4UT3A

X-ray structure of the human pp1 gamma catalytic subunit treated with hydrogen peroxide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 106
structure length 293
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut3A00
3H69A 4H1SA 4XPNA 3TGHA 2CV9A 3EGGA 3IVDA 1M63A 2O8AA 3DSDA 4TUGA 2USHA 4JA9A 2BCDA 3DSCA 1OIDA 4V0XA 3AV0A 5JPFA 4JA7A 2AHDA 3QFOA 4WWLA 2Z06A 3PSOA 3IB8A 2NXFA 1XZWA 1S3NA 2KKNA 3C9FA 3THOB 4KBPA 4LU9A 1JK7A 3IB7A 1MF8A 3K7WC 4M0VA 4O24A 4YKEA 2XMOA 3RL3A 4LTYA 2JOGA 3H61A 4H2FA 2WDEA 1IT6A 2QFPA 1HPUA 1OIEA 3V4YA 2NYMC 3RQZA 1S3MA 1WAO1 3T1IA 3E7AA 1G5BA 2HY1A 5JPEA 1FJMA 3JYFA 4I5NC 1QHWA 2R17A 4O5GA 1WARA 4ZVZA 2WDDA 3H60A 3IVEA 2IAEC 3H62B 4H1YP 4MP0A 4OR9A 5C1VA 4FCXA 2NYLC 2WDCA 4UT2A 1T71A 1NNWA 4UWQA 3H63A 1TCOA 4FBWA 3THNA 3ZTVA 4B2OA 3QFNA 4UT3B 1UTEA 1QFCA 2IE4C 2QFRA 2BQ8X 1UF3A 2HYOA 2NPPC 4V0VA 1S3LA 1S95A 1T70A 3HVQA 2P6BA 2Z1AA 3H64A 1HP1A 4F0ZA 5DNYA 3E7BA 3N5UA 3QG5C 4HD0A 4V0WA 4H2IA 2A22A 4H2BA 3RL5A 3KBPA 4IYPC 4G9JA 3RL4A 4Q7FA 5J28A 1AUIA 1S8EA 5EQVA 3ZU0A 4KKZA 1V73A 4FBKA 4J6OA 4FBQA 1Z2XA 2QJCA 3CK2A 5INBA 3H67A 4NZVA 5B8IA 4I5LC 2WDFA 2DFJA 3LL8A 3AUZA 4DSYA 4ORAA 3QFMA 3H66A 3EGHA 3P71C 3H68A 1OI8A 5HPEA 4H2GA 2HYPA 3QFKA 4MOVA 4UT3A 1U32A 1HO5A 3DW8C 2BDXA 4DT2A 1S70A 2GJUA 2YVTA 2Q8UA 4LACC 4DHLA 1Z2WA 2Z72A 3C5WC 4O4KA 2ZBMA 3FGAC 2O8GA 4TUIA 4ORBA 4IL1A 4O43A 3K7VC 1SU1A 3GVEA 4MOYA 1USHA 1II7A 2IE3C 3ICFA 4ZX2A 4ORCA 5JJTA 5F3WA 5IOHA 1KBPA 1XM7A 3PSNA 5GTUA 1W24A
chains in the Genus database with same CATH superfamily
3H69A 4H1SA 4XPNA 3TGHA 2CV9A 3EGGA 3IVDA 1M63A 2O8AA 3DSDA 4TUGA 2USHA 4JA9A 2BCDA 3DSCA 1OIDA 4V0XA 3AV0A 5JPFA 4JA7A 2AHDA 3QFOA 4WWLA 2Z06A 3PSOA 3IB8A 2NXFA 1XZWA 1S3NA 2KKNA 3C9FA 3THOB 4KBPA 4LU9A 1JK7A 3IB7A 1MF8A 3K7WC 4M0VA 4O24A 4YKEA 2XMOA 3RL3A 2ZO9B 4LTYA 2JOGA 3H61A 4H2FA 2WDEA 1IT6A 2QFPA 1HPUA 1OIEA 3V4YA 2NYMC 3RQZA 1S3MA 1WAO1 3T1IA 3E7AA 1G5BA 2HY1A 5JPEA 1FJMA 3JYFA 4I5NC 1QHWA 2R17A 4O5GA 1WARA 4ZVZA 2WDDA 3H60A 3IVEA 2IAEC 3H62B 4H1YP 4MP0A 4OR9A 5C1VA 