4UT5A

Crystal structure of the lecb lectin from pseudomonas aeruginosa strain pa7 in complex with lewis a tetrasaccharide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSATQTVKVLVNNETAATFTGQSTNNAVIGSQVLNSGGGGKVQIQVSVNGRSSDLVSAQVILANELNVALVGSEDSTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECB LECTIN
publication title Genomic Rearrangements and Functional Diversification of Leca and Lecb Lectin-Coding Regions Impacting the Efficacy of Glycomimetics Directed Against Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 4ut5A00
2BP6A 5A3OA 1W8HA 5HCHA 2VNVA 2JDNA 1OVSA 2JDMA 2XR4A 1OUXA 4AOCA 2WR9A 2CHHA 3DCQA 2JDPA 2VUDA 2VUCA 2JDHA 4CE8A 1W8FA 5A70A 2JDUA 2BV4A 1OURA 3ZDVA 5A6QA 5A6YA 2JDKA 2JDYA 5D2AA 4UT5A 1UZVA 2BOIA 1UQXA 1GZTA 5A6XA 5A6ZA 1OUSA 2WRAA 1OVPA 2BOJA 1OXCA
chains in the Genus database with same CATH superfamily
1PZ7A 1BVP1 4GMP0 1N1SA 4Z82A 3IWZA 5DN2A 1ULCA 2AZ5A 3UGFA 1WCUA 1QDOA 4QHZA 5FXWA 5GZCA 2VZTA 4TYSA 1HRV1 1GFF2 2C5DA 3MIGA 4RS5C 5HPOA 2EF6A 3AMNA 5C33A 5JPMB 4MHRA 5FXZA 1JXNA 2Q30A 5EXOA 3BTAA 3VDBA 4E27A 4CCEA 3SHRA 4WM7A 4CVUA 2VPVA 2VULA 1CJPA 1UYXA 4XF1A 2WZR3 4R9BA 1X9TA 2WWUA 2XONA 5B4XA 3WNMA 3PJYA 4MXWB 3RDIA 3WQBA 1GICA 4Y24A 3B94A 5BNPC 1KJLA 1SBFA 3KCXA 3NAPB 4GJZA 1D4M2 2DCYA 3JXSA 4LE4A 3AP4A 4YM1A 1OFSA 3PUAA 1Q5OA 1X9PA 5KXBA 4UFHA 5HCAA 1DQ1A 3OY8A 2JDNA 3V0AA 2WYFA 2YV8A 2OVUA 1FNYA 5JLVA 4Q4V1 2F4PA 2BWCA 1BK1A 3HD8B 1FT9A 1LRHA 2C26A 3I7DA 5GZEA 1YRZA 3TN93 1W03A 1GZCA 3AZYA 1UPSA 2DDUA 4A42A 1RHI3 2YPJA 1LODA 1BKZA 1YHFA 4L2NA 1VMFA 5EZWA 2YC4A 3FN9A 3G6JB 4FQZA 3M70A 3WF2A 2VXRA 2IFRA 3NNLA 5FPAA 2WUHA 4K7JA 1CN1A 3NJZA 2O1QA 3LCPA 4JV4A 2XBO2 1I5ZA 4BIOA 4IXLA 5HV4A 4FXKB 3WDTA 1A8DA 4ES8A 1NY71 4CEYC 3MIHA 1ZBA2 1A78A 3CHXA 1ND2B 2XH6A 4RSUA 2D6LX 1LOAA 1J1LA 2X10A 1C8M3 5HV0A 1VB4A 5DG1A 2ZMKA 5DDJ3 1VBA2 3ZOIA 2GC0A 5JOYA 2EIBA 1Y9GA 2PAMA 3ECQA 1JZ7A 4XAEA 3OUIA 3WNLA 1ZRIA 3C2UA 5AC92 3GXUA 1OKQA 5CZKA 1PMHX 1W6MA 1EUTA 3ZKYA 5JIUA 2VUDA 1TQ5A 2D44A 2Z42A 1K5JA 3OBTA 1ZRDA 2HWD1 1TMF2 1S0JA 3LPGA 2GNMA 1OHFA 5LRSA 3W20A 1US3A 1W0PA 1FPN2 3AXDA 1DQ5A 2V73A 3HEIA 4LOSA 4EWEA 4FPKA 4AVVA 1NX9A 1O8PA 2BOJA 2GH8A 1QOSA 1WMDA 2PHTA 1DYKA 4Y3OA 1RUG3 5JCTA 2XKOA 4QPYA 4DXRA 4ISRA 3ZIWA 4YW3A 4MOAA 4AI3A 2SBAA 3S7EA 2QKDA 3VHNA 2V5YA 3NNJA 2ZX1A 3I2KA 2E51A 4JKKA 3C8XA 1POQA 4A6OA 3UESA 1EV11 1Y43B 4LMFA 5SV8A 2ZGSA 1CZTA 1GNHA 1YXWA 4XBQA 3RZJA 2FCUA 2UYBA 3ZYIB 5A7WA 1HQLA 2GALA 1ONAA 3CJIC 3PJQA 2D93A 2Y6JA 3T0AA 3WNKA 2O14A 1AXZA 2WWSA 3ZMOA 4D6QA 1Q8QA 5F37A 3GZEA 3KV6A 4GKYA 1PO13 3USSA 2HWF3 3OY8B 4NIAA 1V0AA 3H3UA 4CCLA 3MIFA 5T5OA 3V0AB 5AFBA 4YVSC 5LA0A 1OI6A 3EO6A 2RS32 3C3VA 4IV3A 5GALA 2LTNA 3ZM8A 4ZZ5A 4G9SB 3AX4A 1UN1A 3DKWA 1RYYA 4XW3A 3NJYA 4K1YA 5BYNA 4QX3A 2XXZA 4JHZA 2RR13 3DCQA 5KWRA 2VMEA 2JDHA 1DQ2A 2D3SA 5GZGA 3KMHA 5LRRA 2BNNA 1IPKA 3ES1A 4XCBA 5A6QA 2PA7A 1YJLA 1ZM1A 4PDWC 1ZA4A 2VNOA 3OCPA 3RGBA 5T5LA 4FCAA 3BI3A 1VBE1 1XNAA 1U5ZA 4HBNA 2VW2A 3VV1A 4AVAA 4ARYA 3Q8FA 2BPA2 5F3CA 1GP6A 5A80A 2TEPA 4MZUA 4QD2A 1W6MB 3UGHA 2VZPA 3VHOA 2UU8A 5DPNA 3AYCA 1OQEA 4N7IA 2EVXA 1UIJA 2VTXJ 4Y1VA 3BUCA 4MSVA 2Y6FA 4HONA 4TLFA 5FP9A 4GAZA 3TEXA 2RM22 4XAAA 3O0XA 5IWFA 4V2WA 4BYYA 1PVC2 2HWC1 3WNXA 4EN0A 1WW7A 1W0OA 2TUNA 1POV0 5M0TA 5D8AA 5F39A 5DG2A 4L8QA 3O0VA 4CUGA 2RHPA 4OUMA 4P5YA 3SNMA 2GC2A 1YWKA 2RS12 4TZDA 1AR73 3KS7A 2AH2A 4YZ1A 1REFA 3O7OA 3RG0A 5FTTC 1G9FA 4YSFA 3MLKA 1RUOA 1XNKA 4AEDA 5A3UA 1PIV2 1LB2A 1GWLA 1ODMA 1OA2A 2VTFA 4QPIA 3ZVXA 5F6KA 3SC7X 4CCCA 1SQ4A 5A7WB 1EY2A 3IDAA 1HB2A 2ORXA 1L7RA 1F31A 4GWMA 1KEXA 1QJEA 4FOVA 4CP1A 2W39A 3U0ZA 2VCMA 1LOGA 1QJX1 3N7KA 1YFXA 2V72A 1QQP1 2BNOA 3KWVA 3MV11 3OPZA 1UY3A 2P3JA 5FZ6A 5B4NA 4NRQA 3B02A 3HJRA 4FPLA 1MS1A 3ITQA 4XHBA 4E8CA 1RUNA 3DPRC 2HWF1 4IV3B 4WM8C 1W6NA 3ALQA 1GQGA 3IIAA 3OYWB 2JD4A 3UETA 3E5QA 1GOFA 1V70A 2Y0IA 2YB7A 3VHRA 3I3MA 3MICA 1H1AA 4XFIA 5C71A 1DDLA 3THDA 2QQMA 3H8UA 1VALA 2RR11 2BVVA 3HR9A 4EJRA 3U11A 5IUQA 3FHQA 4RS5A 2ZGRA 1JBCA 1XSRA 3KT4A 5FY5A 1L3JA 5EQUA 5K0UC 1UO9A 3WP3A 2GH2A 1V9U1 3JB4C 2SLIA 2C6SA 4IEWA 5BNQA 1A34A 4FTSA 1N1TA 4KU8A 1L7LA 1UZYA 1VMHA 2MHFA 3VL9A 4Q26A 3RWNA 5L9VA 2EICA 3AMPA 1UOGA 3NV3A 1O3QA 3POEA 5GKAC 3IMMA 1ZX5A 1QXRA 3OBRA 2HBUA 5DUWA 2C24A 4BHPA 4Z8BA 2XHKA 2Q8EA 4S2HA 5TSWA 4CXYA 4GMP3 2C9KA 1WW5A 3ZSLA 4BPZA 4PF5A 5DAXA 2VQ0A 2E32A 1IG0A 3QH6A 5F5AA 2WFF2 1NCRA 2W3JA 1HXS3 4M0NA 2ZEWA 1Z7S2 3AMHA 3N9PA 4OULA 4H7LA 2X29A 2GAUA 3GALA 4QX5A 4YGDA 1JZ5A 2QCSB 3I2HA 2RE9A 1PHMA 3NRUA 5KXEA 4Q0VA 5JDBA 4CDQA 1OLME 5JSRA 3EMRA 3IM0A 4R8HA 1GANA 2W95A 1XNBA 3AZWA 3LEIA 1F4AA 2XVGA 2E7QA 3BALA 4AEDB 3JUUA 4GD4A 4P9IA 2FZ2A 4LKDA 2J1EA 4LOTA 4QPIB 4UWDA 1FI2A 1Q8SA 3KQRA 3KHCA 2ZMLA 1GWKA 4FQ4A 4QX7A 2ZZQA 3J7LA 4CCDA 4C0HA 3NV2A 2VCCA 4ATFA 2XLFA 1NZCA 2DVGA 2VM9A 4K1ZA 2D98A 4KU7A 4QDSA 3R0RA 1SDDB 4PLOA 3ZXKA 3MV01 2P3IA 4JGYC 4BJ0A 4J25A 1XNCA 1HV1A 4FPFA 2R1DA 1OPOA 3R4SA 2EXHA 1W6NB 2XBO1 5L9BA 2FBEA 1KDKA 4OMCA 3TAYA 1DQ6A 2KA3A 4QMAA 3WNOA 1SBDA 4KBBA 3POYA 1RUC1 2OIIA 2VU9A 5FY4A 3TWIA 1FV2A 4S2DA 5FY9A 5ANQA 5FXVA 3WP6A 1G9DA 2LROA 1YJKA 1VBA1 5IAVA 3K48A 5HCHA 1RUF2 3DYPA 2YZ4A 1SEFA 4RS5B 2WAOA 4MADA 1IS6A 3SH3A 1O3TA 5AC91 3GYDA 3KT7A 1GQPA 1UZ0A 3PMSA 4JHTA 4AOCA 3WZ1A 4RGKA 3WVJA 1XXNA 1AUYA 2ARBA 4UYBA 2MEV3 3CQOA 3P3NA 1S0IA 2CNAA 3ACHA 3RVHA 3IKWA 3UK9A 4ORFA 3M1HA 3B3QE 1IS3A 2GP3A 1M06G 4P08A 2ZGKA 5FJKA 1FPN1 1W9TA 1O5UA 2BERA 3SEEA 5BNPB 1K3IA 2LUWA 4XACA 3CJIA 1CX1A 1WUVA 1XYPA 4UFIA 1YI9A 4LK7A 4Z07A 4CCOA 1J84A 4MG2A 1GBGA 1NCRB 4Y33A 5A3OA 4INDA 1LNSA 3Q8BA 1SFYA 4YVSA 1W8OA 4B3NA 5KHGA 4WVWA 1R082 2IXIA 1OPMA 2Z2SB 4BQ3A 2D5FA 1W2NA 2ZX4A 2D97A 4UFKA 1TNRA 4XFFA 2ARAA 4MGQA 2VZRA 1KFUL 2DTWA 3WLUA 3WEZA 3ILRA 2YXSA 4CEYB 2JIGA 5I91A 4K40A 3ZFGC 4KH9A 5CG8A 4PDWA 3LE0A 5FLHA 3SITA 1XE8A 3AYEA 4CDXC 3WT3A 2VBDA 5F9TA 4IEXA 2RS31 3RZMA 1XU2A 3VZLA 4OI2A 1W9SA 4V2VA 1VB2A 3LOBA 3P6BA 1PM7A 1PK6A 3FJSA 4QHOA 4LO5B 1E5HA 2ERFA 2VD7A 1HJGA 3LQCA 4IV1A 4AI1A 4AEMA 5BNNC 3FLPA 2WKKA 1MZFA 4FAGA 1X36A 3HAGA 4PQQA 4CCJA 3GCXA 1OH3A 4MXVA 3UT0A 2WLPA 5FWJA 1AR93 1QIQA 4Q1RA 2PAKA 5C4WC 3MEPA 1YFYA 3FUQA 2VOXA 4Z2WA 2QZ3A 3AC0A 3V65A 1JYVA 2JEMA 2YBKA 3BOPA 4JDOA 3VKLA 3DKQA 5A32A 5L36A 3CEWA 3U14A 5CAZA 5F1RA 4Y1ZA 4YVWC 4DINB 1JHJA 5FMDA 3ACLA 2BWAA 1H2KA 4KGQA 2O8OA 3PHMA 2AACA 3FZ3A 3S7IA 3JCIA 3K75B 2QNKA 4GZ9A 4DUXA 3OB8A 2VZUA 4ZU4A 2VZQA 4I3PA 1VAKA 4OZXA 5IK8A 2FDHA 2XVKA 4BZ4A 4GXLA 4LIUA 2K9ZA 4AEKA 3O14A 1W06A 5EPAA 1FMD2 1FV3A 1S2EA 1HRV2 2RM21 3ES4A 5FUNA 1FOD2 3DEMA 4TSVA 1MEC2 1PVC1 1CONA 1MS9A 4CE8A 2AGSA 4XJ9A 4NIGA 4GJYA 1HIXA 2WO3A 3CJIB 4ATEA 4E4ZA 1JYIA 2XUEA 2Y64A 2GN7A 1OQDA 1W3VA 1W6OA 1W9FA 1POV3 2XKPA 5GLTA 2PN5A 5FP4A 2RS11 4YVSB 5E16A 4BXSV 3KM5A 1LEDA 2PHUA 2PYTA 4WM8A 2DYCA 1LU2A 3VBRC 1X8EA 2J7MA 4QDQA 3D4KA 4WZFA 1FYUA 3VN4A 4AQ2A 1AR82 4C1XA 2DVAA 3MI8A 1LEMA 3H7YA 5CKMA 3LKJA 4PIZA 3QACA 3EHKA 1KS5A 2B9UA 4KI5M 1IQDC 4QGLA 3C7HA 1AX0A 1XSQA 4IE5A 4FP3A 2R071 5JWPA 3VGIA 1RVF3 2CDOA 4PDWB 4LNVA 2VL4A 4E4SA 5E1RA 1XNDA 1FATA 2DVBA 1SBEA 1O8SA 4WBBA 3UGGA 2OZJA 3WDYA 1E57A 2FZ1A 2R0FA 4BQYA 3PU8A 4E4HA 1PK6B 1UOBA 2BEOA 3TBDA 1BCXA 4KMQA 4A45A 3AMMA 4FOQA 1XE7A 4IV1B 4AAPA 2OS2A 3EYPA 3KT1A 4Q0QA 4RA0A 1IQAA 2ZGUA 5DMYA 3USUA 1PO23 2YMZA 1H4HA 1KFXL 5FJHA 2FDJA 3PTYA 1LOEA 5A32B 4JAAA 2E53A 4PIXA 4Z92B 4OHYA 1QGLA 1Y7BA 4O7XA 4NHKA 1GQHA 4HFSA 1JYXA 4YW6A 5A33A 1C5HA 1RUJ2 4EROA 3BKZA 2E33A 3B93A 1IGOA 1UOJA 2WNEA 1TME3 4PI2A 4IERA 3VD3A 5HBAA 1H30A 1MQTA 1U0AA 1NA1C 2VG9A 3GHMA 4NRPA 3CKHA 5L9RA 1OXCA 2XMLA 4N9IA 5FO9B 3PVEA 5LBEA 4Q4Y3 3H1MA 1RTVA 2GMPA 1Z7S1 4CP0A 2XWBB 3FC0A 2ZAHA 4Q1PA 2XUMA 2A6ZA 2R0HA 4OUSA 1NAEA 5I8TA 1NG0A 3KHBA 1AL23 3O5SA 3KGZA 1W6OB 4CCNA 1RINA 2DV9A 4QX2A 3LB9A 4JGZB 1QY4A 2GNTA 2VUAA 4GWIA 3RMYA 1EV12 2R7EB 3SH5A 4JGYA 4FOWA 4AGVA 4LULA 4AGRA 3Q8EA 2HWE3 3POWA 4WM8B 2WZR2 2R041 3I2IA 2DF7A 3BTXA 3V64A 1UZZA 1GLHA 2D6NA 5FYHA 5CBLA 1MPXA 2A5ZA 2R30A 3T09A 3RNSA 4QM8A 5BNOA 4DXTA 1G6NA 4ISQA 4YZ2A 3UYJA 1JODA 2B9VA 4RD7A 2CWMA 1XPWA 4ZY9A 3BTYA 4BISA 2LW8A 4CU8A 4XOGA 4AAXA 3WQ0A 1CVNA 3POJA 4QXKA 3TN92 2UURA 1QJY1 4M3CA 3MF6A 4O9GA 1RHI2 2VY0A 3OTFA 4RYDA 3UKVA 4K20A 4LJHA 1JZ3A 2PMWB 4LLOA 3O1TA 2JDYA 3WHUA 2OUHA 4Q4X3 2PLV3 3GBGA 4ZXKA 3OBZA 1L7QA 1VAVA 5FZ0A 1DLCA 2ATFA 2EXIA 5CG9A 3VZNA 2ZEYA 4Y22A 5KBFA 