4UT3A

X-ray structure of the human pp1 gamma catalytic subunit treated with hydrogen peroxide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 106
structure length 293
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut3A00
2HYPA 2HYOA 3H64A 3H62B 3QFMA 5DNYA 1Z2XA 4FCXA 5C1VA 1S3LA 4I5NC 5JPFA 4ZVZA 4V0WA 2BQ8X 3QFOA 1XM7A 4MP0A 1V73A 4F0ZA 1U32A 2Z06A 2GJUA 3H60A 2IAEC 3H69A 2XMOA 2AHDA 4H1SA 2BDXA 3H68A 5J28A 4FBKA 5B8IA 2NYMC 2O8AA 4H1YP 1T70A 3KBPA 2KKNA 3QFNA 5INBA 3ZTVA 1WAO1 4TUGA 3E7BA 4JA7A 5GTUA 4O4KA 1AUIA 4ORBA 4IYPC 1XZWA 2QFRA 4UT3A 2P6BA 3EGHA 4FBQA 2JOGA 3IB7A 4HD0A 3C9FA 3CK2A 1II7A 4IL1A 3IB8A 1S3NA 5HPEA 1HPUA 3AV0A 3H63A 4MOVA 2DFJA 1OI8A 3TGHA 4O24A 1KBPA 2WDFA 2BCDA 4FBWA 2CV9A 3E7AA 5IOHA 5EQVA 2WDDA 4LU9A 3H67A 3FGAC 3H66A 2O8GA 1MF8A 4ZX2A 4ORCA 2ZBMA 4XPNA 1JK7A 3N5UA 4H2FA 4JA9A 4M0VA 1IT6A 1OIEA 4NZVA 4OR9A 4V0XA 4WWLA 3EGGA 1S95A 1USHA 1W24A 2NYLC 3K7WC 4G9JA 4V0VA 4DSYA 1S8EA 1UF3A 4J6OA 2QFPA 3H61A 3QG5C 4B2OA 3HVQA 3DSDA 4KBPA 1QFCA 3V4YA 4KKZA 4TUIA 3IVEA 4H2IA 2NXFA 3T1IA 1WARA 4LTYA 1S70A 5JPEA 2R17A 3AUZA 3PSNA 4I5LC 5F3WA 4H2BA 2IE4C 4LACC 2WDEA 2QJCA 1G5BA 3RL5A 3THNA 3P71C 2HY1A 4DHLA 1UTEA 3GVEA 2Q8UA 3K7VC 4UWQA 2Z72A 3PSOA 4DT2A 2NPPC 3C5WC 1SU1A 3IVDA 3QFKA 4UT2A 4Q7FA 4MOYA 2YVTA 3DW8C 3ICFA 4ORAA 3RL3A 1OIDA 5JJTA 3DSCA 1TCOA 4O43A 4YKEA 1QHWA 2WDCA 1HP1A 3RL4A 1S3MA 1T71A 1HO5A 2USHA 4H2GA 2Z1AA 3JYFA 2IE3C 1FJMA 3LL8A 3RQZA 3THOB 3ZU0A 4UT3B 2A22A 1M63A 4O5GA 1NNWA 1Z2WA
chains in the Genus database with same CATH superfamily
2HYPA 2HYOA 3H64A 3H62B 3QFMA 5DNYA 1Z2XA 4FCXA 5C1VA 1S3LA 4I5NC 5JPFA 4ZVZA 4V0WA 2BQ8X 3QFOA 1XM7A 4MP0A 1V73A 4F0ZA 1U32A 2Z06A 2GJUA 3H60A 2IAEC 3H69A 2XMOA 2AHDA 4H1SA 2BDXA 3H68A 5J28A 4FBKA 5B8IA 2NYMC 2O8AA 4H1YP 1T70A 3KBPA 2KKNA 3QFNA 5INBA 3ZTVA 1WAO1 4TUGA 3E7BA 4JA7A 5GTUA 4O4KA 1AUIA 4ORBA 4IYPC 1XZWA 2QFRA 4UT3A 2P6BA 3EGHA 4FBQA 2JOGA 3IB7A 4HD0A 3C9FA 3CK2A 1II7A 4IL1A 3IB8A 1S3NA 5HPEA 1HPUA 3AV0A 3H63A 4MOVA 2DFJA 1OI8A 3TGHA 4O24A 1KBPA 2WDFA 2BCDA 3FLOA 