4UT5A

Crystal structure of the lecb lectin from pseudomonas aeruginosa strain pa7 in complex with lewis a tetrasaccharide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSATQTVKVLVNNETAATFTGQSTNNAVIGSQVLNSGGGGKVQIQVSVNGRSSDLVSAQVILANELNVALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genomic Rearrangements and Functional Diversification of Leca and Lecb Lectin-Coding Regions Impacting the Efficacy of Glycomimetics Directed Against Pseudomonas Aeruginosa.
pubmed doi rcsb
molecule keywords LECB LECTIN
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 4ut5A00
3ZDVA 1GZTA 1W8FA 1OUXA 1OUSA 2JDKA 4AOCA 5A70A 1OXCA 1W8HA 2JDYA 4UT5A 1UZVA 2BP6A 1OVSA 2XR4A 2BOIA 1UQXA 5A6YA 5A6QA 2VUDA 1OVPA 5HCHA 5A6ZA 2WRAA 5A3OA 5A6XA 3DCQA 2JDNA 2VNVA 2JDPA 2CHHA 2JDMA 2VUCA 4CE8A 2WR9A 2JDHA 1OURA 5D2AA 2BV4A 2BOJA 2JDUA
chains in the Genus database with same CATH superfamily
4YW5A 4NROA 3JB8A 5E88A 5HCBA 3V0AB 1IPSA 2WO1A 2JKXA 4OFGA 3U1XA 2RHPA 2EALA 4FXKB 1DYPA 1QJU3 1DGRA 3M3EA 2A73B 2RR11 2MEV1 2NLRA 3SHRA 5DZGA 4LQRA 2ADEA 3ATGA 3E6BA 3UGGA 5CFCA 3FHAA 5FLJA 2Q8CA 1BYHA 3E6DA 3POFA 1FNZA 1BXHA 3RRDA 4LKDA 4Q4V2 1PK6C 1O91A 5I8TA 4Y5Z0 2YMZA 4OZXA 2ZEZA 5IHRA 3CHXA 3PUQA 4D6RA 2VQAA 2EICA 2QQMA 2VQTA 4JGZB 4MGYE 2I45A 1IS3A 1ST8A 2JE8A 2P6CA 1H2LA 5FXWA 3T3YA 4KWKA 1QY4A 3WW1A 3N35A 1FXZA 2W46A 3O1VA 2XVLA 2R041 4JV4A 5FWJA 4K9SA 5J09A 3KQRA 1QWRA 4H2AA 4GWIA 1R1A3 1R64A 1V6OA 5A3MA 4ISRA 5FMDA 5BNOA 2WFPA 5JR2A 1LGBA 1ZBA3 2YXSA 1YRZA 1LR5A 2NN8A 1N3QA 2JKBA 3D3AA 1N47A 3MIEA 1K5MB 2UU8A 3OBRA 5HI0A 5KWRA 3USSA 3B93A 3OB8A 2VZRA 2WT0A 4FSJA 4LIUA 1W99A 3I2OA 1LHWA 1WLTA 2JB4A 2QJVA 2RVAA 2UWCA 3IBMA 2BOJA 3MUY1 1WMFA 2Q1ZB 1LECA 5FBZA 1GLHA 3UGFA 3WEZA 1WMDA 4GMP3 2R042 4JHZA 5SV8A 1VR3A 2Y38A 3ALQA 3WF4A 5DPNA 1RUC3 1I5ZA 2PTMA 1SG3A 2VZSA 4JKMA 3IZOA 4Y4YA 1KITA 5FCCA 5FZIA 3RMYA 4QMAA 3J7NA 4GD4A 2A6VA 2VOXA 2ERFA 4YM0A 4O61A 3BPZA 1LAJA 4BK5A 4J1XA 4BOWA 1YI9A 3S5QA 1C57A 3POWA 2Q8DA 4P9GA 5FY0A 4XQDA 1QJFA 4TYSA 1HRI1 2QZ2A 2D93A 4JAAA 3POEA 3T4HB 1LGNA 1NLQA 2OX0A 2Y34A 3GNEA 4W65A 2DVFA 4TLGA 3H8OA 3RNSA 2R30A 4B4RA 2VJXA 2VMFA 2QE3A 3FHQA 4FPHA 3PVBB 4Z8BA 2XBO3 1LOCA 2WLQA 3KF3A 1OXCA 4U36A 5FQ0B 2ZGNA 3LEGA 4AI3A 1UD1A 4RS5B 5L7OA 1IOAA 1RUH3 3VZOA 2BFUL 3C8XA 2YPJA 1ASJ2 4AE2A 5F9TA 1LNSA 2ZHMA 3ZYFA 4A7YA 2DBNA 5FPXA 1GP4A 1HRI2 1PIV1 2FQPA 3NAPC 5FXZA 1POV3 5L73A 4XVHA 1RUI1 4FFFA 3JD73 5A3UA 3EJKA 4BYYA 4NN0A 4A44A 1QJY1 2VVEA 5E89A 2K9ZA 4PQ9A 4AEDA 5KHJA 1E5SA 2XGXA 2DUOA 3NVCA 3QH6A 5BY5A 3RZKA 1JS9A 2OZJA 2B9VA 3MHZA 3I4IA 4AFMA 4EZ4A 3ON7A 4IEQA 3HVDA 1VMHA 1AF9A 3GDBA 1RUF1 4MH0E 4AQTA 1AXKA 3J9SA 1JBCA 2Z79A 2JG9A 5ABJA 1TME3 1W8NA 4YARA 5JSPA 3MYXA 3CNAA 1PIV2 5E6HA 3VHRA 2R072 5ANQA 3LA3A 1A34A 3RQ0A 4SLIA 2E63A 2RMU1 4M01A 4XJAA 5CIRA 4EJRA 1ALYA 2E31A 2KM2A 1YI7A 4XFFA 3HN3A 4A2UA 4AEKA 4QX8A 4QPYA 2XH6A 3MW4A 1HV1A 1R093 2JG8A 1FOD1 1LHOA 2CV6A 1W9FA 1SLIA 5D8AC 4NIHA 1HB2A 3L2HA 4LE3A 3WLUA 2FCUA 2V72A 3WDUA 3FLTA 2CAUA 3T0DA 3OGRA 3MZHA 3M2MA 3AL6A 3VBOB 1BHGA 1ENRA 4UW3A 4XETA 1ENSA 2F17A 4D8MA 5FOBB 5FKCA 4CCNA 5JUVA 1RUG3 2P3IA 2V73A 4LO6B 3P5BA 5FZ0A 4ASMB 3RZHA 5FPLA 4XDOA 4FOVA 4OULA 1GU3A 4C1WA 4XJUA 4NPRA 3UKVA 3WSOA 3IWZA 1FOD2 3ACGA 1WUVA 4DIQA 2FDFA 1W04A 2VCBA 4YW2A 2JENA 2R062 4QXCA 4Q8KA 1UYXA 3EBRA 1ODMA 2YGLA 3PURA 3VZNA 4IUGA 3K4AA 4MGIE 3WW3A 1G9DA 2XKOA 1AR73 1X33A 1UF2C 3CEWA 4L8QA 5FXXA 4LITA 4W6XA 4MO3M 2WLPA 3BPSA 5JIUA 1G7YA 4FTBA 3N9QA 5JCTA 1MS1A 1S1AA 3B01A 2X8KA 3FZ3A 3P3PA 5AFEA 1DGWA 2F4PA 2HWC3 3WNPA 1IQDC 3URFA 5L36A 2YBSA 1Y7BA 2XR4A 4RGAA 4RSUA 3VBFA 1UPSA 2WO3A 1HRV3 3CU7A 4S2DA 5A32B 5CB7A 1HXS3 1O4TA 1DQ6A 2WA4A 4AAPA 4DINB 4MXWA 3IIIA 3VZLA 4IEYA 1W8ZA 2RS52 1QJEA 1H8VA 1LTEA 5E8AA 1W9WA 2ZGKA 3MFCA 2ADDA 2D44A 4G4FA 3N7MA 2QTWB 4R9AA 3E6CC 1WW7A 4C1XA 3NRUA 3OUIA 1MPXA 4NPLA 3VBSB 3OGSA 1Q8OA 4I09A 3AZYA 2GP5A 1UKRA 1EYBA 2OXBA 3AYCA 2LROA 2VGDA 1XNCA 4RA0A 3O0WA 1IS4A 1XU2A 3H1MA 1PGW1 3GBFA 4OMDA 5FWEA 5FUPA 1TG7A 3TBDA 2QZ3A 4YFZA 1IG3A 2RM21 2O0OA 1SDWA 4XHBA 1R082 2PFWA 2W3JA 3A22A 2OIIA 3VB9A 4OUMA 2A6YA 1LHNA 4JGZC 5IK4A 3HD8B 4LNVA 3TOJA 1K45A 3JUUA 4JC1A 4ONUA 1EAH1 1LOFA 3H50A 4IV1A 5EXOA 4HXCA 3ZXAC 4OZOA 4ISQA 2EXKA 3WT3A 2ZABA 5ACA1 1Q43A 1FX5A 3AP4A 2WNUB 3OGGA 1EUTA 1UCXA 2X5IB 1Y9MA 4GA9A 2E7TA 1D4M1 2D3PA 4AEJA 2Y26A 5J96B 1I9RA 1SMVA 5FLIA 1KJLA 3R4DB 3DYOA 4FPYA 2AC1A 2D40A 2QQNA 3D4KA 4AQSA 2A3YA 1PMHX 2RM22 5A80A 4ZU7A 2JDZA 1ENXA 1K5MC 5A3WA 1WW6A 5JOWA 2FHRA 3VKNA 5KR7A 1O7FA 3ZXGA 4QXBA 1OOPB 1EAH2 2OQ7A 3OBTA 3U0ZA 1CJDA 2A7AA 3ZN5A 2XHNA 2EXJA 4DEVA 4RR3A 3H3LA 4JZRA 3HNYM 2GC1A 2O1QA 4NVPA 4PDWB 4MGQA 4BHPA 3WDTA 1D4M2 2RDSA 1CAWB 2HWB1 2FZ1A 3USUA 4LO7A 1NQJA 4JKKA 5A7PA 3TNPB 4EROA 3ILFA 1VALA 3PVOA 1OI6A 3N3HA 3SH4A 3KZ4C 1W6NA 4WZFA 1MQTA 2P17A 2BV4A 2WYFA 3AM2A 5G05L 4AR2A 1GZTA 1DGLA 2EA7A 1CONA 4FPOB 4YG3A 3HBZA 2JDKA 3C3VA 4Q4Y1 4ITCA 2GNTA 5ERLA 2ZMKA 5FY8A 2XB6C 5F3GA 3PTYA 3O0XA 5CADA 4IEVA 1XYPA 3E5QA 3LOBA 3CZUA 2WNOA 3EYPA 3I97A 3PUIA 1Q8VA 2WFF1 4QQPA 4YW6A 4P9XA 2GP3A 4RGKA 1ZBE3 4RS5C 3HQUA 2JD9A 4P9IA 3ZYHA 1V6KA 1Q3EA 1G9FA 4AVVA 3GYDA 5A7NA 3B7MA 5FP3A 2WS91 5LB6A 1QXPA 1SPPB 2BVBA 3BB6A 2YHJA 3KCXA 5CVRA 3H1WA 1K42A 1W6OA 3WHTA 1JZ3A 5LEKA 1ULEA 5CG9A 1UOBA 1KFXL 4F8AA 2OKXA 3I2JA 2VMEA 5A6YA 3WG3A 3SCGA 1XU1A 4KL1A 5LWBA 1V00A 4LA3A 1OT5A 5GLUA 2E9QA 1ND3A 4N43A 3OPWA 4OI2A 4Q0SA 2VNRA 1LB2A 1ULPA 3M4FA 5KHGA 4KGGA 2KXLA 3NSTA 1DYKA 3ZDSA 3O1UA 2ARAA 2GN7A 3WF1A 5HPOA 1W6PB 3I7DA 3ZR6A 4Y1VA 2D97A 3ES4A 4CRQA 1RUJ1 2UWBA 2W52A 2XXZA 4I0BA 5EJ3A 3U10A 4CDQB 2QVSB 4XC9A 3AKTA 4CCKA 3EO6A 3UETA 2E7AA 2VG9A 1NAEA 1YIFA 1WLCA 3MIHA 4YM1A 2DVBA 3ACLA 5APAA 5C8CB 2LRPA 2G19A 2RS13 3LSEA 4NHLA 4ZS3A 3GHNA 3MEPA 2ENRA 4BCUA 4P9WA 1AXYA 4BPZA 1OH3A 4TXWA 2XJVA 3LGRA 4OHXA 4UI9L 3NJYA 4FAHA 1BBT3 1DFQA 4Y20A 3VBOC 1COV2 2ET1A 2ZTNA 3QCWA 1RIRA 1RUJ2 5FZEA 1JW6A 5AC92 5JZGA 5HBAA 3BOPA 4QQHA 2RG4A 1QJX2 2GZWA 3UGHA 3MF6A 4DRVA 1C8M1 1SFPA 4V2WA 4QPIA 1CAXA 1POQA 5C70A 2HWF1 4JDNA 2ARXA 4OHZA 5JXJA 3HOBA 1OQDA 3MGUA 4QB2A 1S0IA 1RHI2 5I0UA 2XJUA 3FUOA 4RHV1 4GULA 3AZZA 1YFYA 3SEEA 2XLGA 2W5FA 1VMFA 3TEZA 4QX3A 3AMMA 4MXVA 2HLEA 3T2QA 1RUNA 3LB9A 2X53S 2R0HA 1NXMA 5K4LA 2EXIA 3ZFEA 1YQCA 3ZN4A 1NUKA 3FHIB 3WXPA 1GICA 5LK7B 2BNNA 4CEYB 5IATA 2ZHNA 3ZN6A 2PA7A 1W6NB 3AL5A 1AJOA 3EHKA 1RVF1 4AHXA 1OSGA 1RXGA 4QDQA 1ZX5A 2R1BA 4LOTA 3ZFFA 5EYYA 4CXXA 5GLVA 3P6BA 3KT7A 2J1AA 1UN1A 1ZZ9A 1RUD2 1NG0A 4XURA 3RZGA 2GALA 1UU6A 5IVBA 4B4QA 3N9NA 3ME2A 4MVTA 2ORXA 3KT4A 4Q0VA 4K3UA 3U07A 1F2NA 2PQSA 4UW5A 5DQ0A 4YGDA 2C0ZA 2DCTA 1LENA 1ENQA 2HWE1 3WOGA 3O1SA 1OF4A 2WA3A 3DKQA 4XE9A 3SQOA 3T2OA 5JSRA 3OPTA 4ZXKA 3VBSC 5FBJA 4TTGA 2D5HA 2GN3A 5LY1A 4XABA 5D21A 5FYUA 2IXJA 1QOTA 1KS4A 2IXLA 2VL4A 3WUCA 1DU3D 4INDA 3J8F1 4LO8A 1CJPA 4L11A 3HNMA 3WW4A 3DKWA 3RJ2X 1LKNA 2EXHA 4H14A 4XPVA 3VL8A 4AL9A 1G9BA 4QPGB 1N3PA 1VB2A 4UYBA 4FFHA 5C3QA 1X36A 4SBVA 3RWNA 2ZZJA 3D8CA 3D6EA 3FWEA 2QDNA 5F8PA 4DB5A 5CKQA 1NY72 1WMXA 4UFLA 4XBLA 3O1MA 4QQOA 5I8SA 1Q56A 2DU0A 2BW8A 2VW2A 1VBE2 2WNUC 5A70A 5JXGA 1IPJA 1OPMA 2X5IC 1W8WA 1AR61 4QXHA 2BOIA 2ETEA 5FO9B 3FE5A 5I93A 5I0SA 2MHFA 1PO21 1S2BA 5A33A 1U12A 2O8QA 2QQJA 3AMNA 3LA2A 4Z82A 5E16A 2G4IA 3B3QE 4I3PA 5F6KA 1QHDA 4GB33 1Q8QA 1JZ6A 2QQKA 3BTXA 4BM8A 4P00B 4MHUA 1OOPC 2ZAHA 3ILNA 4GWNA 5A1AA 4Z07A 1LOGA 1V9U1 4LLOA 4PT6A 5DZFA 3TN92 3W59A 2D3SA 4PDWC 1AVBA 5KC6A 3EQEA 2DFCA 1AR62 2FDGA 1QGLA 3ZOIA 4MYEA 1PO22 3AMQA 3M3QA 3FC0A 5IFPA 1NZIA 1JZ8A 4OMCA 5JPNB 4COUA 1CZVA 4YGEA 1D2QA 2DBIA 2FCTA 4AZZA 3IMMA 4AHWA 1NA1B 3X29B 3OUHA 3BIWE 5F39A 3C7FA 4YWAA 2A70A 1WCKA 4I02A 1YXWA 1G9CA 2BNMA 3N4MA 1JODA 2FMYA 2ZGSA 3KVAA 1YUDA 1VB4A 3AP6A 2GNDA 3VGIA 2GH8A 3NNMA 1O4YA 2XOMA 4BMEA 4HFSA 4Q8LA 2V4AA 3VZJA 3TAYA 4XEZA 1RUE3 3W21A 3POGA 1J84A 4YZ3A 5L9BA 3RPQA 3WUDA 5IK5A 1W0PA 2JDYA 3NV2A 3ZX7A 1OF3A 1FPN1 2WZR3 4JGYB 1HB1A 4QU2A 2ZKLA 2XL9A 3HBKA 3LPFA 3NV4A 3V65A 2IXIA 4AFAA 4UFIA 4AGRA 3CJXA 4XUTA 5F37A 5IWFA 1N1YA 2OVUA 2GMEA 4OHYA 3DUIA 5FYTA 1O3SA 5F3EA 5JOZA 4FPEA 5DXDA 1H30A 1Z7S3 4LO4B 3U4SA 2B39A 3LKJA 1H2KA 1W6MB 3SITA 3ZDVA 4AAXA 2DU1A 2YC0A 1BVVA 3ITQA 3OYWA 3LIGA 1MEC1 4IEWA 2E32A 3IAPA 4UFHA 4CDQC 4KQ7A 1JUHA 1I3HA 1OHFA 1VBA2 4R4ZA 1TNRA 4D69A 4ASLA 5GKAC 1VBB1 4LBLA 1EV11 4S2FA 3WNXA 1GWKA 3ZFGA 4YM3A 5C8CC 1BJQA 4G3YC 1YQ6A 2H0VA 