4UT5A

Crystal structure of the lecb lectin from pseudomonas aeruginosa strain pa7 in complex with lewis a tetrasaccharide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSATQTVKVLVNNETAATFTGQSTNNAVIGSQVLNSGGGGKVQIQVSVNGRSSDLVSAQVILANELNVALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECB LECTIN
publication title Genomic Rearrangements and Functional Diversification of Leca and Lecb Lectin-Coding Regions Impacting the Efficacy of Glycomimetics Directed Against Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 4ut5A00
2JDKA 2WRAA 4UT5A 1OURA 3ZDVA 2VUCA 1UZVA 2WR9A 5A3OA 2JDHA 5A6YA 1OVPA 2JDMA 5D2AA 1OUXA 5A70A 2JDYA 2VNVA 2BOIA 1OVSA 2BV4A 2VUDA 3DCQA 5HCHA 2JDNA 5A6ZA 1W8FA 2JDUA 1OUSA 1W8HA 5A6QA 2CHHA 2XR4A 2BP6A 2JDPA 1GZTA 5A6XA 4CE8A 1OXCA 1UQXA 2BOJA 4AOCA
chains in the Genus database with same CATH superfamily
1LU2A 5JR7B 3SC7X 1A34A 2VVDA 1I5PA 2C1FA 3ZDVA 3D6EA 1KDKA 1UCXA 4QPIC 4B1LA 1TG7A 4XPVA 3B9CA 4BQ5A 1W2TA 5A1FA 1RYYA 3OJBA 1FYUA 1QJX3 2JWPA 2VUDA 1W2UA 4FAHA 4YRDA 3U07A 1B35A 3K48A 1KDMA 2ARBA 5FZHA 2ATFA 5JSPA 3ZVXA 1NE4A 5G05L 4HONA 3ZYRA 4B4PA 1KFUL 2MHFA 3TNPB 3WCSA 1XC6A 4BHPA 1MVQA 2GMEA 1HLCA 2J1SA 2Y6FA 2DCKA 5C3OA 2BYVE 3OGVA 1Q8OA 1J3QA 1WLCA 4AWDA 5FZIA 5EFUA 5JPNB 5IK8A 1IG3A 1RHI1 5H9PA 1F8VA 1ZZCA 2VQTA 5CKMA 3T1MA 4AXOA 3RVHA 4EE2A 3OCPA 4AL9A 4JKLA 1YI9A 1GUIA 2ZEYA 2FQPA 1QKQA 2V4AA 4LUMA 3LDRA 4RS5C 4ZS3A 3H8UA 4IEWA 3BUCA 5A7OA 1PZ9A 1AXYA 1FMD1 3LA2A 3AMMA 3K3NA 1DU3D 4TLFA 1Z7S2 3NJXA 5FMCA 4COWA 3RZJA 3MW2A 1UIJA 4XCAA 3VL9A 5FO8B 4AEJA 4IV3A 2Y0OA 4HKOA 4YNIA 5SV8A 4FPJA 2D6OX 4XF0A 1O3RA 4QXHA 5L7OB 4LK7A 4OCTA 4KWLA 1QEXA 2HWD2 1REEA 1REDA 1N3OA 4QKBA 4QGNA 2KD7A 5BNOB 3VHOA 5AFEA 4Q4Y3 4LO5B 3POSA 4CDWA 2I07B 1OD3A 2HWE1 4GMP1 4MGTA 2XBO1 4MGQA 5A6QA 4UFHA 3UKTA 3PIGA 1RUD2 4D69A 4XUNA 4XF4A 5CB7A 4CE8A 2D6PA 3X29B 2PAKA 4BQXA 5KR7A 3A7QA 1K3IA 1VBC3 2BTVC 3HNMA 3LAGA 3M3IA 4FOWA 4Y5TA 1YRZA 5DXDA 3TB0A 1RUNA 3AYAA 1Y43B 3ZXFA 1Q43A 2EALA 2ERFA 3B00A 1R082 4HKWA 3H1WA 4QX3A 4XJWA 4EZHA 2XJTA 2RS32 2QQOA 1SLBA 2VNRA 4YFWA 1RUF2 3UT0A 3JBG2 3KZ4C 4C90A 3WNOA 5A32A 1UIKA 5FPZA 2VMHA 2ZX2A 3WF3A 5LZ6A 2YPDA 2QQWA 2H6BA 4FPLA 1JZ2A 1V00A 2H6CA 1RVF3 5FLJA 3RRDA 1F35A 2I2SA 1Q8PA 2DVGA 5JZGC 1H2KA 4CP0A 3QBQA 1SCRA 1W8TA 2IVJA 2QZ3A 4WV8A 1NA1A 1BKZA 3DUIA 3I2HA 5D8AC 5FBZA 3SCFA 3BIEA 4JKKA 3GYDA 3WW1A 3O1MA 3N9QA 5LBFA 2R32A 3HQRA 1LKNA 2DTYA 4TN7A 4AQ2A 4BB3A 5BNPB 4Q4X3 2QJVA 3LIHA 4C8DA 1ZM1A 5I0UA 4QKFA 5LK7B 1AR93 1X36A 4KG8A 1QDOA 2PLV1 1Q8QA 1SMVA 4LK6A 5T54A 5A70A 4J1XA 3VZMA 2HWF2 1MZ5A 3P3NA 4M0HA 4AVBA 3MIDA 3VKMA 1MZEA 1VALA 4I0AA 3AXEA 4K21A 3OUHA 4WM8A 3USUA 1OQDA 4FFIA 4XTMA 5JI7A 1EYBA 1OF4A 1R1A2 1W39A 2ZXQA 3EBRA 2A3YA 2YV8A 1ZRCA 2WNUB 3ZFGC 1VBD1 4TYSA 3ON7A 4HSJA 1WBLA 1XE7A 1W3VA 1OHFA 1IKQA 4GZ9A 2V4VA 3J8F1 2B8MA 2EAKA 2Q8CA 3S7EA 1ZREA 2XWJB 4AI9A 1PK6C 2WS92 1W9TA 4Q27A 2O8OA 3V64A 4CZSA 2GSYA 5FMBA 1BEV1 1FI2A 1W6PA 1HV1A 2ORXA 5A6YA 1IHMA 5LY2A 4O9GA 4LR4A 2ZGKA 1V9U1 3J7NA 4OHVA 3WLUA 3CJIB 2W0XA 5C71A 2WQ4A 1JOPA 4QGLA 3PU8A 1PO21 3U78A 3CDZB 1ODNA 4YZ3A 4F3JA 4JZRA 2RHPA 4YZ5A 1X9TA 4NE9A 3D8CA 1O4ZA 4CEWC 1OBNA 3I49A 4LE3A 2W68A 2BP6A 1VBB3 3ETQA 5EJZB 1EAH1 2UU8A 3VBFB 1UU4A 1ASJ2 3D0SA 3C7EA 4YM1A 4CDXC 4OHWA 5IFPA 5I8YA 4ZZ5A 4DB5A 2V5YA 1G9CA 1RIRA 2Y8KA 4QQOA 3VKOA 3WNNA 5HCAA 2R0FA 1AR82 3GF6A 1COV1 3LE0A 3AX4A 3WF2A 3NL1A 1UOBA 5FOJB 3ITQA 