2CV9A 3E7AA 4FBWA 5IOHA 5EQVA 2WDDA 4LU9A 3H67A 3FGAC 3H66A 2O8GA 1MF8A 4ZX2A 4ORCA 2ZBMA 4XPNA 1JK7A 3N5UA 4H2FA 4JA9A 4M0VA 1IT6A 1OIEA 4NZVA 4OR9A 4V0XA 4WWLA 3EGGA 2YEQA 1S95A 1USHA 1W24A 2NYLC 3K7WC 4G9JA 4V0VA 4DSYA 1S8EA 1UF3A 4J6OA 2QFPA 3H61A 3QG5C 4B2OA 3HVQA 3DSDA 4KBPA 1QFCA 3V4YA 4KKZA 4TUIA 3IVEA 4H2IA 2NXFA 3T1IA 1WARA 4LTYA 1S70A 5JPEA 2R17A 3AUZA 3PSNA 4I5LC 5F3WA 4H2BA 2IE4C 4LACC 2WDEA 2QJCA 1G5BA 3RL5A 3THNA 3P71C 2HY1A 2ZO9B 4DHLA 1UTEA 3GVEA 2Q8UA 3K7VC 4UWQA 2Z72A 3PSOA 4DT2A 2NPPC 3C5WC 1SU1A 3IVDA 3QFKA 4UT2A 4Q7FA 4MOYA 2YVTA 3DW8C 3ICFA 4ORAA 3RL3A 1OIDA 5JJTA 3DSCA 1TCOA 4O43A 4YKEA 2DXLA 1QHWA 2WDCA 1HP1A 2DXNA 3RL4A 1S3MA 1T71A 1HO5A 2USHA 4H2GA 2Z1AA 3JYFA 2IE3C 1FJMA 3LL8A 3E0JA 3RQZA 3THOB 3D03A 3ZU0A 4UT3B 2A22A 2ZOAA 1M63A 4O5GA 1NNWA 1Z2WA
chains in the Genus database with same CATH topology
2HYPA 2HYOA 3H64A 3H62B 3QFMA 5DNYA 1Z2XA 4FCXA 5C1VA 1S3LA 4I5NC 5JPFA 4ZVZA 4V0WA 2BQ8X 3QFOA 1XM7A 4MP0A 1V73A 4F0ZA 1U32A 2Z06A 2GJUA 3H60A 2IAEC 3H69A 2XMOA 2AHDA 4H1SA 2BDXA 3H68A 5J28A 4FBKA 5B8IA 2NYMC 2O8AA 4H1YP 1T70A 3KBPA 2KKNA 3QFNA 5INBA 3ZTVA 1WAO1 4TUGA 3E7BA 4JA7A 5GTUA 4O4KA 1AUIA 4ORBA 4IYPC 1XZWA 2QFRA 4UT3A 2P6BA 3EGHA 4FBQA 2JOGA 3IB7A 4HD0A 3C9FA 3CK2A 1II7A 4IL1A 3IB8A 1S3NA 5HPEA 1HPUA 3AV0A 3H63A 4MOVA 2DFJA 1OI8A 3TGHA 4O24A 1KBPA 2WDFA 2BCDA 3FLOA 2CV9A 3E7AA 4FBWA 5IOHA 5EQVA 2WDDA 4LU9A 3H67A 3FGAC 3H66A 2O8GA 1MF8A 4ZX2A 4ORCA 2ZBMA 4XPNA 1JK7A 3N5UA 4H2FA 4JA9A 4M0VA 1IT6A 1OIEA 4NZVA 4OR9A 4V0XA 4WWLA 3EGGA 2YEQA 1S95A 1USHA 1W24A 2NYLC 3K7WC 4G9JA 4V0VA 4DSYA 1S8EA 1UF3A 4J6OA 2QFPA 3H61A 3QG5C 4B2OA 3HVQA 3DSDA 4KBPA 1QFCA 3V4YA 4KKZA 4TUIA 3IVEA 4H2IA 2NXFA 3T1IA 1WARA 4LTYA 1S70A 5JPEA 2R17A 3AUZA 3PSNA 4I5LC 5F3WA 4H2BA 2IE4C 4LACC 2WDEA 2QJCA 1G5BA 3RL5A 3THNA 3P71C 2HY1A 2ZO9B 4DHLA 1UTEA 3GVEA 2Q8UA 3K7VC 4UWQA 2Z72A 3PSOA 4DT2A 2NPPC 3C5WC 1SU1A 3IVDA 3QFKA 4UT2A 4Q7FA 4MOYA 2YVTA 3DW8C 3ICFA 4ORAA 3RL3A 1OIDA 5JJTA 3DSCA 1TCOA 4O43A 4YKEA 2DXLA 1QHWA 2WDCA 1HP1A 2DXNA 3RL4A 1S3MA 1T71A 