Z9AA 3TLLA 3ARUA 3TNOA 3FXYA 3OZYA 4LAZA 3AS3A 4JD4A 3HPXA 2TRSA 5F2MA 2XZ7A 1OT1A 4JTUA 4YTRA 4UTIA 3BCDA 3WYZA 5DF0A 2FQIA 2INFA 5DEZA 4ZSTA 1ICPA 4K8GA 1JRCA 5ABTA 4UTUA 3RM8A 1QO5A 4ZSUA 1TJPA 1DQUA 3WDPP 3V1HA 3KRUA 4Q3MA 2XWEA 2QCGA 1MRQA 3CO4A 3ZJ7A 4B5NA 4HB7A 1JDAA 4GZEA 5CLTA 2JKPA 4AF0B 3ATYA 1M41A 1YDYA 1SFLA 3GXTA 5D9NA 3MBFA 3EWDA 4HMNA 1JD7A 8RUCA 1KFEA 1UR1A 5C7HA 4QXIA 3TU9A 2ZC8A 3WF2A 2X40A 1EZWA 3FKRA 5G2IA 4A8NA 3RG6A 3F03K 3NGFA 3W1XA 4LVAA 9CGTA 3UZ5A 1DJNA 1TJ1A 3LCXA 1U30A 4WOZA 3VYLA 1OZMA 4PN2A 3Q45A 4J3SA 1XP3A 3PBWA 3AU6A 1CGXA 2GWNA 2AL2A 3B9NA 4LC8A 2GUYA 3KZSA 1CI1A 3QN3A 3TC7A 3AJ7A 3WBXA 1F05A 2OFJA 3GG7A 4FI4A 1CNVA 3NNTA 4V1YA 2W66A 1ZBKA 1OD0A 4UWMA 1UW9A 4POCA 1SZNA 4S2CA 3KXQA 5LNVA 5DT7A 3EGJA 4HPXA 3S2MA 4ES4A 4HHPA 5A8NA 3QQ1A 1A5MC 3ZXWA 1QJWA 3CAVA 1K7FA 1DJIA 4YVVA 8A3HA 4UOJA 4BF7A 1I0BA 5FAGA 3VC5A 2E6DA 2NVDA 4XIAA 3H21A 1E9IA 1MW0A 3O05A 5J04A 4U28A 1ISWA 3QXBA 2CBIA 4LB3A 5DO8A 2AKZA 2WJFA 4GINA 5C71A 3ZO9A 3W1LA 3TSMA 2ACQA 1RBAA 3N13A 4F2TA 2PLCA 1ZUAX 3U4FA 4UTTA 1GVEA 2WSYA 1QI4A 3LPPA 4JKKA 4GH3A 5KZDA 1ITUA 4L7ZA 4X0VA 1UH3A 3OU8A 1V6TA 1NFPA 4MJ4A 3RHGA 4C6KA 3GTNA 1ONWA 1VP5A 3WLNA 3T0BA 1QNPA 3M64A 5B7ZA 1OQFA 4HD5A 3MKKA 4F0KA 3A13A 4J5NA 3SUUA 5HOSA 1QT1A 1XYBA 1V3IA 1TPC1 2QJNA 3W75A 5G1YA 3R25A 1ODZA 1ICSA 2YFOA 3EDFA 3GE7A 3KVLA 3CHVA 3IGHX 3DFQA 4C7FA 4Y8FA 3JU2A 3T0AA 1J0ZA 4K8HA 3G0UA 2BOEX 1TE1A 2QXWA 2YL8A 5G4EA 1W6TA 4H01A 4UCFA 3W53A 4GO8A 1ICQA 5ABHA 2G95A 4J1OA 1IE7C 5BRQA 1BYAA 1L2UA 3QGAC 4BWLA 2D23A 1GOQA 4GUGA 3OHIA 1A0CA 4I5UA 3K4DA 5DY3A 2QVHA 2HQAA 3E0LA 3WJSA 