2ZS6B 2RDNA 3DPRA 3VHNA 5F3IA 2X09A 2ZEXA 1R091 4O65A 5CADA 2TBVA 2NN8A 3ALQA 3VBSA 3QACA 4XACA 5LEJA 3V65A 4CUCA 3GNEA 3R05A 1RUD3 1SBDA 1YQ5A 4UWDA 5IHRA 1RTVA 1H0BA 2A3XA 2IXLA 5GZDA 4QX5A 1X50A 3NNMA 3BTXA 2W47A 1LODA 2CU5A 2YYOA 2DF7A 4Y20A 1RL3A 5FPXA 1OQEA 3PIJA 1R083 4AFDA 1ND3A 5KBFA 2CTVA 2RS33 5CYYA 1MVEA 2BNMA 1HB2A 1RUF3 1O8SA 3FMGA 5GJ6A 3VDDA 4E4ZA 2G9ZA 4LIVA 2Q5TA 4QX7A 3ZSMA 4X8NA 4UYBA 3WNXA 1EUTA 1SACA 3FUQA 4LO4B 2PFWA 4AG4A 1CAWB 2JDYA 3UGGA 3WP6A 4QX2A 2ZACA 2RS11 3S7IA 3BTYA 4CVUA 3ZXKA 3I54A 4WBBA 3J7LA 4BWOA 2ZKNA 1Y9MA 3BODA 1VBE1 3PVNA 4P9GA 5GZCA 2WNOA 2RJ2A 3THPA 2ES3A 3OYWB 4UW5A 4Y33A 5BNNA 3MFCA 4Y22B 2K46A 5IK5A 5FLIA 3DF0A 4NIGA 1IZ3A 4D3WA 3WD5A 1NZIA 4V1PA 1RUE1 1C8M1 5FYVA 1PVC2 1AJOA 1QXRA 3HPNA 3IDBB 4LE4A 4A7KA 3LA7A 4B7KA 1HB4A 3NAPB 2HWF3 2D7FA 4IV1A 5CBLA 3DV8A 5JPMB 4UI9L 4BPZA 1R1ZA 4LOTA 1UOJA 4LHSA 5IVBA 4XETA 3IDCB 1OH4A 2SLIA 3TBDA 4LO6B 2FCUA 3SITA 3OBTA 3ZFFB 2BV4A 2P4EA 2PHWA 3P6BA 1J3PA 1SFPA 1GWKA 3OPTA 4BXFA 5FYCA 1LOGA 2HWC2 2CNAA 5A1AA 5BNOC 5C8WA 3AC0A 4Q4Y1 3E6DA 3FBMA 1CPNA 1PZ7A 3I3EA 3OBRA 4QB6A 3HQUA 4NWWA 1KEXA 3PVOA 5CVRA 2WQ8A 1YFWA 2Y6GA 5A33A 5FZOA 1DLCA 3AZXA 3CL1A 3CF6E 3ZXGA 3WW4A 2ZGTA 1ACCA 1IQAA 2AGSA 5KHJA 1AYN2 1NLRA 5J09A 2JENA 3ZOIA 4EQVA 3GBFA 1J1LA 3S0MA 2Z4FA 3H50A 1FOD2 3B02A 2BFUL 2VQAA 1H30A 5FPAA 1Y9QA 4UFJA 1WD3A 1IG0A 2OX0A 4PLNA 5CNAA 5FZ6A 3EHKA 3OG2A 1KJLA 4PIXA 4AGRA 5FFOC 3TEZA 1DGRN 1DLLA 1LOFA 1CX1A 2AEYA 1ASJ3 5FQ0B 4NIIA 3MIGA 3ZYGA 5A1LA 1OF3A 4TXWA 2XL9A 2JECA 1LOCA 3AZVA 4MHUA 2YC4A 3WDUA 4BDVB 3Q8EA 1LHWA 2WAOA 3WOGA 1YIFA 4ONUA 3AYDA 2WLPA 4XQ4A 5FWEA 5KXEA 5SV5A 1A6CA 1BMV2 4EN0A 2R0HA 3EO6A 5DAVA 3UKNA 2ZZJA 4E8DA 2Z69A 1GU3A 4KWJA 2EIDA 1GP6A 5BNPC 1IS6A 4FAGA 3K51A 3HT1A 4OZXA 1I6XA 5HI0A 3MICA 3VBHC 1MS8A 3ZFEA 1JHNA 4XMIA 4FP2A 3A0KA 3DCQA 5GLUA 1S0FA 1AR91 3RI9A 2EIGA 4FXKB 3O1UA 5EPAA 2WNEA 1LHVA 3FX3A 3PUHA 5JXIA 2ADDA 3B5LB 3CEWA 1ZBE2 2FBEA 4A45A 1DGLA 1JW6A 2GN3A 2ZCWA 3T0AA 2WNUC 2O14A 4BQ4A 4W6WA 2E7TA 5FZBA 3ZYPA 3GZUC 1SQ4A 2ZX1A 4CCOA 2ORZA 4H55A 2Q8DA 2VOWA 2FDGA 3LCPA 4MGYE 4QB1A 3WP3A 5FUNA 1JYWA 2R30A 1DF0A 4HANA 4N43B 4IEOA 3BYWA 5L73A 4ARXA 2ZGMA 2O8QA 4BISA 2GNBA 5IK7A 3MIFA 2EA7A 4FPKA 3TNQA 4TWTA 1TME2 3AL6A 4NUBA 2A7AA 4Y1VA 3B01A 1UY4A 5GLWA 3I2GA 3LKJA 4GULA 5KXCA 5FKCA 5CAZA 2OW4A 5K7PA 3AM2A 1VP6A 4XFHA 1F5JA 1GMMA 4QQLA 5GLVA 5F3GA 1OUSA 2I74A 5JMCA 4LUKA 5E88A 2VR4A 3MUZ1 1GQGA 3CHXA 3OEBA 1OA4A 2WNVA 4AI0A 4XDPA 1N3QA 1VRH2 3M1HA 1YWKA 2ARAA 3ES4A 2B46X 3F95A 1I3HA 2E32A 2GDFA 1O7FA 4RL7A 5EHDA 3VBFC 4CP9B 1VBB1 2XB6C 3U4XA 4HPKB 4K1YA 2HWC3 5FXXA 4AGVA 2WFF2 1HX6A 2IVIB 1N1TA 3N35A 3ZXDA 2BVVA 2BVBA 1QQP1 2B7YA 5T5OA 2XJPA 2GNDA 4S2FA 5KC5A 1RUG2 1W8HA 2PHFA 4F8AA 2C9AA 1G7YA 1NG0A 1ODMA 2W95A 4IE0A 2CL2A 3MGUA 3R4SA 4XTPA 5JXGA 2A6WA 1WGPA 3L9JT 3KHCA 2FDKA 1ZRDA 1DYKA 5ISLA 2PAEA 1OSGA 4I02A 3R0RA 1VAKA 2H0VA 3I59B 4LKFA 4QWNA 1HXS1 3BKZA 2XLGA 1ND2A 3BPZA 3CLPA 4XIKA 1HKDA 1NA1C 1YQ6A 1J58A 2XUEA 1YLLA 1YQ2A 1Q3EA 1SZBA 3OGRA 5DUWA 4CCDA 1ULCA 4W8JA 4XURA 4BQYA 2OPWA 5FO9B 1RUH1 2RJKA 2VNVA 4BQWA 4CEYC 4X8PA 4Y26A 2EVXA 1AZDA 2LTNA 1W06A 3H0OA 3VBOA 3PLQA 5FZ1A 4E2GA 1HRI3 3AB0A 4LNVA 3LFIA 4FXGB 5DDJ2 3AP9A 3WINE 5C3RA 4IEPA 5HCBA 2ZAAA 1YFYA 1OOPA 3CIHA 5EQUA 3ZXJA 2HEWF 3K75B 2RM22 4LJHA 1H6XA 1D0HA 2BERA 1AYM1 2W52A 4N9HA 1AL21 2CGOA 2YGMA 5F37A 1PGL2 3OB8A 3DXTA 2EF6A 2YZ4A 2P6HA 4J1WA 3DKQA 