1HO5A 2USHA 4H2GA 2Z1AA 3JYFA 2IE3C 1FJMA 3LL8A 3E0JA 3RQZA 3THOB 3D03A 3ZU0A 4UT3B 2A22A 2ZOAA 1M63A 4O5GA 1NNWA 1Z2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYP A;  2HYO A;  3H64 A;  3H62 B;  3QFM A;  5DNY A;  1Z2X A;  4FCX A;  5C1V A;  1S3L A;  4I5N C;  5JPF A;  4ZVZ A;  4V0W A;  2BQ8 X;  3QFO A;  1XM7 A;  4MP0 A;  1V73 A;  4F0Z A;  1U32 A;  2Z06 A;  2GJU A;  3H60 A;  2IAE C;  3H69 A;  2XMO A;  2AHD A;  4H1S A;  2BDX A;  3H68 A;  5J28 A;  4FBK A;  5B8I A;  2NYM C;  2O8A A;  4H1Y P;  1T70 A;  3KBP A;  2KKN A;  3QFN A;  5INB A;  3ZTV A;  1WAO 1;  4TUG A;  3E7B A;  4JA7 A;  5GTU A;  4O4K A;  1AUI A;  4ORB A;  4IYP C;  1XZW A;  2QFR A;  4UT3 A;  2P6B A;  3EGH A;  4FBQ A;  2JOG A;  3IB7 A;  4HD0 A;  3C9F A;  3CK2 A;  1II7 A;  4IL1 A;  3IB8 A;  1S3N A;  5HPE A;  1HPU A;  3AV0 A;  3H63 A;  4MOV A;  2DFJ A;  1OI8 A;  3TGH A;  4O24 A;  1KBP A;  2WDF A;  2BCD A;  4FBW A;  2CV9 A;  3E7A A;  5IOH A;  5EQV A;  2WDD A;  4LU9 A;  3H67 A;  3FGA C;  3H66 A;  2O8G A;  1MF8 A;  4ZX2 A;  4ORC A;  2ZBM A;  4XPN A;  1JK7 A;  3N5U A;  4H2F A;  4JA9 A;  4M0V A;  1IT6 A;  1OIE A;  4NZV A;  4OR9 A;  4V0X A;  4WWL A;  3EGG A;  1S95 A;  1USH A;  1W24 A;  2NYL C;  3K7W C;  4G9J A;  4V0V A;  4DSY A;  1S8E A;  1UF3 A;  4J6O A;  2QFP A;  3H61 A;  3QG5 C;  4B2O A;  3HVQ A;  3DSD A;  4KBP A;  1QFC A;  3V4Y A;  4KKZ A;  4TUI A;  3IVE A;  4H2I A;  2NXF A;  3T1I A;  1WAR A;  4LTY A;  1S70 A;  5JPE A;  2R17 A;  3AUZ A;  3PSN A;  4I5L C;  5F3W A;  4H2B A;  2IE4 C;  4LAC C;  2WDE A;  2QJC A;  1G5B A;  3RL5 A;  3THN A;  3P71 C;  2HY1 A;  4DHL A;  1UTE A;  3GVE A;  2Q8U A;  3K7V C;  4UWQ A;  2Z72 A;  3PSO A;  4DT2 A;  2NPP C;  3C5W C;  1SU1 A;  3IVD A;  3QFK A;  4UT2 A;  4Q7F A;  4MOY A;  2YVT A;  3DW8 C;  3ICF A;  4ORA A;  3RL3 A;  1OID A;  5JJT A;  3DSC A;  1TCO A;  4O43 A;  4YKE A;  1QHW A;  2WDC A;  1HP1 A;  3RL4 A;  1S3M A;  1T71 A;  1HO5 A;  2USH A;  4H2G A;  2Z1A A;  3JYF A;  2IE3 C;  1FJM A;  3LL8 A;  3RQZ A;  3THO B;  3ZU0 A;  4UT3 B;  2A22 A;  1M63 A;  4O5G A;  1NNW A;  1Z2W A; 