3AS0A 2GVJA 3TMLA 3GDRA 5H8PA 4ORIA 2PBOA 3N3TA 1V3MA 3SCRA 3CTTA 1P1MA 2VQTA 3KRBA 4PUKA 5IFTA 5K9CA 3GTIA 3DHDA 3C86A 1YW1A 4LC6A 1R86A 1JPMA 2XH4A 1JGIA 3UPMA 3I10A 2IQ0A 3VX1A 4JHZA 4X2RA 1PCWA 3MA8A 1LUCB 3URAA 3NPUA 3A3WA 3E74A 2YFNA 4IZGA 4JTTA 3DIPA 3T0DA 3S5NA 3TTQA 1A3XA 3GH5A 3SN0A 1WO2A 1H0GA 3A3HA 2OO0A 3ZJ8A 1VZWA 2QYGA 2CLEA 5H8UA 2OYMA 1ISXA 2VI0A 4MY1A 4NUWA 4DHGA 7TIMA 1H7NA 5HWJA 4CNTA 3ARQA 4O11A 4FB7A 1GHRA 2VX6A 5CSRA 1H1NA 1FWDC 3W7IA 4ZXLA 2BHYA 1U1UA 2NQHA 2PWDA 1K7XA 4QDWA 3GFZA 3GTXA 1VAHA 3Q65A 4GX9A 3BUVA 5C9WA 1V7YA 1J0KA 3LLFA 1A5NC 4NT0A 1W1A1 3CO8A 1MXSA 1GG0A 4D6HA 2RGMA 3PG8A 5TNVA 1S38A 1SUXA 1OC6A 4GVIA 3WSUA 3LM7A 1EIBA 3ZLHA 1R3SA 5DCDA 4W8LA 2PGEA 2WVUA 4Y9PA 2WCSA 3FEQA 1E0VA 3OJGA 5FL0A 4PUJA 2J8TA 1QW9A 4K39A 1JDDA 3TEVA 4O4WA 3Q2DA 4HU3A 4MB1A 3U9IA 3OLIA 3S4TA 1E9LA 5IBXC 3VNDA 2QPXA 4TMBA 3LY0A 3WL1A 1AUSL 1FWNA 3NTYA 3OIXA 4NP7A 1J10A 1TFVA 1S2TA 1PL9A 2WCAA 3C2RA 4EXQA 4ZA0A 5G4WA 3HOJA 1KV5A 1MFUA 1B30A 3N2XA 1G1YA 1DJGA 1FWJC 4OV4A 2X30A 1GQIA 1XI3A 3PZMA 4MZYA 4BEUA 4IGHA 5A95A 2X0SA 5HWMA 1I60A 2DW7A 1I8JA 3ITCA 4RXGA 1SW3A 2PDNA 4UTLA 3AYSA 4FPSA 2IPWA 3RK8A 5F2IA 1JI2A 3WF0A 2QT3A 4DUXA 4CU6A 1ECQA 3UZWA 1JYXA 5FJTA 2G50A 5AHMA 2I17A 5I00A 2ZXBA 1TIWA 1I1XA 4EIVA 1E9ZB 1EYEA 2WB5A 3OODA 3HO8A 1KBIA 3GXNA 3WLTA 1R3YA 3S9YA 3PZUA 3SUWA 1PWMA 1IR2A 4HMCA 1OVDA 1HNYA 1VPQA 5EYWA 1WZAA 4OIFA 1DE5A 2QV4A 1Q6CA 4V28A 4Q8VA 3J7HA 5BWAA 3IUDA 3PZOA 1X1ZA 3BK0A 2D22A 2D1ZA 4P7RA 4JNZA 2GQ9A 5AYIA 5T8GA 3TKFA 2X1SA 2V5DA 2YW3A 3KS5A 1V3JA 1D8WA 1B3OA 5GNXA 4AY8A 3CV1A 4MLRA 2E40A 3MI3A 4AB4A 1JYVA 3VUPA 