1VBD1 2QTWB 1RUF1 3POBA 3FLTA 1W8HA 1C8M2 1EP0A 3VZKA 1OLRA 3PIJA 5FZ1A 4AFAA 3IDCB 5DAQA 5DDJ2 5FZLA 1AF9A 4UW3A 1ZRCA 3ZN5A 5C9AC 3PDQA 2F17A 2VNGA 4JZRA 4PT6A 3HBKA 3T4HB 2WT2A 2N7GA 2VBBA 4QB6A 5FY1A 2Y60A 5A33B 5A70A 1QDCA 2LM3A 3L2YA 1RITA 4D6RA 3AXEA 5D2AA 3I59A 5C3OA 2IXHA 1H1MA 2HWC2 3PVBB 5H9SA 3VLBB 4DB5A 2VC9A 4QKDA 5FYIA 2D40A 2JG8A 3ZFGA 2VZSA 5C3QA 1BMV1 1N3PA 2DBNA 3H9AA 2QQJA 1R081 1ALYA 5LK5A 2BUKA 4TLGA 4H55A 5LY2A 3K2OA 5F3GA 4MX3A 1MACA 5EJ1B 3IZOA 4GKXA 4JGYB 3T2TA 2B45X 1FAYA 2A6WA 3AK0A 1JOBA 2X5IC 2VQUA 4B4RA 4YG0A 1HRI3 3I3QA 1TG7A 5JZGA 4HANA 3VD5A 2F6BA 4XF0A 5C4WA 1UIKA 3CO2A 1QQP2 2H6CA 2A73B 4LXLA 5E89A 1WMEA 1JYWA 3VBHC 1PO12 5I0RA 2HWF2 2R32A 3NNMA 3VL8A 4R52A 4X6QB 5LB6A 4ET7A 1AJKA 1H6YA 1LGBA 2OKXA 2P3YA 1VR3A 2HEWF 3HIFA 3C7GA 1BHGA 2NLRA 1K5MA 1EAH1 1JHNA 1ND3C 1GR3A 1V6JA 2O0OA 2W1QA 2ZA9A 4LHLA 4AK3A 4BK4A 4FSJA 1DGWX 1SDWA 1NYWA 3WDUA 4QPGA 1ULEA 2RR12 3H7JA 5F2WA 3VDDC 4AZZA 4CUAA 3VKFC 4ASMB 4D7YA 5CYYA 4Y22B 4DXSA 1BJQA 1DFQA 2PLV1 2YYOA 3I3DA 4NUBA 4ITCA 4M00A 4B4QA 2HEYF 3KF5A 2E6VA 5IAXA 1VRH3 3J7MA 5T3NA 5JAXA 4W50A 1XBFA 4BQXA 1UAIA 5FOJB 4JDNA 1UX6A 3DF0A 5FZ3A 1D0HA 4RFT0 4XFAA 1FMD1 3LA7A 4DS0A 5C7GA 1FOD1 1RIRA 2CGOA 1MEC1 4AE2A 4AQSA 2WT0A 3MDPA 2A3XA 3WF3A 2RJLA 5A3LA 4FXGB 1H8VA 1N47A 3I59B 3OD0A 4NJ4A 1H6XA 3FBYA 1ZBE3 3ZXDA 2JG8B 4JTNA 4NHYA 4J1WA 2BVBA 3ZFGB 3TB0A 1WCQA 3CZJA 4MGTA 2A6YA 1CWPA 2H6BA 2WINB 5LA2A 4CZSA 1W05A 3N9MA 1W8NA 3A22A 3SCHA 4PIYA 1UPIA 5A1LA 1JMUB 3AYDA 2G19A 1AR81 1SCRA 3F2ZA 3IDBB 1AR72 4N9HA 3WP4A 2A6XA 1JZ6A 1VE0A 1YQ6A 3OEAA 1RUE3 2XB6C 4Y4RA 4JVAA 4FO9A 5JZGB 2Y38A 3MW4A 3S5AA 5C4WB 3TYJA 4P9JA 3WF1A 2H0VA 5FK7A 2VH9A 1RJ7A 2CAVA 2QQVA 4DPNA 4AHYA 4DY3A 2Z5WA 4UAPA 3T2OA 1QJFA 4I09A 4JDMA 5LA9A 1SG3A 4HSLA 2Q8CA 3ZXAC 3GGLA 2ZX2A 3H3ZA 3RYKA 2WNUC 1W8TA 3ELNA 2LALA 1NUKA 1RUC2 1K5MB 3FE5A 3ZFEB 4LT5A 2DU1A 2PHWA 4RGAA 5LBBA 1AXYA 1CAVA 1LHWA 1NA1A 2XJTA 3AP5A 4N53C 4QPGB 4XCAA 4QM9A 4XUQA 2ADEA 5FZGA 3AL6A 3U4SA 4NIIA 4CU7A 2HWB3 4YZ3A 4CP2A 5FYCA 4OHVA 4Q4W3 1HB1A 4QAWA 2DVFA 1J3RA 2R063 2XOMA 3DN7A 4KWKA 4YW1A 2FDFA 4UW5A 1APNA 2CGNA 4XC9A 3TNPB 3K3OA 1QJU3 4FPJA 1HB3A 4K9SA 4DRRA 1URXA 1W2UA 4EZ4A 5A3MA 1RUJ1 1SZBA 2J1SA 2ILMA 2VBPA 4OLLA 4HOOA 1FNZA 1G9AA 3W58A 1IZ3A 5CFCC 2XLGA 4XFHA 1PZ8A 3NV1A 2B8MA 3VBRB 1SLIA 2GC3A 1UY1A 4BB3A 3K4ZA 5E6HA 1EUUA 4C90A 2P3KA 2WFPA 1S55A 1ASJ3 2DCZA 2OW4A 4XF3A 3VKMA 3LEKA 3U37A 4A2UA 3TEWA 4CDUC 4DUVA 1M4WA 3B9CA 3E5XA 1O91A 2WNVA 4C8DA 1GP5A 4TXWA 1HXS2 1X33A 2WQZC 4FT8A 3D82A 2VMDA 1S0BA 1OA3A 1A6CA 2NN8A 1GZ9A 3OSDA 5JVVA 3JD73 4RR3C 3BN6A 3VDAA 4M01A 5L7OC 1S0GA 2WZR1 4DMIA 3ZR6A 5LWBA 2XWJB 2FD8A 2JE7A 1W39A 5GLVA 4AFBA 1WLCA 1WD4A 3NNFA 4HK8A 4LKFA 3RSJA 5A6ZA 4UFMA 4AR2A 1UOFA 1SHWB 1MVQA 1T6BX 1UYYA 3DGTA 4QXCA 4Y1XA 5F8PA 3CJXA 3BTZA 3K4AA 5LA1A 1RUE1 3NVCA 3OYWA 5FZDA 3KZ4C 3SQOA 3VBFC 2RS53 4LUKA 4M4PA 4YFWA 3PUQA 3TN91 2C4XA 5CISA 5IT6A 1KQRA 2W94A 1UL9A 2MNGA 1RHI1 4DUWA 3NSTA 3ZFEA 2E7AA 4XZUG 2QQKA 1KJRA 1ULPA 1JI6A 3IB3A 3WW4A 3C7EA 3HQRA 3WP5A 4Q27A 1QKQA 3NW4A 4MO3M 4O9EA 5IK7A 2I07B 4LBKA 2BFUL 1C57A 3L2HA 2GSYA 3ME2A 1CAVB 3A0KA 1NA1B 5HXMA 1C8M1 2WJSA 2WRAA 4YNIA 4AHWA 4DEVA 3ZMNA 5FYUA 5DDJ1 3DXTA 5FO7B 4XUNA 5FLIA 3U1XA 1AJOA 4RHV3 1UCXA 2HWB1 3A0NA 3WG4A 2TBVA 4Q4W1 3VUOA 5I0TA 3CMGA 3PURA 2ZS6B 1SLAA 2E63A 4IEVA 2YPDA 3QD6A 2MEV2 4XVHA 1O59A 3N35A 5FMOL 1GUIA 2VQTA 2YROA 4K3UA 5J7MA 2X5IA 1Q8OA 1Y4WA 2QE3A 2ZJCA 3WCRA 4QQ2A 4IEQA 4EWDA 5LZ6A 2RJ2A 1SLBA 5EP9A 1QU0A 1UYZA 4X8PA 5A6XA 4BXFA 4P9XA 4ZS3A 3U10A 4I2OA 3VBOA 2WNVB 1RUG1 3POFA 2EA7A 5LW9A 1OQ1A 1OOPC 1QH7A 3MIEA 4IDZA 1HQNA 1QNWA 2HEVF 3GF6A 1SMVA 5EYYA 5FBJA 4I3GA 1O5LA 1LTEA 4OQ9A 1O7FA 1QMJA 3RQ0A 5KHIA 1AYM3 1LECA 2WA4A 1ND3A 4HVQA 5FK8A 1TVGA 3DXUA 3CU7A 5JSOA 4LBMA 2G9GA 2R072 4D6SA 2RVAA 2YG0A 4BQ1A 2P4EA 4XJAA 1H9PA 1PO11 2FHRA 1YUDA 5IVFA 4COUA 1AL0G 2RDRA 3CF6E 1OVPA 4A6SA 1C28A 3OGVA 2BP6A 2D6KA 2I74A 4B8EA 5C3RA 5FDBA 1PGSA 2VW0A 3PIGA 1X8MA 1RUI3 2J22A 4LUMA 5EV7A 4CCKA 4K21A 1KDMA 4AQ6A 4ASKA 1UX7A 1LKNA 3DYMA 1I1EA 3MPBA 1BBT3 1BZWA 1N3OA 3KF3A 3WNPA 4D69A 3BU0A 1YQ2A 3HMYA 1GZWA 3CIHA 1AR92 3T3YA 1W2AX 4IETA 4R9AA 3ASIA 1OH4A 1AX1A 1SPPA 1YIPA 2OUJA 1ZBA3 4XHXA 4LHSA 2B7YA 1V6OA 2X8KA 5G04L 5FZCA 1ZRFA 3RWKX 3ABZA 3E6BA 2BOIA 4HKWA 3M2MA 1J1TA 1H2MA 2CV6A 1G8WA 1MS4A 4XJ8A 4JQTA 1CR7A 3PUIA 3MFAA 3ZFFC 5BNPA 3SKVA 3O1UA 4UBGA 1SCSA 1JYCA 5FZBA 3LDRA 3T1MA 4NIHA 1XJAA 1UYPA 1N3QA 2VCAA 4ARXA 5JXIA 2I2SA 3KLSA 5L19A 3ZKUA 2C9AA 2GN3A 1H9WA 2IVIB 3GM8A 4XXAA 2X5IB 3NJVA 1RUH3 3QH7A 4YGEA 3WF0A 1KD7A 1KXGA 4DFSA 5FBZA 1EPZA 2W68A 2JDKA 2Q4SA 2Y34A 5IVJA 3RFRA 1Y9QA 3VBOB 1NCQC 4DOUA 4TN7A 2B39A 5FRAA 1CZSA 4XFBA 4NIDA 2R042 3X29B 3AFKA 5FZKA 4BIFA 2P2KA 3MIBA 4YW2A 1AR71 4CEYA 3NMBA 1H2NA 2WNUA 4FPHA 4YG6A 2IXJA 1MS3A 3HOBA 4DZGA 3WQ7A 2XJSA 1PNFA 1ND3B 3LIHA 2WYSA 3VKNA 1ZVFA 2D7FA 4QX0A 5ERLA 3PVOA 5GZDA 2KD7A 3ZIXA 5GZFA 1CAUA 2VUJA 5C8CA 4YWAA 1JYNA 1ZYBA 3VZJA 2JE8A 2D3PA 5DUVA 3I3EA 1COV3 1WBLA 4K6BA 4XILA 3POGA 4LLFA 2IXCA 2ZGMA 2XLAA 4QU2A 2BGOA 1J59A 1RVF2 4HG6B 1LHVA 1QJY2 3PMEA 3JQXA 2CDPA 2ZX0A 3ZXLA 1JYTA 2OXBA 4UFLA 1RUD3 3LIGA 5KXCA 5CEHA 4EQVA 3ZSEA 1JUHA 3MUZ1 1RMU3 1CESA 2W0XA 2DCKA 2VCBA 3EBRA 3DV8A 4BMEA 2EAKA 4IE4A 4CUBA 4D7SA 1VBD2 4BWOA 3J8F3 1GYKA 1KS4A 1N1YA 5JOWA 2ARCA 2WL1A 1O3SA 2VQAA 1RUI1 3LWCA 2AC1A 4QWNA 1GZWB 1RC6A 1NXD1 2WA3A 4AVSA 1SPPB 4ZU5A 5T54A 3AMQA 4G4FA 4Q5OA 3MF9A 4WVZA 1W8FA 2VMGA 5FQ0A 1HDKA 4PLNA 4Z2AA 4FVVA 4YGCA 3ZDVA 3RS6A 1DQ0A 1MS8A 4BQ4A 2HJIA 2DWRA 1JOJA 1ODNA 1YFWA 5F2SA 5C70A 3OOXA 4IE0A 2QDNA 4M3CE 5T52A 5FPZA 5DABA 1V6NA 3LA3A 2XQXA 3SXWA 3AP7A 4NHMA 3GBFA 4CU9A 3LFMA 3I2FA 4XF4A 1TME2 4GMP1 5AFEA 1GOHA 4LQRA 2VAUA 1VBC3 3CDZB 2WQ4A 2NYYA 1RB8G 4IW3A 1BMV2 4H14A 4Q4Y2 4IUGA 1XYOA 3IPVA 1HXS1 2QQOA 2WABA 1XRUA 2J1RA 4FFGA 4QX1A 2W9XA 3AL5A 2X53S 3FHIB 3MLLA 3PVNA 5FY7A 5KXDA 3OEBA 2Y26A 4YM3A 3KV9A 4OI0A 3EB7A 4FPGA 3LSEA 1PNGA 1F35A 5A6YA 2YUEA 5GLZA 1V6KA 2WIIB 1B35C 5FUIA 3VZMA 2WNUB 4AGGA 2A75A 2DFCA 2WQ8A 1I9RA 3GDBA 4WVVA 3EXUA 5A7PA 1LGCA 2ZKNA 3VDCA 2XJVA 5DZEA 1PIV3 5K4LA 5C8CB 1IS5A 1CAUB 2EIEA 2ZGOA 4AI2A 1OMIA 4NAMA 1LJ7A 2R49A 2WN2A 3UJOA 5B2GB 1ZZ8A 2WC2A 3RJRA 3BCWA 1YFUA 1DBNA 3ACGA 1R093 1EAH2 1AX2A 2Y6KA 2OA2A 3KV4A 3OUJA 2GP5A 4QT6A 1COV1 1REEA 2ZHKA 2JB8A 1LOFC 3M8LA 3LZZA 4FI9A 4MYEA 3ZPOA 4UW6A 2AEYA 5C3SA 1VJ2A 4Q2FA 2DCTA 3HT1A 2VZOA 1D4VB 3SKJE 1W9YA 4Q4X2 2B5HA 2JIJA 2PLV2 4JTOA 4QKBA 4JKMA 2XDVA 3CLPA 3IT8A 2K46A 1I3HA 4XJWA 3M3OA 3ZYHA 1O4ZA 2D43A 4BQWA 4CTEA 1DU3D 3O12A 3SLIA 3T08A 2DUQA 3O1OA 3O1PA 4YRDA 4QGNA 3IBMA 2GNDA 2XG3A 4XJZA 4XQDA 2OYZA 4NAOA 2BBVA 2A6VA 2W1SA 5C8CC 1YQ5A 5JSPA 3WQ1A 2P34A 5FQ0B 2HYKA 3L9JT 1R1ZA 2VOTA 4BE3A 1YEWA 5K9YA 2MEV1 3UNPA 1AR63 4G3YC 3LEMA 4N90A 4X6RB 1SFNA 2J1AA 1G9CA 4CP9A 5DAPA 4OYUA 4ZZ8A 3D8CA 4F83A 5JXGA 2WSVA 3BODA 3TNQA 1UXXX 4LTAA 2J1TA 5EJZB 1QF3A 2XQRA 1WMFA 5FZ7A 2YC0A 2BNMA 5FYMA 2PHDA 4JGZA 1LR5A 1UKRA 1CD3G 4QHBA 4E2GA 1ND2C 2XJPA 4M3CF 3LGRA 3ZN6A 4BOWA 1UF2C 2W08A 3DPRA 3IPVB 3VB9A 1VBC1 1YO8A 2VNVA 4Q0SA 2WFF3 4PBOA 5FWEA 4XXPA 3ETPA 4D94A 1GV9A 1LESA 3ZO0B 4FPCA 4W8JA 2VOVA 2C1FA 5IJRA 3HT2A 4A4AA 1OF3A 4QGMA 4QQOA 1WGPA 2UWBA 3LSDA 3D6EA 4Y5TA 2DURA 4BK5A 3AP9A 3AJZA 2WO2A 1IHMA 1TNFA 4U2AA 3WXPA 2NZ9A 5A3TA 5A7NA 3KD4A 1W90A 4XURA 1DCSA 1WD3A 2OX0A 4UT5A 5K0UA 4EN8B 5JI9A 2YDEA 4A7YA 1LHOA 3OBAA 5H9PA 3FFQA 3MPPG 5A1AA 1Z78A 4QXBA 3JU9A 3ROUA 2ZGTA 4E2SA 1DGRN 3ZFFA 2FCVA 3AKSA 3INAA 2AYHA 2BZDA 2ZZJA 4L0PA 4AFCA 4YARA 1R091 3LDBA 4WM7C 4N8MA 2RV9A 1W3XA 2NM1A 2YU1A 3HNBM 1AR91 4P9WA 1SLLA 2MPFA 3CL1A 1C1LA 5FZIA 1H0BA 1BEV3 4UF0A 4D0QA 3E5UA 3ZPYA 5IFTA 1GOGA 2RJKA 4QX8A 2ORZA 3ILNA 1IKPA 4P9YA 4QB1A 2ZMNA 1OUSA 4FFIA 1VRH2 1NCQA 5ACA3 2ETEA 1W99A 3B00A 5DAVA 4YLZA 4BM8A 4KWLA 3DL3A 4IEYA 4XQ4A 3T30A 4CP9B 4A41A 4COZA 1DIWA 1HLCA 1R1A3 3WHTA 4DY5A 5AVPA 4H2AA 2BBAA 2PHFA 4HK9A 4KWUA 1MZ5A 2GU9A 3M3QA 4FPOB 2WS93 5DAWA 2ZAAA 4FTEA 5LATA 1D0GA 1IPSA 1POV1 3ZN6B 4MV2A 5FFOC 1ZBE2 3DPRB 5APAA 2CY6A 1ZREA 1NQJA 3HN1A 3URFA 1GZTA 1S1AA 4LO8A 2WDBA 3DYOA 3WDWA 5A7SA 2ET1A 5C5TA 3O1VA 1CQ9A 5BXXA 4NVPA 3N7JA 2Q5TA 4YGBA 1WWYA 4IEOA 3D0SA 2VGDA 3ZDSA 5CNAA 2JDMA 2PAEA 3WX5A 2XR4A 4YW7A 3FX3A 3JZVA 5JMCA 2ZACA 1UU6A 2EXKA 3KCYA 4LBJA 4NR1A 4YZ5A 1RUE2 4ZKTB 5FZMA 1CIYA 1VBB3 2Y6HA 2FCTA 2Z79A 2JE9A 3BOWA 1S0DA 1GMMA 