4FCXA 2DXLA 2NYLC 2WDCA 4UT2A 1T71A 1NNWA 4UWQA 3H63A 1TCOA 4FBWA 3THNA 3ZTVA 4B2OA 3QFNA 4UT3B 1UTEA 1QFCA 3D03A 2IE4C 2QFRA 2BQ8X 1UF3A 2HYOA 2NPPC 4V0VA 1S3LA 1S95A 1T70A 3FLOA 3HVQA 2P6BA 2Z1AA 2ZOAA 3H64A 1HP1A 4F0ZA 5DNYA 3E7BA 3N5UA 3QG5C 4HD0A 4V0WA 4H2IA 2A22A 4H2BA 3RL5A 3KBPA 4IYPC 4G9JA 3RL4A 4Q7FA 5J28A 1AUIA 2DXNA 1S8EA 5EQVA 3ZU0A 4KKZA 1V73A 4FBKA 4J6OA 4FBQA 1Z2XA 2QJCA 3CK2A 5INBA 3H67A 4NZVA 5B8IA 4I5LC 2WDFA 2DFJA 3LL8A 3AUZA 4DSYA 4ORAA 3QFMA 3H66A 3EGHA 3P71C 3H68A 1OI8A 5HPEA 4H2GA 2HYPA 3QFKA 4MOVA 4UT3A 1U32A 1HO5A 3DW8C 2BDXA 4DT2A 1S70A 2GJUA 2YVTA 2Q8UA 4LACC 4DHLA 1Z2WA 2Z72A 3C5WC 4O4KA 2ZBMA 3FGAC 2O8GA 4TUIA 4ORBA 4IL1A 4O43A 3K7VC 1SU1A 3GVEA 4MOYA 1USHA 1II7A 2IE3C 3ICFA 4ZX2A 4ORCA 5JJTA 2YEQA 5F3WA 5IOHA 1KBPA 1XM7A 3PSNA 5GTUA 3E0JA 1W24A
chains in the Genus database with same CATH topology
3H69A 4H1SA 4XPNA 3TGHA 2CV9A 3EGGA 3IVDA 1M63A 2O8AA 3DSDA 4TUGA 2USHA 4JA9A 2BCDA 3DSCA 1OIDA 4V0XA 3AV0A 5JPFA 4JA7A 2AHDA 3QFOA 4WWLA 2Z06A 3PSOA 3IB8A 2NXFA 1XZWA 1S3NA 2KKNA 3C9FA 3THOB 4KBPA 4LU9A 1JK7A 3IB7A 1MF8A 3K7WC 4M0VA 4O24A 4YKEA 2XMOA 3RL3A 2ZO9B 4LTYA 2JOGA 3H61A 4H2FA 2WDEA 1IT6A 2QFPA 1HPUA 1OIEA 3V4YA 2NYMC 3RQZA 1S3MA 1WAO1 3T1IA 3E7AA 1G5BA 2HY1A 5JPEA 1FJMA 3JYFA 4I5NC 1QHWA 2R17A 4O5GA 1WARA 4ZVZA 2WDDA 3H60A 3IVEA 2IAEC 3H62B 4H1YP 4MP0A 4OR9A 5C1VA 4FCXA 2DXLA 2NYLC 2WDCA 4UT2A 1T71A 1NNWA 4UWQA 3H63A 1TCOA 4FBWA 3THNA 3ZTVA 4B2OA 3QFNA 4UT3B 1UTEA 1QFCA 3D03A 2IE4C 2QFRA 2BQ8X 1UF3A 2HYOA 2NPPC 4V0VA 1S3LA 1S95A 1T70A 3FLOA 3HVQA 2P6BA 2Z1AA 2ZOAA 3H64A 1HP1A 4F0ZA 5DNYA 3E7BA 3N5UA 3QG5C 4HD0A 4V0WA 4H2IA 2A22A 4H2BA 3RL5A 3KBPA 4IYPC 4G9JA 3RL4A 4Q7FA 5J28A 1AUIA 2DXNA 1S8EA 5EQVA 3ZU0A 4KKZA 1V73A 4FBKA 4J6OA 4FBQA 1Z2XA 2QJCA 3CK2A 5INBA 3H67A 4NZVA 5B8IA 4I5LC 2WDFA 2DFJA 3LL8A 3AUZA 4DSYA 4ORAA 3QFMA 3H66A 3EGHA 3P71C 3H68A 1OI8A 5HPEA 4H2GA 2HYPA 3QFKA 4MOVA 4UT3A 1U32A 1HO5A 3DW8C 2BDXA 4DT2A 1S70A 2GJUA 2YVTA 2Q8UA 4LACC 4DHLA 1Z2WA 2Z72A 3C5WC 4O4KA 2ZBMA 3FGAC 2O8GA 4TUIA 4ORBA 4IL1A 4O43A 