2P2KA 2PTMA 2YBPA 4FFGA 2QQJA 5C70A 1VB4A 1AUYA 1NCRB 2VOTA 3D4KA 3MPBA 3NAPC 4R9CA 3ZYIB 4FTSA 4EJRA 2WINB 3IMMA 2XL7A 2W1QA 4BQ1A 4A4AA 2X5IC 3VBRB 4GA9A 1JYCA 3IZOA 4MGSA 2JDNA 2Z5WA 2OQ7A 2OT7A 3H7JA 4JV4A 4P9JA 3UETA 3PJYA 2DURA 2JDUA 4N53A 3H8XA 1W9SA 2HWB2 2OUJA 1MQTA 2WDBA 4AHXA 1HN1A 3WG2A 2GC0A 4DRVA 3HEIA 5FZ9A 2VG9A 2W87A 4FQ4A 1C1FA 3H42B 1YXWA 2RVAA 2ZOEB 3Q8FA 1CJPA 4Z82A 4I30A 3TN91 1NLSA 4QPIB 4ZPIA 4YVWB 1TME3 2WZR3 1POV1 1PGSA 5EZWA 4Y1YA 4A41A 2D43A 2D3SA 1W6OB 2DUQA 2R042 3WQ0A 4COYA 4NIAA 1KQRA 2VTFA 3VZNA 2Q1FA 2C9KA 4XAAA 1QGLA 1FPN2 5A3MA 5FZEA 1VBA2 5JLVA 4FPCA 1LENA 1FT9A 1XYPA 1VRH3 2DYCA 5FKBA 5AC92 3FL7A 3GZEA 5A7WB 3SNMA 1CAVA 3ZSLA 3E6CC 3FHIB 3O1VA 5F5CA 5FZ8A 2C6SA 2XDVA 4LBNA 4L11A 3IDAA 4AEMA 2PYTA 5KXBA 1ZYBA 4K6BA 2UYBA 4JAAA 4UT5A 5HBAA 1RITA 2VOKA 4NN0A 5BYNA 3ZN6B 1TMF1 1VMFA 1VMHA 1H4GA 1ZZ7A 2WUHA 3RSJA 1CPMA 4YZ2A 2Y38A 4FFHA 3ZYHA 5A3OA 4QKDA 4QDRA 1MS9A 1Y9GA 1ZRRA 4YGBA 1RUG3 3RI8A 4CCJA 2JIJA 1HB3A 4RD7A 3KV4A 4DOUA 5IVJA 1V70A 5FP8A 2HBUA 2ZGNA 5FYZA 2OVUA 5FMOS 5LW9A 5FTTC 4OHXA 3VDBA 4AVAA 2VMCA 4HBNA 4O7XA 4HFSA 2DWRA 3J9SA 4AVVA 4AEDA 5A3LA 3N7LA 4HG6B 2VH9A 4XFIA 2ZPXA 1PGW1 4TSVA 5JOXA 4NHKA 4BM8A 4M0NA 4IEYA 4DIQA 2E51A 3HVDA 1BEV2 1HRV2 1OVPA 2PHLA 1U0AA 3IAPA 4RR3A 2B42B 4Q4V1 5ACA1 3SCGA 3T2PA 1I9RA 1WLTA 2WIIB 3CZUA 4CDUB 4XQDA 4CPBD 2QBXA 5LK5A 3SKVA 1VAMA 2PAMA 3I2JA 4IW3A 1XB9A 1QJY3 2QQIA 4D6RA 4DPNA 1UYYA 1GOHA 5J36A 2DBIA 3WDVA 4IEVA 1SLIA 4G4FA 3GJAA 3AP7A 2BBVA 1QJU1 3CQOA 4XUPA 1D0GA 4MX3A 1SEFA 3LGRA 3OPWA 3AJYA 4BMBA 3CJXA 5FZ4A 2JD9A 3A23A 4YZ4A 1ZX5A 3K46A 5FIXA 4GWJA 1S0JA 3IM0A 3POGA 4M00A 5FPBA 3WDYA 4BU2A 1X8MA 1CJDA 1K5MB 1MEC3 2HEYF 1OLQA 2NMNA 1J3RA 4ATEA 1GOFA 1O3SA 5JZGB 3SHRA 4RFRB 2W46A 4OUMA 2KXLA 1UNBA 3ZPYA 1MZ6A 2A71A 2J7MA 3AMQA 4LIUA 1CGPA 2BQPA 2VQUA 3W59A 3PVBB 5F6LB 1H8TB 5LATA 2D44A 1QH7A 4WM7B 4AE2A 1RUOA 2R1DA 2ZGLA 3IN9A 1QMJA 1E5SA 1EV12 2R043 2VUAA 1LOFC 3JCIA 1DGWA 1H1MA 4QPGA 5DPNA 2OYZA 2YXSA 3FE5A 4H2AA 1GQHA 1FPN3 4GJZA 1VBA3 4B4RA 2GALA 1SFYA 1W8WA 1CQ9A 5CKNA 2ARCA 5C3SA 3OD0A 1PX4A 4OUSA 1S4CA 2XJRA 4AFMA 4RQPA 3AKPA 4LORA 1BBT1 4FVVA 4OQ9A 5LA2A 1REFA 4IGPA 3J26N 3ZMOA 3UESA 1ZBA3 2Q4SA 2BDRA 3WR0A 1RMU2 2NYYA 2WLQA 1AHSA 3SEEA 4K9SA 3ROUA 4DS0A 3O14A 2JB8A 2MEV1 5GLTA 5JOYA 4XVHA 4Q26A 1W6NA 2R062 1HRI1 3AKTA 2YHJA 4LBQA 4LHKA 5IJRA 5A6XA 1OXCA 5DABA 4CU8A 1DCSA 1OT5A 1KJRA 5FZMA 3WQ7A 1OMIA 2W2IA 2RV9A 3D82A 3VKNA 2BGPA 3BU0A 1TE1B 3IIAA 4AI8A 3M3CA 3ZKYA 1RB8G 4CXXA 3O7OA 4KBZA 4Q0VA 4EWDA 1D4M1 1CX4A 1YHFA 3THDA 1O5LA 2D6LX 1N1YA 1NCRC 1IKPA 1T6BX 1ULFA 3C7FA 4HOOA 3ZSJA 1H4HA 1UOGA 4YVSB 2ZGQA 4DMIA 3PMSA 1XPWA 1CZTA 3N9NA 5L9RA 1TZOA 3ZX7A 3MHZA 4CEWB 1K12A 4QD2A 4AI1A 4L2NA 1CN1A 1XE0A 1LAJA 4WVMB 2ZX3A 4A6SA 1MR5A 5L19A 1NQDA 3KF3A 1UMIA 1GANA 1S2KA 2JE8A 4MZUA 5JXHA 3TEYA 4F83A 3B3QE 4LO8A 1YO8A 2UWCA 4XHBA 4YW5A 3KV5A 4YVWC 3ACLA 4UFLA 2Y34A 4INDA 4XXPA 3ACGA 2WZR1 1OPMA 4HVQA 3N9LA 4RSUA 4E8CA 1W90A 3WNKA 4KI5M 5A7QA 1W99A 2QCSB 4AK3A 4DXSA 2J1TA 3NNGA 3N7MA 4A2UA 2DVFA 1JZ7A 1OLMA 2DV9A 3WEZA 2ZEWA 4MLOA 2A1XA 2JDPA 3MW3A 5FP7A 4JTOA 4XUTA 5F3EA 4DXRA 4ZHNA 1UYZA 3RFRA 5C4WA 2IZWA 3O12A 2PHDA 5IT6A 5C8CB 3SLIA 5FPLA 4OHZA 3WG3A 3LPGA 5JMOA 4PI0A 3B7MA 2F4PA 1G6NA 4LBJA 4U2AA 1C5HA 2VPVA 2VCAA 2W5FA 4OI1A 2ZKLA 3WZ1A 1UMHA 2GC1A 1LTEA 4IQPA 2Z79A 4CDQC 4E2SA 4R4XA 2HYXA 2VZQA 3OEAA 5CFDB 2P3IA 2GH8A 1PM7A 3O1TA 2WA4A 