#chains in the Genus database with same CATH topology
 2HYP A;  2HYO A;  3H64 A;  3H62 B;  3QFM A;  5DNY A;  1Z2X A;  4FCX A;  5C1V A;  1S3L A;  4I5N C;  5JPF A;  4ZVZ A;  4V0W A;  2BQ8 X;  3QFO A;  1XM7 A;  4MP0 A;  1V73 A;  4F0Z A;  1U32 A;  2Z06 A;  2GJU A;  3H60 A;  2IAE C;  3H69 A;  2XMO A;  2AHD A;  4H1S A;  2BDX A;  3H68 A;  5J28 A;  4FBK A;  5B8I A;  2NYM C;  2O8A A;  4H1Y P;  1T70 A;  3KBP A;  2KKN A;  3QFN A;  5INB A;  3ZTV A;  1WAO 1;  4TUG A;  3E7B A;  4JA7 A;  5GTU A;  4O4K A;  1AUI A;  4ORB A;  4IYP C;  1XZW A;  2QFR A;  4UT3 A;  2P6B A;  3EGH A;  4FBQ A;  2JOG A;  3IB7 A;  4HD0 A;  3C9F A;  3CK2 A;  1II7 A;  4IL1 A;  3IB8 A;  1S3N A;  5HPE A;  1HPU A;  3AV0 A;  3H63 A;  4MOV A;  2DFJ A;  1OI8 A;  3TGH A;  4O24 A;  1KBP A;  2WDF A;  2BCD A;  3FLO A;  2CV9 A;  3E7A A;  4FBW A;  5IOH A;  5EQV A;  2WDD A;  4LU9 A;  3H67 A;  3FGA C;  3H66 A;  2O8G A;  1MF8 A;  4ZX2 A;  4ORC A;  2ZBM A;  4XPN A;  1JK7 A;  3N5U A;  4H2F A;  4JA9 A;  4M0V A;  1IT6 A;  1OIE A;  4NZV A;  4OR9 A;  4V0X A;  4WWL A;  3EGG A;  2YEQ A;  1S95 A;  1USH A;  1W24 A;  2NYL C;  3K7W C;  4G9J A;  4V0V A;  4DSY A;  1S8E A;  1UF3 A;  4J6O A;  2QFP A;  3H61 A;  3QG5 C;  4B2O A;  3HVQ A;  3DSD A;  4KBP A;  1QFC A;  3V4Y A;  4KKZ A;  4TUI A;  3IVE A;  4H2I A;  2NXF A;  3T1I A;  1WAR A;  4LTY A;  1S70 A;  5JPE A;  2R17 A;  3AUZ A;  3PSN A;  4I5L C;  5F3W A;  4H2B A;  2IE4 C;  4LAC C;  2WDE A;  2QJC A;  1G5B A;  3RL5 A;  3THN A;  3P71 C;  2HY1 A;  2ZO9 B;  4DHL A;  1UTE A;  3GVE A;  2Q8U A;  3K7V C;  4UWQ A;  2Z72 A;  3PSO A;  4DT2 A;  2NPP C;  3C5W C;  1SU1 A;  3IVD A;  3QFK A;  4UT2 A;  4Q7F A;  4MOY A;  2YVT A;  3DW8 C;  3ICF A;  4ORA A;  3RL3 A;  1OID A;  5JJT A;  3DSC A;  1TCO A;  4O43 A;  4YKE A;  2DXL A;  1QHW A;  2WDC A;  1HP1 A;  2DXN A;  3RL4 A;  1S3M A;  1T71 A;  1HO5 A;  2USH A;  4H2G A;  2Z1A A;  3JYF A;  2IE3 C;  1FJM A;  3LL8 A;  3E0J A;  3RQZ A;  3THO B;  3D03 A;  3ZU0 A;  4UT3 B;  2A22 A;  2ZOA A;  1M63 A;  4O5G A;  1NNW A;  1Z2W A; 