3K7VC 1SU1A 3GVEA 4MOYA 1USHA 1II7A 2IE3C 3ICFA 4ZX2A 4ORCA 5JJTA 2YEQA 5F3WA 5IOHA 1KBPA 1XM7A 3PSNA 5GTUA 3E0JA 1W24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H69 A;  4H1S A;  4XPN A;  3TGH A;  2CV9 A;  3EGG A;  3IVD A;  1M63 A;  2O8A A;  3DSD A;  4TUG A;  2USH A;  4JA9 A;  2BCD A;  3DSC A;  1OID A;  4V0X A;  3AV0 A;  5JPF A;  4JA7 A;  2AHD A;  3QFO A;  4WWL A;  2Z06 A;  3PSO A;  3IB8 A;  2NXF A;  1XZW A;  1S3N A;  2KKN A;  3C9F A;  3THO B;  4KBP A;  4LU9 A;  1JK7 A;  3IB7 A;  1MF8 A;  3K7W C;  4M0V A;  4O24 A;  4YKE A;  2XMO A;  3RL3 A;  4LTY A;  2JOG A;  3H61 A;  4H2F A;  2WDE A;  1IT6 A;  2QFP A;  1HPU A;  1OIE A;  3V4Y A;  2NYM C;  3RQZ A;  1S3M A;  1WAO 1;  3T1I A;  3E7A A;  1G5B A;  2HY1 A;  5JPE A;  1FJM A;  3JYF A;  4I5N C;  1QHW A;  2R17 A;  4O5G A;  1WAR A;  4ZVZ A;  2WDD A;  3H60 A;  3IVE A;  2IAE C;  3H62 B;  4H1Y P;  4MP0 A;  4OR9 A;  5C1V A;  4FCX A;  2NYL C;  2WDC A;  4UT2 A;  1T71 A;  1NNW A;  4UWQ A;  3H63 A;  1TCO A;  4FBW A;  3THN A;  3ZTV A;  4B2O A;  3QFN A;  4UT3 B;  1UTE A;  1QFC A;  2IE4 C;  2QFR A;  2BQ8 X;  1UF3 A;  2HYO A;  2NPP C;  4V0V A;  1S3L A;  1S95 A;  1T70 A;  3HVQ A;  2P6B A;  2Z1A A;  3H64 A;  1HP1 A;  4F0Z A;  5DNY A;  3E7B A;  3N5U A;  3QG5 C;  4HD0 A;  4V0W A;  4H2I A;  2A22 A;  4H2B A;  3RL5 A;  3KBP A;  4IYP C;  4G9J A;  3RL4 A;  4Q7F A;  5J28 A;  1AUI A;  1S8E A;  5EQV A;  3ZU0 A;  4KKZ A;  1V73 A;  4FBK A;  4J6O A;  4FBQ A;  1Z2X A;  2QJC A;  3CK2 A;  5INB A;  3H67 A;  4NZV A;  5B8I A;  4I5L C;  2WDF A;  2DFJ A;  3LL8 A;  3AUZ A;  4DSY A;  4ORA A;  3QFM A;  3H66 A;  3EGH A;  3P71 C;  3H68 A;  1OI8 A;  5HPE A;  4H2G A;  2HYP A;  3QFK A;  4MOV A;  4UT3 A;  1U32 A;  1HO5 A;  3DW8 C;  2BDX A;  4DT2 A;  1S70 A;  2GJU A;  2YVT A;  2Q8U A;  4LAC C;  4DHL A;  1Z2W A;  2Z72 A;  3C5W C;  4O4K A;  2ZBM A;  3FGA C;  2O8G A;  4TUI A;  4ORB A;  4IL1 A;  4O43 A;  3K7V C;  1SU1 A;  3GVE A;  4MOY A;  1USH A;  1II7 A;  2IE3 C;  3ICF A;  4ZX2 A;  4ORC A;  5JJT A;  5F3W A;  5IOH A;  1KBP A;  1XM7 A;  3PSN A;  5GTU A;  1W24 A; 