5LNSA 4DBUA 3GFXA 1UH4A 4XTDA 5AHEA 3VDGA 2XSXA 1ZENA 2BHUA 2PWVA 4DELA 4L56A 2CLIA 3OVGA 2YGYA 2RDTA 4FX6M 2WPGA 1GKPA 1AK5A 1S5TA 3RAOA 1Z8AA 2A6LA 4RDVA 2WC7A 3RF9A 1M7OA 1V6UA 5TD4A 2I7GA 3DFOA 3FFSA 1JDCA 4Y9AA 2X05A 1R30A 3VU2A 3HZ3A 2CYGA 2O7QA 4ZGYA 4FXJA 1UA3A 3SY5A 4MWAB 3M5YA 3GD6A 4KQNA 3THDA 1UIPA 3UR7A 5GVJA 5EFFA 3LI0A 4DNHA 4KWOA 5JVLA 1US3A 1OX4A 5CBBA 4ZOAA 1KW1A 3MJYA 2F8QA 4J3VA 1RP9A 3IJ9A 3VDHA 3N4AA 4IH3A 3M0LA 2VNCA 3S1WA 1F3EA 1KXHA 2VENA 7CGTA 1BD0A 2R1NA 3E3HA 1TMHA 2CBJA 1O95A 3AZRA 1TKKA 5FJPA 3V5OA 4FO4A 4Z1AA 3SRKA 4K8EA 3TA6A 1LCOA 2DY3A 4Q8TA 3IIVA 4JHMA 5D2YA 5G2WA 2NWRA 3GDMA 1GVOA 1XCFA 3C8NA 1GKQA 5E93A 3FVMA 3BC9A 5A2BA 4NKCA 5DFAA 1LLWA 2QHAA 1TYGA 5GJNA 1JCXA 1PJ9A 2ACRA 1J0JA 4MJMA 5BMWA 3BICA 2IXUA 3S1GA 3PUDA 3ANUA 1TTQA 3TYUA 1Q85A 4ROPA 3AI0A 1S2CA 4HOWA 4NAFA 2PAJA 4KIRA 4AVOA 3M1ZA 2IW0A 4R88A 1CXEA 4XX6A 1DVJA 2P3ZA 5AYBA 1TX0A 1TV5A 3EXRA 3CQKA 4D6DA 3EKGA 3RITA 3WD2A 1JFHA 4B4HA 2OXNA 3FJ4A 4KIEA 4P7LA 4WZHA 2ZC1A 3TR9A 1YHTA 4E8GA 4ZB2A 2IPJA 1E71M 3LXBA 3U6WA 2JK2A 3ZLFA 5EA9A 1KR0A 2QMKA 3QKEA 3JUGA 2WHKA 3BLOA 2DU2A 4E38A 3BAXA 4FOJA 3TN6A 1NP2A 4LUSB 3ANVA 1OY0A 4W5ZA 1AQHA 3S1UA 2J8GA 4RZBA 3KLLA 3W7NA 2IKIA 2O4MA 4ZO7A 5BOEA 3CL7A 1KGXA 4MPQA 3SQSA 5C9RA 2AMXA 4BCEA 2PODA 4A8LA 2BNJA 2YR1A 2IKGA 1EEXA 5BRBA 1ZPTA 1QATA 3VDBA 1Q7QA 3A12A 4F40A 3TYEA 2Y88A 1TWWA 3VNMA 2OKTA 4BF9A 4EXBA 3CLMA 1AMKA 9RUBA 1SJBA 3UD6A 5A94A 2HMCA 2DZSA 4JQ3A 2QAFA 4EXAA 3HM7A 4JEQA 1V08A 3LLXA 1TTPA 1UWIA 2YSWA 3IAPA 5J5DA 4MY8A 2ZA1A 2G0WA 3QYSA 4LALA 4UR7A 1TIMA 3C52A 6ALDA 1P0BA 3H4XA 4JHOA 1CTNA 1VFLA 