5K0UB 1RVF1 2DBIA 2G1MA 4PQ9A 3HQUA 2W1WA 5FZFA 2JDZA 4NWWA 1K12A 2Z69A 1J58A 1UMHA 1UZWA 1F5FA 2H0BA 2RMU3 3WG2A 4AI8A 1UQXA 1QH6A 2K2SA 4U36A 5A1FA 2PQQA 2GDFA 5FPUA 5FO8B 3ZFFB 4JGZC 4ZS2A 5FY8A 4N7UA 2QQIA 2WZPP 4Q0UA 1AYN3 1A3KA 3MZHA 3OGRA 1UU4A 1JZ4A 2QQNA 1DP0A 1PO21 2VZVA 2WAAA 3WNNA 2CTVA 1N1VA 4J6GA 5JPNB 4V1PA 5FCCA 3NL1A 3FLRA 1HW5A 2HWB2 4MGKE 4N43C 3IIIA 4IGPA 4Q4W2 4UF0B 4UI9L 1C8NA 4AVCA 2XGXA 2YBSA 1V6MA 3A21A 3D5OA 2R062 4O61A 4Y5Z0 2VNRA 2VMIA 1JTZX 2NMOA 1QJU2 1REDA 3KV5A 1DYOA 3DUIA 1NCQB 1K42A 3G7DA 4XUOA 4IV3C 5FZ4A 1WW4A 5FMOS 4P14A 1B35A 1TME1 2JDAA 3UJQA 3AM2A 4HZFA 3NKTA 1OT5A 4FAHA 5JR2A 4F3JA 2B42B 1Q8PA 4CDXA 4Q4Y1 3PNAA 1Q3EA 2A3YA 1P8JA 4XEZA 1PX3A 2G9FA 1RUG2 3AB0A 1HRV3 1H2LA 1HN1A 2BGPA 5DZGA 2ADDA 5EIYB 2AEZA 2RG4A 3S0MA 1AL21 3EJKA 5IK4A 2DFBA 3BPSA 4X8NA 5BNNA 2OPKA 2ZPXA 1JU4A 2JECA 2WS91 5EJ3A 4GB33 5LK7B 3RZGA 5KHKA 4E8DA 3ZR5A 4EN7B 2HWE1 2I45A 5J48A 4URAA 3KB5A 1H4GA 2JX9A 3MFCA 5T50A 4ZXEA 4AI0A 5FV3A 1MZEA 1LULA 4BA6A 1XQNA 4XYXA 5CFDC 3IAPA 4GA9A 3LAGA 4YVWA 4QU1A 4UW4A 4BCUA 2IUWA 1GNZA 1QXPA 2A70A 3OGGA 2ZHLA 1GSLA 4Q4V3 1F8VA 5FXXA 3B7MA 4TTGA 3RYRA 3CZUA 2VMCA 2E9QA 3T0DA 1ZA7A 5FPBA 1WLTA 1YQ8A 3ZSKA 1S0EA 2RS52 2XJQA 1LENA 1DQ4A 3UKNA 2OQ7A 1S0FA 3KSCA 4XE9A 3LD8A 2FDGA 5D8AC 2RDNA 2ZGPA 4OHWA 3OGSA 2W92A 3KCCA 2CU5A 2KR2A 4W6WA 2WNOA 5T55A 4Q4X1 1ULOA 4OVEA 2V5DA 3VBUC 3HQXA 4JRAA 4MGSA 1WMXA 3VD4A 4DIQA 2BQPA 1UWWA 1OA4A 3HWJA 3LF7A 3MW3A 4XFCA 4AEDC 5JOXA 3K3NA 4WZCA 5FYZA 4NHLA 3RZKA 2R6QA 2DUOA 2OZ6A 5AVAA 4JC1A 4XMAA 1CJDA 1WCDJ 5FYVA 4PI0A 3VBRA 3J26N 3A4UA 2BJSA 5ABJC 5FR3A 5GJ6A 3W5MA 4EE2A 1X82A 2XJRA 3APBA 4COWA 4XPVA 3GCWA 3VHPA 1QOOA 1Q8VA 2JXAA 1FXZA 3HN3A 2HWD3 3K51A 5SV5A 1B35B 1PMIA 3N36A 1TE1B 2PHLA 3C7OA 4WV8A 2J1UA 2Y6LA 3TRSB 2FMDA 4AW7A 4QKNA 3UKTA 4CDXB 1DZQA 3NO8A 3MHZA 5F7UA 3AVRA 3LPFA 1F4HA 4HVRA 5ANNA 5FPLA 4KGGA 4AFDA 1IPJA 1DHKB 4ZONA 4CA9A 3JB8A 5J36A 4HN1A 3B9IA 2ZTNA 5BNNB 1PGL2 4YFZA 3SH4A 3ZYFA 2O8QA 1PGW1 4RL7A 1LU1A 5FP3A 1ULFA 1AYM2 1EV13 3I54A 1HRI1 4GB31 4QPWA 3PUHA 3GZTB 2C0ZA 3ZYRA 1V00A 5FY0A 4URTA 5IVYA 3WINE 5H9QA 2P17A 3NV4A 1BVVA 2UYAA 3N9LA 1VPHA 4I01A 4YVWB 3ST7A 4BQ5A 4CEWC 1H1IA 5A7QA 3TEYA 1UMZA 4UFJA 1VIWB 4A7KA 1DF0A 1NCRC 2QDRA 3M7AA 3OJBA 5FZAA 1WCKA 2IXLA 1G9BA 4EV0A 3UV9A 3RZLA 4CDQC 5CKQA 3GZUC 4P5HA 1RUI2 1BXHA 1RJ8A 5IW0A 4ASLA 2IWGB 3RYPA 3D3AA 1BBT2 4LO6B 4TWTA 3GJBA 4P9LA 3WG1A 1LOBA 2GC1A 5FZHA 1DLLA 1HX6A 4S2GA 1OSGA 4XDPA 4IEUA 3CBNA 3Q8AA 3KVBA 1VBE3 1VRH1 3DECA 3RZHA 1YYNA 3BU7A 4LK6A 2BRTA 1B09A 1JZ2A 1BK0A 4W6XA 1CAWA 1YNAA 4GQ7A 5JUVA 1W8UA 2P5BA 4AXOA 4R4ZA 1HKDA 3N4MA 1W2TA 3B69A 4ZU7A 1AHSA 2ZXQA 5FP7A 4MHUA 2JDPA 3U07A 1IG3A 1MZ6A 5I8YA 2Q1MA 1RUH2 2GMEA 4IQPA 2W5FA 2YC2A 1F15A 3I49A 2FDKA 1FX5A 3NJXA 1JN2P 2QFEA 3VBSC 1ZBE1 2HWC3 4UXAA 2XJUA 2CWSA 2J42A 5KC5A 2JENA 4BLJA 3ORJA 5KHHA 5LBCA 3W9AA 1U5YA 1U5XA 1QWRA 2LRPA 4A44A 4UOJA 4NMIA 4FOYA 3GHNA 4ES9A 3ZYJB 5I93A 3IMNA 3GNEA 3N9NA 4AI9A 2RDQA 5I8SA 2W2IA 3RRDA 1WA6X 4CXWA 1KGYA 5F3EA 4WM7B 4NWVA 5HCBA 1NE4A 4LEJA 2CAUA 3GZAA 3W59A 4Y1UA 1XE0A 4GWJA 1TEIA 4N43A 3H1YA 5C9AA 1QJX3 4P02B 1COV2 3ZX7A 1QQP3 5C5UA 3RPQA 3PTRB 4M0HA 1W6PA 4P9GA 5HCFA 1Y3TA 5C8WA 1LHNA 3POSA 1D2QA 3N7MA 1BYHA 4IGQA 1RUD2 4PHZA 1HV0A 2JICA 5I0DA 3MLJA 4HL0A 2E31A 4K8RB 1RMU2 4YPJA 1GKBA 1NLRA 2GZWA 1C1FA 3JBG3 3BIWE 3J8F2 3THTA 3VD7A 2WZEA 2AR6A 5FOBB 2PFWA 4NOTA 4I0AA 2R061 4HETA 1HB4A 1QJU1 3J7HA 2Y6GA 4CPBA 1V9U3 3PLQA 2XL7A 5DUXA 1MVEA 5F3IA 1X7NA 3WUDA 1JH5A 1ZRRA 2BTVC 1CAWB 4R4XA 5IK5A 1PK6C 4LBNA 1HQWA 5BPXA 4HLTA 3FBMA 2K0GA 4LO4B 2GMMA 4IV1C 4KWJA 1W28A 1OD3A 3VBHA 3VD9A 4CPBD 1O6UA 1ASJ1 1XC6A 3HNMA 4CSWA 1NLSA 1VBC2 4LKEA 5CFDA 2A3WA 2JJ6A 1WLDA 3AKQA 3LEGA 4YYOA 4AVTA 4IE6A 4L92A 1JUIA 2WWJA 4DRVA 4FFHA 1EYBA 1XB9A 2ZHNA 2QQWA 5C3PA 1ENSA 5LBFA 3JD71 3W21A 4DNYA 3IN9A 1J83A 1W6QA 3QCWA 4FPEA 3VDDA 2IVJA 5FREA 4C1WA 3R4UA 1ZZ9A 4LITA 2WSUA 2VE1A 5FYTA 3AKPA 3ZYPA 1OD5A 4K8FA 1D4M3 5FYSA 2ID4A 3E1F1 3N9QA 3VBUA 3ZXFA 1O4YA 3F95A 4Q8LA 1QNYA 5FAXA 5HXVA 3T2PA 1SLTA 1SFPA 2V09A 3H0OA 3I2JA 2QQUA 4LA3A 4EZHA 1YLLA 5LEJA 1GWMA 1PX4A 2W46A 3HBZA 4HSJA 3AJYA 3Q9OA 5IVCA 2RS51 3T1LA 3BYWA 1WW6A 5FZ9A 4IGOA 4N43B 5C9AB 4PJYA 1QXJA 4ZHNA 3Q8CA 4I0BA 4CDWC 1S2BA 4NN0A 5J1XA 5ABJA 2JG9C 1W6PB 2AENA 3ATGA 5J98B 1R092 3O0WA 4I0WB 4XF9A 4AHZA 2L9LA 2ZKLA 3M4FA 3N9OA 3MIDA 2XBO3 4SBVA 5I0UA 2ZGQA 4CXXA 1IKQA 1WCSA 1GU3A 5J37A 1VLNA 1RUC3 2UY8A 4MH0E 3WD5A 4NROA 5CKNA 4NPRA 1X50A 2YY1A 1OFNA 2VXJA 4LBLA 1JS9A 1S4CA 1VBA3 1W04A 3I8TA 4RQPC 3K77A 1IS4A 3JBG1 3WY6A 3PL0A 1XOYA 2ZEXA 2FDIA 4RHV1 5FMCA 1OVSA 4UBHA 5FZOA 4FTBA 4F8AA 5AC93 4XETA 1UY2A 3AZXA 2R1BA 5F5CA 2EALA 4OI4A 1KITA 5CIRA 1MS5A 3PUSA 2X09A 1TMF3 3FL7A 3M3EA 4LORA 4OZOA 4QQLA 2RDSA 4RFRB 3K46A 4XBLA 1AR62 4OQ8A 3WW3A 3RI8A 1GNYA 3HNYM 5FYBA 4R9DA 1FPN3 2V4VA 4IE7A 5G05L 5JIAA 1RL3A 1D2SA 4AHXA 3VBHB 4MGYE 2KM2A 1NQDA 4PF1A 5CFDB 4CEWA 4OUEA 1OKOA 5J96B 3U78A 4JX0A 2ARXA 1PGL1 1W0NA 2NPIA 4DEQA 2ZGNA 1AYM1 2WO1A 4N53A 3M3CA 1W6QB 4XDOA 5BUVA 2FMYA 1G7YA 5D8AB 5F5QA 3VDDB 2VTXA 4IL7A 2PXJA 2Q8OA 3FFZA 5F6LB 4A7ZA 1C4RA 4NRMA 1H8TC 4A3XA 4CCMA 1LAJA 3VBUB 2IZWA 4L97A 5DXDA 2ZABA 2D6PA 3POIA 4AEJA 1MQTC 1XU1A 4ZPIA 1D4M1 2ZX3A 4M4RA 5IATA 2EAAA 1JZ8A 1YI7A 2HKXA 1DZTA 5LEKA 1Q56A 4FBFA 3E6CC 2RS33 4XUTA 2HH9A 1IOAA 1E5RA 1AZDA 2TNFA 3OUHA 4GH4C 5CFCA 3AZVA 1CPNA 5ABJB 3ON7A 3FWEA 4PCRA 4MLOA 3OPWA 3P1IA 3EQEA 3OGJA 2ZOEB 1PO22 3E97A 3A23A 3KGLA 1BBT1 3AVSA 3S30A 4CDUA 2Q8DA 2EXJA 3RMXA 2PELA 5FYYA 3WV6A 4H7MA 4IEPA 2BV4A 2DTYA 5CADA 3AYAA 3T4VA 1QOTA 1ZBA1 3QBQA 4IEZA 1UW8A 2D5HA 1BEV2 1TZOA 3AFGA 4RR3A 3VBSA 5JOZA 5E8AA 5L7OA 3WDXA 4C91A 5BNOC 5FZOB 4YW4A 2G4IA 4BQ2A 1DZRA 1JU3A 4YM2A 2Q0AA 2XVLA 3BGAA 1J3QA 4XTPA 1UXZA 4AFMA 3MW2A 5KC6A 1W2OA 4GIQA 5ACA2 2VVEA 4AYUA 5K8SA 2UWAA 5JMOA 4GALA 1RUH1 4OCTA 2RM23 2QUOA 1TMF1 4HVOA 1JOPA 5JXJA 1PVC3 1R1A2 2VOWA 3VBFA 3W5NA 1AL22 1UU5A 1WKYA 4L99A 5FKBA 2ZBJA 2CSGA 4HMZA 4QQHA 2DUPA 3J4UH 4XJUA 2WS92 4B29A 2CL2A 4XDQA 3R6SA 4CEWB 1Q43A 2VVFA 2XHNA 4DXZA 2PHRA 2HWE2 1NZIA 1ZZ6A 1UKGA 2HBTA 3BPZA 2RS13 3H8RA 3MGUA 5DQ0A 2OQ6A 4CUCA 3WG3A 3WF4A 3WUCA 2Z4FA 5A3WA 2Y33A 2ZCWA 3QLQA 1R64A 4N53B 2NMNA 5F32A 3H1WA 4Q29A 4L9BA 1CPMA 4NPMA 1C5IA 4NO4A 4CDQB 4W65A 4LHNA 4MGZE 5D1IA 2Y8KA 2A71A 1C3HA 2BGCA 1CIWA 4OFGA 4EWAA 3LDKA 1DGLA 1AVBA 2A7AA 2IFWA 3I2DA 1VBB2 5EWSA 2R073 3ZYGA 5BY5A 1WLWA 2ES3A 1D7PM 2DVDA 5IFPA 4GULA 4LKSA 3ENRA 3JQWA 3N7LA 3OG2A 4HT1T 2JG8C 4LBQA 3GJAA 1RUD1 2VO5A 4I02A 3ZXGA 1S2KA 4COVA 1RXGA 5CFCB 1STMA 2BU9A 1VMJA 2RMU2 3OPTA 2NP0A 2QJVA 3MO4A 4DQAA 1RMU1 3NAPC 4E2QA 3P5BA 1RXFA 3WOGA 2UY9A 3MBWA 2JWPA 3J8F1 1PMJX 3VKOA 2W91A 3O1MA 2HLEA 4CYDA 1DGWA 1AYN2 1OC1A 1W8ZA 1CAXA 4CDUB 2WR9A 1EPWA 1ENXA 5J09A 4LBQD 2CGPA 1OOPA 5JZGC 5LCWL 5IVBA 4J1XA 4Q0PA 5EFUA 2VR4A 4RR3B 3VBSB 4B1LA 3IAQA 5L7OB 2VJXA 1Y9MA 4META 5FPXA 1WBFA 4E9KA 3FHAA 4AVBA 3SISA 1WA4A 4FFFA 1F2NA 4JRLA 1NXMA 3FUOA 2QVSB 1F9KA 1XNTA 2UWCA 4D8MA 1YC61 1K5MC 3T0BA 3ZFEC 2E7TA 3I3BA 1O4TA 1LGNA 1E5SA 2G9ZA 1Z7S3 4QPGC 3OF1A 3VBFB 2R16A 4YM0A 4XUPA 1DG6A 2P6HA 2QZ2A 4HKOA 3WW1A 1UMIA 4AQTA 4XIOA 4XZPA 1PGW2 1VAMA 4CDWA 4E4DX 3RZZA 5CA6A 2YFUA 2JG9A 4GWNA 5BV6A 3KVAA 4KG0A 2QQLA 1HRI2 4GB32 2D6OX 1U5IA 3ZXEA 2R043 3I97A 4RN5A 1ZZCA 4AL9A 4QB2A 2EIGA 5LY1A 1V6IA 3K4DA 1BLZA 4RGGA 4AF9A 2OT7A 5GM0A 1PIV1 4OMDA 4S2FA 2P37A 3NWKA 1OLQA 3ZYBA 4WVMA 1T2XA 3H8OA 4YZ4A 1XYNA 5FZEA 1QJZA 2PHXA 5D21A 5JXHA 4I30A 5CVRA 4RQPA 4D3WA 5A3PA 2ET7A 5IVVA 4Q4V2 4MGIE 4AWDA 2BYVE 3WSOA 5FKCA 3E6DA 4HXCA 3UL2A 4B1MA 5EYXA 4LBQB 3RI9A 1QJY3 2AUYA 4XQWA 2JDUA 1PVXA 2PTMA 4DO0A 4XTMA 2VECA 3WCSA 4CRQA 1G86A 3MYXA 5A3NA 5K7PA 1ENQA 1YQCA 4IESA 1VP6A 4Z1VA 1CZVA 2DCJA 1NLQA 4ONUA 1NY72 2WBKA 3RJ2X 3VZOA 4CU6A 4EN6B 5T5JA 1VBD3 1DGRA 1CAXB 2VW1A 1RUF3 3SCFA 1HN0A 2ENRA 4LO7A 4B7KA 1NOVA 3H8XA 1OOPB 1T6GC 1CX4A 4QKFA 4EYUA 3V0BA 3HVDA 4R9CA 3S5QA 1UY4A 4QQPA 2CHHA 1OLMA 1AR61 3WDVA 3NNGA 1YCIA 3H3LA 2VUCA 3C7FA 1AXKA 2BDRA 2P6CA 1UNBA 4HPKA 1OURA 3J7NA 3AZZA 2WT1A 2XL9A 5CU1A 4KNCA 1KRIA 2HWD2 3BIEA 4XFGA 2JKXA 1H8TA 2ZHMA 3LOIA 3TOJA 3A7QA 5LASA 1ZZBA 4KQ7A 1SACA 4L11A 5FPVA 2WFF1 5FP8A 3TEZA 3O1RA 1LCLA 1R083 2BW8A 5H9RA 5T5PA 4GH4A 3ZSMA 1A8MA 2P1BA 4CDWB 2HYXA 4LA2A 2XPJA 2JG9B 3ZLIA 2JKBA 4EN9B 1ZNPA 2WLQA 3D0JA 2D3RA 4Y4YA 1MR5A 2WO7A 2IC1A 2GNBA 4NPLA 1V6LA 