2X29A 3H42B 2PLV1 3LFMA 3E1F1 4DS0A 1W90A 1DLCA 2ZXQA 3LPGA 1VPHA 2W92A 1SZBA 1Z0HA 2Z69A 1DYOA 1GNHA 2C6SA 1O3QA 2PHUA 1F9KA 4EN6B 3S30A 1IZ3A 3I2DA 5FZ7A 1ULFA 1MS0A 3THDA 3C7EA 3N7LA 4LK6A 3FLRA 4C90A 1FNYA 3KSCA 1AX0A 4W50A 1L3JA 1EV12 4JKLA 2DTWA 5DN2A 2BZDA 3TRSB 4AXOA 2W91A 1X7NA 3OG2A 2JJ6A 2K0GA 4N9IA 2HWD2 2PLV2 3GZUC 5GLTA 1D4VB 1W9YA 3I2IA 4AFCA 1PO12 1JZ5A 4ZXEA 4HANA 4COVA 1UWWA 3RMXA 1HLCA 4AHZA 3QBQA 1UZ0A 4YVSA 2CHHA 4Q29A 4R9CA 3S6PA 2LUWA 2XVGA 2CGPA 4Q4W1 3MW2A 3ZMOA 3RZZA 3QLQA 2D6MA 4CEYC 3VBRA 1M06G 4PI2A 1F4AA 1TMF1 4CDUB 1Q5OA 1VE0A 2J22A 4XF0A 4NHXA 5F2WA 4Y22B 1REFA 3FMGA 3FFQA 4WVMA 1W6QB 3I54A 2HBUA 2BERA 3S0MA 4HPKB 4AI9A 5L19A 2JX9A 5FYVA 1YJKA 4D7TA 1VBC3 2VMGA 4UF0A 1NCRA 4QHOA 3DV8A 2NM1A 4AVTA 5JPMB 4CDWB 3ZPYA 4EZHA 3S5AA 4MG2A 1XXNA 2JE9A 4Q4W2 3HR9A 1UX7A 4Q27A 1PVXA 2VOWA 1AYN3 2VZPA 2CNAA 3F95A 5HV0A 2FZ2A 2RV9A 2VC9A 1OFSA 4LEJA 4Y1XA 1AL22 3T1MA 2O14A 2ZX4A 3UK9A 2BBVA 5JDBA 4AK3A 1LOAA 1ZZCA 5C4WA 4Q4X3 4OCTA 4QPGC 4MLOA 4XACA 3K77A 1UZYA 2X05A 4NUBA 4RL7A 3JB4C 3JU9A 3AP9A 2B4KA 4N53A 4AGVA 2AZ5A 3Q8BA 4CPBA 4M3CA 5I0RA 4C0BA 3PJQA 1VRH2 2A6XA 2VU9A 3O7OA 4KWJA 4XUNA 2VCMA 4BQ5A 2VNOA 3MLKA 1Y9QA 5C9AA 3MFAA 4YRDA 1PVC1 1URXA 4Y24A 4CCDA 1OFNA 4L97A 3U14A 4DUWA 5FYYA 1NQDA 2G1MA 1APNA 2PQQA 2ZGOA 4V1PA 3RFRA 5A3NA 1KD7A 4NR1A 2DFBA 3H8XA 4FVVA 1OD3A 1ZZ8A 4FXGB 5FZKA 1NXD1 1TE1B 1GOFA 2BRTA 4GKXA 1AR83 1OLMA 2QBXA 2XLFA 1UOFA 2W1QA 1RMU1 4CCJA 3W5NA 3KV6A 2ZEWA 1XE7A 3AZWA 4WM7B 3UYJA 1ZBA1 4E2SA 1PVC2 1D2SA 2ZA9A 1PGL1 4LBQA 4Y26A 2WO2A 5DUUA 4YZ1A 3BGAA 4CP9A 2VH9A 2QCSB 4XQWA 3KV9A 4YG0A 3SC7X 1B35B 1A6CA 1WCQA 1NA1C 4RQPB 5C71A 1HDKA 1H1MA 3PNAA 4GMP1 5FY1A 1KQRA 1RMU2 4GMP0 3A4UA 3POYA 1UYYA 1AR93 4JDOA 2FBEA 5IW0A 1PZ9A 4CEWB 3LZZA 1RUC1 2RR12 2MEV2 4GIQA 4BXFA 1BMV1 1ZBA2 4K40A 4N7UA 2Y6HA 4CU9A 5FY5A 1PGL2 2Q5TA 3AKSA 4CSWA 1VAMA 5KHKA 5CZKA 4AI1A 1S0GA 3U11A 1X9TA 2B5HA 2P3KA 2Y0OA 3LDRA 4NIGA 3BKZA 3JBG1 2Y6LA 2Z42A 3OGJA 1BCXA 4IEOA 1ND2A 3UT0A 1CX1A 4XBNA 2ZGRA 4PIXA 2WR9A 4JGYC 1GWMA 1X50A 3MO4A 3PIJA 5F3IA 4ARYA 3DPRA 4XMAA 3ZYPA 2JIJA 3BALA 3GBGA 2A71A 5FIXA 2HJIA 4LBOA 1UOJA 1Z78A 2VZ1A 1GZWA 1T6GC 2VZTA 4Q4V3 5L9RA 2N7GA 1LU2A 4OQ9A 4CP1A 1XE8A 1TVGA 2JDAA 3VLBB 5A7OA 3RSJA 1NCQB 3ZYJB 3O1PA 1YQ2A 2HEYF 1U0AA 4A6OA 4DMIA 2WINB 2WNVA 3JQXA 4HZFA 5FR3A 1PMJX 4QQLA 1RUH1 4DXSA 1GZCA 2X09A 3INAA 5F5QA 4HK9A 3JBG2 3B94A 3I2FA 1NX9A 5K0UB 1AX2A 3N7KA 2XLAA 3AYEA 3NJZA 2HKXA 4YNIA 5TSWA 1W28A 1DDLA 2WWSA 4A42A 1POV1 1US3A 3WV6A 5FZ4A 3KHBA 3JD71 4BWOA 4XF4A 5JXIA 3PUAA 2ILMA 2VZQA 1GNYA 2BYVE 2HEVF 4HKOA 2A3XA 2XVKA 3FX3A 4U2AA 4UBHA 3VBUB 3UKTA 3UJOA 4H7MA 1ULCA 2YYOA 1IKQA 2WO7A 3HEIA 3I2KA 4XBQA 1MS9A 2R043 2W87A 1OPOA 2WWJA 4GJZA 5DUVA 1TME1 4XW3A 5J98B 5K9YA 3VZMA 1GYKA 2FMDA 5AVAA 5A3PA 2WQ4A 4CDXA 5FYHA 3KMHA 1V6IA 2W1WA 4E9KA 4FPJA 1JYXA 4EN0A 1UY1A 3RJRA 2VNVA 1QXRA 1CWPA 2W9XA 3CJIA 3I3QA 1R091 4WM8A 4LMFA 5J48A 3NW4A 4IV3A 2E7QA 1FATA 1RXFA 2WC2A 3CDZB 2TBVA 3ZM8A 3RZJA 3IM0A 4LHNA 3WDYA 3LEKA 1SFNA 4K8RB 2VQUA 2DCKA 5FMOL 4OUSA 1VBD1 2JECA 4HN0A 4QWNA 3GCXA 4OI4A 3SCHA 3ZXEA 5KBFA 4YVWA 4CCMA 5IVYA 1UY4A 4K7JA 4UFKA 3CF6E 5CFCB 1QEXA 3LAGA 1JZ2A 4QGLA 1RUI2 1H8TA 1YNAA 4FPGA 4CDUC 1ASJ3 1QJY2 2Q4SA 3POBA 4WZCA 1FV3A 2WZEA 4Q1PA 1Y3TA 3DYPA 3MDPA 1HRI3 1SLTA 2B7YA 4TN7A 3VDDA 1XE0A 1MZEA 3MBWA 1J59A 1AR71 2EVXA 2QNKA 1VBD2 3HJRA 1CAUA 2J42A 5LASA 2A6ZA 4CDWC 1RUF2 4DY3A 1QJZA 4XFIA 4PI0A 4PBPA 2VY0A 1NLRA 4PLNA 5CU1A 3RS6A 4COYA 3N9MA 5IVEA 4LHKA 1PGSA 4LUMA 2YV8A 4O65A 2RMU2 3IKWA 5BNOB 1J3QA 3OD4A 1O59A 4TWTA 4XJ8A 1GFF2 4AVBA 4H3WA 5J37A 4P9YA 4XAEA 3GJBA 1JYVA 1PIV3 2JB8A 2R073 2OW4A 1O5LA 2WRAA 3PTRB 4Q5OA 3BUCA 4XUQA 4QT6A 4OHVA 1J3PA 1W06A 4L0PA 4QQ2A 3CZJA 4I3GA 1OLRA 3TNQA 1YEWA 4QAWA 1W05A 1PZ8A 1S0JA 2P1BA 3FLPA 3LOIA 4F7ZA 1FMD1 1BKZA 3ZSMA 1DP0A 4YW3A 4IDZA 2IFRA 2JWPA 3A23A 4XOGA 3VUOA 1OA4A 2IWGB 2RJLA 1SBDA 1ZRRA 4ORFA 1DG6A 1LOBA 1KDKA 2C4XA 3A0KA 2LM3A 4C8DA 1OVPA 4CA9A 2ZJCA 2Z4FA 2K2SA 2QDRA 1O5UA 1W0OA 1ZZBA 3EB7A 3I3BA 4DXZA 4CXWA 1FOD3 1FMD2 5FZ6A 1JZ4A 3PUSA 1WA6X 1C1FA 3FFZA 3R05A 2WYSA 1V0AA 4J1WA 1G86A 2R063 2YU2A 1GNZA 4WM7C 4Q0PA 2BEOA 4HONA 5FMBA 2R7EB 5L7OB 1CQ9A 4XUOA 3SNMA 2E33A 3DYMA 1I6XA 4P9LA 4LORA 3VBHA 4D6SA 1UL9A 1YCIA 2CU5A 3LEMA 1B35C 4HVQA 5B2GB 5LZ6A 3ZKUA 3H8UA 1SQ4A 4B4PA 4KBBA 4RQPC 5FLHA 4DY5A 3M3OA 1RITA 4AEDB 4CEWC 3O0VA 1K12A 3DEMA 2OUHA 1O8PA 5C6CA 4NPMA 2UYAA 2ZACA 1LOEA 3CBNA 3K2OA 1EPWA 2VCCA 2RS53 3N9PA 5IUQA 1VJ2A 3ELNA 3PL0A 1JU4A 2Y60A 3AK0A 4KWUA 5ABJB 2JG9B 4H55A 1PGW2 4PF5A 3KGLA 5FUIA 1WLDA 2RE9A 4B7EA 1PX3A 5FPAA 3WQBA 3KV5A 2FDJA 1E5RA 3ETPA 3WHUA 2EAAA 5HCAA 4BLJA 2BPA2 2XJTA 5HV4A 1WCDJ 4GH4A 3T4VA 3U4XA 5I0DA 4HVOA 2AREA 2JG8B 1R083 3ETQA 3D5OA 5FP7A 1NCQC 4D7YA 5ACA2 1VP6A 1Y43B 3VDBA 5BNNA 3AP7A 3B5LB 1YIPA 4RYDA 5FMOS 1SHWB 2QQIA 3HIFA 4DOUA 4FAGA 2VQ0A 1RB8G 5K0UC 3HQXA 1RTVA 4IGPA 4EN9B 5BNPA 2R0FA 1YQ5A 2GNBA 4MGKE 2VO5A 1RJ8A 1MS8A 4P5YA 1H2NA 3MV11 5J36A 5DDJ1 3GGLA 2ZGLA 4LHLA 1MZFA 2RM23 4TLFA 3GHMA 4BIFA 3T09A 2C5DA 5F5CA 1AYM1 2DDUA 3WQ1A 3ZXKA 3B9CA 3VBUC 2QUOA 3ZYBA 2AEZA 2VUDA 1O3RA 2HWB2 1UMIA 1LULA 4NWVA 1C28A 3KCYA 1JYWA 2WABA 3VKMA 2YPDA 3PU8A 2NMOA 4AF9A 1DGWX 4B8EA 2VZOA 1D4M3 2ZX0A 1DGRN 5JWPA 5ANNA 5A7WA 1RC6A 5DDJ2 5D2AA 2RDQA 4AI2A 4Q4Y2 3SXWA 3R0RA 2X10A 2YGMA 1EY2A 1A8MA 4UXAA 1AYM2 1SLBA 4O9EA 3HQRA 4C91A 4KH9A 3VBFB 1CAVA 4RN5A 2HH9A 5GLWA 1N1VA 4UT5A 3K48A 2C26A 3V0BA 5BNQA 3KHCA 3NL1A 3A7QA 1YJLA 2WT1A 3DECA 4HETA 4MXWB 2WFF2 2PYTA 4YW1A 3WQ0A 1XSQA 2PHLA 4JHTA 2Y8KA 4META 5FYBA 3T0AA 4MGZE 4FQZA 5FDBA 5ISLA 1SACA 2WS92 4PQQA 1S0CA 2MPFA 4BIOA 3WX5A 4Y1YA 5DABA 2VUCA 3NQHA 4GZ9A 4DUVA 5CFCC 4ZONA 2D7FA 3ZYGA 4COZA 1F15A 2HYXA 3PDQA 2FD8A 5EJZB 2BUKA 4HKWA 4YG6A 4XHXA 4CP2A 5H9SA 4D6QA 2TUNA 4XIOA 3K4DA 2AEYA 3NNJA 3BN6A 2VTXJ 5CFDA 4XFAA 4IV1B 2NYYA 5IVJA 1X82A 5LA9A 5HCHA 4LKFA 5IJRA 5A7QA 3LFIA 2J1EA 3AXEA 1K3IA 3A0NA 5BNOC 2EF6A 5FZ9A 3BU7A 4IW3A 2J1RA 1ZRIA 2EIEA 4AG4A 4TZDA 4IGOA 4UBGA 4AW7A 2G9GA 3QD6A 2H6BA 3LDBA 4QGMA 2AR6A 3M70A 1UU5A 2LTNA 2PHDA 3RYRA 2AYHA 4OLLA 5K7PA 2YZ4A 2ZEYA 2E51A 4Q0QA 4RR3B 4A4AA 1CGPA 2RS31 4JQRA 3A21A 5IYYA 1JYNA 2RDRA 2DF7A 2EIDA 2G9ZA 2Q8EA 3T0BA 2UURA 4XCAA 2FCVA 4FO9A 3MIFA 1XQNA 4IE7A 5GZDA 3USUB 4FPCA 4OYUA 3WD5A 5F7UA 3ZVXA 2ZHLA 3ST7A 4EWAA 3ZXLA 1PK6A 2JDNA 1C8M2 1GBGA 4LJHA 3NNFA 1MQTB 4AVSA 1E57A 3OEBA 3RG0A 2HWF2 5FZBA 1COV3 3ILRA 1ZVFA 4L99A 1RUJ3 3OD0A 4KGQA 5AC93 3WDVA 5CAZA 1UZZA 4XILA 2YDEA 1W8TA 1QJX3 5LBEA 4RHV2 4UWDA 2RS32 5EPAA 5SV5A 5A3TA 1CIWA 1QNYA 2CL2A 2VBBA 3KQ4B 2DYCA 3WZ1A 1IHMA 4BDVB 1RYYA 4XJWA 5FXVA 1JUIA 3H1YA 2EAKA 3VL9A 3ZR5A 4ATFA 1RHI3 3MPPG 3KB5A 2E6VA 2CDOA 1B09A 2VR4A 4XUPA 2Y33A 4MX3A 1LJ7A 3VHOA 3AXDA 4IE5A 1RVF2 2VW0A 5L7OC 1RJ7A 1CX4A 2C9KA 4LBJA 1QOSA 2GC0A 2VOVA 4M0HA 4NHMA 2KD7A 4GB31 4UFMA 5FZAA 1AZDA 4ES9A 1JTZX 3BTYA 5IVFA 1HJFA 4XZPA 3R4UA 3BTAA 4AI8A 4BXSV 4NIDA 2Y6JA 2ZS6B 1TNFA 4LBNA 3NKGA 3HWJA 2GAUA 1W6OB 5T54A 2DCZA 4KNCA 4AEDC 2A6WA 2HWE2 2XL7A 4K1ZA 2R49A 1RUD3 2D6PA 4FPKA 1JXNA 1L7QA 2VE1A 5CYYA 3CIHA 1ND3B 4N43B 4Z2WA 3MICA 2XG3A 3J8F2 1NOVA 2IC1A 2B46X 2WN3A 1DLLA 1VMJA 5ABJC 2JG9C 1VIWB 1MVQA 4BQ1A 1S0FA 4H7LA 1KEXA 5DG1A 5C7GA 4NMIA 2W94A 3RZMA 2P37A 1ACCA 2D98A 4W4ZA 4S2GA 1S4CA 5FOJB 4XF9A 5GM0A 3AZVA 3R4SA 1UYPA 4FP3A 4XMIA 5C5UA 1C4RA 2YB7A 2JG8C 5GZEA 5FZCA 2W0XA 5IK7A 4ASKA 5A3LA 4QKFA 1RUE1 2IUWA 4AVAA 1LHVA 2JE7A 5FPZA 3GM8A 2WZR1 4Y20B 5EFUA 3NAPA 1H6YA 3Q8EA 3UL2A 1VBE3 5I91A 3PVEA 3U75A 5JZGB 1YFUA 2CWMA 3I59A 1AHSA 4XTPA 3PU3A 1I5PA 1V9U2 4UW6A 1S2KA 2K46A 4QPIB 2H6CA 1W8UA 5EP9A 5FZ3A 1CAXB 4AWDA 3B69A 2Z5WA 3ACIA 5LY2A 4FTEA 4Z2AA 4XYXA 4RFRB 4UW4A 1Z7S1 5CA6A 1AXZA 4GAZA 1XOYA 3WF0A 2WBKA 1JYCA 3T2TA 2MNGA 4Q26A 1F5FA 3IPVA 3TN93 3ZSJA 1U5IA 1R1ZA 4CYDA 3K51A 4HOOA 1DQ5A 2WJSA 3OY8A 4GALA 4X6RB 1CD3G 3ZFEB 3KV4A 1ZRCA 4Y5SA 1AR63 1H0BA 4S2HA 4DEQA 3BU0A 4AFDA 1PO23 2DCJA 1SCRA 1YHFA 3LIHA 3WP4A 3ZN6B 1JHNA 2PAEA 3FN9A 4BQWA 5I8YA 3SH5A 2H0BA 1UY0A 1VAKA 1BZWA 1J58A 5EZWA 3S57A 2J7MA 3ZFFB 5FZOA 2W47A 2PHFA 1QXJA 5D8AA 4BQYA 3VBFC 3HPNA 3OCPA 3SEPA 1U5YA 2D6LX 3BODA 3VKLA 2BGPA 4R4XA 1HKDA 1SFYA 4LBKA 1BVP1 3PUHA 1DBNA 4TSVA 2OZ6A 1YQ8A 2ZGUA 1QQP1 1TQ5A 2VD7A 2ORZA 1J3RA 1FPN2 1YC61 4AI0A 3NNGA 1HIXA 1O4ZA 3B9IA 4BISA 2VW1A 2VTFA 1W0NA 2WUHA 3THPA 3B02A 3AC0A 1IS5A 4LXLA 3VD7A 2J1SA 5A1FA 4A3ZA 