4JQRA 5C9AB 1IOAA 2WYFA 3NRUA 1UAIA 1BVP1 1XYNA 1NY71 4KQ7A 5IW0A 4E4HA 1H6YA 1LGBA 3VBOC 3H8OA 1A8MA 2RR13 2CSGA 1W6QB 5IVYA 4E2QA 4Y4YA 5FZDA 2XJUA 2FDFA 4FSJA 1XNAA 5T50A 3RG0A 3V0BB 3RZHA 2R073 1CAXB 1RMU3 2P1BA 1BXHA 4QQHA 4EN6B 2VOXA 1LEMA 1GV9A 4XFCA 3RJRA 2IFRA 2R063 4CDUC 5C3QA 2YFZA 4QX0A 1VPHA 3VBUA 5ABJB 5J96B 5EWSA 1KS4A 1NQJA 2BJSA 5I91A 1HJGA 3JD71 1QJY1 3KHBA 4QX8A 2VMIA 1K42A 2VVEA 4EN8B 1WW4A 3AYCA 3EXUA 2WWSA 4RHV2 4AOCA 4QHBA 2DCTA 3KT7A 2YGLA 4QXBA 3KV9A 3FC0A 4AYUA 3CJIA 4TTGA 3U0ZA 3N3HA 4CUAA 1RUC1 2DCJA 3KQRA 4YG0A 5JOWA 2VOVA 1QWRA 3MPPG 3N9MA 5FYIA 4LLFA 2VZRA 2XJSA 3VLBB 4YW2A 2XGXA 2VZSA 4MO3M 3LFMA 4QMAA 3WDTA 1EPWA 3BVCA 4BE3A 1K5MC 4B3NA 2JEMA 3D5OA 3LSDA 3R6SA 4I0BA 4C0BA 1D4VB 1V6JA 4UBGA 3HNYM 1B35B 2DTWA 4CRQA 1L3JA 4FI9A 1ZA7A 4FPFA 2LM3A 4I3GA 5FXWA 1H8TC 1P8JA 1ZZ6A 3JQWA 3ACFA 4BOWA 4FOQA 4WM7C 2EXKA 1XNBA 1MZFA 1OFNA 4Z92B 2BNOA 3ZXLA 1HV0A 3KM5A 2BUKA 5FY5A 3VN4A 5FYUA 3VBHB 1PO11 2RMU2 3FHQA 4LPLA 1F15A 3ZXEA 2A3WA 4XUOA 3WF4A 4Q4W2 3ACIA 5HCHA 1YC61 2WYSA 1G8WA 2ZMLA 3NWKA 4XJ8A 4BIOA 4WVVA 3AK0A 2KM2A 5ERLA 3LPFA 5E1RA 5H9RA 5HCFA 4E4DX 3I2KA 3OY8A 1WLDA 1ZZBA 1O5UA 3P5BA 1CAUB 1RUI1 3AFGA 1WW6A 1ZBA1 3WVJA 5GLZA 1AYM2 4ZXKA 1QXPA 3PVEA 1HIXA 4NJ4A 1CAWA 4CA9A 1PIV1 1CIWA 2QQKA 1V6NA 3NQHA 3B94A 3M70A 2OPKA 4K8RB 1TQ5A 3GZAA 4JDNA 3THCA 4AEDC 1WMDA 2IFWA 1JODA 1XJAA 4HL0A 5FREA 3RZZA 1CVNA 5I0SA 1JU3A 2ZGUA 3OYWA 2GH2A 4S2DA 1PZ8A 1OD5A 4V2WA 5FYMA 2JDAA 5BUVA 3LDKA 3HIFA 3U4SA 2P37A 1V6KA 2OZJA 1XE8A 4YVSC 1H1IA 1DYPA 1AF9A 1WUVA 1Z7S3 4A42A 2WA3A 2WL1A 3VD3A 4PDWC 2C0ZA 4Y1ZA 3MZHA 3MEPA 2FDIA 3T3YA 4LO7A 5BV6A 3AP4A 2DU0A 2HWD3 5F2WA 1W8NA 4ZZ8A 4OUEA 3HWJA 4DUXA 2W9XA 1CONA 3ZFFA 4H3WA 3ZN4A 5BNQA 3IBMA 3WSOA 5KC6A 1WCKA 2JD4A 5TSWA 5DAXA 4UF0A 2R6QA 3V0AA 2QQPA 2D98A 2QFEA 4ISRA 4OYUA 1HQLA 2XXZA 2E33A 4QXKA 3A22A 4RGKA 4X6QB 5CG9A 1N3PA 4GMP0 5F5IA 4QM8A 1X9PA 4GALA 3NKTA 4MXVA 3K4AA 4LQRA 1TEIA 2D97A 3T1LA 1QNYA 2DVDA 3FN9A 3U1XA 3RNSA 1QJX1 1QH6A 4FP3A 2PHTA 4MUVA 2Y26A 4GD4A 3POIA 1W6MB 4XQWA 4WVWA 4YM3A 4AGGA 4XFAA 4XBQA 3POFA 2VBDA 4YGCA 1B09A 1NA1B 3JBG3 3I97A 5GZGA 3NJZA 4GH4A 5C8CC 1NCQC 1YQCA 2O0OA 1HQNA 1XOYA 2XG3A 4XUQA 4R9BA 4P5HA 5CKQA 4CEYB 2VW0A 1CIYA 3BU7A 1W2NA 3I7DA 4YW1A 3DEMA 1W28A 1G9DA 3QCWA 1WA4A 3I3MA 5LBEA 4XFGA 1FATA 3JZVA 5I8TA 4RGAA 3H7YA 1JN2P 4HZFA 1RUJ2 1UD1A 3I2FA 1IS5A 5D21A 5FK7A 4GKYA 4NHXA 5GALA 3A0NA 5C5TA 1PX3A 5FV3A 4AQTA 1W8ZA 2X29A 2X53S 4UXAA 5CFDC 4QT6A 1YJLA 4TZDA 5M0TA 1QF3A 5T5PA 5C9AC 4WM8B 1C5IA 4YG3A 5IVVA 4PIZA 5A7PA 4XW3A 2RMU3 3T4HB 2VMDA 3T0BA 1UZYA 4EROA 2E7QA 2XOMA 2ZHLA 4ZONA 4YW4A 2VMFA 4Q4W3 5F5AA 3LOIA 3SQOA 5FZFA 1GSLA 1RXFA 2JG8C 2RR11 2YPJA 3O5SA 2X5IB 3N9OA 2AYHA 1AR62 1IQDC 1R1A3 3AVRA 5CA6A 3E1F1 1AR72 1WCQA 2C4XA 2R071 1W6PB 3LSEA 2C24A 3U37A 4BZ4A 1H9PA 4QPYA 2AR6A 3AKRA 1AX2A 2OZ6A 4GB32 4IGQA 5FR3A 5ABJC 5A3NA 5K0UA 4ZU7A 2VW1A 2WS93 1N1VA 1XRUA 5ANQA 5FZGA 4MG2A 2P17A 3N7KA 1GZWA 3KD4A 4MYEA 4AF9A 4MHRA 1S0EA 4C1XA 1MS0A 2DCZA 4M4RA 1Z78A 5FP9A 2K2SA 4ASKA 1PMIA 1VBC1 3FLTA 4IGOA 4ZS2A 1G9BA 3Q8CA 1DBNA 2G19A 2ET7A 3DPRB 1J1TA 3WG4A 2TUNA 3KGLA 3SKJE 2CV6A 5BPXA 2HBTA 1UWWA 2VECA 3VBSB 4ARYA 3F2ZA 2PQQA 4M01A 1RVF1 1D7PM 4MADA 1AR83 3MLJA 1C57A 1CESA 4JGZA 2A73B 4XF1A 4WZFA 1B35C 4Y20B 3MYXA 3O0VA 3NNLA 2WSVA 3HJRA 4LBKA 1A8DA 5HV0A 5CFCA 2WABA 3CNAA 2W1WA 4P9WA 5C7GA 3APBA 3UJOA 3VDDB 5JAXA 4Q4X1 5F5QA 3URFA 3GCXA 