4MUVA 4JQRA 3MUY1 4LR4A 3H50A 3ACFA 4HKLA 4WVMB 5FUPA 4JCKA 1W9WA 4RQPB 5FMBA 2YGLA 2WNVC 1OF4A 4Y26A 1LOCA 1QEXA 1YIFA 2BFUS 2W1UA 4NE9A 5JI7A 4MVTA 5KR7A 4OHZA 1SLCA 1EAH3 2F4LA 1RGSA 2Y0OA 5J3UA 2J1VA 1S0CA 1US2A 2QBXA 4LPLA 4XMIA 4BMBA 4YW5A 4BLIA 3SMHA 1ST8A 3ILFA 3THPA 4LE3A 1Z0HA 5I0SA 1PZ9A 1BEV1 3NKGA 4Y20A 3S6PA 5CB7A 2JB4A 2W47A 4BH9A 2YHJA 5C6CA 1UD1A 3BB6A 3LFIA 3USUB 2VOKA 5IYYA 1VBE2 3V0BB 2VMFA 3CNAA 2VVDA 3M3IA 3S57A 2W87A 2PQSA 4FPYA 3WW2A 2NQYA 5ACA1 2IXKA 1NKGA 4LBOA 1UY0A 4XIKA 1PM4A 5GLUA 2W52A 2B46X 1K45A 1FMD3 4HPKB 2DU0A 4KG8A 4YG3A 1ASJ2 1FOD3 4H3WA 1MEC3 1R1A1 2EIDA 4SLIA 2X05A 5F5IA 4D7TA 3OD4A 4Y1YA 5A7OA 2JD9A 3LA2A 4QDRA 1JW6A 1H8TB 1J3PA 2Q1FA 4P00B 4OI1A 4PBPA 2Q1ZB 5FIXA 5L73A 1DYPA 1MQTB 5ISLA 5IHRA 3JD72 2FQPA 2OPWA 1LOFA 3BVCA 2A1XA 3R4DB 5JR7B 4LHKA 5GLWA 2QQPA 2E26A 3SEPA 3I2GA 3V56A 1MS0A 3FMGA 4GH4B 4MXWA 4Y5SA 1AR83 5IVEA 4BDVB 2VZ1A 2VZ3A 4Q8KA 3ZN4A 3NAPA 3B5LB 3AKTA 4B4PA 5DZFA 3ETQA 4NHXA 1NE6A 4XBNA 3HPNA 3AKRA 2YU2A 4KBZA 1VBB1 2AREA 3J9SA 4LIVA 1I5PA 3QOPA 3H42B 1HJFA 3ACIA 3THCA 1E5IA 3I2OA 3AP6A 3U4XA 4JKLA 2WZ8A 3SCGA 2D6MA 4A3ZA 4COYA 2CYFA 2B4KA 1QJX2 1QHDA 4F7ZA 5BNOB 1W8WA 1WZXA 2RMU1 2V4AA 4OHXA 3VBOC 4B7EA 4XABA 3B01A 2LS6A 3PU3A 4KL1A 4QPIC 4C0BA 5EHDA 1AYN1 4HN0A 1ND2A 4W6YA 5FZ8A 3IDEA 4FP2A 1OUXA 4M3CB 1U12A 2YGMA 1O3RA 3JBG2 3N3HA 4RHV2 1GP4A 4Y20B 3KQ4B 1BQPA 2KXLA 3P3PA 2WN3A 4W4ZA 2YFZA 2ZEZA 4QXHA 1ZZ7A 1ULGA 3I4IA 4PLMA 1ACCA 2VMHA 1ENRA 4BU2A 1OBNA 3U75A 4AG4A 1RUJ3 1V9U2 1NT0A 5FLJA 3GBWA 3O1SA 1CGPA 1F5JA 4O65A 3WR0A 1LHUA 1UZVA 2YBPA 1I6XA 2ZGLA 3NQHA 1VRBA 5E88A 3ZSJA 5DUUA 5HI0A 3ZXJA 3R05A 3T2QA 5KHJA 1ULDA
chains in the Genus database with same CATH topology
2BP6A 5A3OA 1W8HA 5HCHA 2VNVA 2JDNA 1OVSA 2JDMA 2XR4A 1OUXA 4AOCA 2WR9A 2CHHA 3DCQA 2JDPA 2VUDA 2VUCA 2JDHA 4CE8A 1W8FA 5A70A 2JDUA 2BV4A 1OURA 3ZDVA 5A6QA 5A6YA 2JDKA 2JDYA 5D2AA 4UT5A 1UZVA 2BOIA 1UQXA 1GZTA 5A6XA 5A6ZA 1OUSA 2WRAA 1OVPA 2BOJA 1OXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BP6 A;  5A3O A;  1W8H A;  5HCH A;  2VNV A;  2JDN A;  1OVS A;  2JDM A;  2XR4 A;  1OUX A;  4AOC A;  2WR9 A;  2CHH A;  3DCQ A;  2JDP A;  2VUD A;  2VUC A;  2JDH A;  4CE8 A;  1W8F A;  5A70 A;  2JDU A;  2BV4 A;  1OUR A;  3ZDV A;  5A6Q A;  5A6Y A;  2JDK A;  2JDY A;  5D2A A;  4UT5 A;  1UZV A;  2BOI A;  1UQX A;  1GZT A;  5A6X A;  5A6Z A;  1OUS A;  2WRA A;  1OVP A;  2BOJ A;  1OXC A; 
#chains in the Genus database with same CATH topology
 1PZ7 A;  1BVP 1;  4GMP 0;  1N1S A;  4Z82 A;  3IWZ A;  5DN2 A;  1ULC A;  2AZ5 A;  3UGF A;  1WCU A;  1QDO A;  4QHZ A;  5FXW A;  5GZC A;  2VZT A;  4TYS A;  1HRV 1;  1GFF 2;  2C5D A;  3MIG A;  4RS5 C;  5HPO A;  2EF6 A;  3AMN A;  5C33 A;  5JPM B;  4MHR A;  5FXZ A;  1JXN A;  2Q30 A;  5EXO A;  3BTA A;  3VDB A;  4E27 A;  4CCE A;  3SHR A;  4WM7 A;  4CVU A;  2VPV A;  2VUL A;  1CJP A;  1UYX A;  4XF1 A;  2WZR 3;  4R9B A;  1X9T A;  2WWU A;  2XON A;  5B4X A;  3WNM A;  3PJY A;  4MXW B;  3RDI A;  3WQB A;  1GIC A;  4Y24 A;  3B94 A;  5BNP C;  1KJL A;  1SBF A;  3KCX A;  3NAP B;  4GJZ A;  1D4M 2;  2DCY A;  3JXS A;  4LE4 A;  3AP4 A;  4YM1 A;  1OFS A;  3PUA A;  1Q5O A;  1X9P A;  5KXB A;  4UFH A;  5HCA A;  1DQ1 A;  3OY8 A;  2JDN A;  3V0A A;  2WYF A;  2YV8 A;  2OVU A;  1FNY A;  5JLV A;  4Q4V 1;  2F4P A;  2BWC A;  1BK1 A;  3HD8 B;  1FT9 A;  1LRH A;  2C26 A;  3I7D A;  5GZE A;  1YRZ A;  3TN9 3;  1W03 A;  1GZC A;  3AZY A;  1UPS A;  2DDU A;  4A42 A;  1RHI 3;  2YPJ A;  1LOD A;  1BKZ A;  1YHF A;  4L2N A;  1VMF A;  5EZW A;  2YC4 A;  3FN9 A;  3G6J B;  4FQZ A;  3M70 A;  3WF2 A;  2VXR A;  2IFR A;  3NNL A;  5FPA A;  2WUH A;  4K7J A;  1CN1 A;  3NJZ A;  2O1Q A;  3LCP A;  4JV4 A;  2XBO 2;  1I5Z A;  4BIO A;  4IXL A;  5HV4 A;  4FXK B;  3WDT A;  1A8D A;  4ES8 A;  1NY7 1;  4CEY C;  3MIH A;  1ZBA 2;  1A78 A;  3CHX A;  1ND2 B;  2XH6 A;  4RSU A;  2D6L X;  1LOA A;  1J1L A;  2X10 A;  1C8M 3;  5HV0 A;  1VB4 A;  5DG1 A;  2ZMK A;  5DDJ 3;  1VBA 2;  3ZOI A;  2GC0 A;  5JOY A;  2EIB A;  1Y9G A;  2PAM A;  3ECQ A;  1JZ7 A;  4XAE A;  3OUI A;  3WNL A;  1ZRI A;  3C2U A;  5AC9 2;  3GXU A;  1OKQ A;  5CZK A;  1PMH X;  1W6M A;  1EUT A;  3ZKY A;  5JIU A;  2VUD A;  1TQ5 A;  2D44 A;  2Z42 A;  1K5J A;  3OBT A;  1ZRD A;  2HWD 1;  1TMF 2;  1S0J A;  3LPG A;  2GNM A;  1OHF A;  5LRS A;  3W20 A;  1US3 A;  1W0P A;  1FPN 2;  3AXD A;  1DQ5 A;  2V73 A;  3HEI A;  4LOS A;  4EWE A;  4FPK A;  4AVV A;  1NX9 A;  1O8P A;  2BOJ A;  2GH8 A;  1QOS A;  1WMD A;  2PHT A;  1DYK A;  4Y3O A;  1RUG 3;  5JCT A;  2XKO A;  4QPY A;  4DXR A;  4ISR A;  3ZIW A;  4YW3 A;  4MOA A;  4AI3 A;  2SBA A;  3S7E A;  2QKD A;  3VHN A;  2V5Y A;  3NNJ A;  2ZX1 A;  3I2K A;  2E51 A;  4JKK A;  3C8X A;  1POQ A;  4A6O A;  3UES A;  1EV1 1;  1Y43 B;  4LMF A;  5SV8 A;  2ZGS A;  1CZT A;  1GNH A;  1YXW A;  4XBQ A;  3RZJ A;  2FCU A;  2UYB A;  3ZYI B;  5A7W A;  1HQL A;  2GAL A;  1ONA A;  3CJI C;  3PJQ A;  2D93 A;  2Y6J A;  3T0A A;  3WNK A;  2O14 A;  1AXZ A;  2WWS A;  3ZMO A;  4D6Q A;  1Q8Q A;  5F37 A;  3GZE A;  3KV6 A;  4GKY A;  1PO1 3;  3USS A;  2HWF 3;  3OY8 B;  4NIA A;  1V0A A;  3H3U A;  4CCL A;  3MIF A;  5T5O A;  3V0A B;  5AFB A;  4YVS C;  5LA0 A;  1OI6 A;  3EO6 A;  2RS3 2;  3C3V A;  4IV3 A;  5GAL A;  2LTN A;  3ZM8 A;  4ZZ5 A;  4G9S B;  3AX4 A;  1UN1 A;  3DKW A;  1RYY A;  4XW3 A;  3NJY A;  4K1Y A;  5BYN A;  4QX3 A;  2XXZ A;  4JHZ A;  2RR1 3;  3DCQ A;  5KWR A;  2VME A;  2JDH A;  1DQ2 A;  2D3S A;  5GZG A;  3KMH A;  5LRR A;  2BNN A;  1IPK A;  3ES1 A;  4XCB A;  5A6Q A;  2PA7 A;  1YJL A;  1ZM1 A;  4PDW C;  1ZA4 A;  2VNO A;  3OCP A;  3RGB A;  5T5L A;  4FCA A;  3BI3 A;  1VBE 1;  1XNA A;  1U5Z A;  4HBN A;  2VW2 A;  3VV1 A;  4AVA A;  4ARY A;  3Q8F A;  2BPA 2;  5F3C A;  1GP6 A;  5A80 A;  2TEP A;  4MZU A;  4QD2 A;  1W6M B;  3UGH A;  2VZP A;  3VHO A;  2UU8 A;  5DPN A;  3AYC A;  1OQE A;  4N7I A;  2EVX A;  1UIJ A;  2VTX J;  4Y1V A;  3BUC A;  4MSV A;  2Y6F A;  4HON A;  4TLF A;  5FP9 A;  4GAZ A;  3TEX A;  2RM2 2;  4XAA A;  3O0X A;  5IWF A;  4V2W A;  4BYY A;  1PVC 2;  2HWC 1;  3WNX A;  4EN0 A;  1WW7 A;  1W0O A;  2TUN A;  1POV 0;  5M0T A;  5D8A A;  5F39 A;  5DG2 A;  4L8Q A;  3O0V A;  4CUG A;  2RHP A;  4OUM A;  4P5Y A;  3SNM A;  2GC2 A;  1YWK A;  2RS1 2;  4TZD A;  1AR7 3;  3KS7 A;  2AH2 A;  4YZ1 A;  1REF A;  3O7O A;  3RG0 A;  5FTT C;  1G9F A;  4YSF A;  3MLK A;  1RUO A;  1XNK A;  4AED A;  5A3U A;  1PIV 2;  1LB2 A;  1GWL A;  1ODM A;  1OA2 A;  2VTF A;  4QPI A;  3ZVX A;  5F6K A;  3SC7 X;  4CCC A;  1SQ4 A;  5A7W B;  1EY2 A;  3IDA A;  1HB2 A;  2ORX A;  1L7R A;  1F31 A;  4GWM A;  1KEX A;  1QJE A;  4FOV A;  4CP1 A;  2W39 A;  3U0Z A;  2VCM A;  1LOG A;  1QJX 1;  3N7K A;  1YFX A;  2V72 A;  1QQP 1;  2BNO A;  3KWV A;  3MV1 1;  3OPZ A;  1UY3 A;  2P3J A;  5FZ6 A;  5B4N A;  4NRQ A;  3B02 A;  3HJR A;  4FPL A;  1MS1 A;  3ITQ A;  4XHB A;  4E8C A;  1RUN A;  3DPR C;  2HWF 1;  4IV3 B;  4WM8 C;  1W6N A;  3ALQ A;  1GQG A;  3IIA A;  3OYW B;  2JD4 A;  3UET A;  3E5Q A;  1GOF A;  1V70 A;  2Y0I A;  2YB7 A;  3VHR A;  3I3M A;  3MIC A;  1H1A A;  4XFI A;  5C71 A;  1DDL A;  3THD A;  2QQM A;  3H8U A;  1VAL A;  2RR1 1;  2BVV A;  3HR9 A;  4EJR A;  3U11 A;  5IUQ A;  3FHQ A;  4RS5 A;  2ZGR A;  1JBC A;  1XSR A;  3KT4 A;  5FY5 A;  1L3J A;  5EQU A;  5K0U C;  1UO9 A;  3WP3 A;  2GH2 A;  1V9U 1;  3JB4 C;  2SLI A;  2C6S A;  4IEW A;  5BNQ A;  1A34 A;  4FTS A;  1N1T A;  4KU8 A;  1L7L A;  1UZY A;  1VMH A;  2MHF A;  3VL9 A;  4Q26 A;  3RWN A;  5L9V A;  2EIC A;  3AMP A;  1UOG A;  3NV3 A;  1O3Q A;  3POE A;  5GKA C;  3IMM A;  1ZX5 A;  1QXR A;  3OBR A;  2HBU A;  5DUW A;  2C24 A;  4BHP A;  4Z8B A;  2XHK A;  2Q8E A;  4S2H A;  5TSW A;  4CXY A;  4GMP 3;  2C9K A;  1WW5 A;  3ZSL A;  4BPZ A;  4PF5 A;  5DAX A;  2VQ0 A;  2E32 A;  1IG0 A;  3QH6 A;  5F5A A;  2WFF 2;  1NCR A;  2W3J A;  1HXS 3;  4M0N A;  2ZEW A;  1Z7S 2;  3AMH A;  3N9P A;  4OUL A;  4H7L A;  2X29 A;  2GAU A;  3GAL A;  4QX5 A;  4YGD A;  1JZ5 A;  2QCS B;  3I2H A;  2RE9 A;  1PHM A;  3NRU A;  5KXE A;  4Q0V A;  5JDB A;  4CDQ A;  1OLM E;  5JSR A;  3EMR A;  3IM0 A;  4R8H A;  1GAN A;  2W95 A;  1XNB A;  3AZW A;  3LEI A;  1F4A A;  2XVG A;  2E7Q A;  3BAL A;  4AED B;  3JUU A;  4GD4 A;  4P9I A;  2FZ2 A;  4LKD A;  2J1E A;  4LOT A;  4QPI B;  4UWD A;  1FI2 A;  1Q8S A;  3KQR A;  3KHC A;  2ZML A;  1GWK A;  4FQ4 A;  4QX7 A;  2ZZQ A;  3J7L A;  4CCD A;  4C0H A;  3NV2 A;  2VCC A;  