4NZ3A 2YKKA 1FWAC 1M3UA 4GI6A 3N34A 2XG9A 5GPRA 5FSDC 1GVIA 4W7UA 3TLQA 1KFJA 2QCMA 4FK9A 1EGVA 2A3CA 2YOCA 1OYBA 4Z0SA 3I65A 1NTHA 2FB3A 3ANYA 3GXDA 3IACA 3BE7A 2YJQA 5DY2A 4C6EA 2ZZ4A 2OTDA 5FEXA 4CN1A 2PDYA 4EP8C 4QAIA 3EMZA 4CQ8A 1D9EA 1XLJA 2HS6A 2HEJA 1XIFA 3KE0A 5C2XA 2EF9A 2ZCGA 2QIWA 7REQA 3KDOA 1UD3A 2QEZA 4MFDA 1I2OA 2ISVA 1A5BA 1GOXA 2ASHA 3PAOA 2EQDA 2V38A 2BS9A 4FA3A 1XLIA 3SDOA 1MW3A 1OFDA 2JKEA 1A5LC 1UA7A 1R3QA 4D72A 1KCZA 3QY8A 4KFNA 3GY1A 3W1QA 2OQYA 4Z2LA 1Y0EA 4JFUA 4A2RA 1F4HA 1PUDA 2A1YA 2GJXB 4X9YA 3WK1A 3WNOA 4H8HA 3TE9A 4GY1A 4GYPC 4BS0A 4IFKB 3UWQA 4UMBA 1UZ4A 2Y0FA 3HGRA 4D6JA 2QCEA 3FLUA 1FCBA 4C6OA 1OCJA 6REQB 5K3VA 1TV2A 1A5OC 1NM9A 1RY0A 6XIMA 3RX3A 3ITLA 3MHFA 3OP2A 2BFGA 1T41A 4ZFMA 1SZEA 4MVAA 3WLOA 4XBKA 3A4WA 5LIYX 3GR7A 4O17A 3GNRA 1VR6A 3LNMA 4F66A 1NFBA 4R7JA 1WKDA 4Q22A 2W0UA 3KOWA 2NQ5A 3RYSA 3E1F1 3M9YA 4TU1A 5E0KA 1GQKA 5C0QA 3IIOA 2G4JA 5K2ZA 3NL3A 4IIGA 3P0WA 3MI6A 2B81A 4OHQA 2NVCA 4Q4KA 3G1SA 4GO9A 3S6DA 3CZJA 3FS2A 2WJEA 4UTWA 2DVUA 1R3TA 2PDWA 1SO3A 2QDHA 2YCLB 3BLDA 3FN9A 2ZYFA 1DTUA 3WLRA 3ABQA 1HZYA 1OK4A 5KTLA 1H1ZA 3W27A 1EUAA 7PTDA 2ZXQA 2ODOA 4XK2A 3QV7A 4S3CA 4B9YA 1PSCA 2HVOA 3SN1A 3EOSA 2WHLA 2YPIA 2PRLA 3THCA 4A3YA 5I24A 1BSLA 2EEXA 3ALFA 2VUNA 3BQ6A 4NNBA 1V79A 3WQ6A 3N1AA 3O2LA 3MUAA 5A2CA 4G1KA 4EX4A 9XIMA 1SW7A 2QV5A 4B5VA 4AD2A 1RQHA 2VURA 1GNXA 2WANA 3LCWA 2ISWA 2Y61A 5FSEC 1K3UA 3ME3A 3PFRA 3QC0A 1EZ2A 1XF0A 4UMAA 1VCGA 3GBEA 3RN6A 2PI6A 2XH7A 3TQPA 5DBUA 3FIGA 1KM1A 3K2GA 4WXZA 1FHLA 3N19B 3VFCA 4BKNA 1FWHC 2VXNA 1BWKA 4GVFA 4LYRA 1ESWA 1C29A 2ZFAA 1QPOA 3NO5A 4H19A 2O9OA 