4UT3A

X-ray structure of the human pp1 gamma catalytic subunit treated with hydrogen peroxide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
293
Chain Sequence
b'KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 293
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut3A00
4MOVA 4V0VA 3RL5A 1NNWA 4LACC 4DHLA 4FBKA 3ZTVA 3DW8C 4FBWA 1QFCA 1T71A 3H67A 3RQZA 2IAEC 2GJUA 4V0XA 3KBPA 3QFKA 2BCDA 1W24A 2Z06A 2ZBMA 4HD0A 4J6OA 4IYPC 3TGHA 3K7VC 3CK2A 4ORAA 3THOB 4V0WA 3QG5C 4H2BA 4H1YP 4MP0A 3V4YA 1AUIA 2BDXA 2NXFA 3JYFA 4NZVA 3T1IA 5DNYA 4DT2A 4I5NC 4UWQA 1Z2WA 3PSNA 4XPNA 5EQVA 2Z1AA 1WARA 3H66A 3IB7A 5J28A 3PSOA 3ZU0A 2QJCA 4TUGA 4MOYA 5JJTA 3QFOA 2NPPC 2P6BA 2XMOA 3H64A 4B2OA 1HO5A 2WDFA 4M0VA 5JPEA 4OR9A 3H60A 1M63A 5F3WA 1QHWA 3C5WC 1WAO1 5HPEA 1S3NA 3H68A 1OIEA 3IB8A 2HYPA 1U32A 1USHA 3H61A 2WDEA 3IVEA 5B8IA 2R17A 1HP1A 1II7A 4FBQA 1MF8A 4LU9A 4O4KA 4O24A 1SU1A 2CV9A 4WWLA 3E7BA 4UT3B 3RL3A 4YKEA 1TCOA 3H69A 4ZX2A 4H2IA 2HYOA 1V73A 4ZVZA 3N5UA 1FJMA 3K7WC 3DSCA 3H62B 1JK7A 1OIDA 1IT6A 2USHA 2Q8UA 3AV0A 2KKNA 1G5BA 4F0ZA 2IE4C 1OI8A 1S3MA 1S70A 2AHDA 3H63A 4FCXA 4JA7A 2NYMC 4UT3A 3QFMA 5IOHA 4UT2A 2O8AA 2HY1A 2Z72A 2A22A 4H2GA 2YVTA 3P71C 1S95A 3E7AA 1Z2XA 2WDDA 3QFNA 1UF3A 3DSDA 3IVDA 4ORBA 2QFRA 3HVQA 5INBA 3AUZA 1UTEA 3LL8A 4ORCA 4O5GA 2WDCA 4IL1A 5C1VA 4JA9A 1S8EA 1T70A 2BQ8X 4TUIA 4LTYA 2IE3C 3EGHA 3FGAC 2NYLC 4I5LC 1HPUA 4G9JA 1KBPA 2QFPA 2DFJA 3GVEA 4H1SA 1XZWA 2O8GA 4KBPA 4O43A 3ICFA 5JPFA 3EGGA 4H2FA 4Q7FA 3THNA 3RL4A 1S3LA 2JOGA 5GTUA 4KKZA 3C9FA 4DSYA 1XM7A
chains in the Genus database with same CATH superfamily
4MOVA 4V0VA 3RL5A 1NNWA 4LACC 4DHLA 4FBKA 3ZTVA 3DW8C 4FBWA 1QFCA 1T71A 3D03A 3H67A 3RQZA 2IAEC 2GJUA 4V0XA 3KBPA 3QFKA 2DXNA 2BCDA 1W24A 2Z06A 2ZBMA 4HD0A 4J6OA 4IYPC 3TGHA 3K7VC 3CK2A 4ORAA 3THOB 4V0WA 3QG5C 4H2BA 4H1YP 4MP0A 3V4YA 1AUIA 2BDXA 2NXFA 3JYFA 4NZVA 3T1IA 5DNYA 4DT2A 4I5NC 4UWQA 1Z2WA 3PSNA 3E0JA 4XPNA 5EQVA 2Z1AA 1WARA 3H66A 3IB7A 5J28A 3PSOA 3ZU0A 2QJCA 4TUGA 4MOYA 5JJTA 3QFOA 3FLOA 2NPPC 2P6BA 2XMOA 3H64A 4B2OA 