#chains in the Genus database with same CATH homology
 2HYP A;  2HYO A;  3H64 A;  3H62 B;  3QFM A;  5DNY A;  1Z2X A;  4FCX A;  5C1V A;  1S3L A;  4I5N C;  5JPF A;  4ZVZ A;  4V0W A;  2BQ8 X;  3QFO A;  1XM7 A;  4MP0 A;  1V73 A;  4F0Z A;  1U32 A;  2Z06 A;  2GJU A;  3H60 A;  2IAE C;  3H69 A;  2XMO A;  2AHD A;  4H1S A;  2BDX A;  3H68 A;  5J28 A;  4FBK A;  5B8I A;  2NYM C;  2O8A A;  4H1Y P;  1T70 A;  3KBP A;  2KKN A;  3QFN A;  5INB A;  3ZTV A;  1WAO 1;  4TUG A;  3E7B A;  4JA7 A;  5GTU A;  4O4K A;  1AUI A;  4ORB A;  4IYP C;  1XZW A;  2QFR A;  4UT3 A;  2P6B A;  3EGH A;  4FBQ A;  2JOG A;  3IB7 A;  4HD0 A;  3C9F A;  3CK2 A;  1II7 A;  4IL1 A;  3IB8 A;  1S3N A;  5HPE A;  1HPU A;  3AV0 A;  3H63 A;  4MOV A;  2DFJ A;  1OI8 A;  3TGH A;  4O24 A;  1KBP A;  2WDF A;  2BCD A;  3FLO A;  2CV9 A;  3E7A A;  4FBW A;  5IOH A;  5EQV A;  2WDD A;  4LU9 A;  3H67 A;  3FGA C;  3H66 A;  2O8G A;  1MF8 A;  4ZX2 A;  4ORC A;  2ZBM A;  4XPN A;  1JK7 A;  3N5U A;  4H2F A;  4JA9 A;  4M0V A;  1IT6 A;  1OIE A;  4NZV A;  4OR9 A;  4V0X A;  4WWL A;  3EGG A;  2YEQ A;  1S95 A;  1USH A;  1W24 A;  2NYL C;  3K7W C;  4G9J A;  4V0V A;  4DSY A;  1S8E A;  1UF3 A;  4J6O A;  2QFP A;  3H61 A;  3QG5 C;  4B2O A;  3HVQ A;  3DSD A;  4KBP A;  1QFC A;  3V4Y A;  4KKZ A;  4TUI A;  3IVE A;  4H2I A;  2NXF A;  3T1I A;  1WAR A;  4LTY A;  1S70 A;  5JPE A;  2R17 A;  3AUZ A;  3PSN A;  4I5L C;  5F3W A;  4H2B A;  2IE4 C;  4LAC C;  2WDE A;  2QJC A;  1G5B A;  3RL5 A;  3THN A;  3P71 C;  2HY1 A;  2ZO9 B;  4DHL A;  1UTE A;  3GVE A;  2Q8U A;  3K7V C;  4UWQ A;  2Z72 A;  3PSO A;  4DT2 A;  2NPP C;  3C5W C;  1SU1 A;  3IVD A;  3QFK A;  4UT2 A;  4Q7F A;  4MOY A;  2YVT A;  3DW8 C;  3ICF A;  4ORA A;  3RL3 A;  1OID A;  5JJT A;  3DSC A;  1TCO A;  4O43 A;  4YKE A;  2DXL A;  1QHW A;  2WDC A;  1HP1 A;  2DXN A;  3RL4 A;  1S3M A;  1T71 A;  1HO5 A;  2USH A;  4H2G A;  2Z1A A;  3JYF A;  2IE3 C;  1FJM A;  3LL8 A;  3E0J A;  3RQZ A;  3THO B;  3D03 A;  3ZU0 A;  4UT3 B;  2A22 A;  2ZOA A;  1M63 A;  4O5G A;  1NNW A;  1Z2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...