3ARWA 3OYZA 4ATWA 1TJ2A 4HYVA 1XGDA 3AU2A 4H9UA 5C6MA 3B0PA 4LV4A 1XGEA 3HQPA 1C91A 1WOBA 4UQDA 4IUGA 4GLEA 1ADDA 3MUCA 4ZBCA 4DI9A 4CCCA 4NI8A 5FACA 1QI5A 5IDIA 1Q4WA 3C5QA 1EL3A 2XN0A 1QI2A 2RDXA 3WF1A 4PE8A 4PMJA 1UHVA 3UYIA 2E67A 3T8LA 3IS4A 4P7QA 2PWEA 3C0QA 5C70A 2E5BA 1UIOA 3F1QA 6TAAA 3R7MA 4LVFA 5GNZA 2V5CA 4O1AA 4Y9MA 4QLLA 4M80A 3NZRA 2VUYA 6REQA 2E8YA 2OX1A 4UTKA 1SZFA 1G94A 2FPTA 5BYWA 2UV8G 2EKGA 1J4EA 4XQ6A 3AQUA 1GHSA 3BANA 3B04A 5E09A 2DORA 4NNAA 4M29A 4LBRA 6TIMA 2WZMA 1N7KA 4WOQA 3PULA 3UGRA 4J7RA 3S2CA 2DQXA 2V5KA 1N82A 3BTNA 2O9PA 3FA4A 4CVWA 3GU9A 3I4KA 3PB2A 4HOZA 1UPPA 3H22A 2DZPA 4DXKA 1R2TA 3LZ3A 1OFOA 4ZB0A 2AGKA 5JQ9A 4NZ1A 3WNKA 2DJLA 2ZWZA 3T44A 2H8XA 3GNPA 1W31A 2X1RA 1XS2A 2RJHA 2J75A 2Y89A 1UWAA 3L4XA 2W6RA 3DAQA 3L5AA 3EX1A 5GQBA 3K1DA 2VC9A 3BWWA 3B3DA 2YXXA 2ZXAA 4KBXA 1FCQA 3LQLA 3LB0A 4LB4A 1T7LA 4JTLA 2O92A 5AFDA 4E2VA 1EJ7L 2E28A 2UWFA 2A85A 1JDEA 1JDFA 3WLHA 1IWPA 3NOEA 4XTIA 1KTNA 3G1AA 4PL1A 4CNNA 1WQ5A 4KS0A 1MEWA 3H2CA 3AMKA 1WDSA 1UOZA 3DC8A 4OBTA 3HJZA 1ADSA 1QMLA 3BURA 4MUPA 5AECA 3RJXA 1E70M 2ATSA 3S5ZA 1QNRA 4YJ5A 2XWDA 4E3TA 2DH2A 3GVQA 4KF1A 1LORA 2ISSA 4UQBA 1P6WA 4TV6A 1BAGA 4US5D 5D8ZA 2NUWA 4JFVA 4HNUA 1C3FA 1EOMA 1N55A 1F4AA 4DUVA 5AHFA 4QS5A 5MKGB 4BFAA 1IF2A 2VFFA 4AX6A 4NXKA 1V8EA 2IS7A 4GY7A 2Z6IA 4RNIA 3WK2A 2CU0A 4WJEA 2BY1A 2C1HA 5EKYA 3L65A 4PEKA 1AZ2A 1VBRA 3L5LA 2J66A 1PYFA 5HNUA 3AROA 3N14A 2VR2A 3W9ZA 2HXUA 1MI3A 4NILA 2WVTA 3C3UA 4TXEA 1BVZA 2AOSA 4YPJA 3TW7A 3EOUA 3AIQA 1WYIA 2FIQA 1WDWA 4XAYA 4FNRA 3SAZA 4QSFA 3THAA 1FWFC 4WXYA 2F6XA 3CMJA 1LBFA 2ABBA 3VCRA 2BLEA 4O1BA 