1HO5A 2WDFA 4M0VA 5JPEA 4OR9A 3H60A 1M63A 5F3WA 1QHWA 3C5WC 1WAO1 5HPEA 1S3NA 3H68A 1OIEA 3IB8A 2HYPA 1U32A 1USHA 3H61A 2WDEA 3IVEA 5B8IA 2YEQA 2R17A 1HP1A 1II7A 4FBQA 1MF8A 4LU9A 4O4KA 4O24A 1SU1A 2CV9A 4WWLA 2ZO9B 3E7BA 4UT3B 3RL3A 4YKEA 1TCOA 3H69A 4ZX2A 4H2IA 2HYOA 1V73A 4ZVZA 3N5UA 1FJMA 2ZOAA 3K7WC 3DSCA 3H62B 1JK7A 1OIDA 1IT6A 2USHA 2Q8UA 3AV0A 2KKNA 1G5BA 4F0ZA 2IE4C 1OI8A 1S3MA 1S70A 2AHDA 3H63A 4FCXA 4JA7A 2NYMC 4UT3A 3QFMA 5IOHA 4UT2A 2O8AA 2HY1A 2Z72A 2A22A 4H2GA 2YVTA 3P71C 1S95A 3E7AA 1Z2XA 2WDDA 3QFNA 1UF3A 3DSDA 3IVDA 4ORBA 2QFRA 3HVQA 5INBA 3AUZA 1UTEA 3LL8A 4ORCA 4O5GA 2WDCA 4IL1A 5C1VA 4JA9A 1S8EA 1T70A 2BQ8X 4TUIA 4LTYA 2DXLA 2IE3C 3EGHA 3FGAC 2NYLC 4I5LC 1HPUA 4G9JA 1KBPA 2QFPA 2DFJA 3GVEA 4H1SA 1XZWA 2O8GA 4KBPA 4O43A 3ICFA 5JPFA 3EGGA 4H2FA 4Q7FA 3THNA 3RL4A 1S3LA 2JOGA 5GTUA 4KKZA 3C9FA 4DSYA 1XM7A
chains in the Genus database with same CATH topology
4MOVA 4V0VA 3RL5A 1NNWA 4LACC 4DHLA 4FBKA 3ZTVA 3DW8C 4FBWA 1QFCA 1T71A 3D03A 3H67A 3RQZA 2IAEC 2GJUA 4V0XA 3KBPA 3QFKA 2DXNA 2BCDA 1W24A 2Z06A 2ZBMA 4HD0A 4J6OA 4IYPC 3TGHA 3K7VC 3CK2A 4ORAA 3THOB 4V0WA 3QG5C 4H2BA 4H1YP 4MP0A 3V4YA 1AUIA 2BDXA 2NXFA 3JYFA 4NZVA 3T1IA 5DNYA 4DT2A 4I5NC 4UWQA 1Z2WA 3PSNA 3E0JA 4XPNA 5EQVA 2Z1AA 1WARA 3H66A 3IB7A 5J28A 3PSOA 3ZU0A 2QJCA 4TUGA 4MOYA 5JJTA 3QFOA 3FLOA 2NPPC 2P6BA 2XMOA 3H64A 4B2OA 1HO5A 2WDFA 4M0VA 5JPEA 4OR9A 3H60A 1M63A 5F3WA 1QHWA 3C5WC 1WAO1 5HPEA 1S3NA 3H68A 1OIEA 3IB8A 2HYPA 1U32A 1USHA 3H61A 2WDEA 3IVEA 5B8IA 2YEQA 2R17A 1HP1A 1II7A 4FBQA 1MF8A 4LU9A 4O4KA 4O24A 1SU1A 2CV9A 4WWLA 2ZO9B 3E7BA 4UT3B 3RL3A 4YKEA 1TCOA 3H69A 4ZX2A 4H2IA 2HYOA 1V73A 4ZVZA 3N5UA 1FJMA 2ZOAA 3K7WC 3DSCA 3H62B 1JK7A 1OIDA 1IT6A 2USHA 2Q8UA 3AV0A 2KKNA 1G5BA 4F0ZA 2IE4C 1OI8A 1S3MA 1S70A 2AHDA 3H63A 4FCXA 4JA7A 2NYMC 4UT3A 3QFMA 5IOHA 4UT2A 2O8AA 2HY1A 2Z72A 2A22A 4H2GA 2YVTA 3P71C 1S95A 3E7AA 1Z2XA 2WDDA 3QFNA 1UF3A 3DSDA 3IVDA 4ORBA 2QFRA 3HVQA 5INBA 3AUZA 1UTEA 3LL8A 4ORCA 4O5GA 2WDCA 4IL1A 5C1VA 4JA9A 1S8EA 1T70A 2BQ8X 4TUIA 4LTYA 2DXLA 2IE3C 3EGHA 3FGAC 2NYLC 