4ATF A;  2XLF A;  1NZC A;  2DVG A;  2VM9 A;  4K1Z A;  2D98 A;  4KU7 A;  4QDS A;  3R0R A;  1SDD B;  4PLO A;  3ZXK A;  3MV0 1;  2P3I A;  4JGY C;  4BJ0 A;  4J25 A;  1XNC A;  1HV1 A;  4FPF A;  2R1D A;  1OPO A;  3R4S A;  2EXH A;  1W6N B;  2XBO 1;  5L9B A;  2FBE A;  1KDK A;  4OMC A;  3TAY A;  1DQ6 A;  2KA3 A;  4QMA A;  3WNO A;  1SBD A;  4KBB A;  3POY A;  1RUC 1;  2OII A;  2VU9 A;  5FY4 A;  3TWI A;  1FV2 A;  4S2D A;  5FY9 A;  5ANQ A;  5FXV A;  3WP6 A;  1G9D A;  2LRO A;  1YJK A;  1VBA 1;  5IAV A;  3K48 A;  5HCH A;  1RUF 2;  3DYP A;  2YZ4 A;  1SEF A;  4RS5 B;  2WAO A;  4MAD A;  1IS6 A;  3SH3 A;  1O3T A;  5AC9 1;  3GYD A;  3KT7 A;  1GQP A;  1UZ0 A;  3PMS A;  4JHT A;  4AOC A;  3WZ1 A;  4RGK A;  3WVJ A;  1XXN A;  1AUY A;  2ARB A;  4UYB A;  2MEV 3;  3CQO A;  3P3N A;  1S0I A;  2CNA A;  3ACH A;  3RVH A;  3IKW A;  3UK9 A;  4ORF A;  3M1H A;  3B3Q E;  1IS3 A;  2GP3 A;  1M06 G;  4P08 A;  2ZGK A;  5FJK A;  1FPN 1;  1W9T A;  1O5U A;  2BER A;  3SEE A;  5BNP B;  1K3I A;  2LUW A;  4XAC A;  3CJI A;  1CX1 A;  1WUV A;  1XYP A;  4UFI A;  1YI9 A;  4LK7 A;  4Z07 A;  4CCO A;  1J84 A;  4MG2 A;  1GBG A;  1NCR B;  4Y33 A;  5A3O A;  4IND A;  1LNS A;  3Q8B A;  1SFY A;  4YVS A;  1W8O A;  4B3N A;  5KHG A;  4WVW A;  1R08 2;  2IXI A;  1OPM A;  2Z2S B;  4BQ3 A;  2D5F A;  1W2N A;  2ZX4 A;  2D97 A;  4UFK A;  1TNR A;  4XFF A;  2ARA A;  4MGQ A;  2VZR A;  1KFU L;  2DTW A;  3WLU A;  3WEZ A;  3ILR A;  2YXS A;  4CEY B;  2JIG A;  5I91 A;  4K40 A;  3ZFG C;  4KH9 A;  5CG8 A;  4PDW A;  3LE0 A;  5FLH A;  3SIT A;  1XE8 A;  3AYE A;  4CDX C;  3WT3 A;  2VBD A;  5F9T A;  4IEX A;  2RS3 1;  3RZM A;  1XU2 A;  3VZL A;  4OI2 A;  1W9S A;  4V2V A;  1VB2 A;  3LOB A;  3P6B A;  1PM7 A;  1PK6 A;  3FJS A;  4QHO A;  4LO5 B;  1E5H A;  2ERF A;  2VD7 A;  1HJG A;  3LQC A;  4IV1 A;  4AI1 A;  4AEM A;  5BNN C;  3FLP A;  2WKK A;  1MZF A;  4FAG A;  1X36 A;  3HAG A;  4PQQ A;  4CCJ A;  3GCX A;  1OH3 A;  4MXV A;  3UT0 A;  2WLP A;  5FWJ A;  1AR9 3;  1QIQ A;  4Q1R A;  2PAK A;  5C4W C;  3MEP A;  1YFY A;  3FUQ A;  2VOX A;  4Z2W A;  2QZ3 A;  3AC0 A;  3V65 A;  1JYV A;  2JEM A;  2YBK A;  3BOP A;  4JDO A;  3VKL A;  3DKQ A;  5A32 A;  5L36 A;  3CEW A;  3U14 A;  5CAZ A;  5F1R A;  4Y1Z A;  4YVW C;  4DIN B;  1JHJ A;  5FMD A;  3ACL A;  2BWA A;  1H2K A;  4KGQ A;  2O8O A;  3PHM A;  2AAC A;  3FZ3 A;  3S7I A;  3JCI A;  3K75 B;  2QNK A;  4GZ9 A;  4DUX A;  3OB8 A;  2VZU A;  4ZU4 A;  2VZQ A;  4I3P A;  1VAK A;  4OZX A;  5IK8 A;  2FDH A;  2XVK A;  4BZ4 A;  4GXL A;  4LIU A;  2K9Z A;  4AEK A;  3O14 A;  1W06 A;  5EPA A;  1FMD 2;  1FV3 A;  1S2E A;  1HRV 2;  2RM2 1;  3ES4 A;  5FUN A;  1FOD 2;  3DEM A;  4TSV A;  1MEC 2;  1PVC 1;  1CON A;  1MS9 A;  4CE8 A;  2AGS A;  4XJ9 A;  4NIG A;  4GJY A;  1HIX A;  2WO3 A;  3CJI B;  4ATE A;  4E4Z A;  1JYI A;  2XUE A;  2Y64 A;  2GN7 A;  1OQD A;  1W3V A;  1W6O A;  1W9F A;  1POV 3;  2XKP A;  5GLT A;  2PN5 A;  5FP4 A;  2RS1 1;  4YVS B;  5E16 A;  4BXS V;  3KM5 A;  1LED A;  2PHU A;  2PYT A;  4WM8 A;  2DYC A;  1LU2 A;  3VBR C;  1X8E A;  2J7M A;  4QDQ A;  3D4K A;  4WZF A;  1FYU A;  3VN4 A;  4AQ2 A;  1AR8 2;  4C1X A;  2DVA A;  3MI8 A;  1LEM A;  3H7Y A;  5CKM A;  3LKJ A;  4PIZ A;  3QAC A;  3EHK A;  1KS5 A;  2B9U A;  4KI5 M;  1IQD C;  4QGL A;  3C7H A;  1AX0 A;  1XSQ A;  4IE5 A;  4FP3 A;  2R07 1;  5JWP A;  3VGI A;  1RVF 3;  2CDO A;  4PDW B;  4LNV A;  2VL4 A;  4E4S A;  5E1R A;  1XND A;  1FAT A;  2DVB A;  1SBE A;  1O8S A;  4WBB A;  3UGG A;  2OZJ A;  3WDY A;  1E57 A;  2FZ1 A;  2R0F A;  4BQY A;  3PU8 A;  4E4H A;  1PK6 B;  1UOB A;  2BEO A;  3TBD A;  1BCX A;  4KMQ A;  4A45 A;  3AMM A;  4FOQ A;  1XE7 A;  4IV1 B;  4AAP A;  2OS2 A;  3EYP A;  3KT1 A;  4Q0Q A;  4RA0 A;  1IQA A;  2ZGU A;  5DMY A;  3USU A;  1PO2 3;  2YMZ A;  1H4H A;  1KFX L;  5FJH A;  2FDJ A;  3PTY A;  1LOE A;  5A32 B;  4JAA A;  2E53 A;  4PIX A;  4Z92 B;  4OHY A;  1QGL A;  1Y7B A;  4O7X A;  4NHK A;  1GQH A;  4HFS A;  1JYX A;  4YW6 A;  5A33 A;  1C5H A;  1RUJ 2;  4ERO A;  3BKZ A;  2E33 A;  3B93 A;  1IGO A;  1UOJ A;  2WNE A;  1TME 3;  4PI2 A;  4IER A;  3VD3 A;  5HBA A;  1H30 A;  1MQT A;  1U0A A;  1NA1 C;  2VG9 A;  3GHM A;  4NRP A;  3CKH A;  5L9R A;  1OXC A;  2XML A;  4N9I A;  5FO9 B;  3PVE A;  5LBE A;  4Q4Y 3;  3H1M A;  1RTV A;  2GMP A;  1Z7S 1;  4CP0 A;  2XWB B;  3FC0 A;  2ZAH A;  4Q1P A;  2XUM A;  2A6Z A;  2R0H A;  4OUS A;  1NAE A;  5I8T A;  1NG0 A;  3KHB A;  1AL2 3;  3O5S A;  3KGZ A;  1W6O B;  4CCN A;  1RIN A;  2DV9 A;  4QX2 A;  3LB9 A;  4JGZ B;  1QY4 A;  2GNT A;  2VUA A;  4GWI A;  3RMY A;  1EV1 2;  2R7E B;  3SH5 A;  4JGY A;  4FOW A;  4AGV A;  4LUL A;  4AGR A;  3Q8E A;  2HWE 3;  3POW A;  4WM8 B;  2WZR 2;  2R04 1;  3I2I A;  2DF7 A;  3BTX A;  3V64 A;  1UZZ A;  1GLH A;  2D6N A;  5FYH A;  5CBL A;  1MPX A;  2A5Z A;  2R30 A;  3T09 A;  3RNS A;  4QM8 A;  5BNO A;  4DXT A;  1G6N A;  4ISQ A;  4YZ2 A;  3UYJ A;  1JOD A;  2B9V A;  4RD7 A;  2CWM A;  1XPW A;  4ZY9 A;  3BTY A;  4BIS A;  2LW8 A;  4CU8 A;  4XOG A;  4AAX A;  3WQ0 A;  1CVN A;  3POJ A;  4QXK A;  3TN9 2;  2UUR A;  1QJY 1;  4M3C A;  3MF6 A;  4O9G A;  1RHI 2;  2VY0 A;  3OTF A;  4RYD A;  3UKV A;  4K20 A;  4LJH A;  1JZ3 A;  2PMW B;  4LLO A;  3O1T A;  2JDY A;  3WHU A;  2OUH A;  4Q4X 3;  2PLV 3;  3GBG A;  4ZXK A;  3OBZ A;  1L7Q A;  1VAV A;  5FZ0 A;  1DLC A;  2ATF A;  2EXI A;  5CG9 A;  3VZN A;  2ZEY A;  4Y22 A;  5KBF A;  1VBD 1;  2QTW B;  1RUF 1;  3POB A;  3FLT A;  1W8H A;  1C8M 2;  1EP0 A;  3VZK A;  1OLR A;  3PIJ A;  5FZ1 A;  4AFA A;  3IDC B;  5DAQ A;  5DDJ 2;  5FZL A;  1AF9 A;  4UW3 A;  1ZRC A;  3ZN5 A;  5C9A C;  3PDQ A;  2F17 A;  2VNG A;  4JZR A;  4PT6 A;  3HBK A;  3T4H B;  2WT2 A;  2N7G A;  2VBB A;  4QB6 A;  5FY1 A;  2Y60 A;  5A33 B;  5A70 A;  1QDC A;  2LM3 A;  3L2Y A;  1RIT A;  4D6R A;  3AXE A;  5D2A A;  3I59 A;  5C3O A;  2IXH A;  1H1M A;  2HWC 2;  3PVB B;  5H9S A;  3VLB B;  4DB5 A;  2VC9 A;  4QKD A;  5FYI A;  2D40 A;  2JG8 A;  3ZFG A;  2VZS A;  5C3Q A;  1BMV 1;  1N3P A;  2DBN A;  3H9A A;  2QQJ A;  1R08 1;  1ALY A;  5LK5 A;  2BUK A;  4TLG A;  4H55 A;  5LY2 A;  3K2O A;  5F3G A;  4MX3 A;  1MAC A;  5EJ1 B;  3IZO A;  4GKX A;  4JGY B;  3T2T A;  2B45 X;  1FAY A;  2A6W A;  3AK0 A;  1JOB A;  2X5I C;  2VQU A;  4B4R A;  4YG0 A;  1HRI 3;  3I3Q A;  1TG7 A;  5JZG A;  4HAN A;  3VD5 A;  2F6B A;  4XF0 A;  5C4W A;  1UIK A;  3CO2 A;  1QQP 2;  2H6C A;  2A73 B;  4LXL A;  5E89 A;  1WME A;  1JYW A;  3VBH C;  1PO1 2;  5I0R A;  2HWF 2;  2R32 A;  3NNM A;  3VL8 A;  4R52 A;  4X6Q B;  5LB6 A;  4ET7 A;  1AJK A;  1H6Y A;  1LGB A;  2OKX A;  2P3Y A;  1VR3 A;  2HEW F;  3HIF A;  3C7G A;  1BHG A;  2NLR A;  1K5M A;  1EAH 1;  1JHN A;  1ND3 C;  1GR3 A;  1V6J A;  2O0O A;  2W1Q A;  2ZA9 A;  4LHL A;  4AK3 A;  4BK4 A;  4FSJ A;  1DGW X;  1SDW A;  1NYW A;  3WDU A;  4QPG A;  1ULE A;  2RR1 2;  3H7J A;  5F2W A;  3VDD C;  4AZZ A;  4CUA A;  3VKF C;  4ASM B;  4D7Y A;  5CYY A;  4Y22 B;  4DXS A;  1BJQ A;  1DFQ A;  2PLV 1;  2YYO A;  3I3D A;  4NUB A;  4ITC A;  4M00 A;  4B4Q A;  2HEY F;  3KF5 A;  2E6V A;  5IAX A;  1VRH 3;  3J7M A;  5T3N A;  5JAX A;  4W50 A;  1XBF A;  4BQX A;  1UAI A;  5FOJ B;  4JDN A;  1UX6 A;  3DF0 A;  5FZ3 A;  1D0H A;  4RFT 0;  4XFA A;  1FMD 1;  3LA7 A;  4DS0 A;  5C7G A;  1FOD 1;  1RIR A;  2CGO A;  1MEC 1;  4AE2 A;  4AQS A;  2WT0 A;  3MDP A;  2A3X A;  3WF3 A;  2RJL A;  5A3L A;  4FXG B;  1H8V A;  1N47 A;  3I59 B;  3OD0 A;  4NJ4 A;  1H6X A;  3FBY A;  1ZBE 3;  3ZXD A;  2JG8 B;  4JTN A;  4NHY A;  4J1W A;  2BVB A;  3ZFG B;  3TB0 A;  1WCQ A;  3CZJ A;  4MGT A;  2A6Y A;  1CWP A;  2H6B A;  2WIN B;  5LA2 A;  4CZS A;  1W05 A;  3N9M A;  1W8N A;  3A22 A;  3SCH A;  4PIY A;  1UPI A;  5A1L A;  1JMU B;  3AYD A;  2G19 A;  1AR8 1;  1SCR A;  3F2Z A;  3IDB B;  1AR7 2;  4N9H A;  3WP4 A;  2A6X A;  1JZ6 A;  1VE0 A;  1YQ6 A;  3OEA A;  1RUE 3;  2XB6 C;  4Y4R A;  4JVA A;  4FO9 A;  5JZG B;  2Y38 A;  3MW4 A;  3S5A A;  5C4W B;  3TYJ A;  4P9J A;  3WF1 A;  2H0V A;  5FK7 A;  2VH9 A;  1RJ7 A;  2CAV A;  2QQV A;  4DPN A;  4AHY A;  4DY3 A;  2Z5W A;  4UAP A;  3T2O A;  1QJF A;  4I09 A;  4JDM A;  5LA9 A;  1SG3 A;  4HSL A;  2Q8C A;  3ZXA C;  3GGL A;  2ZX2 A;  3H3Z A;  3RYK A;  2WNU C;  1W8T A;  3ELN A;  2LAL A;  1NUK A;  1RUC 2;  1K5M B;  3FE5 A;  3ZFE B;  4LT5 A;  2DU1 A;  2PHW A;  4RGA A;  5LBB A;  1AXY A;  1CAV A;  1LHW A;  1NA1 A;  2XJT A;  3AP5 A;  4N53 C;  4QPG B;  4XCA A;  4QM9 A;  4XUQ A;  2ADE A;  5FZG A;  3AL6 A;  3U4S A;  