4GK8A 4BQ4A 1E0TA 2V81A 1HJQA 4FZIA 1JPHA 2WMIA 3WH6A 5A6MA 2FH8A 1U83A 5DLCA 1GEQA 1IEQA 1UP0A 2BDQA 3XIMA 1XLKA 5HQMA 5IDZA 3AJXA 4ZMGA 3LPFA 4MJ2A 1WKFA 4PMOA 2E6YA 5A8QA 1XM3A 3SRDA 3APGA 4AZ7A 3VKKA 1NARA 2VRQA 2CNCA 5C9ZA 1T0OA 7XIMA 5XIMA 2VHLA 1ITQA 5I3IA 2VTFA 1YYAA 1FWSA 3G2GA 3BLFA 1JCTA 2WZTA 3ZM8A 2CEQA 3T1GA 2V2HA 1X98A 1RD6A 1HVXA 4GKLA 4JTKA 1EC9A 1P0NA 1TB3A 2ZX8A 4H6KA 1ONRA 1KM3A 1Q6FA 5ABGA 3BGGA 1HJWA 1CIUA 4MGGA 3IUIA 3EB2A 2D73A 4KEUA 2DQWA 1L2QA 4UMCA 3GUWA 4C1NA 2Z29A 3MSGA 3VILA 3RFAA 3DFPA 4BJHA 4FXRA 2PP3A 3GXFA 1B54A 3MJMA 1XRVA 3W26A 1MFVA 2E1DA 4RXFA 5FEWA 3ZVHA 4HN8A 1P6CA 5CSUA 1XUZA 2IQTA 1M6JA 1XLGA 3UZZA 2PB1A 2PCQA 1VCFA 2YL5A 3QFWA 4IIFA 4C1NB 3W4RA 3ARPA 4GJJA 4EOUA 1Q6DA 4BQ5A 4IGMA 1QOPA 1KLZA 4XKYB 2VCCA 1IEVA 1G4PA 3HFYA 3O3RA 3DBPA 4I7WA 2CLOA 3E2SA 2ZRUA 4HHLA 2OYLA 5CGQA 1OX4B 1U2YA 1UH2A 3KVKA 1BKSA 4M1RA 4Q7NA 1SMAA 5HDRA 1L9WA 2FVKA 4UNLA 2WHJA 1J2BA 5D05A 1JPKA 4DYKA 3W87A 3UCCA 1M7PA 3LTSA 4DWSB 4HN4A 2OLSA 2PEVA 1CXKA 3T08A 1X97A 1PDZA 1YNQA 4AD4A 3LRMA 1JFXA 4MTVA 3TONA 3L2IA 4PYSA 4LVDA 4HKPA 2WNNA 3QSRA 2EG8A 1HJUA 3NL6A 3WD3A 4MLJA 1YDOA 1U1HA 1DL3A 3D6NA 2VFHA 4MFEA 4PMRA 5DMNA 1CB7B 4PRWA 4YIWA 3NQVA 6PTDA 4AZIA 4P8VA 1R2RA 2VEKA 4GQ0A 5CLWA 1AVAA 1NF0A 3WQEA 1J01A 4PGLA 5ABFB 4GJIA 3SFWA 4PBFA 1XFCA 4Q8QA 2PZ0A 1GOKA 5KZEA 1VQTA 3W7OA 3LXAA 4IL0A 2Y6ZA 3WH7A 3DHPA 1J5SA 3VZXA 3W2NA 1JL8A 1MZHA 4XAPA 4CNPA 1K6AA 1E6SM 1TZZA 2L5HA 4IPPA 5HANA 3TYDA 2YBUA 1LUCA 3N17A 4HNNA 4JDBA 3FA3A 1EX1A 1KA9F 1R7AA 4M1BA 5XINA 3N2TA 3YPIA 4F0RA 3KTXA 1XH1A 1S1RA 3LXCA 2V0TA 1FH9A 2BXZA 1SPQA 3L4YA 