5T52A 3RZLA 5APAA 4E9KA 2VE1A 2GU9A 3ZM8A 4P9IA 2JG9A 5K8SA 2JE7A 5JVVA 1QOTA 4PI2A 5IWFA 3WQBA 2AREA 3PL0A 5DZFA 3E5QA 4AHYA 4ES8A 3HMYA 3AVSA 4B29A 2XVLA 5BNNB 4ASMB 2XVGA 2RDSA 4LKSA 1RUJ3 4KGGA 3T08A 4W4ZA 4V2VA 5JR2A 3RS6A 1OLRA 2SBAA 5AVPA 1Q8VA 5EXOA 3RWNA 3RYRA 4IV3C 4SBVA 3OF1A 4KGQA 3OSDA 4XDOA 1GICA 1D2QA 5K9YA 1GBGA 1NUKA 1NX9A 2PELA 2RS52 4FBFA 4HMZA 1H9WA 4NMIA 4OLLA 2X8KA 3GHMA 5FYBA 1IPJA 1PVC3 2ZHKA 3QD6A 3WUDA 2WQZC 1WZXA 5KXDA 1QOSA 3M2MA 3WW2A 1FNZA 1KITA 1BLZA 1Z7S1 3QH7A 3WW3A 2P3KA 2VZTA 1MPXA 2Q8OA 4CDWC 5KHIA 1LESA 3VBRA 1AR63 1JTZX 2QDRA 3ZR6A 1DHKB 5BY5A 2X05A 3O1OA 4NIDA 1RJ7A 2NP0A 5A33B 5FZOB 2QUOA 3BB6A 5IATA 3A21A 4GB33 3PNAA 1XSQA 3LEKA 4CTEA 5LA1A 2CWMA 4KBBA 2J42A 4JRAA 4P08A 1WBFA 4R9DA 4QPIA 3CZJA 1RUD1 4XXAA 1C28A 3LDBA 1W6OA 1AYN3 4BLIA 4EN9B 4N7UA 5F9TA 2FZ1A 2YBKA 5J37A 3VHPA 5C6CA 1T6GC 1FOD3 3VZKA 3E5XA 4S2HA 2DBNA 4I3PA 2WJSA 2VUCA 1H2NA 1R081 4NOTA 5JCTA 2RS31 4JGYA 3NVCA 5FBJA 2OA2A 1RUF1 3HAGA 2JKBA 3JBG1 4ES9A 1FX5A 1I1EA 1BZWA 1RHI2 4RGGA 2VNGA 4Z1VA 4Q2FA 3H3UA 4JC1A 2A75A 3UL2A 3BGAA 4A6OA 1UYXA 1XXNA 2VQ0A 4HVRA 5CZKA 4OVEA 5FUPA 3ZN6A 3M4FA 5IFTA 4C1WA 4HSLA 1SLCA 1UN1A 1VE0A 1FMD2 5FYHA 3POBA 5KWRA 2GNMA 1PNFA 2DCYA 2WN3A 4IERA 5D1IA 2VMGA 5K4LA 2ZHNA 4HK9A 2WFPA 2DDUA 1DGRA 2R49A 4WM8C 5FZ7A 3O1SA 1MS5A 4IEZA 3JU9A 2X10A 2UWBA 4ORFA 3VZOA 2JE9A 4PBPA 4RS5A 4AFBA 1C4RA 1QXJA 5A7NA 2HWF1 4H14A 4P9LA 3NV1A 3MFAA 1E5HA 3N36A 4KH9A 1UY0A 4EWEA 5LWBA 4A3XA 1ZBE3 1NXD1 2QQMA 3MBWA 2HWE2 1F4AA 3ABZA 3JQXA 5A3PA 2XBO2 4ASLA 5JDBA 2VC9A 4NPRA 4OULA 3ORJA 3RMXA 1KGYA 1YYNA 4AFAA 1NOVA 3WX5A 1UX7A 3FWEA 2K0GA 1F31A 2V5DA 3U75A 4AAPA 1AX0A 2CAUA 2XQRA 1WLWA 4KU8A 4KWUA 4RFT0 4CXYA 2WAAA 2WS91 2WNVB 2B5HA 2E7AA 3EB7A 3RZMA 3RZKA 1WMXA 5JIUA 5FAXA 2WKKA 1YCIA 1LNSA 5E89A 1IS4A 3H8RA 1QNWA 2RS53 3MF6A 3WP4A 4XBNA 3ZSEA 4QAWA 5J3UA 4FTEA 1ULEA 2WBKA 3FJSA 3IPVB 1W04A 2XLAA 5DG2A 4D0QA 5AFBA 1BVVA 2PHXA 3DPRC 3WF1A 2VZ1A 2NZ9A 4K8FA 5FYYA 3W9AA 1JU4A 3VBSC 2IXIA 4HETA 5JSRA 1YUDA 3AXDA 1ASJ1 2A6ZA 2FMYA 2PA7A 3NW4A 3EMRA 4P14A 2PQSA 4GKXA 3J7HA 1QY4A 2WFF3 2XMLA 1JS9A 1S2EA 2DVBA 1AR81 4NHYA 4S2GA 4CCCA 5JZGA 2W3JA 3MO4A 4HN1A 2QKDA 4GIQA 4KG0A 1M4WA 3FUOA 1ND3C 2C26A 3WNPA 2PLV2 3VHRA 3M3EA 4XBLA 2ZX4A 5D8AA 4I2OA 1ND2B 1WW5A 2XLFA 3KV6A 3AFKA 4G3YC 3G6JB 2HYKA 4JCKA 3VDDC 5J98B 3W21A 5B4NA 4CCKA 5E16A 1RC6A 5ACA3 2NMOA 4JTNA 2D3PA 2WT2A 3LEIA 4AI2A 2UY9A 1FNYA 3POJA 4D7YA 1PM4A 3CMGA 5FZLA 4PBOA 1VBD2 3VBOB 5C33A 1GYKA 4ZXEA 4HLTA 2XH6A 2YY1A 4L8QA 3S5QA 2CDOA 1XBFA 1LGNA 3J8F2 5FYSA 3O1RA 1RHI3 1H2LA 3QLQA 2XHKA 1GR3A 3ZPOA 3VB9A 3ME2A 4JDMA 2VCBA 5JI9A 5LRSA 3BN6A 4AEKA 4PLOA 5E8AA 5BNNC 4Q5OA 1OPOA 2QE3A 1W05A 4JHTA 3ZFGA 4RN5A 2Y6JA 1V9U2 5DDJ3 3VDAA 4IXLA 3IAQA 3H9AA 4UOJA 2BGOA 1FMD3 3UYJA 3ELNA 3MIBA 2OKXA 3L2HA 4SLIA 2WO2A 1US3A 1XNDA 2VAUA 4IV1C 3WNLA 1PO22 1PK6A 1V6LA 2RM23 4Y1XA 4Z8BA 4M3CA 3BI3A 2VL4A 1ST8A 1JXNA 2W08A 3WUCA 1M06G 2FZ2A 1DQ2A 2PHRA 3ASIA 2KA3A 3H1MA 2PMWB 1EAH2 2Y6KA 3KVBA 4J25A 4XABA 4B4QA 3TOJA 1HW5A 1PVC1 1RXGA 1SPPB 3FFQA 3LD8A 4GJYA 4D6QA 4DUVA 4XJUA 2OIIA 3JUUA 2EXHA 1COV2 3TRSB 3OUIA 4IE7A 1NE6A 3WHTA 1R092 2HWE3 4D94A 2VUJA 4WVMA 2XPJA 4UW6A 2HWB3 4L0PA 3I2IA 4CDXA 2VTXA 2HWC1 5FP4A 5EYYA 1QJX2 4MXWB 3KGZA 4OZOA 3P3PA 5AVAA 2MNGA 1LHOA 3MV11 3ATGA 1SLAA 3FBYA 1QIQA 4N7IA 1WCDJ 5LRRA 4XEZA 1POV0 2AC1A 3K2OA 3PTYA 1URXA 2QDNA 2LALA 2V72A 1XNCA 3DN7A 4E27A 5EIYB 