4NII A;  4CU7 A;  2HWB 3;  4YZ3 A;  4CP2 A;  5FYC A;  4OHV A;  4Q4W 3;  1HB1 A;  4QAW A;  2DVF A;  1J3R A;  2R06 3;  2XOM A;  3DN7 A;  4KWK A;  4YW1 A;  2FDF A;  4UW5 A;  1APN A;  2CGN A;  4XC9 A;  3TNP B;  3K3O A;  1QJU 3;  4FPJ A;  1HB3 A;  4K9S A;  4DRR A;  1URX A;  1W2U A;  4EZ4 A;  5A3M A;  1RUJ 1;  1SZB A;  2J1S A;  2ILM A;  2VBP A;  4OLL A;  4HOO A;  1FNZ A;  1G9A A;  3W58 A;  1IZ3 A;  5CFC C;  2XLG A;  4XFH A;  1PZ8 A;  3NV1 A;  2B8M A;  3VBR B;  1SLI A;  2GC3 A;  1UY1 A;  4BB3 A;  3K4Z A;  5E6H A;  1EUU A;  4C90 A;  2P3K A;  2WFP A;  1S55 A;  1ASJ 3;  2DCZ A;  2OW4 A;  4XF3 A;  3VKM A;  3LEK A;  3U37 A;  4A2U A;  3TEW A;  4CDU C;  4DUV A;  1M4W A;  3B9C A;  3E5X A;  1O91 A;  2WNV A;  4C8D A;  1GP5 A;  4TXW A;  1HXS 2;  1X33 A;  2WQZ C;  4FT8 A;  3D82 A;  2VMD A;  1S0B A;  1OA3 A;  1A6C A;  2NN8 A;  1GZ9 A;  3OSD A;  5JVV A;  3JD7 3;  4RR3 C;  3BN6 A;  3VDA A;  4M01 A;  5L7O C;  1S0G A;  2WZR 1;  4DMI A;  3ZR6 A;  5LWB A;  2XWJ B;  2FD8 A;  2JE7 A;  1W39 A;  5GLV A;  4AFB A;  1WLC A;  1WD4 A;  3NNF A;  4HK8 A;  4LKF A;  3RSJ A;  5A6Z A;  4UFM A;  4AR2 A;  1UOF A;  1SHW B;  1MVQ A;  1T6B X;  1UYY A;  3DGT A;  4QXC A;  4Y1X A;  5F8P A;  3CJX A;  3BTZ A;  3K4A A;  5LA1 A;  1RUE 1;  3NVC A;  3OYW A;  5FZD A;  3KZ4 C;  3SQO A;  3VBF C;  2RS5 3;  4LUK A;  4M4P A;  4YFW A;  3PUQ A;  3TN9 1;  2C4X A;  5CIS A;  5IT6 A;  1KQR A;  2W94 A;  1UL9 A;  2MNG A;  1RHI 1;  4DUW A;  3NST A;  3ZFE A;  2E7A A;  4XZU G;  2QQK A;  1KJR A;  1ULP A;  1JI6 A;  3IB3 A;  3WW4 A;  3C7E A;  3HQR A;  3WP5 A;  4Q27 A;  1QKQ A;  3NW4 A;  4MO3 M;  4O9E A;  5IK7 A;  2I07 B;  4LBK A;  2BFU L;  1C57 A;  3L2H A;  2GSY A;  3ME2 A;  1CAV B;  3A0K A;  1NA1 B;  5HXM A;  1C8M 1;  2WJS A;  2WRA A;  4YNI A;  4AHW A;  4DEV A;  3ZMN A;  5FYU A;  5DDJ 1;  3DXT A;  5FO7 B;  4XUN A;  5FLI A;  3U1X A;  1AJO A;  4RHV 3;  1UCX A;  2HWB 1;  3A0N A;  3WG4 A;  2TBV A;  4Q4W 1;  3VUO A;  5I0T A;  3CMG A;  3PUR A;  2ZS6 B;  1SLA A;  2E63 A;  4IEV A;  2YPD A;  3QD6 A;  2MEV 2;  4XVH A;  1O59 A;  3N35 A;  5FMO L;  1GUI A;  2VQT A;  2YRO A;  4K3U A;  5J7M A;  2X5I A;  1Q8O A;  1Y4W A;  2QE3 A;  2ZJC A;  3WCR A;  4QQ2 A;  4IEQ A;  4EWD A;  5LZ6 A;  2RJ2 A;  1SLB A;  5EP9 A;  1QU0 A;  1UYZ A;  4X8P A;  5A6X A;  4BXF A;  4P9X A;  4ZS3 A;  3U10 A;  4I2O A;  3VBO A;  2WNV B;  1RUG 1;  3POF A;  2EA7 A;  5LW9 A;  1OQ1 A;  1OOP C;  1QH7 A;  3MIE A;  4IDZ A;  1HQN A;  1QNW A;  2HEV F;  3GF6 A;  1SMV A;  5EYY A;  5FBJ A;  4I3G A;  1O5L A;  1LTE A;  4OQ9 A;  1O7F A;  1QMJ A;  3RQ0 A;  5KHI A;  1AYM 3;  1LEC A;  2WA4 A;  1ND3 A;  4HVQ A;  5FK8 A;  1TVG A;  3DXU A;  3CU7 A;  5JSO A;  4LBM A;  2G9G A;  2R07 2;  4D6S A;  2RVA A;  2YG0 A;  4BQ1 A;  2P4E A;  4XJA A;  1H9P A;  1PO1 1;  2FHR A;  1YUD A;  5IVF A;  4COU A;  1AL0 G;  2RDR A;  3CF6 E;  1OVP A;  4A6S A;  1C28 A;  3OGV A;  2BP6 A;  2D6K A;  2I74 A;  4B8E A;  5C3R A;  5FDB A;  1PGS A;  2VW0 A;  3PIG A;  1X8M A;  1RUI 3;  2J22 A;  4LUM A;  5EV7 A;  4CCK A;  4K21 A;  1KDM A;  4AQ6 A;  4ASK A;  1UX7 A;  1LKN A;  3DYM A;  1I1E A;  3MPB A;  1BBT 3;  1BZW A;  1N3O A;  3KF3 A;  3WNP A;  4D69 A;  3BU0 A;  1YQ2 A;  3HMY A;  1GZW A;  3CIH A;  1AR9 2;  3T3Y A;  1W2A X;  4IET A;  4R9A A;  3ASI A;  1OH4 A;  1AX1 A;  1SPP A;  1YIP A;  2OUJ A;  1ZBA 3;  4XHX A;  4LHS A;  2B7Y A;  1V6O A;  2X8K A;  5G04 L;  5FZC A;  1ZRF A;  3RWK X;  3ABZ A;  3E6B A;  2BOI A;  4HKW A;  3M2M A;  1J1T A;  1H2M A;  2CV6 A;  1G8W A;  1MS4 A;  4XJ8 A;  4JQT A;  1CR7 A;  3PUI A;  3MFA A;  3ZFF C;  5BNP A;  3SKV A;  3O1U A;  4UBG A;  1SCS A;  1JYC A;  5FZB A;  3LDR A;  3T1M A;  4NIH A;  1XJA A;  1UYP A;  1N3Q A;  2VCA A;  4ARX A;  5JXI A;  2I2S A;  3KLS A;  5L19 A;  3ZKU A;  2C9A A;  2GN3 A;  1H9W A;  2IVI B;  3GM8 A;  4XXA A;  2X5I B;  3NJV A;  1RUH 3;  3QH7 A;  4YGE A;  3WF0 A;  1KD7 A;  1KXG A;  4DFS A;  5FBZ A;  1EPZ A;  2W68 A;  2JDK A;  2Q4S A;  2Y34 A;  5IVJ A;  3RFR A;  1Y9Q A;  3VBO B;  1NCQ C;  4DOU A;  4TN7 A;  2B39 A;  5FRA A;  1CZS A;  4XFB A;  4NID A;  2R04 2;  3X29 B;  3AFK A;  5FZK A;  4BIF A;  2P2K A;  3MIB A;  4YW2 A;  1AR7 1;  4CEY A;  3NMB A;  1H2N A;  2WNU A;  4FPH A;  4YG6 A;  2IXJ A;  1MS3 A;  3HOB A;  4DZG A;  3WQ7 A;  2XJS A;  1PNF A;  1ND3 B;  3LIH A;  2WYS A;  3VKN A;  1ZVF A;  2D7F A;  4QX0 A;  5ERL A;  3PVO A;  5GZD A;  2KD7 A;  3ZIX A;  5GZF A;  1CAU A;  2VUJ A;  5C8C A;  4YWA A;  1JYN A;  1ZYB A;  3VZJ A;  2JE8 A;  2D3P A;  5DUV A;  3I3E A;  1COV 3;  1WBL A;  4K6B A;  4XIL A;  3POG A;  4LLF A;  2IXC A;  2ZGM A;  2XLA A;  4QU2 A;  2BGO A;  1J59 A;  1RVF 2;  4HG6 B;  1LHV A;  1QJY 2;  3PME A;  3JQX A;  2CDP A;  2ZX0 A;  3ZXL A;  1JYT A;  2OXB A;  4UFL A;  1RUD 3;  3LIG A;  5KXC A;  5CEH A;  4EQV A;  3ZSE A;  1JUH A;  3MUZ 1;  1RMU 3;  1CES A;  2W0X A;  2DCK A;  2VCB A;  3EBR A;  3DV8 A;  4BME A;  2EAK A;  4IE4 A;  4CUB A;  4D7S A;  1VBD 2;  4BWO A;  3J8F 3;  1GYK A;  1KS4 A;  1N1Y A;  5JOW A;  2ARC A;  2WL1 A;  1O3S A;  2VQA A;  1RUI 1;  3LWC A;  2AC1 A;  4QWN A;  1GZW B;  1RC6 A;  1NXD 1;  2WA3 A;  4AVS A;  1SPP B;  4ZU5 A;  5T54 A;  3AMQ A;  4G4F A;  4Q5O A;  3MF9 A;  4WVZ A;  1W8F A;  2VMG A;  5FQ0 A;  1HDK A;  4PLN A;  4Z2A A;  4FVV A;  4YGC A;  3ZDV A;  3RS6 A;  1DQ0 A;  1MS8 A;  4BQ4 A;  2HJI A;  2DWR A;  1JOJ A;  1ODN A;  1YFW A;  5F2S A;  5C70 A;  3OOX A;  4IE0 A;  2QDN A;  4M3C E;  5T52 A;  5FPZ A;  5DAB A;  1V6N A;  3LA3 A;  2XQX A;  3SXW A;  3AP7 A;  4NHM A;  3GBF A;  4CU9 A;  3LFM A;  3I2F A;  4XF4 A;  1TME 2;  4GMP 1;  5AFE A;  1GOH A;  4LQR A;  2VAU A;  1VBC 3;  3CDZ B;  2WQ4 A;  2NYY A;  1RB8 G;  4IW3 A;  1BMV 2;  4H14 A;  4Q4Y 2;  4IUG A;  1XYO A;  3IPV A;  1HXS 1;  2QQO A;  2WAB A;  1XRU A;  2J1R A;  4FFG A;  4QX1 A;  2W9X A;  3AL5 A;  2X53 S;  3FHI B;  3MLL A;  3PVN A;  5FY7 A;  5KXD A;  3OEB A;  2Y26 A;  4YM3 A;  3KV9 A;  4OI0 A;  3EB7 A;  4FPG A;  3LSE A;  1PNG A;  1F35 A;  5A6Y A;  2YUE A;  5GLZ A;  1V6K A;  2WII B;  1B35 C;  5FUI A;  3VZM A;  2WNU B;  4AGG A;  2A75 A;  2DFC A;  2WQ8 A;  1I9R A;  3GDB A;  4WVV A;  3EXU A;  5A7P A;  1LGC A;  2ZKN A;  3VDC A;  2XJV A;  5DZE A;  1PIV 3;  5K4L A;  5C8C B;  1IS5 A;  1CAU B;  2EIE A;  2ZGO A;  4AI2 A;  1OMI A;  4NAM A;  1LJ7 A;  2R49 A;  2WN2 A;  3UJO A;  5B2G B;  1ZZ8 A;  2WC2 A;  3RJR A;  3BCW A;  1YFU A;  1DBN A;  3ACG A;  1R09 3;  1EAH 2;  1AX2 A;  2Y6K A;  2OA2 A;  3KV4 A;  3OUJ A;  2GP5 A;  4QT6 A;  1COV 1;  1REE A;  2ZHK A;  2JB8 A;  1LOF C;  3M8L A;  3LZZ A;  4FI9 A;  4MYE A;  3ZPO A;  4UW6 A;  2AEY A;  5C3S A;  1VJ2 A;  4Q2F A;  2DCT A;  3HT1 A;  2VZO A;  1D4V B;  3SKJ E;  1W9Y A;  4Q4X 2;  2B5H A;  2JIJ A;  2PLV 2;  4JTO A;  4QKB A;  4JKM A;  2XDV A;  3CLP A;  3IT8 A;  2K46 A;  1I3H A;  4XJW A;  3M3O A;  3ZYH A;  1O4Z A;  2D43 A;  4BQW A;  4CTE A;  1DU3 D;  3O12 A;  3SLI A;  3T08 A;  2DUQ A;  3O1O A;  3O1P A;  4YRD A;  4QGN A;  3IBM A;  2GND A;  2XG3 A;  4XJZ A;  4XQD A;  2OYZ A;  4NAO A;  2BBV A;  2A6V A;  2W1S A;  5C8C C;  1YQ5 A;  5JSP A;  3WQ1 A;  2P34 A;  5FQ0 B;  2HYK A;  3L9J T;  1R1Z A;  2VOT A;  4BE3 A;  1YEW A;  5K9Y A;  2MEV 1;  3UNP A;  1AR6 3;  4G3Y C;  3LEM A;  4N90 A;  4X6R B;  1SFN A;  2J1A A;  1G9C A;  4CP9 A;  5DAP A;  4OYU A;  4ZZ8 A;  3D8C A;  4F83 A;  5JXG A;  2WSV A;  3BOD A;  3TNQ A;  1UXX X;  4LTA A;  2J1T A;  5EJZ B;  1QF3 A;  2XQR A;  1WMF A;  5FZ7 A;  2YC0 A;  2BNM A;  5FYM A;  2PHD A;  4JGZ A;  1LR5 A;  1UKR A;  1CD3 G;  4QHB A;  4E2G A;  1ND2 C;  2XJP A;  4M3C F;  3LGR A;  3ZN6 A;  4BOW A;  1UF2 C;  2W08 A;  3DPR A;  3IPV B;  3VB9 A;  1VBC 1;  1YO8 A;  2VNV A;  4Q0S A;  2WFF 3;  4PBO A;  5FWE A;  4XXP A;  3ETP A;  4D94 A;  1GV9 A;  1LES A;  3ZO0 B;  4FPC A;  4W8J A;  2VOV A;  2C1F A;  5IJR A;  3HT2 A;  4A4A A;  1OF3 A;  4QGM A;  4QQO A;  1WGP A;  2UWB A;  3LSD A;  3D6E A;  4Y5T A;  2DUR A;  4BK5 A;  3AP9 A;  3AJZ A;  2WO2 A;  1IHM A;  1TNF A;  4U2A A;  3WXP A;  2NZ9 A;  5A3T A;  5A7N A;  3KD4 A;  1W90 A;  4XUR A;  1DCS A;  1WD3 A;  2OX0 A;  4UT5 A;  5K0U A;  4EN8 B;  5JI9 A;  2YDE A;  4A7Y A;  1LHO A;  3OBA A;  5H9P A;  3FFQ A;  3MPP G;  5A1A A;  1Z78 A;  4QXB A;  3JU9 A;  3ROU A;  2ZGT A;  4E2S A;  1DGR N;  3ZFF A;  2FCV A;  3AKS A;  3INA A;  2AYH A;  2BZD A;  2ZZJ A;  4L0P A;  4AFC A;  4YAR A;  1R09 1;  3LDB A;  4WM7 C;  4N8M A;  2RV9 A;  1W3X A;  2NM1 A;  2YU1 A;  3HNB M;  1AR9 1;  