3FGCA 1UUQA 2F61A 3RMEA 4EE9A 3UR8A 3PUOA 5A6BD 1G7UA 2OZTA 3PC0A 3T9PA 1JRBA 1LG2A 3PFMA 4J35A 2Z26A 3SCWA 1WDDA 3FYPA 2ON3A 1WNOA 2PCEA 1FTXA 3G3DA 4DBDA 5FL1A 3HA1A 3QMRA 4PA8A 4K2SA 3VGFA 3EYPA 2AL2B 1KGUA 3GG8A 1ISYA 4LU0A 3ES7A 3AALA 2VJXA 1RR2A 1GVSA 1KM5A 3L66A 4PMXA 2BX7A 1LJYA 2HWGA 2XFWA 1SZRA 2DUAA 3HG4A 4YMZA 3MT1A 2CHRA 1G6CA 2CERA 4W86A 1Q7MA 2BHZA 2PGFA 4FOUA 1HXJA 3MP4A 5B80A 5D38A 1YXCA 3FNDA 4TO8A 1XWYA 1EJSC 2QNEA 1NELA 3BO9A 1Q13A 6CGTA 4UFIA 3N9SA 4DO5A 3KOZA 2WZIA 2NLIA 5FD0A 2PDPA 4IQLA 4PRRA 3I7SA 1W5NA 4ZOEA 1CGWA 3ZOAA 4E3VA 1QOQA 1G67A 1N8WA 3MKCA 3QFEA 2YDRA 4ZB5A 3TXVA 1VF8A 3M46A 4JIRA 4XAFA 1X1OA 3S42A 5DCBA 4KWWA 1XLDA 2PLMA 2QCLA 4DUOA 2C19A 3W2JA 2A7PA 1XSJA 2FZ9A 2NV1A 3N2MA 1GW1A 4IL2A 4WVXA 4ENLA 3NZ1A 4AD0A 1FWBC 4XVEA 1US2A 3LRLA 2PDUA 1VHCA 4PCSA 3NQFA 5LYRA 3QQWA 4JQ1A 3IJLA 1SJAA 2QF7A 1EOKA 1OF8A 4X0NA 3CQJA 5F2LA 3UERA 4RX0A 5U7SA 3TJXA 3ARXA 4PMQA 1GYNA 5DQPA 4E2OA 4FIQA 2Y5EA 3GVGA 4H04A 1SO5A 1U5VA 4UFMA 1P0KA 4IICA 3QV8A 1LM1A 3DXIA 3W7EA 2XINA 2QMJA 2WV8A 3QEZA 3BOXA 3OBKA 2UY3A 4R3UA 1B3VA 3H55A 3A22A 1QPQA 4ECLA 3STCA 1E4IA 1TV7A 3BOLA 4EPDC 2OX4A 4EF8A 2DVXA 3V36A 4C1KA 2PDXA 2POZA 2HVMA 2PU0A 2ABAA 4NVTA 4JCMA 3SJNA 3WK0A 4UCGA 2QJJA 5CPMA 1NQ6A 3LMZA 2YA2A 3N9RA 4GIRA 2X09A 4M82A 1F61A 1LROA 2XSBA 2FZ8A 3CHDA 3DYPA 3N11A 1TPUA 3LK6A 2W61A 3FOKA 1DJWA 1P43A 5EMYA 2F2KA 3TYBA 4Z2KA 3CT7A 1W9VA 5E6YA 4GI4A 3A4AA 4ERGA 4ZQNA 1GOIA 2WOQA 4JTCA 3VK5A 3L4TA 3MTWA 1EC8A 8XIMA 4PTVA 4EF9A 2ESCA 4QX4A 3VAVA 2PD5A 4PCTA 1DQWA 3DC0A 2QUVA 4AWSA 4O0KA 1S2AA 1NDVA 1U5JA 4M6QA 5BXSA 2W4XA 1L6FA 3N6QA 3L2MA 