4B29A 2BJSA 4HBNA 3SLIA 4E27A 5A6ZA 4MV2A 2XUEA 3CO2A 3ZMNA 3AB0A 1G9AA 4QD2A 3WNOA 4URAA 3AVRA 4B3NA 1QQP2 4EWEA 2EIGA 1ZZ6A 3FUQA 3OEAA 1LOFC 1AUYA 4IV1C 4E4HA 2J1UA 4IE0A 4BU2A 2R16A 2PELA 3H7JA 3BCWA 3WNLA 1MEC2 3VD9A 3LEIA 4FOYA 5FY9A 1MS5A 3W58A 1ZA4A 3O1RA 1QKQA 2A5ZA 5JXHA 4XJZA 5A33B 5M0TA 1VBB2 4GQ7A 4K6BA 2W39A 3O1OA 3SKJE 4E2GA 4LT5A 4YYOA 2QQWA 4PIYA 1WKYA 1LEDA 3LSDA 1VBC1 5LW9A 3V0AA 3SKVA 1OLQA 3M7AA 2GDFA 1HQNA 1VBA3 2XJPA 5IFTA 1KDMA 4RR3C 3AMHA 2SLIA 3MUZ1 3BOWA 2AENA 1CZSA 5LA0A 4WVVA 1AYN1 2Y6KA 2GU9A 1OURA 3ASIA 2W95A 3WR0A 1CVNA 2VBDA 4DQAA 3VD4A 1JOBA 4XF1A 3U37A 4GJYA 1C1LA 2D6OX 1MQTC 4CZSA 5J3UA 4PIZA 1XBFA 1WCUA 4KWLA 2OPWA 2DURA 4Q4X1 4YLZA 4D3WA 4CU8A 5DG2A 5JIAA 2DUPA 2GH2A 3AFGA 5GJ6A 3BTZA 1EV13 1CR7A 1ODNA 3N7JA 2XHKA 3M3CA 2OQ6A 2VXJA 3N9LA 2HWD3 1W8OA 2PLV3 3ORJA 4N8MA 1L7LA 2VPVA 4FFGA 4LK7A 2VMCA 1PO13 2UYBA 3SCFA 2WIIB 1HQLA 2DWRA 2ZGQA 2NZ9A 5H9PA 1TMF2 5HXMA 1BEV1 1H1AA 1K5MA 2AUYA 5EHDA 1J83A 2ZGPA 4BQ4A 3MV01 1BLZA 1OMIA 4YGCA 2HYKA 2W68A 3C7HA 2L9LA 3H3ZA 4LULA 5BV6A 2WDBA 3CQOA 4IEPA 3THTA 1QDCA 1NLSA 4XFCA 4BQ2A 2ZX3A 4BE3A 3DL3A 2PHXA 5C3RA 1KXGA 4MZUA 4YGBA 1QJU1 4FT8A 1HW5A 1Y4WA 5CG8A 1G8WA 3RYPA 3NWKA 2CWSA 4K1YA 1BEV2 4NRPA 1C5IA 1XYOA 5T5PA 1ND3C 1XNAA 1MZ5A 1UX6A 4N43C 3WP3A 4Q4W3 4OQ8A 2Q30A 2J1TA 1LHUA 2R6QA 3OYWB 2Q0AA 3KF5A 3MIGA 4ZKTB 2C9AA 1JU3A 1AL23 1SDDB 2A1XA 2XMLA 1AR91 1QJU2 3NO8A 2D6NA 5CNAA 3ZFGB 1AX1A 4OUEA 3TEYA 1O3TA 2UY8A 4LLFA 3PLQA 4D7SA 5FQ0A 2ZX1A 4M3CF 5FZLA 4QB1A 1R1A1 4RS5A 2B42B 1FYUA 3VD3A 4AFBA 4IXLA 1UY3A 2ID4A 3FJSA 3GCWA 4Q1RA 5J1XA 2FDHA 2D5FA 3ES1A 2WN2A 4JDMA 3VN4A 3AJZA 4XTMA 4HVRA 5JLVA 1VRH3 4LIVA 3AKPA 1XNTA 5JZGC 2IFWA 1WCSA 3LWCA 3AFKA 4M0NA 4QDSA 1S2EA 2QQOA 3O14A 3PMEA 1GANA 1STMA 2QKDA 3AZXA 3IDCB 4Q4V1 3ROUA 4D0QA 1KRIA 4QPIC 4IEUA 2HEWF 3KT1A 1IQAA 4OHWA 5FJHA 1WBFA 3P1IA 3H7YA 1DZTA 1R1A2 1VRBA 3GZEA 3GZAA 5LCWL 4W6YA 2VBPA 5LA1A 4P5HA 5D1IA 1D0GA 1BK0A 5BXXA 2YU1A 2NQYA 4G9SB 2VECA 3DXUA 2G9FA 2GNMA 3EMRA 4IGQA 3WDWA 4HG6B 4MSVA 4YVSB 1JOPA 5KC5A 1XNKA 3ZFEC 2VVFA 4RD7A 4NRQA 5FZMA 5FYMA 4KU7A 1IKPA 1PVC3 1V6JA 3H0OA 3VBRB 1WA4A 1JMUB 1H6XA 4WVMB 2XQXA 4A41A 4PHZA 5FMCA 5FZHA 3ZFFC 3KWVA 4AQ6A 2JDUA 1RUC2 5FO7B 4NAOA 1BMV2 4LUKA 4E4SA 3ZKYA 5K8SA 1OUSA 1XB9A 3MPBA 4UF0B 3AP5A 5HCFA 1NCRB 2XBO1 1RMU3 4P08A 3VBOA 1QF3A 4MGTA 1V6NA 1CESA 1UZWA 4IE6A 1UO9A 2RR13 2MEV3 1UIJA 4L9BA 4BJ0A 4E8CA 1QH6A 2VCAA 3H9AA 4ZS2A 5T52A 5F6LB 3WNNA 4YZ5A 3KVBA 1POV0 2Q1MA 5DAPA 3RI8A 3S7IA 3OOXA 5JAXA 3AYAA 3OJBA 5FFOC 3BIEA 3GBWA 5JOXA 5C4WB 4XFHA 2KA3A 1P8JA 2XBO2 2D43A 1MS3A 3ZXJA 4CTEA 2DTYA 3IN9A 2LS6A 1RUH2 2PAKA 4R52A 3ZSKA 4AOCA 4N53B 4P14A 1U5XA 1S0BA 1JHJA 4M3CB 2P3JA 5BUVA 1OKOA 2QQUA 2R32A 2TEPA 2VMHA 1K5JA 2YROA 5BPXA 3WG2A 3ZSEA 4RGGA 4BK4A 5C9AB 2QQPA 1LGCA 3JD72 5T50A 1ASJ1 3D82A 3JBG3 2YC2A 1W2TA 4WVZA 5A6XA 3TEWA 1PMIA 4D94A 3HN1A 5F1RA 5A32A 2JDMA 3RGBA 3D0JA 3JZVA 4ZHNA 4JRLA 4YSFA 1SBFA 4ET7A 4IEXA 1DCSA 4AHYA 1BK1A 4KG8A 2VNGA 2VULA 3ACHA 3HMYA 1TME2 4NHYA 1W8FA 1V6LA 4FQ4A 2GMPA 2P4EA 3WCSA 4DUXA 3VBSA 1WW4A 3ZLIA 2VTXA 4QU1A 4ATEA 1RUG1 3LDKA 3KLSA 4LOSA 3VZKA 5F2SA 2WZPP 2ZKNA 3WG4A 4COWA 4A7ZA 3TYJA 5JOYA 4XAAA 3G7DA 4LBQB 2W2IA 4CUCA 1Q8PA 4YM2A 3IB3A 2R071 5IAVA 1GKBA 1R092 2WQZC 2P5BA 1GV9A 4CP9B 4OI0A 3H3UA 4XDPA 4OI1A 5GLZA 5EV7A 2PHRA 1UMHA 3PMSA 2ARBA 1YFWA 5A1LA 3S7EA 1AL0G 2C1FA 4CCLA 2WNUA 4I01A 3RI9A 1PX4A 4F83A 2X5IA 1RUG2 3TWIA 5IK8A 3OTFA 2WSUA 1N1TA 1T2XA 3GZTB 4Y5TA 3POJA 2BWCA 3FBYA 4JX0A 3LCPA 3LA7A 4FPFA 4MGSA 2HWC1 5FREA 2YBKA 2YG0A 1NE4A 1REDA 5KXDA 3K4ZA 1OOPA 1ND2B 2BGCA 3JQWA 5FZ1A 1HRV1 1L7RA 4KG0A 5FYCA 1UU4A 1HXS1 1RUI3 3DPRB 1DQ2A 2BQPA 1AR72 2JDPA 1GZWB 1GOGA 1GQPA 1QJY3 4PDWA 4QKDA 4EN7B 1CAWA 2R061 2ZBJA 4OVEA 2Y6GA 2O8OA 1AJKA 3OSDA 4ZU4A 4Y1ZA 4LA2A 3LQCA 5J7MA 2HWC2 1KGYA 2WNVB 5E1RA 1VBD3 3ZYIB 5FUNA 4CVUA 4JCKA 1RUF3 1HN1A 2Q1FA 4BQXA 5FZDA 3TB0A 3I3MA 3O12A 1HRV2 1JN2P 1ZZ7A 2RJ2A 1LRHA 1ULOA 1ZM1A 5HXVA 1HXS2 2D3RA 3HT2A 3J26N 4FI9A 2RMU3 4XXPA 5JI7A 4WBBA 4DNYA 3N36A 5DMYA 4YPJA 4Y4RA 2CYFA 3N9OA 4DPNA 1GUIA 1W3XA 5LATA 3ZFGC 1EUUA 4PCRA 2Z2SB 1GQGA 1FI2A 5DZEA 2RS51 1XRUA 2UY9A 5FPUA 4LHSA 1QIQA 4ZPIA 1ZRFA 3APBA 2CDPA 1JOJA 1UXXX 3OGVA 3PHMA 1SPPA 1FAYA 4IE4A 3IIAA 4A45A 4CDXB 2UWAA 4M3CE 4M4RA 1MVEA 2PMWB 4QX5A 5C3SA 3ABZA 2AH2A 4CU6A 1JZ7A 1Q8SA 3Q8AA 3ZO0B 4FBFA 4CP0A 3CJIB 1LESA 4Y3OA 1E5IA 4WM8B 1R081 4IV3B 3BYWA 4Z1VA 2VOKA 4Q0UA 1LCLA 5GZFA 4Y1UA 1F35A 4JVAA 4QKNA 1FMD3 2LW8A 5FTTC 3O1TA 1OLME 1W6PA 4YVSC 5FZFA 3K3NA 2P34A 3MIDA 3HNBM 4CCOA 4YVWB 4UOJA 1X8MA 2Y6FA 4CDQA 2OPKA 1TZOA 5I0TA 2WSVA 3F2ZA 4B1MA 2XUMA 3VBRC 5JMCA 1H8TB 2NMNA 4L92A 3ZYRA 1OD5A 5C8CA 1SBEA 3I2HA 1QOOA 3J7MA 5JMOA 1O8SA 1XSRA 1GZ9A 3UJQA 2ET7A 3VDDB 1C3HA 2XJSA 1QMJA 1XC6A 1HB4A 4AVCA 2VUJA 4LR4A 5T5LA 3POIA 1NCRC 1NZCA 3P3NA 2W08A 1CAUB 3LF7A 1SLLA 1ZBE1 1CPNA 1IGOA 4YW7A 1W2AX 2BFUS 1GMMA 2PHWA 1QNWA 3E5UA 3U78A 3O5SA 5C3PA 1SCSA 1I1EA 1V6MA 3GJAA 2CSGA 2VAUA 5B4XA 4N7IA 2DVGA 2I07B 4FOQA 3RDIA 5T5OA 2W1SA 2R1DA 4E2QA 5LA2A 1EAH3 1ZBE2 2DUQA 3UKNA 3DCQA 5BYNA 2IVJA 1CZTA 4HK8A 4N53C 2OS2A 4UFJA 3C7OA 3IDEA 3DGTA 3WDXA 5ACA3 4V2VA 4CEYA 2HBTA 3PJYA 5IVVA 4EYUA 2C24A 2WL1A 2BWAA 2GC2A 1H9WA 5C9AC 3I3EA 1GQHA 5FKBA 4XZUG 5LEJA 1GOHA 2ZMLA 3WG1A 1JH5A 1W39A 2F4LA 1OQEA 2WAAA 1HX6A 3RYKA 5DUWA 5EYXA 4QKBA 3VDCA 1ZREA 2RS11 4BZ4A 3AKQA 2BP6A 2GC3A 1OVSA 2BU9A 2WQ8A 4CUGA 5GZCA 5JI9A 1SLCA 2ARCA 5AVPA 1QU0A 1XNDA 4HMZA 3LE0A 5F32A 4BA6A 4NAMA 1BBT1 3RZLA 1UYZA 3I2GA 2XJQA 2HWB3 3C7GA 4XFBA 3V64A 2TNFA 4FOWA 5FO8B 4FP2A 3IMNA 4Q2FA 2IXKA 5FYSA 4CE8A 2BGOA 4I30A 4WVWA 5F5IA 2XJRA 2Y0IA 5DAVA 1PM4A 2VUAA 5AFBA 1J1TA 1DQ0A 4DXRA 3OBZA 4MHRA 2CGOA 2RS12 4M4PA 3VBHB 4QPGA 5DDJ3 1W2UA 1RINA 3C2UA 4AEMA 4XF3A 1GSLA 3BI3A 3E97A 2XWBB 4Q4Y3 5FRAA 3WINE 4URTA 5DUXA 3B00A 1MS4A 2D6KA 1BBT2 1AYM3 2ES3A 1M4WA 1NYWA 4JTOA 2IVIB 4LKEA 1MR5A 4JRAA 1LEMA 5LK5A 5KHIA 1UY2A 2VZ3A 4CCCA 1ZYBA 4QM8A 3PVNA 1YWKA 2B9UA 2DVDA 2WFF3 4EV0A 3MI8A 1UMZA 3IT8A 4JTNA 1COV1 1PHMA 5AC91 2WWUA 2ZHKA 2WS93 2WT2A 4C0HA 1QJX1 4PJYA 1ND2C 2F6BA 2GSYA 3CKHA 3UV9A 2OYZA 3DPRC 1WD4A 3NV3A 5GALA 3T30A 2ATFA 1EPZA 5KHHA 1PZ7A 4DO0A 1V70A 5DAWA 3NNLA 4GH4B 1RHI1 2YY1A 4EWDA 2B45X 3ENRA 4EQVA 4CXYA 1SEFA 1VAVA 4QPWA 4FCAA 2YC4A 3NV1A 1OC1A 4LKSA 5BNNB 2JIGA 2WNVC 1G6NA 2LALA 4Y33A 3VDAA 2EIBA 5CKNA 1A3KA 4I0AA 3WNMA 1A8DA 1C5HA 5A7SA 5C4WC 1QH7A 2ZGTA 1NA1A 2WKKA 2YFUA 1N1SA 3I8TA 1XJAA 3OBAA 4XIKA 5BNPB 1WGPA 3WW2A 2E53A 1IS6A 2ZAAA 1F5JA 5EJ1B 3GF6A 4NIAA 4ARXA 1UKGA 2DV9A 4F3JA 4IQPA 1UPIA 1OA3A 4XDQA 4HL0A 4K20A 5FYIA 1RUD1 2XDVA 3QACA 1IPKA 4HN1A 5FPBA 1W9TA 2B8MA 3MLLA 1UOGA 4MUVA 4YZ4A 3ZIWA 5KXBA 5F3CA 1D7PM 1O6UA 1QDOA 3WF2A 4XFGA 3WVJA 4LE4A 3EXUA 3KS7A 4JGYA 1F4HA 4NHKA 1ZA7A 4CDXC 5A7WB 2AGSA 1W9SA 2PN5A 3DXTA 3NJXA 4BH9A 2OUJA 5EQUA 3SISA 1C8M3 4MADA 4Z92B 2V09A 3ECQA 2NPIA 4L2NA 5DAXA 2HWF3 1WD3A 3WP6A 3CJIC 1CAVB 1RUOA 4WM8C 4HLTA 4IV3C 1D0HA 1W03A 3ZSLA 1W3VA 1XPWA 3V0BB 4RHV3 4O9GA 1J1LA 4ZY9A 1W6MA 2RS33 1DZQA 4QX2A 3SMHA 1NY71 3PIGA 4NJ4A 5EWSA 4EE2A 2PHTA 4KBZA 1VBE1 4GB32 5A6QA 2YFZA 2W1UA 4YVWC 5FZ8A 3RWKX 1REEA 4QB6A 1UIKA 3KCCA 4GKYA 1N3OA 4NIIA 3IAQA 1RVF3 2JXAA 4B1LA 5LRSA 1W2NA 1H8TC 4N90A 2FDKA 4CU7A 1YYNA 5B4NA 1SLAA 5IVCA 4X8PA 1WW5A 2Y64A 1UAIA 3J7LA 2BVVA 4E4ZA 4HSLA 4QX7A 3VDDC 4NWWA 3I3DA 2IZWA 4MOAA 4PF1A 4XJ9A 5FK8A 3HT1A 3TN91 3POSA 3WQ7A 2GMMA 5CFDB 1DQ4A 3BVCA 2XONA 2HWE3 2ZZQA 3MF9A 3J4UH 1KFUL 4BQ3A 2A75A 2RJKA 4X6QB 3L9JT 4FTSA 2CY6A 2V4VA 2OA2A 3DF0A 2WNEA 1EP0A 3GXUA 4QHZA 3J8F3 1DIWA 3Q8FA 2YBPA 3T2PA 4R8HA 2ZX2A 4QXKA 2DCYA 2V5YA 1PM7A 1ULDA 3MW3A 2ZCWA 4IL7A 1OKQA 4QX0A 4BB3A 5LBFA 5C33A 1OBNA 5KXEA 3I49A 3TEXA 2I2SA 5LBCA 3AKRA 4K21A 4QX1A 3K46A 5L9VA 1U5ZA 1RUE2 1HB3A 1JYTA 3ZXFA 3GALA 2E26A 2WZR2 5KXCA 3J7HA 1WMEA 3AVSA 4X8NA 4QGNA 3KM5A 4CDUA 2J1VA 2ZPXA 4E4DX 1UZVA 4CUAA 5C5TA 4Y22A 4IESA 4P02B 3W5MA 1W6QA 1PK6B 3FL7A 4W8JA 4HPKA 1F8VA 4M00A 1BQPA 3CL1A 2VVDA 4YW4A 4QHBA 1Z7S2 3FBMA 2BBAA 1CN1A 2NP0A 1ZRDA 1X8EA 4DFSA 4GWJA 4CDWA 1NKGA 1V9U3 4IETA 4J6GA 4ZU5A 4IERA 1PNFA 3VD5A 4ZZ5A 2PAMA 5FZGA 3WCRA 1HV0A 3VHPA 4A3XA 1OA2A 1CIYA 1DQ1A 1ULGA 3KGZA 3K3OA 1DZRA 4LO5B 4NE9A 4LPLA 1VLNA 2ZOEB 3OF1A 2XKPA 5FP8A 4AQ2A 4BMBA 4ES8A 4CUBA 1E5HA 3VBHC 4HKLA 3CMGA 3W20A 1ZNPA 5EIYB 1VBA1 3WY6A 1PNGA 1GP5A 2RDNA 2JICA 2IXCA 3G6JB 1KJRA 2YUEA 3AYDA 4LBMA 