2CDPA 1AYN1 2WR9A 1CD3G 4GAZA 3A4UA 3TAYA 4NROA 4ZU5A 5FY9A 1X8EA 2ZAHA 3KT1A 4HXCA 4O9EA 3W5NA 1V0AA 2EIBA 2G9GA 2VXJA 2R7EB 4AI3A 4DNYA 5AC93 2I45A 3KS7A 4LHNA 3GALA 5FMOL 5I0TA 2RS12 2D6KA 4F7ZA 3ST7A 4Y24A 2YUEA 2G4IA 2YFUA 4UFMA 5FZ0A 4KWKA 1VBE2 4LBOA 2D5FA 2J1VA 3C2UA 2RE9A 2B39A 2G9FA 5FY7A 4B1MA 3BCWA 5FK8A 1OA2A 1WKYA 3PUAA 3DYMA 2AH2A 1GOGA 2P3YA 2WSUA 3ZFEC 1D2SA 1Q56A 3SISA 4MGKE 5JWPA 5F6KA 2E63A 1RUE2 1W03A 1C8M2 3AKSA 3D3AA 4GWIA 1MS4A 4AHWA 1BMV1 5T5JA 2UWAA 4OFGA 4QDSA 4AEDB 3RMYA 2CGNA 1AX1A 3LOBA 1W8OA 1ZNPA 2QQLA 1S1AA 1NAEA 3DGTA 2LUWA 4EYUA 1ZZ8A 4EZ4A 3HD8B 1CWPA 2JKXA 2VU9A 2XKOA 4COUA 4LLOA 4M4PA 4XJ9A 1VBD3 2XKPA 2EIEA 1OQ1A 4RA0A 4NAOA 4RR3B 1EP0A 4PDWB 4META 1S0DA 1S0GA 2XWBB 1US2A 1PMHX 4Q4Y2 4PIYA 5DUVA 1ZBE1 2W92A 3AL5A 2CAVA 5L7OA 4NR1A 4IL7A 4DZGA 4JHZA 1BEV3 4ZY9A 3VL8A 1WCSA 4E4SA 1HRV3 2VMEA 4L99A 1OH3A 5BNOA 1DZRA 3AJZA 4YW7A 3FLRA 2GMMA 4OMDA 4QGMA 5FXZA 3TEWA 1Q5OA 3OBZA 4W6XA 1LRHA 2WNVC 4N8MA 1PO23 1UY1A 5T3NA 3DYPA 1TME1 4Z07A 1OLME 5I93A 2ZMKA 1ENRA 4NIHA 4ZU4A 1JMUB 4P5YA 4K7JA 2VW2A 4OI2A 1EAH3 1IPSA 1W2AX 1S55A 3HR9A 4D8MA 2VZPA 1KS5A 3WT3A 5F32A 2AEZA 1F4HA 1R64A 1XNKA 1VRH1 1COV3 3BALA 3MLLA 5FY8A 2PXJA 3HOBA 3ZMNA 4OI0A 1R093 3T09A 3RYPA 5F39A 4Q8KA 2ZA9A 3M8LA 3NMBA 3LEMA 5FY1A 3UGFA 1NCQB 2JB4A 4COZA 4DUWA 1KRIA 2WZEA 1T2XA 2IXCA 4BK4A 2WFF1 2JICA 2ZMNA 4PT6A 4Q4X2 2IWGB 4QPGB 4CUGA 3GHNA 2BOIA 5DZEA 3OBAA 1LU1A 1V6IA 2BZDA 3POYA 4NWVA 1AR92 1ND2C 4NAMA 4JGYC 1ZRFA 1GWMA 1RUG1 2ETEA 2VNOA 3RPQA 3W20A 4CUBA 4D7TA 1YIPA 4K20A 1EV13 4XFBA 4DEVA 4RQPB 2Q30A 3ZN5A 3AZYA 5BNPA 3UKVA 3H1YA 4H7LA 4YPJA 4BCUA 1BJQA 1GNYA 1WMEA 3GGLA 3VBHA 2MPFA 3IT8A 4CSWA 1YFXA 3K3OA 4NO4A 1F5FA 3NV4A 1JUHA 4AQ6A 3RQ0A 4BXSV 5JOZA 1GQPA 1K5JA 1UZ0A 2RG4A 2RS13 1W6NB 2JG8B 1XSRA 3CBNA 2BEOA 3ES1A 4LBQB 2GP3A 2Y33A 1OOPC 4XDQA 4GQ7A 3PMEA 1UXZA 1VBE3 1Z0HA 2DVAA 2R16A 5A80A 4XC9A 5GM0A 1CAUA 1ENSA 2WNUA 1LEDA 3D0JA 1LHUA 2YDEA 3B9IA 3INAA 3KF5A 4Q0QA 5CISA 1NKGA 1DQ5A 3MIEA 2LROA 2R1BA 2GNTA 3VV1A 1RUE3 1DYOA 1C8M3 1O91A 4FCAA 1ULGA 4X6RB 5DDJ1 2ZTNA 5FLHA 3THTA 3K77A 4OMCA 3WDXA 2J1UA 1AJKA 2W91A 2RM21 5FMDA 2XJQA 5E6HA 2O1QA 5LEKA 4I09A 2BNNA 2WC2A 1PGL1 2ENRA 2ARXA 2BPA2 4P00B 1G86A 1VBB2 4N53C 1W2OA 1L7RA 2IXJA 1A78A 3RDIA 5LY1A 1MQTC 4NHLA 2YU1A 1FAYA 4QHZA 1LGCA 1ENXA 2LS6A 1W0OA 1QQP2 4MGZE 1FV2A 1C3HA 1GLHA 1SBEA 2WT0A 2IXHA 3VBFA 4A44A 3JB4C 3W58A 1MEC1 2GC3A 2HWB1 3E6BA 3B69A 4L9BA 5FZKA 3HQXA 4IEQA 4DQAA 3IDEA 1C1LA 4FPYA 4IEXA 2A6YA 4MV2A 5A7SA 1HXS2 3L2YA 2D3RA 3BTZA 3C7GA 4XHXA 5F8PA 1BHGA 5FZCA 5C4WB 2R041 2VZOA 4I0WB 2WN2A 3OTFA 4A3ZA 1RUH2 1SDWA 1FV3A 5IAXA 4URTA 1FPN1 4MOAA 3UV9A 1VBA1 1W6MA 3QOPA 1J83A 4NRQA 4UW3A 1PHMA 5DAWA 5DZGA 2JX9A 3T4VA 4HN0A 4L97A 5AC91 5F3CA 3KWVA 1O4YA 1XQNA 4YW3A 3VD7A 1DIWA 5EP9A 2VTXJ 1S0CA 2B9VA 4GXLA 1X82A 3CO2A 3FFZA 4YLZA 3WXPA 5IVCA 3KCCA 3ZIWA 4CEYA 2C5DA 2BOJA 3UJQA 4P9XA 1AL22 1GNHA 1SLLA 1O8PA 3PUSA 1BCXA 3AMHA 5FRAA 2W1SA 4PJYA 5IK4A 2BW8A 3RGBA 5HV4A 1OKOA 3DYOA 5LCWL 5CG8A 1SCSA 4IV3B 4CU7A 1DDLA 1QHDA 2D5HA 3PU3A 4Y22A 2UYAA 4QQ2A 4Y5SA 4XF9A 1U5XA 2JIGA 1NXMA 4LA3A 4UAPA 1V6MA 5GKAC 4RR3C 4BQ2A 3KQ4B 3NAPA 4CU9A 1JZ5A 3W5MA 4DXTA 1JZ3A 2Y6HA 3PTRB 3BPSA 1A3KA 3DL3A 4LBLA 1SFNA 5I8SA 1PNGA 3PJQA 1ULDA 4CDWB 3VBUB 2X5IA 3T2OA 3UGHA 3TN92 2ZEZA 2EXIA 3I3BA 2Q1ZB 4KL1A 3AZWA 1HRV1 1O3QA 1VRBA 3N7JA 2J22A 4AVSA 4ATFA 1EY2A 4YWAA 2E9QA 4YGDA 2J1RA 2VBPA 