4I5LC 1HPUA 4G9JA 1KBPA 2QFPA 2DFJA 3GVEA 4H1SA 1XZWA 2O8GA 4KBPA 4O43A 3ICFA 5JPFA 3EGGA 4H2FA 4Q7FA 3THNA 3RL4A 1S3LA 2JOGA 5GTUA 4KKZA 3C9FA 4DSYA 1XM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MOV A;  4V0V A;  3RL5 A;  1NNW A;  4LAC C;  4DHL A;  4FBK A;  3ZTV A;  3DW8 C;  4FBW A;  1QFC A;  1T71 A;  3H67 A;  3RQZ A;  2IAE C;  2GJU A;  4V0X A;  3KBP A;  3QFK A;  2BCD A;  1W24 A;  2Z06 A;  2ZBM A;  4HD0 A;  4J6O A;  4IYP C;  3TGH A;  3K7V C;  3CK2 A;  4ORA A;  3THO B;  4V0W A;  3QG5 C;  4H2B A;  4H1Y P;  4MP0 A;  3V4Y A;  1AUI A;  2BDX A;  2NXF A;  3JYF A;  4NZV A;  3T1I A;  5DNY A;  4DT2 A;  4I5N C;  4UWQ A;  1Z2W A;  3PSN A;  4XPN A;  5EQV A;  2Z1A A;  1WAR A;  3H66 A;  3IB7 A;  5J28 A;  3PSO A;  3ZU0 A;  2QJC A;  4TUG A;  4MOY A;  5JJT A;  3QFO A;  2NPP C;  2P6B A;  2XMO A;  3H64 A;  4B2O A;  1HO5 A;  2WDF A;  4M0V A;  5JPE A;  4OR9 A;  3H60 A;  1M63 A;  5F3W A;  1QHW A;  3C5W C;  1WAO 1;  5HPE A;  1S3N A;  3H68 A;  1OIE A;  3IB8 A;  2HYP A;  1U32 A;  1USH A;  3H61 A;  2WDE A;  3IVE A;  5B8I A;  2R17 A;  1HP1 A;  1II7 A;  4FBQ A;  1MF8 A;  4LU9 A;  4O4K A;  4O24 A;  1SU1 A;  2CV9 A;  4WWL A;  3E7B A;  4UT3 B;  3RL3 A;  4YKE A;  1TCO A;  3H69 A;  4ZX2 A;  4H2I A;  2HYO A;  1V73 A;  4ZVZ A;  3N5U A;  1FJM A;  3K7W C;  3DSC A;  3H62 B;  1JK7 A;  1OID A;  1IT6 A;  2USH A;  2Q8U A;  3AV0 A;  2KKN A;  1G5B A;  4F0Z A;  2IE4 C;  1OI8 A;  1S3M A;  1S70 A;  2AHD A;  3H63 A;  4FCX A;  4JA7 A;  2NYM C;  4UT3 A;  3QFM A;  5IOH A;  4UT2 A;  2O8A A;  2HY1 A;  2Z72 A;  2A22 A;  4H2G A;  2YVT A;  3P71 C;  1S95 A;  3E7A A;  1Z2X A;  2WDD A;  3QFN A;  1UF3 A;  3DSD A;  3IVD A;  4ORB A;  2QFR A;  3HVQ A;  5INB A;  3AUZ A;  1UTE A;  3LL8 A;  4ORC A;  4O5G A;  2WDC A;  4IL1 A;  5C1V A;  4JA9 A;  1S8E A;  1T70 A;  2BQ8 X;  4TUI A;  4LTY A;  2IE3 C;  3EGH A;  3FGA C;  2NYL C;  4I5L C;  1HPU A;  4G9J A;  1KBP A;  2QFP A;  2DFJ A;  3GVE A;  4H1S A;  1XZW A;  2O8G A;  4KBP A;  4O43 A;  3ICF A;  5JPF A;  3EGG A;  4H2F A;  4Q7F A;  3THN A;  3RL4 A;  1S3L A;  2JOG A;  5GTU A;  4KKZ A;  3C9F A;  4DSY A;  1XM7 A; 