4WV8A 1GR3A 3NJVA 4BLIA 1HQWA 1JI6A 3VKOA 2DVAA 4NO4A 5FAXA 3JXSA 3VV1A 5FV3A 3Q8CA 1NT0A 3T08A 2WZ8A 3UNPA 3IDBB 3KD4A 3OPZA 4K8FA 1H4GA 5GZGA 4JQTA 1UXZA 4GXLA 1S0DA 3AMPA 4FPLA 1FPN3 1S55A 3AJYA 1WZXA 1RL3A 3HAGA 4O7XA 2VZUA 1RGSA 1TEIA 4KI5M 5FP4A 2HWD1 1WLWA 2BDRA 3UESA 5CBLA 2IXHA 1PO11 4GH4C 4WM7A 3IDAA 3M1HA 1W2OA 2VZVA 4NOTA 4YFWA 5T55A 4J25A 3ZXDA 4EN8B 4ZZ8A 4I0WB 5FK7A 5IAXA 3SH3A 4A7KA 2BTVC 2ZMNA 5BNNC 1QQP3 1H9PA 3ZPOA 4CPBD 3W9AA 1FT9A 2JEMA 4A6SA 1MACA 2CGNA 2ZGMA 1JYIA 1B35A 3NAPB 5FY7A 1OUXA 5LRRA 5BNPC 4XXAA 4E8DA 1MEC3 4RQPA 1KS5A 3DN7A 3L2YA 1VBC2 3MIBA 2FDIA 1A78A 4HSJA 4IEZA 3I59B 4JGZA 4QDRA 1YLLA 3VKFC 1UQXA 3E5XA 3M3IA 3QOPA 2VM9A 1LU1A 4CEWA 3ZIXA 4DRRA 5DAQA 1VBB3 3WNKA 3M8LA 4B7KA 4KMQA 5T3NA 3RVHA 4R9DA 5FY4A 3R6SA 1AYN2 4KU8A 1LODA 5C8WA 2ZEXA 5T5JA 3WP5A 3IPVB 4I2OA 2JDHA 2VMIA 2CTVA 3LD8A 2Q8OA 3V56A 2XPJA 3OY8B 2XWJB 3NKTA 1HN0A 2WAOA 4LBQD 1F31A 4FFIA 4Q4X2 1GWLA 2XQRA 5CKMA 5JR7B 4DZGA 1AL21 4CCEA 4P9JA 4XQ4A 1OH4A 1AR81 5FZOB 5D8AB 1NCQA 4XCBA 3ACFA 5FJKA 5C3OA 5JVVA 3JCIA 4DXTA 2AACA 1DHKB 4NRMA 4N9HA 5H9QA 2VXRA 2I74A 5CISA 1NE6A 4PLOA 5K0UA 2VMDA 1H1IA 1YFXA 4PLMA 2VOTA 1GP6A 1VRH1 1XYNA 4W6WA 4GWMA 3THCA 3OUJA 2A3WA 1H2MA 5FP9A 5H9RA 1TMF3 1YO8A 2P3YA 3D0SA 4PBOA 4AGGA 5IT6A 3K75B 5JSOA 1AR82 1CPMA 5FYZA 3VBUA 2CAVA 3H8RA 1W8HA 1DF0A 1WBLA 1H4HA 2QFEA 2QQLA 1MZ6A 2BNOA 2V5DA 1WWYA 2P6HA 4AYUA 5LBBA 2SBAA 1IG0A 3NMBA 5F5AA 1HJGA 4QM9A 5A3OA 5CFDC 1US2A 1Y9GA 1FV2A 2QQVA 1ONAA 4R9BA 4RFT0 1XNBA 3MLJA 4UAPA 5G04L 3T1LA 4HT1T 3VHNA 5CEHA 4YZ2A 2KR2A 3QH7A 1BEV3 3AX4A 2JD4A 1T6BX 1OQ1A 2OT7A 3CLPA 3WF3A 3Q9OA 5FPVA 1UW8A 1X9PA 4LTAA 1S0EA 1AR92 1UNBA 2P2KA 2PXJA 1C8NA
chains in the Genus database with same CATH topology
3ZDVA 1GZTA 1W8FA 1OUXA 1OUSA 2JDKA 4AOCA 5A70A 1OXCA 1W8HA 2JDYA 4UT5A 1UZVA 2BP6A 1OVSA 2XR4A 2BOIA 1UQXA 5A6YA 5A6QA 2VUDA 1OVPA 5HCHA 5A6ZA 2WRAA 5A3OA 5A6XA 3DCQA 2JDNA 2VNVA 2JDPA 2CHHA 2JDMA 2VUCA 4CE8A 2WR9A 2JDHA 1OURA 5D2AA 2BV4A 2BOJA 2JDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDV A;  1GZT A;  1W8F A;  1OUX A;  1OUS A;  2JDK A;  4AOC A;  5A70 A;  1OXC A;  1W8H A;  2JDY A;  4UT5 A;  1UZV A;  2BP6 A;  1OVS A;  2XR4 A;  2BOI A;  1UQX A;  5A6Y A;  5A6Q A;  2VUD A;  1OVP A;  5HCH A;  5A6Z A;  2WRA A;  5A3O A;  5A6X A;  3DCQ A;  2JDN A;  2VNV A;  2JDP A;  2CHH A;  2JDM A;  2VUC A;  4CE8 A;  2WR9 A;  2JDH A;  1OUR A;  5D2A A;  2BV4 A;  2BOJ A;  2JDU A; 
#chains in the Genus database with same CATH topology
 4YW5 A;  4NRO A;  3JB8 A;  5E88 A;  5HCB A;  3V0A B;  1IPS A;  2WO1 A;  2JKX A;  4OFG A;  3U1X A;  2RHP A;  2EAL A;  4FXK B;  1DYP A;  1QJU 3;  1DGR A;  3M3E A;  2A73 B;  2RR1 1;  2MEV 1;  2NLR A;  3SHR A;  5DZG A;  4LQR A;  2ADE A;  3ATG A;  3E6B A;  3UGG A;  5CFC A;  3FHA A;  5FLJ A;  2Q8C A;  1BYH A;  3E6D A;  3POF A;  1FNZ A;  1BXH A;  3RRD A;  4LKD A;  4Q4V 2;  1PK6 C;  1O91 A;  5I8T A;  4Y5Z 0;  2YMZ A;  4OZX A;  2ZEZ A;  5IHR A;  3CHX A;  3PUQ A;  4D6R A;  2VQA A;  2EIC A;  2QQM A;  2VQT A;  4JGZ B;  4MGY E;  2I45 A;  1IS3 A;  1ST8 A;  2JE8 A;  2P6C A;  1H2L A;  5FXW A;  3T3Y A;  4KWK A;  1QY4 A;  3WW1 A;  3N35 A;  1FXZ A;  2W46 A;  3O1V A;  2XVL A;  2R04 1;  4JV4 A;  5FWJ A;  4K9S A;  5J09 A;  3KQR A;  1QWR A;  4H2A A;  4GWI A;  1R1A 3;  1R64 A;  1V6O A;  5A3M A;  4ISR A;  5FMD A;  5BNO A;  2WFP A;  5JR2 A;  1LGB A;  1ZBA 3;  2YXS A;  1YRZ A;  1LR5 A;  2NN8 A;  1N3Q A;  2JKB A;  3D3A A;  1N47 A;  3MIE A;  1K5M B;  2UU8 A;  3OBR A;  5HI0 A;  5KWR A;  3USS A;  3B93 A;  3OB8 A;  2VZR A;  2WT0 A;  4FSJ A;  4LIU A;  1W99 A;  3I2O A;  1LHW A;  1WLT A;  2JB4 A;  2QJV A;  2RVA A;  2UWC A;  3IBM A;  2BOJ A;  3MUY 1;  1WMF A;  2Q1Z B;  1LEC A;  5FBZ A;  1GLH A;  3UGF A;  3WEZ A;  1WMD A;  4GMP 3;  2R04 2;  4JHZ A;  5SV8 A;  1VR3 A;  2Y38 A;  3ALQ A;  3WF4 A;  5DPN A;  1RUC 3;  1I5Z A;  2PTM A;  1SG3 A;  2VZS A;  4JKM A;  3IZO A;  4Y4Y A;  1KIT A;  5FCC A;  5FZI A;  3RMY A;  4QMA A;  3J7N A;  4GD4 A;  2A6V A;  2VOX A;  2ERF A;  4YM0 A;  4O61 A;  3BPZ A;  1LAJ A;  4BK5 A;  4J1X A;  4BOW A;  1YI9 A;  3S5Q A;  1C57 A;  3POW A;  2Q8D A;  4P9G A;  5FY0 A;  4XQD A;  1QJF A;  4TYS A;  1HRI 1;  2QZ2 A;  2D93 A;  4JAA A;  3POE A;  3T4H B;  1LGN A;  1NLQ A;  2OX0 A;  2Y34 A;  3GNE A;  4W65 A;  2DVF A;  4TLG A;  3H8O A;  3RNS A;  2R30 A;  4B4R A;  2VJX A;  2VMF A;  2QE3 A;  3FHQ A;  4FPH A;  3PVB B;  4Z8B A;  2XBO 3;  1LOC A;  2WLQ A;  3KF3 A;  1OXC A;  4U36 A;  5FQ0 B;  2ZGN A;  3LEG A;  4AI3 A;  1UD1 A;  4RS5 B;  5L7O A;  1IOA A;  1RUH 3;  3VZO A;  2BFU L;  3C8X A;  2YPJ A;  1ASJ 2;  4AE2 A;  5F9T A;  1LNS A;  2ZHM A;  3ZYF A;  4A7Y A;  2DBN A;  5FPX A;  1GP4 A;  1HRI 2;  1PIV 1;  2FQP A;  3NAP C;  5FXZ A;  1POV 3;  5L73 A;  4XVH A;  1RUI 1;  4FFF A;  3JD7 3;  5A3U A;  3EJK A;  4BYY A;  4NN0 A;  4A44 A;  1QJY 1;  2VVE A;  5E89 A;  2K9Z A;  4PQ9 A;  4AED A;  5KHJ A;  1E5S A;  2XGX A;  2DUO A;  3NVC A;  3QH6 A;  5BY5 A;  3RZK A;  1JS9 A;  2OZJ A;  2B9V A;  3MHZ A;  3I4I A;  4AFM A;  4EZ4 A;  3ON7 A;  4IEQ A;  3HVD A;  1VMH A;  1AF9 A;  3GDB A;  1RUF 1;  4MH0 E;  4AQT A;  1AXK A;  3J9S A;  1JBC A;  2Z79 A;  2JG9 A;  5ABJ A;  1TME 3;  1W8N A;  4YAR A;  5JSP A;  3MYX A;  3CNA A;  1PIV 2;  5E6H A;  3VHR A;  2R07 2;  5ANQ A;  3LA3 A;  1A34 A;  3RQ0 A;  4SLI A;  2E63 A;  2RMU 1;  4M01 A;  4XJA A;  5CIR A;  4EJR A;  1ALY A;  2E31 A;  2KM2 A;  1YI7 A;  4XFF A;  3HN3 A;  4A2U A;  4AEK A;  4QX8 A;  4QPY A;  2XH6 A;  3MW4 A;  1HV1 A;  1R09 3;  2JG8 A;  1FOD 1;  1LHO A;  2CV6 A;  1W9F A;  1SLI A;  5D8A C;  4NIH A;  1HB2 A;  3L2H A;  4LE3 A;  3WLU A;  2FCU A;  2V72 A;  3WDU A;  3FLT A;  2CAU A;  3T0D A;  3OGR A;  3MZH A;  3M2M A;  3AL6 A;  3VBO B;  1BHG A;  1ENR A;  4UW3 A;  4XET A;  1ENS A;  2F17 A;  4D8M A;  5FOB B;  5FKC A;  4CCN A;  5JUV A;  1RUG 3;  2P3I A;  2V73 A;  4LO6 B;  3P5B A;  5FZ0 A;  4ASM B;  3RZH A;  5FPL A;  4XDO A;  4FOV A;  4OUL A;  1GU3 A;  4C1W A;  4XJU A;  4NPR A;  3UKV A;  3WSO A;  3IWZ A;  1FOD 2;  3ACG A;  1WUV A;  4DIQ A;  2FDF A;  1W04 A;  2VCB A;  4YW2 A;  2JEN A;  2R06 2;  4QXC A;  4Q8K A;  1UYX A;  3EBR A;  1ODM A;  2YGL A;  3PUR A;  3VZN A;  4IUG A;  3K4A A;  4MGI E;  3WW3 A;  1G9D A;  2XKO A;  1AR7 3;  1X33 A;  1UF2 C;  3CEW A;  4L8Q A;  5FXX A;  4LIT A;  4W6X A;  4MO3 M;  2WLP A;  3BPS A;  5JIU A;  1G7Y A;  4FTB A;  3N9Q A;  5JCT A;  1MS1 A;  1S1A A;  3B01 A;  2X8K A;  3FZ3 A;  3P3P A;  5AFE A;  1DGW A;  2F4P A;  2HWC 3;  3WNP A;  1IQD C;  3URF A;  5L36 A;  2YBS A;  1Y7B A;  2XR4 A;  4RGA A;  4RSU A;  3VBF A;  1UPS A;  2WO3 A;  1HRV 3;  3CU7 A;  4S2D A;  5A32 B;  5CB7 A;  1HXS 3;  1O4T A;  1DQ6 A;  2WA4 A;  4AAP A;  4DIN B;  4MXW A;  3III A;  3VZL A;  4IEY A;  1W8Z A;  2RS5 2;  1QJE A;  1H8V A;  1LTE A;  5E8A A;  1W9W A;  2ZGK A;  3MFC A;  2ADD A;  2D44 A;  4G4F A;  3N7M A;  2QTW B;  4R9A A;  3E6C C;  1WW7 A;  4C1X A;  3NRU A;  3OUI A;  1MPX A;  4NPL A;  3VBS B;  3OGS A;  1Q8O A;  4I09 A;  3AZY A;  2GP5 A;  1UKR A;  1EYB A;  2OXB A;  3AYC A;  2LRO A;  2VGD A;  1XNC A;  4RA0 A;  3O0W A;  1IS4 A;  1XU2 A;  3H1M A;  1PGW 1;  3GBF A;  4OMD A;  5FWE A;  5FUP A;  1TG7 A;  3TBD A;  2QZ3 A;  4YFZ A;  1IG3 A;  2RM2 1;  2O0O A;  1SDW A;  4XHB A;  1R08 2;  2PFW A;  2W3J A;  3A22 A;  2OII A;  3VB9 A;  4OUM A;  2A6Y A;  1LHN A;  4JGZ C;  5IK4 A;  3HD8 B;  4LNV A;  3TOJ A;  1K45 A;  3JUU A;  4JC1 A;  4ONU A;  1EAH 1;  1LOF A;  3H50 A;  4IV1 A;  5EXO A;  4HXC A;  3ZXA C;  4OZO A;  4ISQ A;  2EXK A;  3WT3 A;  2ZAB A;  5ACA 1;  1Q43 A;  1FX5 A;  3AP4 A;  2WNU B;  3OGG A;  1EUT A;  1UCX A;  2X5I B;  1Y9M A;  4GA9 A;  2E7T A;  1D4M 1;  2D3P A;  4AEJ A;  2Y26 A;  5J96 B;  1I9R A;  1SMV A;  5FLI A;  1KJL A;  3R4D B;  3DYO A;  4FPY A;  2AC1 A;  2D40 A;  2QQN A;  3D4K A;  4AQS A;  2A3Y A;  1PMH X;  2RM2 2;  5A80 A;  4ZU7 A;  2JDZ A;  1ENX A;  1K5M C;  5A3W A;  1WW6 A;  5JOW A;  2FHR A;  3VKN A;  5KR7 A;  1O7F A;  3ZXG A;  4QXB A;  1OOP B;  1EAH 2;  2OQ7 A;  3OBT A;  3U0Z A;  1CJD A;  2A7A A;  3ZN5 A;  2XHN A;  2EXJ A;  4DEV A;  4RR3 A;  3H3L A;  4JZR A;  3HNY M;  2GC1 A;  2O1Q A;  4NVP A;  4PDW B;  4MGQ A;  4BHP A;  3WDT A;  1D4M 2;  2RDS A;  1CAW B;  2HWB 1;  2FZ1 A;  3USU A;  4LO7 A;  1NQJ A;  4JKK A;  5A7P A;  3TNP B;  4ERO A;  3ILF A;  1VAL A;  3PVO A;  1OI6 A;  3N3H A;  3SH4 A;  3KZ4 C;  1W6N A;  4WZF A;  1MQT A;  