1H2JA 2PF8A 4WDWA 3LCHA 1JPIA 4DO6A 4NZCA 1JZ7A 4K7VA 1YLVA 1ISZA 3LPOA 2BV9A 1ZNNA 1LOQA 3ZSSA 3SR7A 1FWEC 3ITYA 4NG3A 3AIEA 5AHLA 4IFRA 4HZ7A 1FH7A 4ZODA 4AYGA 2DGAA 2BB0A 3CNYA 2WSKA 2Y7DA 1R3WA 1K8CA 1OYCA 4LUYA 1F76A 3NAVA 5BOOA 2PTZA 1KBLA 4L4OA 2G97A 1P6BA 3Q37A 4DJFC 1BKHA 4MNLA 3OQ8A 2I1OA 5CZ0A 3TWAA 2R1LA 1F6PA 4ZQPA 2HVNA 3LGGA 4WUIA 1R9YA 4UB9A 3R94A 4QNEA 3VNKA 4DB7A 2H3DA 3L4UA 3ZT7A 3F2DA 2X2GA 4PUUA 1QOXA 1Q7ZA 3IJ8A 1GEHA 4QRNA 1GTHA 1IGWA 3LEPA 2OU4A 4PMZA 3CK5A 4EWND 4E4PA 4N6FA 4HA4A 1ZCOA 1F3WA 1JUEA 2YLLA 4G2DA 3S6OA 3TV8A 1O5XA 3BPWA 1XD1A 5H6HA 2D2GA 4F2UA 3ITTA 3FJLA 4C6CA 1AJZA 1X1NA 3CB8A 2GSEA 3TQVA 1THFD 1FOBA 2I16A 3W1NA 1GONA 2Z28A 3PP7A 1ZCCA 3OG2A 3GXPA 1HKVA 3NQMA 1MDLA 1YRRA 4A22A 2OOGA 4I8YA 1XIEA 1XQKA 1H7RA 4JR5A 1O7AA 1X39A 2NQLA 2ZADA 4F2BA 2GUBA 4G9PA 3W1TA 1V03A 3W73A 2XU2A 3MHUA 1GZ1A 4B15A 4QG9A 2E5DA 3T2OA 1YEYA 4GPNA 3QZ6A 4QGCA 4PSRA 3W6MA 3SQMA 2WVVA 3LCGA 4DO4A 4H6QA 3GNNA 1XDMA 3PJXA 3HN3A 3CL6A 4O12A 1FRBA 2XGIA 3RGTA 4ADTA 3V1PA 4JEJA 3ORWA 3WDRA 4LS1A 2WMKA 2MANA 2BXYA 2PTYA 3CPRA 4D71A 1H0IA 1X7FA 4XD4A 3K8MA 4UFLA 4FF5A 3F4NA 4IIEA 1VHNA 3BG5A 1KQZA 2PF0A 1Q65A 2ZIDA 4LUIA 3WQGA 5JIPA 1VBHA 3GVVA 5CXPA 3STPA 3CUFA 4RCXA 2O4QA 2OR2A 1CXFA 4CQ9A 1T96A 1ENUA 4JFSA 3RX4A 3MWAA 2GQ8A 4AWUA 4MNKA 5A5WA 4HGXA 5C9XA 4MWAC 3T09A 3TQKA 3ERPA 1FH8A 3TN4A 3R0KA 4LAUA 1GORA 2ZICA 1JZ4A 1CLXA 1O1ZA 1XLMA 2ZBTA 2DIKA 3CM4A 1W91A 3C61A 3VD3A 3SCPA 2PC8A 3O07A 3FGCB 3A4JA 3EX3A 1F8MA 3MPGA 1CXLA 3IGUA 3GLCA 4HNCA 1G5AA 4JY8A 4XIMA 3W2MA 5LKYA 4S3FA 3PPHA 3ZR5A 4MY9A 4DBWA 3R4IA 5AYZA 1XINA 3M5VA 5EY5A