#chains in the Genus database with same CATH topology
 3H69 A;  4H1S A;  4XPN A;  3TGH A;  2CV9 A;  3EGG A;  3IVD A;  1M63 A;  2O8A A;  3DSD A;  4TUG A;  2USH A;  4JA9 A;  2BCD A;  3DSC A;  1OID A;  4V0X A;  3AV0 A;  5JPF A;  4JA7 A;  2AHD A;  3QFO A;  4WWL A;  2Z06 A;  3PSO A;  3IB8 A;  2NXF A;  1XZW A;  1S3N A;  2KKN A;  3C9F A;  3THO B;  4KBP A;  4LU9 A;  1JK7 A;  3IB7 A;  1MF8 A;  3K7W C;  4M0V A;  4O24 A;  4YKE A;  2XMO A;  3RL3 A;  2ZO9 B;  4LTY A;  2JOG A;  3H61 A;  4H2F A;  2WDE A;  1IT6 A;  2QFP A;  1HPU A;  1OIE A;  3V4Y A;  2NYM C;  3RQZ A;  1S3M A;  1WAO 1;  3T1I A;  3E7A A;  1G5B A;  2HY1 A;  5JPE A;  1FJM A;  3JYF A;  4I5N C;  1QHW A;  2R17 A;  4O5G A;  1WAR A;  4ZVZ A;  2WDD A;  3H60 A;  3IVE A;  2IAE C;  3H62 B;  4H1Y P;  4MP0 A;  4OR9 A;  5C1V A;  4FCX A;  2DXL A;  2NYL C;  2WDC A;  4UT2 A;  1T71 A;  1NNW A;  4UWQ A;  3H63 A;  1TCO A;  4FBW A;  3THN A;  3ZTV A;  4B2O A;  3QFN A;  4UT3 B;  1UTE A;  1QFC A;  3D03 A;  2IE4 C;  2QFR A;  2BQ8 X;  1UF3 A;  2HYO A;  2NPP C;  4V0V A;  1S3L A;  1S95 A;  1T70 A;  3FLO A;  3HVQ A;  2P6B A;  2Z1A A;  2ZOA A;  3H64 A;  1HP1 A;  4F0Z A;  5DNY A;  3E7B A;  3N5U A;  3QG5 C;  4HD0 A;  4V0W A;  4H2I A;  2A22 A;  4H2B A;  3RL5 A;  3KBP A;  4IYP C;  4G9J A;  3RL4 A;  4Q7F A;  5J28 A;  1AUI A;  2DXN A;  1S8E A;  5EQV A;  3ZU0 A;  4KKZ A;  1V73 A;  4FBK A;  4J6O A;  4FBQ A;  1Z2X A;  2QJC A;  3CK2 A;  5INB A;  3H67 A;  4NZV A;  5B8I A;  4I5L C;  2WDF A;  2DFJ A;  3LL8 A;  3AUZ A;  4DSY A;  4ORA A;  3QFM A;  3H66 A;  3EGH A;  3P71 C;  3H68 A;  1OI8 A;  5HPE A;  4H2G A;  2HYP A;  3QFK A;  4MOV A;  4UT3 A;  1U32 A;  1HO5 A;  3DW8 C;  2BDX A;  4DT2 A;  1S70 A;  2GJU A;  2YVT A;  2Q8U A;  4LAC C;  4DHL A;  1Z2W A;  2Z72 A;  3C5W C;  4O4K A;  2ZBM A;  3FGA C;  2O8G A;  4TUI A;  4ORB A;  4IL1 A;  4O43 A;  3K7V C;  1SU1 A;  3GVE A;  4MOY A;  1USH A;  1II7 A;  2IE3 C;  3ICF A;  4ZX2 A;  4ORC A;  5JJT A;  2YEQ A;  5F3W A;  5IOH A;  1KBP A;  1XM7 A;  3PSN A;  5GTU A;  3E0J A;  1W24 A; 