2P17 A;  2BV4 A;  2WYF A;  3AM2 A;  5G05 L;  4AR2 A;  1GZT A;  1DGL A;  2EA7 A;  1CON A;  4FPO B;  4YG3 A;  3HBZ A;  2JDK A;  3C3V A;  4Q4Y 1;  4ITC A;  2GNT A;  5ERL A;  2ZMK A;  5FY8 A;  2XB6 C;  5F3G A;  3PTY A;  3O0X A;  5CAD A;  4IEV A;  1XYP A;  3E5Q A;  3LOB A;  3CZU A;  2WNO A;  3EYP A;  3I97 A;  3PUI A;  1Q8V A;  2WFF 1;  4QQP A;  4YW6 A;  4P9X A;  2GP3 A;  4RGK A;  1ZBE 3;  4RS5 C;  3HQU A;  2JD9 A;  4P9I A;  3ZYH A;  1V6K A;  1Q3E A;  1G9F A;  4AVV A;  3GYD A;  5A7N A;  3B7M A;  5FP3 A;  2WS9 1;  5LB6 A;  1QXP A;  1SPP B;  2BVB A;  3BB6 A;  2YHJ A;  3KCX A;  5CVR A;  3H1W A;  1K42 A;  1W6O A;  3WHT A;  1JZ3 A;  5LEK A;  1ULE A;  5CG9 A;  1UOB A;  1KFX L;  4F8A A;  2OKX A;  3I2J A;  2VME A;  5A6Y A;  3WG3 A;  3SCG A;  1XU1 A;  4KL1 A;  5LWB A;  1V00 A;  4LA3 A;  1OT5 A;  5GLU A;  2E9Q A;  1ND3 A;  4N43 A;  3OPW A;  4OI2 A;  4Q0S A;  2VNR A;  1LB2 A;  1ULP A;  3M4F A;  5KHG A;  4KGG A;  2KXL A;  3NST A;  1DYK A;  3ZDS A;  3O1U A;  2ARA A;  2GN7 A;  3WF1 A;  5HPO A;  1W6P B;  3I7D A;  3ZR6 A;  4Y1V A;  2D97 A;  3ES4 A;  4CRQ A;  1RUJ 1;  2UWB A;  2W52 A;  2XXZ A;  4I0B A;  5EJ3 A;  3U10 A;  4CDQ B;  2QVS B;  4XC9 A;  3AKT A;  4CCK A;  3EO6 A;  3UET A;  2E7A A;  2VG9 A;  1NAE A;  1YIF A;  1WLC A;  3MIH A;  4YM1 A;  2DVB A;  3ACL A;  5APA A;  5C8C B;  2LRP A;  2G19 A;  2RS1 3;  3LSE A;  4NHL A;  4ZS3 A;  3GHN A;  3MEP A;  2ENR A;  4BCU A;  4P9W A;  1AXY A;  4BPZ A;  1OH3 A;  4TXW A;  2XJV A;  3LGR A;  4OHX A;  4UI9 L;  3NJY A;  4FAH A;  1BBT 3;  1DFQ A;  4Y20 A;  3VBO C;  1COV 2;  2ET1 A;  2ZTN A;  3QCW A;  1RIR A;  1RUJ 2;  5FZE A;  1JW6 A;  5AC9 2;  5JZG A;  5HBA A;  3BOP A;  4QQH A;  2RG4 A;  1QJX 2;  2GZW A;  3UGH A;  3MF6 A;  4DRV A;  1C8M 1;  1SFP A;  4V2W A;  4QPI A;  1CAX A;  1POQ A;  5C70 A;  2HWF 1;  4JDN A;  2ARX A;  4OHZ A;  5JXJ A;  3HOB A;  1OQD A;  3MGU A;  4QB2 A;  1S0I A;  1RHI 2;  5I0U A;  2XJU A;  3FUO A;  4RHV 1;  4GUL A;  3AZZ A;  1YFY A;  3SEE A;  2XLG A;  2W5F A;  1VMF A;  3TEZ A;  4QX3 A;  3AMM A;  4MXV A;  2HLE A;  3T2Q A;  1RUN A;  3LB9 A;  2X53 S;  2R0H A;  1NXM A;  5K4L A;  2EXI A;  3ZFE A;  1YQC A;  3ZN4 A;  1NUK A;  3FHI B;  3WXP A;  1GIC A;  5LK7 B;  2BNN A;  4CEY B;  5IAT A;  2ZHN A;  3ZN6 A;  2PA7 A;  1W6N B;  3AL5 A;  1AJO A;  3EHK A;  1RVF 1;  4AHX A;  1OSG A;  1RXG A;  4QDQ A;  1ZX5 A;  2R1B A;  4LOT A;  3ZFF A;  5EYY A;  4CXX A;  5GLV A;  3P6B A;  3KT7 A;  2J1A A;  1UN1 A;  1ZZ9 A;  1RUD 2;  1NG0 A;  4XUR A;  3RZG A;  2GAL A;  1UU6 A;  5IVB A;  4B4Q A;  3N9N A;  3ME2 A;  4MVT A;  2ORX A;  3KT4 A;  4Q0V A;  4K3U A;  3U07 A;  1F2N A;  2PQS A;  4UW5 A;  5DQ0 A;  4YGD A;  2C0Z A;  2DCT A;  1LEN A;  1ENQ A;  2HWE 1;  3WOG A;  3O1S A;  1OF4 A;  2WA3 A;  3DKQ A;  4XE9 A;  3SQO A;  3T2O A;  5JSR A;  3OPT A;  4ZXK A;  3VBS C;  5FBJ A;  4TTG A;  2D5H A;  2GN3 A;  5LY1 A;  4XAB A;  5D21 A;  5FYU A;  2IXJ A;  1QOT A;  1KS4 A;  2IXL A;  2VL4 A;  3WUC A;  1DU3 D;  4IND A;  3J8F 1;  4LO8 A;  1CJP A;  4L11 A;  3HNM A;  3WW4 A;  3DKW A;  3RJ2 X;  1LKN A;  2EXH A;  4H14 A;  4XPV A;  3VL8 A;  4AL9 A;  1G9B A;  4QPG B;  1N3P A;  1VB2 A;  4UYB A;  4FFH A;  5C3Q A;  1X36 A;  4SBV A;  3RWN A;  2ZZJ A;  3D8C A;  3D6E A;  3FWE A;  2QDN A;  5F8P A;  4DB5 A;  5CKQ A;  1NY7 2;  1WMX A;  4UFL A;  4XBL A;  3O1M A;  4QQO A;  5I8S A;  1Q56 A;  2DU0 A;  2BW8 A;  2VW2 A;  1VBE 2;  2WNU C;  5A70 A;  5JXG A;  1IPJ A;  1OPM A;  2X5I C;  1W8W A;  1AR6 1;  4QXH A;  2BOI A;  2ETE A;  5FO9 B;  3FE5 A;  5I93 A;  5I0S A;  2MHF A;  1PO2 1;  1S2B A;  5A33 A;  1U12 A;  2O8Q A;  2QQJ A;  3AMN A;  3LA2 A;  4Z82 A;  5E16 A;  2G4I A;  3B3Q E;  4I3P A;  5F6K A;  1QHD A;  4GB3 3;  1Q8Q A;  1JZ6 A;  2QQK A;  3BTX A;  4BM8 A;  4P00 B;  4MHU A;  1OOP C;  2ZAH A;  3ILN A;  4GWN A;  5A1A A;  4Z07 A;  1LOG A;  1V9U 1;  4LLO A;  4PT6 A;  5DZF A;  3TN9 2;  3W59 A;  2D3S A;  4PDW C;  1AVB A;  5KC6 A;  3EQE A;  2DFC A;  1AR6 2;  2FDG A;  1QGL A;  3ZOI A;  4MYE A;  1PO2 2;  3AMQ A;  3M3Q A;  3FC0 A;  5IFP A;  1NZI A;  1JZ8 A;  4OMC A;  5JPN B;  4COU A;  1CZV A;  4YGE A;  1D2Q A;  2DBI A;  2FCT A;  4AZZ A;  3IMM A;  4AHW A;  1NA1 B;  3X29 B;  3OUH A;  3BIW E;  5F39 A;  3C7F A;  4YWA A;  2A70 A;  1WCK A;  4I02 A;  1YXW A;  1G9C A;  2BNM A;  3N4M A;  1JOD A;  2FMY A;  2ZGS A;  3KVA A;  1YUD A;  1VB4 A;  3AP6 A;  2GND A;  3VGI A;  2GH8 A;  3NNM A;  1O4Y A;  2XOM A;  4BME A;  4HFS A;  4Q8L A;  2V4A A;  3VZJ A;  3TAY A;  4XEZ A;  1RUE 3;  3W21 A;  3POG A;  1J84 A;  4YZ3 A;  5L9B A;  3RPQ A;  3WUD A;  5IK5 A;  1W0P A;  2JDY A;  3NV2 A;  3ZX7 A;  1OF3 A;  1FPN 1;  2WZR 3;  4JGY B;  1HB1 A;  4QU2 A;  2ZKL A;  2XL9 A;  3HBK A;  3LPF A;  3NV4 A;  3V65 A;  2IXI A;  4AFA A;  4UFI A;  4AGR A;  3CJX A;  4XUT A;  5F37 A;  5IWF A;  1N1Y A;  2OVU A;  2GME A;  4OHY A;  3DUI A;  5FYT A;  1O3S A;  5F3E A;  5JOZ A;  4FPE A;  5DXD A;  1H30 A;  1Z7S 3;  4LO4 B;  3U4S A;  2B39 A;  3LKJ A;  1H2K A;  1W6M B;  3SIT A;  3ZDV A;  4AAX A;  2DU1 A;  2YC0 A;  1BVV A;  3ITQ A;  3OYW A;  3LIG A;  1MEC 1;  4IEW A;  2E32 A;  3IAP A;  4UFH A;  4CDQ C;  4KQ7 A;  1JUH A;  1I3H A;  1OHF A;  1VBA 2;  4R4Z A;  1TNR A;  4D69 A;  4ASL A;  5GKA C;  1VBB 1;  4LBL A;  1EV1 1;  4S2F A;  3WNX A;  1GWK A;  3ZFG A;  4YM3 A;  5C8C C;  1BJQ A;  4G3Y C;  1YQ6 A;  2H0V A;  2X29 A;  3H42 B;  2PLV 1;  3LFM A;  3E1F 1;  4DS0 A;  1W90 A;  1DLC A;  2ZXQ A;  3LPG A;  1VPH A;  2W92 A;  1SZB A;  1Z0H A;  2Z69 A;  1DYO A;  1GNH A;  2C6S A;  1O3Q A;  2PHU A;  1F9K A;  4EN6 B;  3S30 A;  1IZ3 A;  3I2D A;  5FZ7 A;  1ULF A;  1MS0 A;  3THD A;  3C7E A;  3N7L A;  4LK6 A;  3FLR A;  4C90 A;  1FNY A;  3KSC A;  1AX0 A;  4W50 A;  1L3J A;  1EV1 2;  4JKL A;  2DTW A;  5DN2 A;  2BZD A;  3TRS B;  4AXO A;  2W91 A;  1X7N A;  3OG2 A;  2JJ6 A;  2K0G A;  4N9I A;  2HWD 2;  2PLV 2;  3GZU C;  5GLT A;  1D4V B;  1W9Y A;  3I2I A;  4AFC A;  1PO1 2;  1JZ5 A;  4ZXE A;  4HAN A;  4COV A;  1UWW A;  3RMX A;  1HLC A;  4AHZ A;  3QBQ A;  1UZ0 A;  4YVS A;  2CHH A;  4Q29 A;  4R9C A;  3S6P A;  2LUW A;  2XVG A;  2CGP A;  4Q4W 1;  3MW2 A;  3ZMO A;  3RZZ A;  3QLQ A;  2D6M A;  4CEY C;  3VBR A;  1M06 G;  4PI2 A;  1F4A A;  1TMF 1;  4CDU B;  1Q5O A;  1VE0 A;  2J22 A;  4XF0 A;  4NHX A;  5F2W A;  4Y22 B;  1REF A;  3FMG A;  3FFQ A;  4WVM A;  1W6Q B;  3I54 A;  2HBU A;  2BER A;  3S0M A;  4HPK B;  4AI9 A;  5L19 A;  2JX9 A;  5FYV A;  1YJK A;  4D7T A;  1VBC 3;  2VMG A;  4UF0 A;  1NCR A;  4QHO A;  3DV8 A;  2NM1 A;  4AVT A;  5JPM B;  4CDW B;  3ZPY A;  4EZH A;  3S5A A;  4MG2 A;  1XXN A;  2JE9 A;  4Q4W 2;  3HR9 A;  1UX7 A;  4Q27 A;  1PVX A;  2VOW A;  1AYN 3;  2VZP A;  2CNA A;  3F95 A;  5HV0 A;  2FZ2 A;  2RV9 A;  2VC9 A;  1OFS A;  4LEJ A;  4Y1X A;  1AL2 2;  3T1M A;  2O14 A;  2ZX4 A;  3UK9 A;  2BBV A;  5JDB A;  4AK3 A;  1LOA A;  1ZZC A;  5C4W A;  4Q4X 3;  4OCT A;  4QPG C;  4MLO A;  4XAC A;  3K77 A;  1UZY A;  2X05 A;  4NUB A;  4RL7 A;  3JB4 C;  3JU9 A;  3AP9 A;  2B4K A;  4N53 A;  4AGV A;  2AZ5 A;  3Q8B A;  4CPB A;  4M3C A;  5I0R A;  4C0B A;  3PJQ A;  1VRH 2;  2A6X A;  2VU9 A;  3O7O A;  4KWJ A;  4XUN A;  2VCM A;  4BQ5 A;  2VNO A;  3MLK A;  1Y9Q A;  5C9A A;  3MFA A;  4YRD A;  1PVC 1;  1URX A;  4Y24 A;  4CCD A;  1OFN A;  4L97 A;  3U14 A;  4DUW A;  5FYY A;  1NQD A;  2G1M A;  1APN A;  2PQQ A;  2ZGO A;  4V1P A;  3RFR A;  5A3N A;  1KD7 A;  4NR1 A;  2DFB A;  3H8X A;  4FVV A;  1OD3 A;  1ZZ8 A;  4FXG B;  5FZK A;  1NXD 1;  1TE1 B;  1GOF A;  2BRT A;  4GKX A;  1AR8 3;  1OLM A;  2QBX A;  2XLF A;  1UOF A;  2W1Q A;  1RMU 1;  4CCJ A;  3W5N A;  3KV6 A;  2ZEW A;  1XE7 A;  3AZW A;  4WM7 B;  3UYJ A;  1ZBA 1;  4E2S A;  1PVC 2;  1D2S A;  2ZA9 A;  1PGL 1;  4LBQ A;  4Y26 A;  2WO2 A;  5DUU A;  4YZ1 A;  3BGA A;  4CP9 A;  2VH9 A;  2QCS B;  4XQW A;  3KV9 A;  4YG0 A;  3SC7 X;  1B35 B;  1A6C A;  1WCQ A;  1NA1 C;  4RQP B;  5C71 A;  1HDK A;  1H1M A;  3PNA A;  4GMP 1;  5FY1 A;  1KQR A;  1RMU 2;  4GMP 0;  3A4U A;  3POY A;  1UYY A;  1AR9 3;  4JDO A;  2FBE A;  5IW0 A;  1PZ9 A;  4CEW B;  3LZZ A;  1RUC 1;  2RR1 2;  2MEV 2;  4GIQ A;  4BXF A;  1BMV 1;  1ZBA 2;  4K40 A;  4N7U A;  2Y6H A;  4CU9 A;  5FY5 A;  1PGL 2;  2Q5T A;  3AKS A;  4CSW A;  1VAM A;  5KHK A;  5CZK A;  4AI1 A;  1S0G A;  3U11 A;  1X9T A;  2B5H A;  2P3K A;  2Y0O A;  3LDR A;  4NIG A;  3BKZ A;  3JBG 1;  2Y6L A;  2Z42 A;  3OGJ A;  1BCX A;  4IEO A;  1ND2 A;  3UT0 A;  1CX1 A;  4XBN A;  2ZGR A;  4PIX