2AZ5A 2VY0A 3C7OA 2V09A 4Y4RA 3KMHA 4CDQB 1DG6A 3Q9OA 1UKRA 5CIRA 1HB1A 1VR3A 4LEJA 4CCNA 2VZUA 2CWSA 4FPGA 4RHV3 2CHHA 4XMAA 5A32B 1TVGA 1UMZA 2XR4A 3C7HA 3TWIA 4HVOA 3KVAA 2XJVA 3R4UA 1OC1A 4A7ZA 2WRAA 1KFXL 3HN1A 4J6GA 1TMF2 4Q0PA 1POQA 1YEWA 3WQ1A 4PHZA 1HJFA 1QQP3 2F4LA 1UYPA 3LWCA 3JB8A 4AVCA 5FQ0A 1BYHA 3ILRA 1U5YA 3NV2A 2BFUS 4JVAA 4NPLA 4Y5Z0 5C5UA 5LBCA 1SDDB 2FD8A 4Q1RA 1NYWA 4URAA 3SH4A 4QPGC 3VKLA 1Q8SA 4XZUG 5T55A 3S6PA 2VGDA 1ULPA 4PQQA 5I0DA 1GP5A 1GFF2 1UX6A 4LA2A 2NLRA 1HXS3 3POWA 1E5RA 4AVTA 2XONA 1ZZ9A 1JZ6A 3RWKX 1GNZA 2BWAA 4RQPC 4GWMA 3T2TA 1LULA 3PUQA 3S30A 1EV11 1PGW2 3USUB 1VB2A 3OY8B 1LJ7A 1RUH3 1ALYA 1UY2A 1UZVA 4CCMA 2FHRA 4QQPA 4PF1A 5T5LA 4CCLA 4BH9A 1GP4A 1LECA 2BU9A 5ACA2 4Q4V2 4LBQD 3ZYBA 4JX0A 3WNMA 2YBSA 3UK9A 3T30A 4A7YA 3AP5A 5DUXA 4IE5A 5JIAA 1UW8A 5FO7B 2EAAA 5B4XA 4C91A 1AYM3 1RMU1 2VBBA 1AL23 1NT0A 1DGWX 1SHWB 1WMFA 5I0RA 3I2DA 3VGIA 1Y4WA 1TNFA 2YC0A 2R061 2WT1A 4YSFA 2VVFA 3VD9A 3GJBA 3LA3A 1QJU2 4N43A 1VLNA 4YYOA 4CPBA 3OGGA 5LA9A 1MS1A 2QTWB 2TNFA 3CU7A 2ZGPA 1WD4A 2ET1A 3WG1A 3LQCA 1APNA 1VIWB 2VCMA 3H3LA 5L7OC 4AR2A 4Z2WA 5LA0A 2BBAA 4W50A 1DZQA 3CKHA 2YU2A 4LMFA 4COVA 1OVSA 1UXXX 5HXMA 1UPSA 2F17A 2DU1A 4UFIA 4UF0B 3DXUA 2JDZA 3V0AB 3SCHA 3USSA 4CP9A 3TN93 1LCLA 4N90A 1KD7A 1U12A 3C8XA 3S5AA 1POV3 2VM9A 4QXCA 3M3OA 4GWNA 4HPKA 1UQXA 3WP5A 1WA6X 3Q8BA 1ENQA 5FPVA 4LT5A 3MV01 1JI6A 1F9KA 3OPZA 1JZ8A 1EUUA 4YW6A 3ZYJB 4AFCA 2WWUA 1O3TA 3GBWA 5FY0A 3LF7A 4YFZA 1ND3B 2Y6LA 2QZ2A 2NM1A 4YM0A 3NNJA 3IIIA 1QJEA 3WCRA 3OD4A 2QQUA 3GM8A 1AXKA 5C4WC 1JYVA 4C0HA 1XYOA 4QB2A 1QU0A 4GH4B 1BBT2 2RDRA 2WWJA 1LOEA 1W8FA 2IC1A 1YFUA 1ZVFA 4XAEA 3I59A 2DUPA 1RGSA 5JXJA 3J7MA 1TMF3 2MEV2 1HRI2 1W0PA 2K9ZA 2Q0AA 4HT1T 4ZKTB 1E5IA 1PVXA 4IE6A 1D4M2 5D2AA 5J1XA 4DO0A 3AMPA 1OUXA 2WZPP 4LOSA 1L7LA 4MH0E 3O1PA 1CR7A 3MI8A 3EYPA 4IV1B 5HPOA 1UZZA 3GDBA 1JYTA 4PCRA 2W94A 3B93A 4Y1UA 2P3JA 4UFKA 2E6VA 2GAUA 1LOAA 5FXVA 5B2GB 4N9IA 4ET7A 5DUUA 2W1UA 5FYTA 4EV0A 2ZZQA 1BQPA 4PLMA 5LBBA 4BJ0A 1JOBA 5J7MA 5H9QA 4QX1A 2B9UA 1NCRA 2DUOA 1XU1A 1AXZA 2Q1MA 1UU5A 5G04L 1OURA 4FOYA 2G1MA 4Q4V3 3WF0A 1JHJA 2GZWA 3GXUA 1TNRA 1GZ9A 3VBUC 1LOBA 3S57A 4Q0UA 5K0UB 4BMEA 4R4ZA 1AR73 2CGPA 2HWD1 1DZTA 3ZSKA 2B4KA 1GZWB 3MDPA 2WZR2 4XIOA 3ZXAC 3VZJA 5KHKA 5JUVA 2ZGRA 1UF2C 3VZLA 2GC2A 2Y0IA 3CJIC 3MIHA 5DQ0A 3C3VA 5IVEA 3DECA 1ULOA 1QJU3 1LR5A 1DFQA 3P1IA 3FLPA 3UNPA 4YVWA 1H8VA 2Z2SB 3NJYA 4MVTA 4O61A 1X7NA 3Q8AA 1U5ZA 2VD7A 3NKGA 1QDCA 4RHV1 4Q1PA 3T2QA 2HKXA 1U5IA 1UO9A 1HDKA 5FOBB 3IPVA 4LKDA 5A3TA 3ECQA 4JGZB 3NNFA 1F2NA 5FDBA 1UOFA 2H0BA 3NJVA 5A7WA 3ZO0B 5DMYA 4IDZA 5LASA 4QU1A 2FCTA 2OXBA 5DAQA 2WO3A 2FMDA 3AZZA 2QQNA 5CFCB 1DQ0A 3RZGA 4AZZA 3I3QA 1FXZA 4U36A 3R4DB 3WY6A 3IMNA 2VULA 1W9FA 3SMHA 2YB7A 4IESA 3LEGA 4OI4A 4XF3A 4YZ1A 1OI6A 1QOOA 4AHZA 2JJ6A 2TEPA 2PN5A 1GKBA 1S0BA 3ZFEB 3RJ2X 2EXJA 5KHGA 3HN3A 1NY72 1YQ8A 3SH3A 2HH9A 4YM2A 5EV7A 1V6OA 1W8UA 5DN2A 4DEQA 1VMJA 1STMA 4AAXA 4CP1A 2JG9B 2Z42A 2D93A 1XU2A 1IGOA 4CDQA 4XILA 5IYYA 1G9FA 4H7MA 1SLTA 3LB9A 4IEUA 1BBT3 4XZPA 2NPIA 5F2SA 2QNKA 2JDMA 2RMU1 3LZZA 4Y3OA 5L9BA 3GCWA 1L7QA 1QJZA 2D6NA 4BIFA 2A6XA 4Q4W1 3KT4A 5FY4A 2MEV3 1MACA 4JKMA 3HBZA 1WWYA 4NHMA 3ILNA 1AL0G 2HEVF 3KCYA 2J1AA 1N47A 1PMJX 2PHUA 4R52A 5FCCA 1O4TA 3U14A 4LTAA 2A5ZA 1R1A1 3TYJA 2GMPA 4DRRA 3ACHA 1JBCA 2ZJCA 2DFCA 1JZ4A 3JD72 1QJY2 3E97A 2CY6A 4AW7A 1CZSA 3GZTB 1D4M3 2AACA 1YNAA 3PHMA 4LKEA 1CZVA 