#chains in the Genus database with same CATH topology
 4MOV A;  4V0V A;  3RL5 A;  1NNW A;  4LAC C;  4DHL A;  4FBK A;  3ZTV A;  3DW8 C;  4FBW A;  1QFC A;  1T71 A;  3D03 A;  3H67 A;  3RQZ A;  2IAE C;  2GJU A;  4V0X A;  3KBP A;  3QFK A;  2DXN A;  2BCD A;  1W24 A;  2Z06 A;  2ZBM A;  4HD0 A;  4J6O A;  4IYP C;  3TGH A;  3K7V C;  3CK2 A;  4ORA A;  3THO B;  4V0W A;  3QG5 C;  4H2B A;  4H1Y P;  4MP0 A;  3V4Y A;  1AUI A;  2BDX A;  2NXF A;  3JYF A;  4NZV A;  3T1I A;  5DNY A;  4DT2 A;  4I5N C;  4UWQ A;  1Z2W A;  3PSN A;  3E0J A;  4XPN A;  5EQV A;  2Z1A A;  1WAR A;  3H66 A;  3IB7 A;  5J28 A;  3PSO A;  3ZU0 A;  2QJC A;  4TUG A;  4MOY A;  5JJT A;  3QFO A;  3FLO A;  2NPP C;  2P6B A;  2XMO A;  3H64 A;  4B2O A;  1HO5 A;  2WDF A;  4M0V A;  5JPE A;  4OR9 A;  3H60 A;  1M63 A;  5F3W A;  1QHW A;  3C5W C;  1WAO 1;  5HPE A;  1S3N A;  3H68 A;  1OIE A;  3IB8 A;  2HYP A;  1U32 A;  1USH A;  3H61 A;  2WDE A;  3IVE A;  5B8I A;  2YEQ A;  2R17 A;  1HP1 A;  1II7 A;  4FBQ A;  1MF8 A;  4LU9 A;  4O4K A;  4O24 A;  1SU1 A;  2CV9 A;  4WWL A;  2ZO9 B;  3E7B A;  4UT3 B;  3RL3 A;  4YKE A;  1TCO A;  3H69 A;  4ZX2 A;  4H2I A;  2HYO A;  1V73 A;  4ZVZ A;  3N5U A;  1FJM A;  2ZOA A;  3K7W C;  3DSC A;  3H62 B;  1JK7 A;  1OID A;  1IT6 A;  2USH A;  2Q8U A;  3AV0 A;  2KKN A;  1G5B A;  4F0Z A;  2IE4 C;  1OI8 A;  1S3M A;  1S70 A;  2AHD A;  3H63 A;  4FCX A;  4JA7 A;  2NYM C;  4UT3 A;  3QFM A;  5IOH A;  4UT2 A;  2O8A A;  2HY1 A;  2Z72 A;  2A22 A;  4H2G A;  2YVT A;  3P71 C;  1S95 A;  3E7A A;  1Z2X A;  2WDD A;  3QFN A;  1UF3 A;  3DSD A;  3IVD A;  4ORB A;  2QFR A;  3HVQ A;  5INB A;  3AUZ A;  1UTE A;  3LL8 A;  4ORC A;  4O5G A;  2WDC A;  4IL1 A;  5C1V A;  4JA9 A;  1S8E A;  1T70 A;  2BQ8 X;  4TUI A;  4LTY A;  2DXL A;  2IE3 C;  3EGH A;  3FGA C;  2NYL C;  4I5L C;  1HPU A;  4G9J A;  1KBP A;  2QFP A;  2DFJ A;  3GVE A;  4H1S A;  1XZW A;  2O8G A;  4KBP A;  4O43 A;  3ICF A;  5JPF A;  3EGG A;  4H2F A;  4Q7F A;  3THN A;  3RL4 A;  1S3L A;  2JOG A;  5GTU A;  4KKZ A;  3C9F A;  4DSY A;  1XM7 A; 