A;  2WR9 A;  4JGY C;  1GWM A;  1X50 A;  3MO4 A;  3PIJ A;  5F3I A;  4ARY A;  3DPR A;  4XMA A;  3ZYP A;  2JIJ A;  3BAL A;  3GBG A;  2A71 A;  5FIX A;  2HJI A;  4LBO A;  1UOJ A;  1Z78 A;  2VZ1 A;  1GZW A;  1T6G C;  2VZT A;  4Q4V 3;  5L9R A;  2N7G A;  1LU2 A;  4OQ9 A;  4CP1 A;  1XE8 A;  1TVG A;  2JDA A;  3VLB B;  5A7O A;  3RSJ A;  1NCQ B;  3ZYJ B;  3O1P A;  1YQ2 A;  2HEY F;  1U0A A;  4A6O A;  4DMI A;  2WIN B;  2WNV A;  3JQX A;  4HZF A;  5FR3 A;  1PMJ X;  4QQL A;  1RUH 1;  4DXS A;  1GZC A;  2X09 A;  3INA A;  5F5Q A;  4HK9 A;  3JBG 2;  3B94 A;  3I2F A;  1NX9 A;  5K0U B;  1AX2 A;  3N7K A;  2XLA A;  3AYE A;  3NJZ A;  2HKX A;  4YNI A;  5TSW A;  1W28 A;  1DDL A;  2WWS A;  4A42 A;  1POV 1;  1US3 A;  3WV6 A;  5FZ4 A;  3KHB A;  3JD7 1;  4BWO A;  4XF4 A;  5JXI A;  3PUA A;  2ILM A;  2VZQ A;  1GNY A;  2BYV E;  2HEV F;  4HKO A;  2A3X A;  2XVK A;  3FX3 A;  4U2A A;  4UBH A;  3VBU B;  3UKT A;  3UJO A;  4H7M A;  1ULC A;  2YYO A;  1IKQ A;  2WO7 A;  3HEI A;  3I2K A;  4XBQ A;  1MS9 A;  2R04 3;  2W87 A;  1OPO A;  2WWJ A;  4GJZ A;  5DUV A;  1TME 1;  4XW3 A;  5J98 B;  5K9Y A;  3VZM A;  1GYK A;  2FMD A;  5AVA A;  5A3P A;  2WQ4 A;  4CDX A;  5FYH A;  3KMH A;  1V6I A;  2W1W A;  4E9K A;  4FPJ A;  1JYX A;  4EN0 A;  1UY1 A;  3RJR A;  2VNV A;  1QXR A;  1CWP A;  2W9X A;  3CJI A;  3I3Q A;  1R09 1;  4WM8 A;  4LMF A;  5J48 A;  3NW4 A;  4IV3 A;  2E7Q A;  1FAT A;  1RXF A;  2WC2 A;  3CDZ B;  2TBV A;  3ZM8 A;  3RZJ A;  3IM0 A;  4LHN A;  3WDY A;  3LEK A;  1SFN A;  4K8R B;  2VQU A;  2DCK A;  5FMO L;  4OUS A;  1VBD 1;  2JEC A;  4HN0 A;  4QWN A;  3GCX A;  4OI4 A;  3SCH A;  3ZXE A;  5KBF A;  4YVW A;  4CCM A;  5IVY A;  1UY4 A;  4K7J A;  4UFK A;  3CF6 E;  5CFC B;  1QEX A;  3LAG A;  1JZ2 A;  4QGL A;  1RUI 2;  1H8T A;  1YNA A;  4FPG A;  4CDU C;  1ASJ 3;  1QJY 2;  2Q4S A;  3POB A;  4WZC A;  1FV3 A;  2WZE A;  4Q1P A;  1Y3T A;  3DYP A;  3MDP A;  1HRI 3;  1SLT A;  2B7Y A;  4TN7 A;  3VDD A;  1XE0 A;  1MZE A;  3MBW A;  1J59 A;  1AR7 1;  2EVX A;  2QNK A;  1VBD 2;  3HJR A;  1CAU A;  2J42 A;  5LAS A;  2A6Z A;  4CDW C;  1RUF 2;  4DY3 A;  1QJZ A;  4XFI A;  4PI0 A;  4PBP A;  2VY0 A;  1NLR A;  4PLN A;  5CU1 A;  3RS6 A;  4COY A;  3N9M A;  5IVE A;  4LHK A;  1PGS A;  4LUM A;  2YV8 A;  4O65 A;  2RMU 2;  3IKW A;  5BNO B;  1J3Q A;  3OD4 A;  1O59 A;  4TWT A;  4XJ8 A;  1GFF 2;  4AVB A;  4H3W A;  5J37 A;  4P9Y A;  4XAE A;  3GJB A;  1JYV A;  1PIV 3;  2JB8 A;  2R07 3;  2OW4 A;  1O5L A;  2WRA A;  3PTR B;  4Q5O A;  3BUC A;  4XUQ A;  4QT6 A;  4OHV A;  1J3P A;  1W06 A;  4L0P A;  4QQ2 A;  3CZJ A;  4I3G A;  1OLR A;  3TNQ A;  1YEW A;  4QAW A;  1W05 A;  1PZ8 A;  1S0J A;  2P1B A;  3FLP A;  3LOI A;  4F7Z A;  1FMD 1;  1BKZ A;  3ZSM A;  1DP0 A;  4YW3 A;  4IDZ A;  2IFR A;  2JWP A;  3A23 A;  4XOG A;  3VUO A;  1OA4 A;  2IWG B;  2RJL A;  1SBD A;  1ZRR A;  4ORF A;  1DG6 A;  1LOB A;  1KDK A;  2C4X A;  3A0K A;  2LM3 A;  4C8D A;  1OVP A;  4CA9 A;  2ZJC A;  2Z4F A;  2K2S A;  2QDR A;  1O5U A;  1W0O A;  1ZZB A;  3EB7 A;  3I3B A;  4DXZ A;  4CXW A;  1FOD 3;  1FMD 2;  5FZ6 A;  1JZ4 A;  3PUS A;  1WA6 X;  1C1F A;  3FFZ A;  3R05 A;  2WYS A;  1V0A A;  4J1W A;  1G86 A;  2R06 3;  2YU2 A;  1GNZ A;  4WM7 C;  4Q0P A;  2BEO A;  4HON A;  5FMB A;  2R7E B;  5L7O B;  1CQ9 A;  4XUO A;  3SNM A;  2E33 A;  3DYM A;  1I6X A;  4P9L A;  4LOR A;  3VBH A;  4D6S A;  1UL9 A;  1YCI A;  2CU5 A;  3LEM A;  1B35 C;  4HVQ A;  5B2G B;  5LZ6 A;  3ZKU A;  3H8U A;  1SQ4 A;  4B4P A;  4KBB A;  4RQP C;  5FLH A;  4DY5 A;  3M3O A;  1RIT A;  4AED B;  4CEW C;  3O0V A;  1K12 A;  3DEM A;  2OUH A;  1O8P A;  5C6C A;  4NPM A;  2UYA A;  2ZAC A;  1LOE A;  3CBN A;  3K2O A;  1EPW A;  2VCC A;  2RS5 3;  3N9P A;  5IUQ A;  1VJ2 A;  3ELN A;  3PL0 A;  1JU4 A;  2Y60 A;  3AK0 A;  4KWU A;  5ABJ B;  2JG9 B;  4H55 A;  1PGW 2;  4PF5 A;  3KGL A;  5FUI A;  1WLD A;  2RE9 A;  4B7E A;  1PX3 A;  5FPA A;  3WQB A;  3KV5 A;  2FDJ A;  1E5R A;  3ETP A;  3WHU A;  2EAA A;  5HCA A;  4BLJ A;  2BPA 2;  2XJT A;  5HV4 A;  1WCD J;  4GH4 A;  3T4V A;  3U4X A;  5I0D A;  4HVO A;  2ARE A;  2JG8 B;  1R08 3;  3ETQ A;  3D5O A;  5FP7 A;  1NCQ C;  4D7Y A;  5ACA 2;  1VP6 A;  1Y43 B;  3VDB A;  5BNN A;  3AP7 A;  3B5L B;  1YIP A;  4RYD A;  5FMO S;  1SHW B;  2QQI A;  3HIF A;  4DOU A;  4FAG A;  2VQ0 A;  1RB8 G;  5K0U C;  3HQX A;  1RTV A;  4IGP A;  4EN9 B;  5BNP A;  2R0F A;  1YQ5 A;  2GNB A;  4MGK E;  2VO5 A;  1RJ8 A;  1MS8 A;  4P5Y A;  1H2N A;  3MV1 1;  5J36 A;  5DDJ 1;  3GGL A;  2ZGL A;  4LHL A;  1MZF A;  2RM2 3;  4TLF A;  3GHM A;  4BIF A;  3T09 A;  2C5D A;  5F5C A;  1AYM 1;  2DDU A;  3WQ1 A;  3ZXK A;  3B9C A;  3VBU C;  2QUO A;  3ZYB A;  2AEZ A;  2VUD A;  1O3R A;  2HWB 2;  1UMI A;  1LUL A;  4NWV A;  1C28 A;  3KCY A;  1JYW A;  2WAB A;  3VKM A;  2YPD A;  3PU8 A;  2NMO A;  4AF9 A;  1DGW X;  4B8E A;  2VZO A;  1D4M 3;  2ZX0 A;  1DGR N;  5JWP A;  5ANN A;  5A7W A;  1RC6 A;  5DDJ 2;  5D2A A;  2RDQ A;  4AI2 A;  4Q4Y 2;  3SXW A;  3R0R A;  2X10 A;  2YGM A;  1EY2 A;  1A8M A;  4UXA A;  1AYM 2;  1SLB A;  4O9E A;  3HQR A;  4C91 A;  4KH9 A;  3VBF B;  1CAV A;  4RN5 A;  2HH9 A;  5GLW A;  1N1V A;  4UT5 A;  3K48 A;  2C26 A;  3V0B A;  5BNQ A;  3KHC A;  3NL1 A;  3A7Q A;  1YJL A;  2WT1 A;  3DEC A;  4HET A;  4MXW B;  2WFF 2;  2PYT A;  4YW1 A;  3WQ0 A;  1XSQ A;  2PHL A;  4JHT A;  2Y8K A;  4MET A;  5FYB A;  3T0A A;  4MGZ E;  4FQZ A;  5FDB A;  5ISL A;  1SAC A;  2WS9 2;  4PQQ A;  1S0C A;  2MPF A;  4BIO A;  3WX5 A;  4Y1Y A;  5DAB A;  2VUC A;  3NQH A;  4GZ9 A;  4DUV A;  5CFC C;  4ZON A;  2D7F A;  3ZYG A;  4COZ A;  1F15 A;  2HYX A;  3PDQ A;  2FD8 A;  5EJZ B;  2BUK A;  4HKW A;  4YG6 A;  4XHX A;  4CP2 A;  5H9S A;  4D6Q A;  2TUN A;  4XIO A;  3K4D A;  2AEY A;  3NNJ A;  3BN6 A;  2VTX J;  5CFD A;  4XFA A;  4IV1 B;  2NYY A;  5IVJ A;  1X82 A;  5LA9 A;  5HCH A;  4LKF A;  5IJR A;  5A7Q A;  3LFI A;  2J1E A;  3AXE A;  1K3I A;  3A0N A;  5BNO C;  2EF6 A;  5FZ9 A;  3BU7 A;  4IW3 A;  2J1R A;  1ZRI A;  2EIE A;  4AG4 A;  4TZD A;  4IGO A;  4UBG A;  4AW7 A;  2G9G A;  3QD6 A;  2H6B A;  3LDB A;  4QGM A;  2AR6 A;  3M70 A;  1UU5 A;  2LTN A;  2PHD A;  3RYR A;  2AYH A;  4OLL A;  5K7P A;  2YZ4 A;  2ZEY A;  2E51 A;  4Q0Q A;  4RR3 B;  4A4A A;  1CGP A;  2RS3 1;  4JQR A;  3A21 A;  5IYY A;  1JYN A;  2RDR A;  2DF7 A;  2EID A;  2G9Z A;  2Q8E A;  3T0B A;  2UUR A;  4XCA A;  2FCV A;  4FO9 A;  3MIF A;  1XQN A;  4IE7 A;  5GZD A;  3USU B;  4FPC A;  4OYU A;  3WD5 A;  5F7U A;  3ZVX A;  2ZHL A;  3ST7 A;  4EWA A;  3ZXL A;  1PK6 A;  2JDN A;  1C8M 2;  1GBG A;  4LJH A;  3NNF A;  1MQT B;  4AVS A;  1E57 A;  3OEB A;  3RG0 A;  2HWF 2;  5FZB A;  1COV 3;  3ILR A;  1ZVF A;  4L99 A;  1RUJ 3;  3OD0 A;  4KGQ A;  5AC9 3;  3WDV A;  5CAZ A;  1UZZ A;  4XIL A;  2YDE A;  1W8T A;  1QJX 3;  5LBE A;  4RHV 2;  4UWD A;  2RS3 2;  5EPA A;  5SV5 A;  5A3T A;  1CIW A;  1QNY A;  2CL2 A;  2VBB A;  3KQ4 B;  2DYC A;  3WZ1 A;  1IHM A;  4BDV B;  1RYY A;  4XJW A;  5FXV A;  1JUI A;  3H1Y A;  2EAK A;  3VL9 A;  3ZR5 A;  4ATF A;  1RHI 3;  3MPP G;  3KB5 A;  2E6V A;  2CDO A;  1B09 A;  2VR4 A;  4XUP A;  2Y33 A;  4MX3 A;  1LJ7 A;  3VHO A;  3AXD A;  4IE5 A;  1RVF 2;  2VW0 A;  5L7O C;  1RJ7 A;  1CX4 A;  2C9K A;  4LBJ A;  1QOS A;  2GC0 A;  2VOV A;  4M0H A;  4NHM A;  2KD7 A;  4GB3 1;  4UFM A;  5FZA A;  1AZD A;  4ES9 A;  1JTZ X;  3BTY A;  5IVF A;  1HJF A;  4XZP A;  3R4U A;  3BTA A;  4AI8 A;  4BXS V;  4NID A;  2Y6J A;  2ZS6 B;  1TNF A;  4LBN A;  3NKG A;  3HWJ A;  2GAU A;  1W6O B;  5T54 A;  2DCZ A;  4KNC A;  4AED C;  2A6W A;  2HWE 2;  2XL7 A;  4K1Z A;  2R49 A;  1RUD 3;  2D6P A;  4FPK A;  1JXN A;  1L7Q A;  2VE1 A;  5CYY A;  3CIH A;  1ND3 B;  4N43 B;  4Z2W A;  3MIC A;  2XG3 A;  3J8F 2;  1NOV A;  2IC1 A;  2B46 X;  2WN3 A;  1DLL A;  1VMJ A;  5ABJ C;  2JG9 C;  1VIW B;  1MVQ A;  4BQ1 A;  1S0F A;  4H7L A;  1KEX A;  5DG1 A;  5C7G A;  4NMI A;  2W94 A;  3RZM A;  2P37 A;  1ACC A;  2D98 A;  4W4Z A;  4S2G A;  1S4C A;  5FOJ B;  4XF9 A;  5GM0 A;  3AZV A;  3R4S A;  1UYP A;  4FP3 A;  4XMI A;  5C5U A;  1C4R A;  2YB7 A;  2JG8 C;  5GZE A;  5FZC A;  2W0X A;  5IK7 A;  4ASK A;  5A3L A;  4QKF A;  1RUE 1;  2IUW A;  4AVA A;  1LHV A;  2JE7 A;  5FPZ A;  3GM8 A;  2WZR 1;  4Y20 B;  5EFU A;  3NAP A;  1H6Y A;  3Q8E A;  3UL2 A;  1VBE 3;  5I91 A;  3PVE A;  3U75 A;  5JZG B;  1YFU A;  2CWM A;  3I59 A;  1AHS A;  4XTP A;  3PU3 A;  1I5P A;  1V9U 2;  4UW6 A;  1S2K A;  2K46 A;  4QPI B;  2H6C A;  1W8U A;  5EP9 A;  5FZ3 A;  1CAX B;  