4P9W A;  1SLL A;  2MPF A;  3CL1 A;  1C1L A;  5FZI A;  1H0B A;  1BEV 3;  4UF0 A;  4D0Q A;  3E5U A;  3ZPY A;  5IFT A;  1GOG A;  2RJK A;  4QX8 A;  2ORZ A;  3ILN A;  1IKP A;  4P9Y A;  4QB1 A;  2ZMN A;  1OUS A;  4FFI A;  1VRH 2;  1NCQ A;  5ACA 3;  2ETE A;  1W99 A;  3B00 A;  5DAV A;  4YLZ A;  4BM8 A;  4KWL A;  3DL3 A;  4IEY A;  4XQ4 A;  3T30 A;  4CP9 B;  4A41 A;  4COZ A;  1DIW A;  1HLC A;  1R1A 3;  3WHT A;  4DY5 A;  5AVP A;  4H2A A;  2BBA A;  2PHF A;  4HK9 A;  4KWU A;  1MZ5 A;  2GU9 A;  3M3Q A;  4FPO B;  2WS9 3;  5DAW A;  2ZAA A;  4FTE A;  5LAT A;  1D0G A;  1IPS A;  1POV 1;  3ZN6 B;  4MV2 A;  5FFO C;  1ZBE 2;  3DPR B;  5APA A;  2CY6 A;  1ZRE A;  1NQJ A;  3HN1 A;  3URF A;  1GZT A;  1S1A A;  4LO8 A;  2WDB A;  3DYO A;  3WDW A;  5A7S A;  2ET1 A;  5C5T A;  3O1V A;  1CQ9 A;  5BXX A;  4NVP A;  3N7J A;  2Q5T A;  4YGB A;  1WWY A;  4IEO A;  3D0S A;  2VGD A;  3ZDS A;  5CNA A;  2JDM A;  2PAE A;  3WX5 A;  2XR4 A;  4YW7 A;  3FX3 A;  3JZV A;  5JMC A;  2ZAC A;  1UU6 A;  2EXK A;  3KCY A;  4LBJ A;  4NR1 A;  4YZ5 A;  1RUE 2;  4ZKT B;  5FZM A;  1CIY A;  1VBB 3;  2Y6H A;  2FCT A;  2Z79 A;  2JE9 A;  3BOW A;  1S0D A;  1GMM A;  5K0U B;  1RVF 1;  2DBI A;  2G1M A;  4PQ9 A;  3HQU A;  2W1W A;  5FZF A;  2JDZ A;  4NWW A;  1K12 A;  2Z69 A;  1J58 A;  1UMH A;  1UZW A;  1F5F A;  2H0B A;  2RMU 3;  3WG2 A;  4AI8 A;  1UQX A;  1QH6 A;  2K2S A;  4U36 A;  5A1F A;  2PQQ A;  2GDF A;  5FPU A;  5FO8 B;  3ZFF B;  4JGZ C;  4ZS2 A;  5FY8 A;  4N7U A;  2QQI A;  2WZP P;  4Q0U A;  1AYN 3;  1A3K A;  3MZH A;  3OGR A;  1UU4 A;  1JZ4 A;  2QQN A;  1DP0 A;  1PO2 1;  2VZV A;  2WAA A;  3WNN A;  2CTV A;  1N1V A;  4J6G A;  5JPN B;  4V1P A;  5FCC A;  3NL1 A;  3FLR A;  1HW5 A;  2HWB 2;  4MGK E;  4N43 C;  3III A;  4IGP A;  4Q4W 2;  4UF0 B;  4UI9 L;  1C8N A;  4AVC A;  2XGX A;  2YBS A;  1V6M A;  3A21 A;  3D5O A;  2R06 2;  4O61 A;  4Y5Z 0;  2VNR A;  2VMI A;  1JTZ X;  2NMO A;  1QJU 2;  1RED A;  3KV5 A;  1DYO A;  3DUI A;  1NCQ B;  1K42 A;  3G7D A;  4XUO A;  4IV3 C;  5FZ4 A;  1WW4 A;  5FMO S;  4P14 A;  1B35 A;  1TME 1;  2JDA A;  3UJQ A;  3AM2 A;  4HZF A;  3NKT A;  1OT5 A;  4FAH A;  5JR2 A;  4F3J A;  2B42 B;  1Q8P A;  4CDX A;  4Q4Y 1;  3PNA A;  1Q3E A;  2A3Y A;  1P8J A;  4XEZ A;  1PX3 A;  2G9F A;  1RUG 2;  3AB0 A;  1HRV 3;  1H2L A;  1HN1 A;  2BGP A;  5DZG A;  2ADD A;  5EIY B;  2AEZ A;  2RG4 A;  3S0M A;  1AL2 1;  3EJK A;  5IK4 A;  2DFB A;  3BPS A;  4X8N A;  5BNN A;  2OPK A;  2ZPX A;  1JU4 A;  2JEC A;  2WS9 1;  5EJ3 A;  4GB3 3;  5LK7 B;  3RZG A;  5KHK A;  4E8D A;  3ZR5 A;  4EN7 B;  2HWE 1;  2I45 A;  5J48 A;  4URA A;  3KB5 A;  1H4G A;  2JX9 A;  3MFC A;  5T50 A;  4ZXE A;  4AI0 A;  5FV3 A;  1MZE A;  1LUL A;  4BA6 A;  1XQN A;  4XYX A;  5CFD C;  3IAP A;  4GA9 A;  3LAG A;  4YVW A;  4QU1 A;  4UW4 A;  4BCU A;  2IUW A;  1GNZ A;  1QXP A;  2A70 A;  3OGG A;  2ZHL A;  1GSL A;  4Q4V 3;  1F8V A;  5FXX A;  3B7M A;  4TTG A;  3RYR A;  3CZU A;  2VMC A;  2E9Q A;  3T0D A;  1ZA7 A;  5FPB A;  1WLT A;  1YQ8 A;  3ZSK A;  1S0E A;  2RS5 2;  2XJQ A;  1LEN A;  1DQ4 A;  3UKN A;  2OQ7 A;  1S0F A;  3KSC A;  4XE9 A;  3LD8 A;  2FDG A;  5D8A C;  2RDN A;  2ZGP A;  4OHW A;  3OGS A;  2W92 A;  3KCC A;  2CU5 A;  2KR2 A;  4W6W A;  2WNO A;  5T55 A;  4Q4X 1;  1ULO A;  4OVE A;  2V5D A;  3VBU C;  3HQX A;  4JRA A;  4MGS A;  1WMX A;  3VD4 A;  4DIQ A;  2BQP A;  1UWW A;  1OA4 A;  3HWJ A;  3LF7 A;  3MW3 A;  4XFC A;  4AED C;  5JOX A;  3K3N A;  4WZC A;  5FYZ A;  4NHL A;  3RZK A;  2R6Q A;  2DUO A;  2OZ6 A;  5AVA A;  4JC1 A;  4XMA A;  1CJD A;  1WCD J;  5FYV A;  4PI0 A;  3VBR A;  3J26 N;  3A4U A;  2BJS A;  5ABJ C;  5FR3 A;  5GJ6 A;  3W5M A;  4EE2 A;  1X82 A;  2XJR A;  3APB A;  4COW A;  4XPV A;  3GCW A;  3VHP A;  1QOO A;  1Q8V A;  2JXA A;  1FXZ A;  3HN3 A;  2HWD 3;  3K51 A;  5SV5 A;  1B35 B;  1PMI A;  3N36 A;  1TE1 B;  2PHL A;  3C7O A;  4WV8 A;  2J1U A;  2Y6L A;  3TRS B;  2FMD A;  4AW7 A;  4QKN A;  3UKT A;  4CDX B;  1DZQ A;  3NO8 A;  3MHZ A;  5F7U A;  3AVR A;  3LPF A;  1F4H A;  4HVR A;  5ANN A;  5FPL A;  4KGG A;  4AFD A;  1IPJ A;  1DHK B;  4ZON A;  4CA9 A;  3JB8 A;  5J36 A;  4HN1 A;  3B9I A;  2ZTN A;  5BNN B;  1PGL 2;  4YFZ A;  3SH4 A;  3ZYF A;  2O8Q A;  1PGW 1;  4RL7 A;  1LU1 A;  5FP3 A;  1ULF A;  1AYM 2;  1EV1 3;  3I54 A;  1HRI 1;  4GB3 1;  4QPW A;  3PUH A;  3GZT B;  2C0Z A;  3ZYR A;  1V00 A;  5FY0 A;  4URT A;  5IVY A;  3WIN E;  5H9Q A;  2P17 A;  3NV4 A;  1BVV A;  2UYA A;  3N9L A;  1VPH A;  4I01 A;  4YVW B;  3ST7 A;  4BQ5 A;  4CEW C;  1H1I A;  5A7Q A;  3TEY A;  1UMZ A;  4UFJ A;  1VIW B;  4A7K A;  1DF0 A;  1NCR C;  2QDR A;  3M7A A;  3OJB A;  5FZA A;  1WCK A;  2IXL A;  1G9B A;  4EV0 A;  3UV9 A;  3RZL A;  4CDQ C;  5CKQ A;  3GZU C;  4P5H A;  1RUI 2;  1BXH A;  1RJ8 A;  5IW0 A;  4ASL A;  2IWG B;  3RYP A;  3D3A A;  1BBT 2;  4LO6 B;  4TWT A;  3GJB A;  4P9L A;  3WG1 A;  1LOB A;  2GC1 A;  5FZH A;  1DLL A;  1HX6 A;  4S2G A;  1OSG A;  4XDP A;  4IEU A;  3CBN A;  3Q8A A;  3KVB A;  1VBE 3;  1VRH 1;  3DEC A;  3RZH A;  1YYN A;  3BU7 A;  4LK6 A;  2BRT A;  1B09 A;  1JZ2 A;  1BK0 A;  4W6X A;  1CAW A;  1YNA A;  4GQ7 A;  5JUV A;  1W8U A;  2P5B A;  4AXO A;  4R4Z A;  1HKD A;  3N4M A;  1W2T A;  3B69 A;  4ZU7 A;  1AHS A;  2ZXQ A;  5FP7 A;  4MHU A;  2JDP A;  3U07 A;  1IG3 A;  1MZ6 A;  5I8Y A;  2Q1M A;  1RUH 2;  2GME A;  4IQP A;  2W5F A;  2YC2 A;  1F15 A;  3I49 A;  2FDK A;  1FX5 A;  3NJX A;  1JN2 P;  2QFE A;  3VBS C;  1ZBE 1;  2HWC 3;  4UXA A;  2XJU A;  2CWS A;  2J42 A;  5KC5 A;  2JEN A;  4BLJ A;  3ORJ A;  5KHH A;  5LBC A;  3W9A A;  1U5Y A;  1U5X A;  1QWR A;  2LRP A;  4A44 A;  4UOJ A;  4NMI A;  4FOY A;  3GHN A;  4ES9 A;  3ZYJ B;  5I93 A;  3IMN A;  3GNE A;  3N9N A;  4AI9 A;  2RDQ A;  5I8S A;  2W2I A;  3RRD A;  1WA6 X;  4CXW A;  1KGY A;  5F3E A;  4WM7 B;  4NWV A;  5HCB A;  1NE4 A;  4LEJ A;  2CAU A;  3GZA A;  3W59 A;  4Y1U A;  1XE0 A;  4GWJ A;  1TEI A;  4N43 A;  3H1Y A;  5C9A A;  1QJX 3;  4P02 B;  1COV 2;  3ZX7 A;  1QQP 3;  5C5U A;  3RPQ A;  3PTR B;  4M0H A;  1W6P A;  4P9G A;  5HCF A;  1Y3T A;  5C8W A;  1LHN A;  3POS A;  1D2Q A;  3N7M A;  1BYH A;  4IGQ A;  1RUD 2;  4PHZ A;  1HV0 A;  2JIC A;  5I0D A;  3MLJ A;  4HL0 A;  2E31 A;  4K8R B;  1RMU 2;  4YPJ A;  1GKB A;  1NLR A;  2GZW A;  1C1F A;  3JBG 3;  3BIW E;  3J8F 2;  3THT A;  3VD7 A;  2WZE A;  2AR6 A;  5FOB B;  2PFW A;  4NOT A;  4I0A A;  2R06 1;  4HET A;  1HB4 A;  1QJU 1;  3J7H A;  2Y6G A;  4CPB A;  1V9U 3;  3PLQ A;  2XL7 A;  5DUX A;  1MVE A;  5F3I A;  1X7N A;  3WUD A;  1JH5 A;  1ZRR A;  2BTV C;  1CAW B;  4R4X A;  5IK5 A;  1PK6 C;  4LBN A;  1HQW A;  5BPX A;  4HLT A;  3FBM A;  2K0G A;  4LO4 B;  2GMM A;  4IV1 C;  4KWJ A;  1W28 A;  1OD3 A;  3VBH A;  3VD9 A;  4CPB D;  1O6U A;  1ASJ 1;  1XC6 A;  3HNM A;  4CSW A;  1NLS A;  1VBC 2;  4LKE A;  5CFD A;  2A3W A;  2JJ6 A;  1WLD A;  3AKQ A;  3LEG A;  4YYO A;  4AVT A;  4IE6 A;  4L92 A;  1JUI A;  2WWJ A;  4DRV A;  4FFH A;  1EYB A;  1XB9 A;  2ZHN A;  2QQW A;  5C3P A;  1ENS A;  5LBF A;  3JD7 1;  3W21 A;  4DNY A;  3IN9 A;  1J83 A;  1W6Q A;  3QCW A;  4FPE A;  3VDD A;  2IVJ A;  5FRE A;  4C1W A;  3R4U A;  1ZZ9 A;  4LIT A;  2WSU A;  2VE1 A;  5FYT A;  3AKP A;  3ZYP A;  1OD5 A;  4K8F A;  1D4M 3;  5FYS A;  2ID4 A;  3E1F 1;  3N9Q A;  3VBU A;  3ZXF A;  1O4Y A;  3F95 A;  4Q8L A;  1QNY A;  5FAX A;  5HXV A;  3T2P A;  1SLT A;  1SFP A;  2V09 A;  3H0O A;  3I2J A;  2QQU A;  4LA3 A;  4EZH A;  1YLL A;  5LEJ A;  1GWM A;  1PX4 A;  2W46 A;  3HBZ A;  4HSJ A;  3AJY A;  3Q9O A;  5IVC A;  2RS5 1;  3T1L A;  3BYW A;  1WW6 A;  5FZ9 A;  4IGO A;  4N43 B;  5C9A B;  4PJY A;  1QXJ A;  4ZHN A;  3Q8C A;  4I0B A;  4CDW C;  1S2B A;  4NN0 A;  5J1X A;  5ABJ A;  2JG9 C;  1W6P B;  2AEN A;  3ATG A;  5J98 B;  1R09 2;  3O0W A;  4I0W B;  4XF9 A;  4AHZ A;  2L9L A;  2ZKL A;  3M4F A;  3N9O A;  3MID A;  2XBO 3;  4SBV A;  5I0U A;  2ZGQ A;  4CXX A;  1IKQ A;  1WCS A;  1GU3 A;  5J37 A;  1VLN A;  1RUC 3;  2UY8 A;  4MH0 E;  3WD5 A;  4NRO A;  5CKN A;  4NPR A;  1X50 A;  2YY1 A;  1OFN A;  2VXJ A;  4LBL A;  1JS9 A;  1S4C A;  1VBA 3;  1W04 A;  3I8T A;  4RQP C;  3K77 A;  1IS4 A;  3JBG 1;  3WY6 A;  3PL0 A;  1XOY A;  2ZEX A;  2FDI A;  4RHV 1;  5FMC A;  1OVS A;  4UBH A;  5FZO A;  4FTB A;  4F8A A;  5AC9 3;  4XET A;  1UY2 A;  3AZX A;  2R1B A;  5F5C A;  2EAL A;  4OI4 A;  1KIT A;  5CIR A;  1MS5 A;  3PUS A;  2X09 A;  1TMF 3;  3FL7 A;  3M3E A;  4LOR A;  4OZO A;  4QQL A;  2RDS A;  4RFR B;  3K46 A;  4XBL A;  1AR6 