#chains in the Genus database with same CATH homology
 3H69 A;  4H1S A;  4XPN A;  3TGH A;  2CV9 A;  3EGG A;  3IVD A;  1M63 A;  2O8A A;  3DSD A;  4TUG A;  2USH A;  4JA9 A;  2BCD A;  3DSC A;  1OID A;  4V0X A;  3AV0 A;  5JPF A;  4JA7 A;  2AHD A;  3QFO A;  4WWL A;  2Z06 A;  3PSO A;  3IB8 A;  2NXF A;  1XZW A;  1S3N A;  2KKN A;  3C9F A;  3THO B;  4KBP A;  4LU9 A;  1JK7 A;  3IB7 A;  1MF8 A;  3K7W C;  4M0V A;  4O24 A;  4YKE A;  2XMO A;  3RL3 A;  2ZO9 B;  4LTY A;  2JOG A;  3H61 A;  4H2F A;  2WDE A;  1IT6 A;  2QFP A;  1HPU A;  1OIE A;  3V4Y A;  2NYM C;  3RQZ A;  1S3M A;  1WAO 1;  3T1I A;  3E7A A;  1G5B A;  2HY1 A;  5JPE A;  1FJM A;  3JYF A;  4I5N C;  1QHW A;  2R17 A;  4O5G A;  1WAR A;  4ZVZ A;  2WDD A;  3H60 A;  3IVE A;  2IAE C;  3H62 B;  4H1Y P;  4MP0 A;  4OR9 A;  5C1V A;  4FCX A;  2DXL A;  2NYL C;  2WDC A;  4UT2 A;  1T71 A;  1NNW A;  4UWQ A;  3H63 A;  1TCO A;  4FBW A;  3THN A;  3ZTV A;  4B2O A;  3QFN A;  4UT3 B;  1UTE A;  1QFC A;  3D03 A;  2IE4 C;  2QFR A;  2BQ8 X;  1UF3 A;  2HYO A;  2NPP C;  4V0V A;  1S3L A;  1S95 A;  1T70 A;  3FLO A;  3HVQ A;  2P6B A;  2Z1A A;  2ZOA A;  3H64 A;  1HP1 A;  4F0Z A;  5DNY A;  3E7B A;  3N5U A;  3QG5 C;  4HD0 A;  4V0W A;  4H2I A;  2A22 A;  4H2B A;  3RL5 A;  3KBP A;  4IYP C;  4G9J A;  3RL4 A;  4Q7F A;  5J28 A;  1AUI A;  2DXN A;  1S8E A;  5EQV A;  3ZU0 A;  4KKZ A;  1V73 A;  4FBK A;  4J6O A;  4FBQ A;  1Z2X A;  2QJC A;  3CK2 A;  5INB A;  3H67 A;  4NZV A;  5B8I A;  4I5L C;  2WDF A;  2DFJ A;  3LL8 A;  3AUZ A;  4DSY A;  4ORA A;  3QFM A;  3H66 A;  3EGH A;  3P71 C;  3H68 A;  1OI8 A;  5HPE A;  4H2G A;  2HYP A;  3QFK A;  4MOV A;  4UT3 A;  1U32 A;  1HO5 A;  3DW8 C;  2BDX A;  4DT2 A;  1S70 A;  2GJU A;  2YVT A;  2Q8U A;  4LAC C;  4DHL A;  1Z2W A;  2Z72 A;  3C5W C;  4O4K A;  2ZBM A;  3FGA C;  2O8G A;  4TUI A;  4ORB A;  4IL1 A;  4O43 A;  3K7V C;  1SU1 A;  3GVE A;  4MOY A;  1USH A;  1II7 A;  2IE3 C;  3ICF A;  4ZX2 A;  4ORC A;  5JJT A;  2YEQ A;  5F3W A;  5IOH A;  1KBP A;  1XM7 A;  3PSN A;  5GTU A;  3E0J A;  1W24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...