4AWD A;  3B69 A;  2Z5W A;  3ACI A;  5LY2 A;  4FTE A;  4Z2A A;  4XYX A;  4RFR B;  4UW4 A;  1Z7S 1;  5CA6 A;  1AXZ A;  4GAZ A;  1XOY A;  3WF0 A;  2WBK A;  1JYC A;  3T2T A;  2MNG A;  4Q26 A;  1F5F A;  3IPV A;  3TN9 3;  3ZSJ A;  1U5I A;  1R1Z A;  4CYD A;  3K51 A;  4HOO A;  1DQ5 A;  2WJS A;  3OY8 A;  4GAL A;  4X6R B;  1CD3 G;  3ZFE B;  3KV4 A;  1ZRC A;  4Y5S A;  1AR6 3;  1H0B A;  4S2H A;  4DEQ A;  3BU0 A;  4AFD A;  1PO2 3;  2DCJ A;  1SCR A;  1YHF A;  3LIH A;  3WP4 A;  3ZN6 B;  1JHN A;  2PAE A;  3FN9 A;  4BQW A;  5I8Y A;  3SH5 A;  2H0B A;  1UY0 A;  1VAK A;  1BZW A;  1J58 A;  5EZW A;  3S57 A;  2J7M A;  3ZFF B;  5FZO A;  2W47 A;  2PHF A;  1QXJ A;  5D8A A;  4BQY A;  3VBF C;  3HPN A;  3OCP A;  3SEP A;  1U5Y A;  2D6L X;  3BOD A;  3VKL A;  2BGP A;  4R4X A;  1HKD A;  1SFY A;  4LBK A;  1BVP 1;  3PUH A;  1DBN A;  4TSV A;  2OZ6 A;  1YQ8 A;  2ZGU A;  1QQP 1;  1TQ5 A;  2VD7 A;  2ORZ A;  1J3R A;  1FPN 2;  1YC6 1;  4AI0 A;  3NNG A;  1HIX A;  1O4Z A;  3B9I A;  4BIS A;  2VW1 A;  2VTF A;  1W0N A;  2WUH A;  3THP A;  3B02 A;  3AC0 A;  1IS5 A;  4LXL A;  3VD7 A;  2J1S A;  5A1F A;  4A3Z A;  4B29 A;  2BJS A;  4HBN A;  3SLI A;  4E27 A;  5A6Z A;  4MV2 A;  2XUE A;  3CO2 A;  3ZMN A;  3AB0 A;  1G9A A;  4QD2 A;  3WNO A;  4URA A;  3AVR A;  4B3N A;  1QQP 2;  4EWE A;  2EIG A;  1ZZ6 A;  3FUQ A;  3OEA A;  1LOF C;  1AUY A;  4IV1 C;  4E4H A;  2J1U A;  4IE0 A;  4BU2 A;  2R16 A;  2PEL A;  3H7J A;  3BCW A;  3WNL A;  1MEC 2;  3VD9 A;  3LEI A;  4FOY A;  5FY9 A;  1MS5 A;  3W58 A;  1ZA4 A;  3O1R A;  1QKQ A;  2A5Z A;  5JXH A;  4XJZ A;  5A33 B;  5M0T A;  1VBB 2;  4GQ7 A;  4K6B A;  2W39 A;  3O1O A;  3SKJ E;  4E2G A;  4LT5 A;  4YYO A;  2QQW A;  4PIY A;  1WKY A;  1LED A;  3LSD A;  1VBC 1;  5LW9 A;  3V0A A;  3SKV A;  1OLQ A;  3M7A A;  2GDF A;  1HQN A;  1VBA 3;  2XJP A;  5IFT A;  1KDM A;  4RR3 C;  3AMH A;  2SLI A;  3MUZ 1;  3BOW A;  2AEN A;  1CZS A;  5LA0 A;  4WVV A;  1AYN 1;  2Y6K A;  2GU9 A;  1OUR A;  3ASI A;  2W95 A;  3WR0 A;  1CVN A;  2VBD A;  4DQA A;  3VD4 A;  1JOB A;  4XF1 A;  3U37 A;  4GJY A;  1C1L A;  2D6O X;  1MQT C;  4CZS A;  5J3U A;  4PIZ A;  1XBF A;  1WCU A;  4KWL A;  2OPW A;  2DUR A;  4Q4X 1;  4YLZ A;  4D3W A;  4CU8 A;  5DG2 A;  5JIA A;  2DUP A;  2GH2 A;  3AFG A;  5GJ6 A;  3BTZ A;  1EV1 3;  1CR7 A;  1ODN A;  3N7J A;  2XHK A;  3M3C A;  2OQ6 A;  2VXJ A;  3N9L A;  2HWD 3;  1W8O A;  2PLV 3;  3ORJ A;  4N8M A;  1L7L A;  2VPV A;  4FFG A;  4LK7 A;  2VMC A;  1PO1 3;  2UYB A;  3SCF A;  2WII B;  1HQL A;  2DWR A;  2ZGQ A;  2NZ9 A;  5H9P A;  1TMF 2;  5HXM A;  1BEV 1;  1H1A A;  1K5M A;  2AUY A;  5EHD A;  1J83 A;  2ZGP A;  4BQ4 A;  3MV0 1;  1BLZ A;  1OMI A;  4YGC A;  2HYK A;  2W68 A;  3C7H A;  2L9L A;  3H3Z A;  4LUL A;  5BV6 A;  2WDB A;  3CQO A;  4IEP A;  3THT A;  1QDC A;  1NLS A;  4XFC A;  4BQ2 A;  2ZX3 A;  4BE3 A;  3DL3 A;  2PHX A;  5C3R A;  1KXG A;  4MZU A;  4YGB A;  1QJU 1;  4FT8 A;  1HW5 A;  1Y4W A;  5CG8 A;  1G8W A;  3RYP A;  3NWK A;  2CWS A;  4K1Y A;  1BEV 2;  4NRP A;  1C5I A;  1XYO A;  5T5P A;  1ND3 C;  1XNA A;  1MZ5 A;  1UX6 A;  4N43 C;  3WP3 A;  4Q4W 3;  4OQ8 A;  2Q30 A;  2J1T A;  1LHU A;  2R6Q A;  3OYW B;  2Q0A A;  3KF5 A;  3MIG A;  4ZKT B;  2C9A A;  1JU3 A;  1AL2 3;  1SDD B;  2A1X A;  2XML A;  1AR9 1;  1QJU 2;  3NO8 A;  2D6N A;  5CNA A;  3ZFG B;  1AX1 A;  4OUE A;  3TEY A;  1O3T A;  2UY8 A;  4LLF A;  3PLQ A;  4D7S A;  5FQ0 A;  2ZX1 A;  4M3C F;  5FZL A;  4QB1 A;  1R1A 1;  4RS5 A;  2B42 B;  1FYU A;  3VD3 A;  4AFB A;  4IXL A;  1UY3 A;  2ID4 A;  3FJS A;  3GCW A;  4Q1R A;  5J1X A;  2FDH A;  2D5F A;  3ES1 A;  2WN2 A;  4JDM A;  3VN4 A;  3AJZ A;  4XTM A;  4HVR A;  5JLV A;  1VRH 3;  4LIV A;  3AKP A;  1XNT A;  5JZG C;  2IFW A;  1WCS A;  3LWC A;  3AFK A;  4M0N A;  4QDS A;  1S2E A;  2QQO A;  3O14 A;  3PME A;  1GAN A;  1STM A;  2QKD A;  3AZX A;  3IDC B;  4Q4V 1;  3ROU A;  4D0Q A;  1KRI A;  4QPI C;  4IEU A;  2HEW F;  3KT1 A;  1IQA A;  4OHW A;  5FJH A;  1WBF A;  3P1I A;  3H7Y A;  1DZT A;  1R1A 2;  1VRB A;  3GZE A;  3GZA A;  5LCW L;  4W6Y A;  2VBP A;  5LA1 A;  4P5H A;  5D1I A;  1D0G A;  1BK0 A;  5BXX A;  2YU1 A;  2NQY A;  4G9S B;  2VEC A;  3DXU A;  2G9F A;  2GNM A;  3EMR A;  4IGQ A;  3WDW A;  4HG6 B;  4MSV A;  4YVS B;  1JOP A;  5KC5 A;  1XNK A;  3ZFE C;  2VVF A;  4RD7 A;  4NRQ A;  5FZM A;  5FYM A;  4KU7 A;  1IKP A;  1PVC 3;  1V6J A;  3H0O A;  3VBR B;  1WA4 A;  1JMU B;  1H6X A;  4WVM B;  2XQX A;  4A41 A;  4PHZ A;  5FMC A;  5FZH A;  3ZFF C;  3KWV A;  4AQ6 A;  2JDU A;  1RUC 2;  5FO7 B;  4NAO A;  1BMV 2;  4LUK A;  4E4S A;  3ZKY A;  5K8S A;  1OUS A;  1XB9 A;  3MPB A;  4UF0 B;  3AP5 A;  5HCF A;  1NCR B;  2XBO 1;  1RMU 3;  4P08 A;  3VBO A;  1QF3 A;  4MGT A;  1V6N A;  1CES A;  1UZW A;  4IE6 A;  1UO9 A;  2RR1 3;  2MEV 3;  1UIJ A;  4L9B A;  4BJ0 A;  4E8C A;  1QH6 A;  2VCA A;  3H9A A;  4ZS2 A;  5T52 A;  5F6L B;  3WNN A;  4YZ5 A;  3KVB A;  1POV 0;  2Q1M A;  5DAP A;  3RI8 A;  3S7I A;  3OOX A;  5JAX A;  3AYA A;  3OJB A;  5FFO C;  3BIE A;  3GBW A;  5JOX A;  5C4W B;  4XFH A;  2KA3 A;  1P8J A;  2XBO 2;  2D43 A;  1MS3 A;  3ZXJ A;  4CTE A;  2DTY A;  3IN9 A;  2LS6 A;  1RUH 2;  2PAK A;  4R52 A;  3ZSK A;  4AOC A;  4N53 B;  4P14 A;  1U5X A;  1S0B A;  1JHJ A;  4M3C B;  2P3J A;  5BUV A;  1OKO A;  2QQU A;  2R32 A;  2TEP A;  2VMH A;  1K5J A;  2YRO A;  5BPX A;  3WG2 A;  3ZSE A;  4RGG A;  4BK4 A;  5C9A B;  2QQP A;  1LGC A;  3JD7 2;  5T50 A;  1ASJ 1;  3D82 A;  3JBG 3;  2YC2 A;  1W2T A;  4WVZ A;  5A6X A;  3TEW A;  1PMI A;  4D94 A;  3HN1 A;  5F1R A;  5A32 A;  2JDM A;  3RGB A;  3D0J A;  3JZV A;  4ZHN A;  4JRL A;  4YSF A;  1SBF A;  4ET7 A;  4IEX A;  1DCS A;  4AHY A;  1BK1 A;  4KG8 A;  2VNG A;  2VUL A;  3ACH A;  3HMY A;  1TME 2;  4NHY A;  1W8F A;  1V6L A;  4FQ4 A;  2GMP A;  2P4E A;  3WCS A;  4DUX A;  3VBS A;  1WW4 A;  3ZLI A;  2VTX A;  4QU1 A;  4ATE A;  1RUG 1;  3LDK A;  3KLS A;  4LOS A;  3VZK A;  5F2S A;  2WZP P;  2ZKN A;  3WG4 A;  4COW A;  4A7Z A;  3TYJ A;  5JOY A;  4XAA A;  3G7D A;  4LBQ B;  2W2I A;  4CUC A;  1Q8P A;  4YM2 A;  3IB3 A;  2R07 1;  5IAV A;  1GKB A;  1R09 2;  2WQZ C;  2P5B A;  1GV9 A;  4CP9 B;  4OI0 A;  3H3U A;  4XDP A;  4OI1 A;  5GLZ A;  5EV7 A;  2PHR A;  1UMH A;  3PMS A;  2ARB A;  1YFW A;  5A1L A;  3S7E A;  1AL0 G;  2C1F A;  4CCL A;  2WNU A;  4I01 A;  3RI9 A;  1PX4 A;  4F83 A;  2X5I A;  1RUG 2;  3TWI A;  5IK8 A;  3OTF A;  2WSU A;  1N1T A;  1T2X A;  3GZT B;  4Y5T A;  3POJ A;  2BWC A;  3FBY A;  4JX0 A;  3LCP A;  3LA7 A;  4FPF A;  4MGS A;  2HWC 1;  5FRE A;  2YBK A;  2YG0 A;  1NE4 A;  1RED A;  5KXD A;  3K4Z A;  1OOP A;  1ND2 B;  2BGC A;  3JQW A;  5FZ1 A;  1HRV 1;  1L7R A;  4KG0 A;  5FYC A;  1UU4 A;  1HXS 1;  1RUI 3;  3DPR B;  1DQ2 A;  2BQP A;  1AR7 2;  2JDP A;  1GZW B;  1GOG A;  1GQP A;  1QJY 3;  4PDW A;  4QKD A;  4EN7 B;  1CAW A;  2R06 1;  2ZBJ A;  4OVE A;  2Y6G A;  2O8O A;  1AJK A;  3OSD A;  4ZU4 A;  4Y1Z A;  4LA2 A;  3LQC A;  5J7M A;  2HWC 2;  1KGY A;  2WNV B;  5E1R A;  1VBD 3;  3ZYI B;  5FUN A;  4CVU A;  4JCK A;  1RUF 3;  1HN1 A;  2Q1F A;  4BQX A;  5FZD A;  3TB0 A;  3I3M A;  3O12 A;  1HRV 2;  1JN2 P;  1ZZ7 A;  2RJ2 A;  1LRH A;  1ULO A;  1ZM1 A;  5HXV A;  1HXS 2;  2D3R A;  3HT2 A;  3J26 N;  4FI9 A;  2RMU 3;  4XXP A;  5JI7 A;  4WBB A;  4DNY A;  3N36 A;  5DMY A;  4YPJ A;  4Y4R A;  2CYF A;  3N9O A;  4DPN A;  1GUI A;  1W3X A;  5LAT A;  3ZFG C;  1EUU A;  4PCR A;  2Z2S B;  1GQG A;  1FI2 A;  5DZE A;  2RS5 1;  1XRU A;  2UY9 A;  5FPU A;  4LHS A;  1QIQ A;  4ZPI A;  1ZRF A;  3APB A;  2CDP A;  1JOJ A;  1UXX X;  3OGV A;  3PHM A;  1SPP A;  1FAY A;  4IE4 A;  3IIA A;  4A45 A;  4CDX B;  2UWA A;  4M3C E;  4M4R A;  1MVE A;  2PMW B;  4QX5 A;  5C3S A;  3ABZ A;  2AH2 A;  4CU6 A;  1JZ7 A;  1Q8S A;  3Q8A A;  3ZO0 B;  4FBF A;  4CP0 A;  3CJI B;  1LES A;  4Y3O A;  1E5I A;  4WM8 B;  1R08 1;  4IV3 B;  3BYW A;  4Z1V A;  2VOK A;  4Q0U A;  1LCL A;  5GZF A;  4Y1U A;  1F35 A;  4JVA A;  4QKN A;  1FMD 3;  2LW8 A;  5FTT C;  3O1T A;  1OLM E;  1W6P A;  4YVS C;  5FZF A;  3K3N A;  2P34 A;  3MID A;  3HNB M;  4CCO A;  4YVW B;  4UOJ A;  1X8M A;  2Y6F A;  4CDQ A;  2OPK A;  1TZO A;  5I0T A;  2WSV A;  3F2Z A;  4B1M A;  2XUM A;  3VBR C;  5JMC A;  1H8T B;  2NMN A;  4L92 A;  3ZYR A;  1OD5 A;  5C8C A;  1SBE A;  3I2H A;  1QOO A;  3J7M A;  5JMO A;  1O8S A;  1XSR A;  1GZ9 A;  3UJQ A;  2ET7 A;  3VDD B;  1C3H A;  2XJS A;  1QMJ A;  1XC6 A;  1HB4 A;  4AVC A;  2VUJ A;  4LR4 A;  5T5L A;  3POI A;  1NCR C;  