#chains in the Genus database with same CATH homology
 4MOV A;  4V0V A;  3RL5 A;  1NNW A;  4LAC C;  4DHL A;  4FBK A;  3ZTV A;  3DW8 C;  4FBW A;  1QFC A;  1T71 A;  3D03 A;  3H67 A;  3RQZ A;  2IAE C;  2GJU A;  4V0X A;  3KBP A;  3QFK A;  2DXN A;  2BCD A;  1W24 A;  2Z06 A;  2ZBM A;  4HD0 A;  4J6O A;  4IYP C;  3TGH A;  3K7V C;  3CK2 A;  4ORA A;  3THO B;  4V0W A;  3QG5 C;  4H2B A;  4H1Y P;  4MP0 A;  3V4Y A;  1AUI A;  2BDX A;  2NXF A;  3JYF A;  4NZV A;  3T1I A;  5DNY A;  4DT2 A;  4I5N C;  4UWQ A;  1Z2W A;  3PSN A;  3E0J A;  4XPN A;  5EQV A;  2Z1A A;  1WAR A;  3H66 A;  3IB7 A;  5J28 A;  3PSO A;  3ZU0 A;  2QJC A;  4TUG A;  4MOY A;  5JJT A;  3QFO A;  3FLO A;  2NPP C;  2P6B A;  2XMO A;  3H64 A;  4B2O A;  1HO5 A;  2WDF A;  4M0V A;  5JPE A;  4OR9 A;  3H60 A;  1M63 A;  5F3W A;  1QHW A;  3C5W C;  1WAO 1;  5HPE A;  1S3N A;  3H68 A;  1OIE A;  3IB8 A;  2HYP A;  1U32 A;  1USH A;  3H61 A;  2WDE A;  3IVE A;  5B8I A;  2YEQ A;  2R17 A;  1HP1 A;  1II7 A;  4FBQ A;  1MF8 A;  4LU9 A;  4O4K A;  4O24 A;  1SU1 A;  2CV9 A;  4WWL A;  2ZO9 B;  3E7B A;  4UT3 B;  3RL3 A;  4YKE A;  1TCO A;  3H69 A;  4ZX2 A;  4H2I A;  2HYO A;  1V73 A;  4ZVZ A;  3N5U A;  1FJM A;  2ZOA A;  3K7W C;  3DSC A;  3H62 B;  1JK7 A;  1OID A;  1IT6 A;  2USH A;  2Q8U A;  3AV0 A;  2KKN A;  1G5B A;  4F0Z A;  2IE4 C;  1OI8 A;  1S3M A;  1S70 A;  2AHD A;  3H63 A;  4FCX A;  4JA7 A;  2NYM C;  4UT3 A;  3QFM A;  5IOH A;  4UT2 A;  2O8A A;  2HY1 A;  2Z72 A;  2A22 A;  4H2G A;  2YVT A;  3P71 C;  1S95 A;  3E7A A;  1Z2X A;  2WDD A;  3QFN A;  1UF3 A;  3DSD A;  3IVD A;  4ORB A;  2QFR A;  3HVQ A;  5INB A;  3AUZ A;  1UTE A;  3LL8 A;  4ORC A;  4O5G A;  2WDC A;  4IL1 A;  5C1V A;  4JA9 A;  1S8E A;  1T70 A;  2BQ8 X;  4TUI A;  4LTY A;  2DXL A;  2IE3 C;  3EGH A;  3FGA C;  2NYL C;  4I5L C;  1HPU A;  4G9J A;  1KBP A;  2QFP A;  2DFJ A;  3GVE A;  4H1S A;  1XZW A;  2O8G A;  4KBP A;  4O43 A;  3ICF A;  5JPF A;  3EGG A;  4H2F A;  4Q7F A;  3THN A;  3RL4 A;  1S3L A;  2JOG A;  5GTU A;  4KKZ A;  3C9F A;  4DSY A;  1XM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...