2;  4OQ8 A;  3WW3 A;  3RI8 A;  1GNY A;  3HNY M;  5FYB A;  4R9D A;  1FPN 3;  2V4V A;  4IE7 A;  5G05 L;  5JIA A;  1RL3 A;  1D2S A;  4AHX A;  3VBH B;  4MGY E;  2KM2 A;  1NQD A;  4PF1 A;  5CFD B;  4CEW A;  4OUE A;  1OKO A;  5J96 B;  3U78 A;  4JX0 A;  2ARX A;  1PGL 1;  1W0N A;  2NPI A;  4DEQ A;  2ZGN A;  1AYM 1;  2WO1 A;  4N53 A;  3M3C A;  1W6Q B;  4XDO A;  5BUV A;  2FMY A;  1G7Y A;  5D8A B;  5F5Q A;  3VDD B;  2VTX A;  4IL7 A;  2PXJ A;  2Q8O A;  3FFZ A;  5F6L B;  4A7Z A;  1C4R A;  4NRM A;  1H8T C;  4A3X A;  4CCM A;  1LAJ A;  3VBU B;  2IZW A;  4L97 A;  5DXD A;  2ZAB A;  2D6P A;  3POI A;  4AEJ A;  1MQT C;  1XU1 A;  4ZPI A;  1D4M 1;  2ZX3 A;  4M4R A;  5IAT A;  2EAA A;  1JZ8 A;  1YI7 A;  2HKX A;  1DZT A;  5LEK A;  1Q56 A;  4FBF A;  3E6C C;  2RS3 3;  4XUT A;  2HH9 A;  1IOA A;  1E5R A;  1AZD A;  2TNF A;  3OUH A;  4GH4 C;  5CFC A;  3AZV A;  1CPN A;  5ABJ B;  3ON7 A;  3FWE A;  4PCR A;  4MLO A;  3OPW A;  3P1I A;  3EQE A;  3OGJ A;  2ZOE B;  1PO2 2;  3E97 A;  3A23 A;  3KGL A;  1BBT 1;  3AVS A;  3S30 A;  4CDU A;  2Q8D A;  2EXJ A;  3RMX A;  2PEL A;  5FYY A;  3WV6 A;  4H7M A;  4IEP A;  2BV4 A;  2DTY A;  5CAD A;  3AYA A;  3T4V A;  1QOT A;  1ZBA 1;  3QBQ A;  4IEZ A;  1UW8 A;  2D5H A;  1BEV 2;  1TZO A;  3AFG A;  4RR3 A;  3VBS A;  5JOZ A;  5E8A A;  5L7O A;  3WDX A;  4C91 A;  5BNO C;  5FZO B;  4YW4 A;  2G4I A;  4BQ2 A;  1DZR A;  1JU3 A;  4YM2 A;  2Q0A A;  2XVL A;  3BGA A;  1J3Q A;  4XTP A;  1UXZ A;  4AFM A;  3MW2 A;  5KC6 A;  1W2O A;  4GIQ A;  5ACA 2;  2VVE A;  4AYU A;  5K8S A;  2UWA A;  5JMO A;  4GAL A;  1RUH 1;  4OCT A;  2RM2 3;  2QUO A;  1TMF 1;  4HVO A;  1JOP A;  5JXJ A;  1PVC 3;  1R1A 2;  2VOW A;  3VBF A;  3W5N A;  1AL2 2;  1UU5 A;  1WKY A;  4L99 A;  5FKB A;  2ZBJ A;  2CSG A;  4HMZ A;  4QQH A;  2DUP A;  3J4U H;  4XJU A;  2WS9 2;  4B29 A;  2CL2 A;  4XDQ A;  3R6S A;  4CEW B;  1Q43 A;  2VVF A;  2XHN A;  4DXZ A;  2PHR A;  2HWE 2;  1NZI A;  1ZZ6 A;  1UKG A;  2HBT A;  3BPZ A;  2RS1 3;  3H8R A;  3MGU A;  5DQ0 A;  2OQ6 A;  4CUC A;  3WG3 A;  3WF4 A;  3WUC A;  2Z4F A;  5A3W A;  2Y33 A;  2ZCW A;  3QLQ A;  1R64 A;  4N53 B;  2NMN A;  5F32 A;  3H1W A;  4Q29 A;  4L9B A;  1CPM A;  4NPM A;  1C5I A;  4NO4 A;  4CDQ B;  4W65 A;  4LHN A;  4MGZ E;  5D1I A;  2Y8K A;  2A71 A;  1C3H A;  2BGC A;  1CIW A;  4OFG A;  4EWA A;  3LDK A;  1DGL A;  1AVB A;  2A7A A;  2IFW A;  3I2D A;  1VBB 2;  5EWS A;  2R07 3;  3ZYG A;  5BY5 A;  1WLW A;  2ES3 A;  1D7P M;  2DVD A;  5IFP A;  4GUL A;  4LKS A;  3ENR A;  3JQW A;  3N7L A;  3OG2 A;  4HT1 T;  2JG8 C;  4LBQ A;  3GJA A;  1RUD 1;  2VO5 A;  4I02 A;  3ZXG A;  1S2K A;  4COV A;  1RXG A;  5CFC B;  1STM A;  2BU9 A;  1VMJ A;  2RMU 2;  3OPT A;  2NP0 A;  2QJV A;  3MO4 A;  4DQA A;  1RMU 1;  3NAP C;  4E2Q A;  3P5B A;  1RXF A;  3WOG A;  2UY9 A;  3MBW A;  2JWP A;  3J8F 1;  1PMJ X;  3VKO A;  2W91 A;  3O1M A;  2HLE A;  4CYD A;  1DGW A;  1AYN 2;  1OC1 A;  1W8Z A;  1CAX A;  4CDU B;  2WR9 A;  1EPW A;  1ENX A;  5J09 A;  4LBQ D;  2CGP A;  1OOP A;  5JZG C;  5LCW L;  5IVB A;  4J1X A;  4Q0P A;  5EFU A;  2VR4 A;  4RR3 B;  3VBS B;  4B1L A;  3IAQ A;  5L7O B;  2VJX A;  1Y9M A;  4MET A;  5FPX A;  1WBF A;  4E9K A;  3FHA A;  4AVB A;  3SIS A;  1WA4 A;  4FFF A;  1F2N A;  4JRL A;  1NXM A;  3FUO A;  2QVS B;  1F9K A;  1XNT A;  2UWC A;  4D8M A;  1YC6 1;  1K5M C;  3T0B A;  3ZFE C;  2E7T A;  3I3B A;  1O4T A;  1LGN A;  1E5S A;  2G9Z A;  1Z7S 3;  4QPG C;  3OF1 A;  3VBF B;  2R16 A;  4YM0 A;  4XUP A;  1DG6 A;  2P6H A;  2QZ2 A;  4HKO A;  3WW1 A;  1UMI A;  4AQT A;  4XIO A;  4XZP A;  1PGW 2;  1VAM A;  4CDW A;  4E4D X;  3RZZ A;  5CA6 A;  2YFU A;  2JG9 A;  4GWN A;  5BV6 A;  3KVA A;  4KG0 A;  2QQL A;  1HRI 2;  4GB3 2;  2D6O X;  1U5I A;  3ZXE A;  2R04 3;  3I97 A;  4RN5 A;  1ZZC A;  4AL9 A;  4QB2 A;  2EIG A;  5LY1 A;  1V6I A;  3K4D A;  1BLZ A;  4RGG A;  4AF9 A;  2OT7 A;  5GM0 A;  1PIV 1;  4OMD A;  4S2F A;  2P37 A;  3NWK A;  1OLQ A;  3ZYB A;  4WVM A;  1T2X A;  3H8O A;  4YZ4 A;  1XYN A;  5FZE A;  1QJZ A;  2PHX A;  5D21 A;  5JXH A;  4I30 A;  5CVR A;  4RQP A;  4D3W A;  5A3P A;  2ET7 A;  5IVV A;  4Q4V 2;  4MGI E;  4AWD A;  2BYV E;  3WSO A;  5FKC A;  3E6D A;  4HXC A;  3UL2 A;  4B1M A;  5EYX A;  4LBQ B;  3RI9 A;  1QJY 3;  2AUY A;  4XQW A;  2JDU A;  1PVX A;  2PTM A;  4DO0 A;  4XTM A;  2VEC A;  3WCS A;  4CRQ A;  1G86 A;  3MYX A;  5A3N A;  5K7P A;  1ENQ A;  1YQC A;  4IES A;  1VP6 A;  4Z1V A;  1CZV A;  2DCJ A;  1NLQ A;  4ONU A;  1NY7 2;  2WBK A;  3RJ2 X;  3VZO A;  4CU6 A;  4EN6 B;  5T5J A;  1VBD 3;  1DGR A;  1CAX B;  2VW1 A;  1RUF 3;  3SCF A;  1HN0 A;  2ENR A;  4LO7 A;  4B7K A;  1NOV A;  3H8X A;  1OOP B;  1T6G C;  1CX4 A;  4QKF A;  4EYU A;  3V0B A;  3HVD A;  4R9C A;  3S5Q A;  1UY4 A;  4QQP A;  2CHH A;  1OLM A;  1AR6 1;  3WDV A;  3NNG A;  1YCI A;  3H3L A;  2VUC A;  3C7F A;  1AXK A;  2BDR A;  2P6C A;  1UNB A;  4HPK A;  1OUR A;  3J7N A;  3AZZ A;  2WT1 A;  2XL9 A;  5CU1 A;  4KNC A;  1KRI A;  2HWD 2;  3BIE A;  4XFG A;  2JKX A;  1H8T A;  2ZHM A;  3LOI A;  3TOJ A;  3A7Q A;  5LAS A;  1ZZB A;  4KQ7 A;  1SAC A;  4L11 A;  5FPV A;  2WFF 1;  5FP8 A;  3TEZ A;  3O1R A;  1LCL A;  1R08 3;  2BW8 A;  5H9R A;  5T5P A;  4GH4 A;  3ZSM A;  1A8M A;  2P1B A;  4CDW B;  2HYX A;  4LA2 A;  2XPJ A;  2JG9 B;  3ZLI A;  2JKB A;  4EN9 B;  1ZNP A;  2WLQ A;  3D0J A;  2D3R A;  4Y4Y A;  1MR5 A;  2WO7 A;  2IC1 A;  2GNB A;  4NPL A;  1V6L A;  4MUV A;  4JQR A;  3MUY 1;  4LR4 A;  3H50 A;  3ACF A;  4HKL A;  4WVM B;  5FUP A;  4JCK A;  1W9W A;  4RQP B;  5FMB A;  2YGL A;  2WNV C;  1OF4 A;  4Y26 A;  1LOC A;  1QEX A;  1YIF A;  2BFU S;  2W1U A;  4NE9 A;  5JI7 A;  4MVT A;  5KR7 A;  4OHZ A;  1SLC A;  1EAH 3;  2F4L A;  1RGS A;  2Y0O A;  5J3U A;  2J1V A;  1S0C A;  1US2 A;  2QBX A;  4LPL A;  4XMI A;  4BMB A;  4YW5 A;  4BLI A;  3SMH A;  1ST8 A;  3ILF A;  3THP A;  4LE3 A;  1Z0H A;  5I0S A;  1PZ9 A;  1BEV 1;  3NKG A;  4Y20 A;  3S6P A;  5CB7 A;  2JB4 A;  2W47 A;  4BH9 A;  2YHJ A;  5C6C A;  1UD1 A;  3BB6 A;  3LFI A;  3USU B;  2VOK A;  5IYY A;  1VBE 2;  3V0B B;  2VMF A;  3CNA A;  2VVD A;  3M3I A;  3S57 A;  2W87 A;  2PQS A;  4FPY A;  3WW2 A;  2NQY A;  5ACA 1;  2IXK A;  1NKG A;  4LBO A;  1UY0 A;  4XIK A;  1PM4 A;  5GLU A;  2W52 A;  2B46 X;  1K45 A;  1FMD 3;  4HPK B;  2DU0 A;  4KG8 A;  4YG3 A;  1ASJ 2;  1FOD 3;  4H3W A;  1MEC 3;  1R1A 1;  2EID A;  4SLI A;  2X05 A;  5F5I A;  4D7T A;  3OD4 A;  4Y1Y A;  5A7O A;  2JD9 A;  3LA2 A;  4QDR A;  1JW6 A;  1H8T B;  1J3P A;  2Q1F A;  4P00 B;  4OI1 A;  4PBP A;  2Q1Z B;  5FIX A;  5L73 A;  1DYP A;  1MQT B;  5ISL A;  5IHR A;  3JD7 2;  2FQP A;  2OPW A;  1LOF A;  3BVC A;  2A1X A;  3R4D B;  5JR7 B;  4LHK A;  5GLW A;  2QQP A;  2E26 A;  3SEP A;  3I2G A;  3V56 A;  1MS0 A;  3FMG A;  4GH4 B;  4MXW A;  4Y5S A;  1AR8 3;  5IVE A;  4BDV B;  2VZ1 A;  2VZ3 A;  4Q8K A;  3ZN4 A;  3NAP A;  3B5L B;  3AKT A;  4B4P A;  5DZF A;  3ETQ A;  4NHX A;  1NE6 A;  4XBN A;  3HPN A;  3AKR A;  2YU2 A;  4KBZ A;  1VBB 1;  2ARE A;  3J9S A;  4LIV A;  1I5P A;  3QOP A;  3H42 B;  1HJF A;  3ACI A;  3THC A;  1E5I A;  3I2O A;  3AP6 A;  3U4X A;  4JKL A;  2WZ8 A;  3SCG A;  2D6M A;  4A3Z A;  4COY A;  2CYF A;  2B4K A;  1QJX 2;  1QHD A;  4F7Z A;  5BNO B;  1W8W A;  1WZX A;  2RMU 1;  2V4A A;  4OHX A;  3VBO C;  4B7E A;  4XAB A;  3B01 A;  2LS6 A;  3PU3 A;  4KL1 A;  4QPI C;  4C0B A;  5EHD A;  1AYN 1;  4HN0 A;  1ND2 A;  4W6Y A;  5FZ8 A;  3IDE A;  4FP2 A;  1OUX A;  4M3C B;  1U12 A;  2YGM A;  1O3R A;  3JBG 2;  3N3H A;  4RHV 2;  1GP4 A;  4Y20 B;  3KQ4 B;  1BQP A;  2KXL A;  3P3P A;  2WN3 A;  4W4Z A;  2YFZ A;  2ZEZ A;  4QXH A;  1ZZ7 A;  1ULG A;  3I4I A;  4PLM A;  1ACC A;  2VMH A;  1ENR A;  4BU2 A;  1OBN A;  3U75 A;  4AG4 A;  1RUJ 3;  1V9U 2;  1NT0 A;  5FLJ A;  3GBW A;  3O1S A;  1CGP A;  1F5J A;  4O65 A;  3WR0 A;  1LHU A;  1UZV A;  2YBP A;  1I6X A;  2ZGL A;  3NQH A;  1VRB A;  5E88 A;  3ZSJ A;  5DUU A;  5HI0 A;  3ZXJ A;  3R05 A;  3T2Q A;  5KHJ A;  1ULD A; 
#chains in the Genus database with same CATH homology
 2BP6 A;  5A3O A;  1W8H A;  5HCH A;  2VNV A;  2JDN A;  1OVS A;  2JDM A;  2XR4 A;  1OUX A;  4AOC A;  2WR9 A;  2CHH A;  3DCQ A;  2JDP A;  2VUD A;  2VUC A;  2JDH A;  4CE8 A;  1W8F A;  5A70 A;  2JDU A;  2BV4 A;  1OUR A;  3ZDV A;  5A6Q A;  5A6Y A;  2JDK A;  2JDY A;  5D2A A;  4UT5 A;  1UZV A;  2BOI A;  1UQX A;  1GZT A;  5A6X A;  5A6Z A;  1OUS A;  2WRA A;  1OVP A;  2BOJ A;  1OXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...