1NZC A;  3P3N A;  2W08 A;  1CAU B;  3LF7 A;  1SLL A;  1ZBE 1;  1CPN A;  1IGO A;  4YW7 A;  1W2A X;  2BFU S;  1GMM A;  2PHW A;  1QNW A;  3E5U A;  3U78 A;  3O5S A;  5C3P A;  1SCS A;  1I1E A;  1V6M A;  3GJA A;  2CSG A;  2VAU A;  5B4X A;  4N7I A;  2DVG A;  2I07 B;  4FOQ A;  3RDI A;  5T5O A;  2W1S A;  2R1D A;  4E2Q A;  5LA2 A;  1EAH 3;  1ZBE 2;  2DUQ A;  3UKN A;  3DCQ A;  5BYN A;  2IVJ A;  1CZT A;  4HK8 A;  4N53 C;  2OS2 A;  4UFJ A;  3C7O A;  3IDE A;  3DGT A;  3WDX A;  5ACA 3;  4V2V A;  4CEY A;  2HBT A;  3PJY A;  5IVV A;  4EYU A;  2C24 A;  2WL1 A;  2BWA A;  2GC2 A;  1H9W A;  5C9A C;  3I3E A;  1GQH A;  5FKB A;  4XZU G;  5LEJ A;  1GOH A;  2ZML A;  3WG1 A;  1JH5 A;  1W39 A;  2F4L A;  1OQE A;  2WAA A;  1HX6 A;  3RYK A;  5DUW A;  5EYX A;  4QKB A;  3VDC A;  1ZRE A;  2RS1 1;  4BZ4 A;  3AKQ A;  2BP6 A;  2GC3 A;  1OVS A;  2BU9 A;  2WQ8 A;  4CUG A;  5GZC A;  5JI9 A;  1SLC A;  2ARC A;  5AVP A;  1QU0 A;  1XND A;  4HMZ A;  3LE0 A;  5F32 A;  4BA6 A;  4NAM A;  1BBT 1;  3RZL A;  1UYZ A;  3I2G A;  2XJQ A;  2HWB 3;  3C7G A;  4XFB A;  3V64 A;  2TNF A;  4FOW A;  5FO8 B;  4FP2 A;  3IMN A;  4Q2F A;  2IXK A;  5FYS A;  4CE8 A;  2BGO A;  4I30 A;  4WVW A;  5F5I A;  2XJR A;  2Y0I A;  5DAV A;  1PM4 A;  2VUA A;  5AFB A;  1J1T A;  1DQ0 A;  4DXR A;  3OBZ A;  4MHR A;  2CGO A;  2RS1 2;  4M4P A;  3VBH B;  4QPG A;  5DDJ 3;  1W2U A;  1RIN A;  3C2U A;  4AEM A;  4XF3 A;  1GSL A;  3BI3 A;  3E97 A;  2XWB B;  4Q4Y 3;  5FRA A;  3WIN E;  4URT A;  5DUX A;  3B00 A;  1MS4 A;  2D6K A;  1BBT 2;  1AYM 3;  2ES3 A;  1M4W A;  1NYW A;  4JTO A;  2IVI B;  4LKE A;  1MR5 A;  4JRA A;  1LEM A;  5LK5 A;  5KHI A;  1UY2 A;  2VZ3 A;  4CCC A;  1ZYB A;  4QM8 A;  3PVN A;  1YWK A;  2B9U A;  2DVD A;  2WFF 3;  4EV0 A;  3MI8 A;  1UMZ A;  3IT8 A;  4JTN A;  1COV 1;  1PHM A;  5AC9 1;  2WWU A;  2ZHK A;  2WS9 3;  2WT2 A;  4C0H A;  1QJX 1;  4PJY A;  1ND2 C;  2F6B A;  2GSY A;  3CKH A;  3UV9 A;  2OYZ A;  3DPR C;  1WD4 A;  3NV3 A;  5GAL A;  3T30 A;  2ATF A;  1EPZ A;  5KHH A;  1PZ7 A;  4DO0 A;  1V70 A;  5DAW A;  3NNL A;  4GH4 B;  1RHI 1;  2YY1 A;  4EWD A;  2B45 X;  3ENR A;  4EQV A;  4CXY A;  1SEF A;  1VAV A;  4QPW A;  4FCA A;  2YC4 A;  3NV1 A;  1OC1 A;  4LKS A;  5BNN B;  2JIG A;  2WNV C;  1G6N A;  2LAL A;  4Y33 A;  3VDA A;  2EIB A;  5CKN A;  1A3K A;  4I0A A;  3WNM A;  1A8D A;  1C5H A;  5A7S A;  5C4W C;  1QH7 A;  2ZGT A;  1NA1 A;  2WKK A;  2YFU A;  1N1S A;  3I8T A;  1XJA A;  3OBA A;  4XIK A;  5BNP B;  1WGP A;  3WW2 A;  2E53 A;  1IS6 A;  2ZAA A;  1F5J A;  5EJ1 B;  3GF6 A;  4NIA A;  4ARX A;  1UKG A;  2DV9 A;  4F3J A;  4IQP A;  1UPI A;  1OA3 A;  4XDQ A;  4HL0 A;  4K20 A;  5FYI A;  1RUD 1;  2XDV A;  3QAC A;  1IPK A;  4HN1 A;  5FPB A;  1W9T A;  2B8M A;  3MLL A;  1UOG A;  4MUV A;  4YZ4 A;  3ZIW A;  5KXB A;  5F3C A;  1D7P M;  1O6U A;  1QDO A;  3WF2 A;  4XFG A;  3WVJ A;  4LE4 A;  3EXU A;  3KS7 A;  4JGY A;  1F4H A;  4NHK A;  1ZA7 A;  4CDX C;  5A7W B;  2AGS A;  1W9S A;  2PN5 A;  3DXT A;  3NJX A;  4BH9 A;  2OUJ A;  5EQU A;  3SIS A;  1C8M 3;  4MAD A;  4Z92 B;  2V09 A;  3ECQ A;  2NPI A;  4L2N A;  5DAX A;  2HWF 3;  1WD3 A;  3WP6 A;  3CJI C;  1CAV B;  1RUO A;  4WM8 C;  4HLT A;  4IV3 C;  1D0H A;  1W03 A;  3ZSL A;  1W3V A;  1XPW A;  3V0B B;  4RHV 3;  4O9G A;  1J1L A;  4ZY9 A;  1W6M A;  2RS3 3;  1DZQ A;  4QX2 A;  3SMH A;  1NY7 1;  3PIG A;  4NJ4 A;  5EWS A;  4EE2 A;  2PHT A;  4KBZ A;  1VBE 1;  4GB3 2;  5A6Q A;  2YFZ A;  2W1U A;  4YVW C;  5FZ8 A;  3RWK X;  1REE A;  4QB6 A;  1UIK A;  3KCC A;  4GKY A;  1N3O A;  4NII A;  3IAQ A;  1RVF 3;  2JXA A;  4B1L A;  5LRS A;  1W2N A;  1H8T C;  4N90 A;  2FDK A;  4CU7 A;  1YYN A;  5B4N A;  1SLA A;  5IVC A;  4X8P A;  1WW5 A;  2Y64 A;  1UAI A;  3J7L A;  2BVV A;  4E4Z A;  4HSL A;  4QX7 A;  3VDD C;  4NWW A;  3I3D A;  2IZW A;  4MOA A;  4PF1 A;  4XJ9 A;  5FK8 A;  3HT1 A;  3TN9 1;  3POS A;  3WQ7 A;  2GMM A;  5CFD B;  1DQ4 A;  3BVC A;  2XON A;  2HWE 3;  2ZZQ A;  3MF9 A;  3J4U H;  1KFU L;  4BQ3 A;  2A75 A;  2RJK A;  4X6Q B;  3L9J T;  4FTS A;  2CY6 A;  2V4V A;  2OA2 A;  3DF0 A;  2WNE A;  1EP0 A;  3GXU A;  4QHZ A;  3J8F 3;  1DIW A;  3Q8F A;  2YBP A;  3T2P A;  4R8H A;  2ZX2 A;  4QXK A;  2DCY A;  2V5Y A;  1PM7 A;  1ULD A;  3MW3 A;  2ZCW A;  4IL7 A;  1OKQ A;  4QX0 A;  4BB3 A;  5LBF A;  5C33 A;  1OBN A;  5KXE A;  3I49 A;  3TEX A;  2I2S A;  5LBC A;  3AKR A;  4K21 A;  4QX1 A;  3K46 A;  5L9V A;  1U5Z A;  1RUE 2;  1HB3 A;  1JYT A;  3ZXF A;  3GAL A;  2E26 A;  2WZR 2;  5KXC A;  3J7H A;  1WME A;  3AVS A;  4X8N A;  4QGN A;  3KM5 A;  4CDU A;  2J1V A;  2ZPX A;  4E4D X;  1UZV A;  4CUA A;  5C5T A;  4Y22 A;  4IES A;  4P02 B;  3W5M A;  1W6Q A;  1PK6 B;  3FL7 A;  4W8J A;  4HPK A;  1F8V A;  4M00 A;  1BQP A;  3CL1 A;  2VVD A;  4YW4 A;  4QHB A;  1Z7S 2;  3FBM A;  2BBA A;  1CN1 A;  2NP0 A;  1ZRD A;  1X8E A;  4DFS A;  4GWJ A;  4CDW A;  1NKG A;  1V9U 3;  4IET A;  4J6G A;  4ZU5 A;  4IER A;  1PNF A;  3VD5 A;  4ZZ5 A;  2PAM A;  5FZG A;  3WCR A;  1HV0 A;  3VHP A;  4A3X A;  1OA2 A;  1CIY A;  1DQ1 A;  1ULG A;  3KGZ A;  3K3O A;  1DZR A;  4LO5 B;  4NE9 A;  4LPL A;  1VLN A;  2ZOE B;  3OF1 A;  2XKP A;  5FP8 A;  4AQ2 A;  4BMB A;  4ES8 A;  4CUB A;  1E5H A;  3VBH C;  4HKL A;  3CMG A;  3W20 A;  1ZNP A;  5EIY B;  1VBA 1;  3WY6 A;  1PNG A;  1GP5 A;  2RDN A;  2JIC A;  2IXC A;  3G6J B;  1KJR A;  2YUE A;  3AYD A;  4LBM A;  4WV8 A;  1GR3 A;  3NJV A;  4BLI A;  1HQW A;  1JI6 A;  3VKO A;  2DVA A;  4NO4 A;  5FAX A;  3JXS A;  3VV1 A;  5FV3 A;  3Q8C A;  1NT0 A;  3T08 A;  2WZ8 A;  3UNP A;  3IDB B;  3KD4 A;  3OPZ A;  4K8F A;  1H4G A;  5GZG A;  4JQT A;  1UXZ A;  4GXL A;  1S0D A;  3AMP A;  4FPL A;  1FPN 3;  1S55 A;  3AJY A;  1WZX A;  1RL3 A;  3HAG A;  4O7X A;  2VZU A;  1RGS A;  1TEI A;  4KI5 M;  5FP4 A;  2HWD 1;  1WLW A;  2BDR A;  3UES A;  5CBL A;  2IXH A;  1PO1 1;  4GH4 C;  4WM7 A;  3IDA A;  3M1H A;  1W2O A;  2VZV A;  4NOT A;  4YFW A;  5T55 A;  4J25 A;  3ZXD A;  4EN8 B;  4ZZ8 A;  4I0W B;  5FK7 A;  5IAX A;  3SH3 A;  4A7K A;  2BTV C;  2ZMN A;  5BNN C;  1QQP 3;  1H9P A;  3ZPO A;  4CPB D;  3W9A A;  1FT9 A;  2JEM A;  4A6S A;  1MAC A;  2CGN A;  2ZGM A;  1JYI A;  1B35 A;  3NAP B;  5FY7 A;  1OUX A;  5LRR A;  5BNP C;  4XXA A;  4E8D A;  1MEC 3;  4RQP A;  1KS5 A;  3DN7 A;  3L2Y A;  1VBC 2;  3MIB A;  2FDI A;  1A78 A;  4HSJ A;  4IEZ A;  3I59 B;  4JGZ A;  4QDR A;  1YLL A;  3VKF C;  1UQX A;  3E5X A;  3M3I A;  3QOP A;  2VM9 A;  1LU1 A;  4CEW A;  3ZIX A;  4DRR A;  5DAQ A;  1VBB 3;  3WNK A;  3M8L A;  4B7K A;  4KMQ A;  5T3N A;  3RVH A;  4R9D A;  5FY4 A;  3R6S A;  1AYN 2;  4KU8 A;  1LOD A;  5C8W A;  2ZEX A;  5T5J A;  3WP5 A;  3IPV B;  4I2O A;  2JDH A;  2VMI A;  2CTV A;  3LD8 A;  2Q8O A;  3V56 A;  2XPJ A;  3OY8 B;  2XWJ B;  3NKT A;  1HN0 A;  2WAO A;  4LBQ D;  1F31 A;  4FFI A;  4Q4X 2;  1GWL A;  2XQR A;  5CKM A;  5JR7 B;  4DZG A;  1AL2 1;  4CCE A;  4P9J A;  4XQ4 A;  1OH4 A;  1AR8 1;  5FZO B;  5D8A B;  1NCQ A;  4XCB A;  3ACF A;  5FJK A;  5C3O A;  5JVV A;  3JCI A;  4DXT A;  2AAC A;  1DHK B;  4NRM A;  4N9H A;  5H9Q A;  2VXR A;  2I74 A;  5CIS A;  1NE6 A;  4PLO A;  5K0U A;  2VMD A;  1H1I A;  1YFX A;  4PLM A;  2VOT A;  1GP6 A;  1VRH 1;  1XYN A;  4W6W A;  4GWM A;  3THC A;  3OUJ A;  2A3W A;  1H2M A;  5FP9 A;  5H9R A;  1TMF 3;  1YO8 A;  2P3Y A;  3D0S A;  4PBO A;  4AGG A;  5IT6 A;  3K75 B;  5JSO A;  1AR8 2;  1CPM A;  5FYZ A;  3VBU A;  2CAV A;  3H8R A;  1W8H A;  1DF0 A;  1WBL A;  1H4H A;  2QFE A;  2QQL A;  1MZ6 A;  2BNO A;  2V5D A;  1WWY A;  2P6H A;  4AYU A;  5LBB A;  2SBA A;  1IG0 A;  3NMB A;  5F5A A;  1HJG A;  4QM9 A;  5A3O A;  5CFD C;  1US2 A;  1Y9G A;  1FV2 A;  2QQV A;  1ONA A;  4R9B A;  4RFT 0;  1XNB A;  3MLJ A;  4UAP A;  5G04 L;  3T1L A;  4HT1 T;  3VHN A;  5CEH A;  4YZ2 A;  2KR2 A;  3QH7 A;  1BEV 3;  3AX4 A;  2JD4 A;  1T6B X;  1OQ1 A;  2OT7 A;  3CLP A;  3WF3 A;  3Q9O A;  5FPV A;  1UW8 A;  1X9P A;  4LTA A;  1S0E A;  1AR9 2;  1UNB A;  2P2K A;  2PXJ A;  1C8N A; 
#chains in the Genus database with same CATH homology
 3ZDV A;  1GZT A;  1W8F A;  1OUX A;  1OUS A;  2JDK A;  4AOC A;  5A70 A;  1OXC A;  1W8H A;  2JDY A;  4UT5 A;  1UZV A;  2BP6 A;  1OVS A;  2XR4 A;  2BOI A;  1UQX A;  5A6Y A;  5A6Q A;  2VUD A;  1OVP A;  5HCH A;  5A6Z A;  2WRA A;  5A3O A;  5A6X A;  3DCQ A;  2JDN A;  2VNV A;  2JDP A;  2CHH A;  2JDM A;  2VUC A;  4CE8 A;  2WR9 A;  2JDH A;  1OUR A;  5D2A A;  2BV4 A;  2BOJ A;  2JDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...