4DXZA 2ADEA 2HLEA 3MW4A 3OGSA 5ANNA 4CDUA 3ZIXA 4QKNA 3POEA 2P5BA 1RUC2 2YROA 3NO8A 1WW7A 3MUY1 2E26A 2Q8EA 1Y3TA 3KB5A 2EICA 5A3WA 4P9YA 1YI7A 2BRTA 3MF9A 1LB2A 1DQ1A 4IETA 4YARA 1JYXA 3ZFFC 3AYEA 4I01A 3I8TA 2ZGSA 1JH5A 1SPPA 2XVKA 1MEC2 1SBFA 1UY3A 1X33A 4WVZA 3IWZA 4FFFA 1IS3A 4NRPA 2WO1A 1W3XA 3H3ZA 3I3DA 1C8NA 2IXKA 4BA6A 3VUOA 3OGJA 1K5MA 3WHUA 3HNBM 1Y7BA 1UKGA 4UW4A 4CU6A 5C3PA 4K1ZA 4MXWA 1PO12 5FP3A 3DKWA 3ZYFA 4JGYB 1H8TA 5FZAA 5A6ZA 2N7GA 1N1SA 2CYFA 1UU6A 4Q0SA 4WM7A 1EPZA 2JXAA 4GH4C 2VJXA 3RYKA 4BQ3A 3N9PA 2VZ3A 3K4ZA 3OOXA 1MS3A 3V56A 4CCEA 1RUI2 2XHNA 4W65A 1ZBA2 3U10A 5BXXA 4LITA 5L9VA 3AKQA 1PIV2 5IUQA 2UURA 3VD5A 1OOPB 1VAVA 4YGEA 1O59A 4G9SB 2YMZA 2HJIA 4M3CE 2ILMA 4DFSA 1YJKA 2FDJA 3WDWA 2D6MA 2FCVA 2KR2A 2ZABA 2L9LA 4QDQA 1OA3A 2OS2A 3ZR5A 4RS5B 2YC2A 4AQSA 1RUJ1 4HK8A 1OKQA 5DG1A 5GZEA 1JUIA 2YG0A 3GBGA 1W0NA 2WZ8A 3AP6A 4XJZA 5FWJA 3BTAA 4JRLA 4CP2A 1W9YA 4K40A 2RDQA 2GP5A 3AMNA 4B8EA 1XNTA 4N53B 4CYDA 3VD4A 3BIWE 1S0IA 3T0DA 2W39A 4M3CF 4R9AA 1MQTB 3J4UH 2FDHA 4YVSA 3SEPA 4IE4A 3VDCA 2XQXA 4D7SA 4QPWA 3BOPA 4PDWA 2NQYA 2VZVA 4XYXA 5FJHA 5GZFA 3BOWA 5F7UA 3PDQA 4CEWA 5K0UC 4N43C 4WZCA 1AR61 4GMP3 5EJ3A 4YG6A 2BGCA 2XBO3 1AR71 2V73A 5FZ3A 5IVFA 3JD73 2OUHA 2E53A 3E5UA 1W9WA 4LXLA 4BK5A 3ENRA 4FO9A 4NRMA 3KCXA 4GB31 4L92A 4BLJA 5H9SA 5J48A 3NV3A 3KSCA 1RJ8A 2J1EA 5EYXA 3SXWA 1OFSA 1RUC3 5L36A 2A6VA 1UL9A 2VO5A 1AVBA 4LULA 2DFBA 2ZGOA 1S2BA 2RJLA 3M3QA 1CAVB 1ZA4A 4XJAA 4MGIE 5CEHA 4PQ9A 4BYYA 2P34A 3O0WA 4ITCA 2QQVA 1FOD1 4JQTA 4JGZC 3TEXA 1UZWA 4K3UA 4QU2A 4XFFA 2E31A 4FTBA 1K45A 1BK1A 1J84A 1NLQA 4LHLA 4Q8LA 5JSOA 1KXGA 2LW8A 3N4MA 1HN0A 3FZ3A 4EN7B 5CFCC 3ILFA 3OUJA 5D8AB 3FHAA 1NCQA 4B7EA 5C8CA 1JYIA 3VKFC 2D40A 3JXSA 5FJKA 4KU7A 1VJ2A 4EWAA 4R8HA 3IKWA 5IAVA 2XUMA 2JDKA 3I4IA 3WV6A 1GZCA 1IPKA 3SH5A 1PO13 4FQZA 4LBMA 4XCBA 2PLV3 1SG3A 1H2MA 1ZRIA 2JG9C 4JDOA 2JDHA 2RR12 5CFDA 4MSVA 5LB6A 4UBHA 3EJKA 3O0XA 1HQWA 3HT2A 2LRPA 5C9AA 1H1AA 3K4DA 2BWCA 2R072 1RUI3 2Y60A 2ZX0A 4KNCA 4Q29A 4XE9A 3ZLIA 3M7AA 2UY8A 4DINB 3ZFGB 2P6CA 2IUWA 1PIV3 1LHNA 1ONAA 1O6UA 1W6QA 2A70A 4FOVA 3ZDSA 2JG8A 3J8F3 4FPOB 4DY3A 1BK0A 2AENA 3ZKUA 4PF5A 5HXVA 2AUYA 3V0BA 1GZTA 4FT8A 1DP0A 4RYDA 4TLGA 5CU1A 3HBKA 1PK6B 4XOGA 3U11A 4M3CB 1CAXA 4IUGA 1JYNA 3I2OA 1G9AA 4CXWA 3NSTA 2B45X 2OQ6A 1E57A 2WO7A 4QHOA 2ZBJA 3ETPA 3PUIA 3QH6A 4W6YA 1V9U3 2QVSB 3EQEA 1WCUA 1VBC2 3PURA 4NVPA 2Y64A 1DQ4A 2F6BA 3MLKA 5ABJA 5A3UA 4FPHA 4DY5A 2ID4A 2VCCA 3IB3A 2ZHMA 1I5ZA 4FPEA 4KMQA 4Z2AA 3KLSA 2VXRA 1QJFA 5FUIA 3VBRC 5F1RA 1JOJA 4NPMA 2RS51 5DAPA 4OQ8A 1NZCA 4HKLA 5EJ1B 4D6SA 1DQ6A 2GN7A 1GWLA 4P02B 4CDXB 5KHHA 1RVF2 4OHYA 3LIGA 3G7DA 1RINA 1UPIA 4QM9A 5FPUA 1J59A 4ISQA
chains in the Genus database with same CATH topology
2JDKA 2WRAA 4UT5A 1OURA 3ZDVA 2VUCA 1UZVA 2WR9A 5A3OA 2JDHA 5A6YA 1OVPA 2JDMA 5D2AA 1OUXA 5A70A 2JDYA 2VNVA 2BOIA 1OVSA 2BV4A 2VUDA 3DCQA 5HCHA 2JDNA 5A6ZA 1W8FA 2JDUA 1OUSA 1W8HA 5A6QA 2CHHA 2XR4A 2BP6A 2JDPA 1GZTA 5A6XA 4CE8A 1OXCA 1UQXA 2BOJA 4AOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDK A;  2WRA A;  4UT5 A;  1OUR A;  3ZDV A;  2VUC A;  1UZV A;  2WR9 A;  5A3O A;  2JDH A;  5A6Y A;  1OVP A;  2JDM A;  5D2A A;  1OUX A;  5A70 A;  2JDY A;  2VNV A;  2BOI A;  1OVS A;  2BV4 A;  2VUD A;  3DCQ A;  5HCH A;  2JDN A;  5A6Z A;  1W8F A;  2JDU A;  1OUS A;  1W8H A;  5A6Q A;  2CHH A;  2XR4 A;  2BP6 A;  2JDP A;  1GZT A;  5A6X A;  4CE8 A;  1OXC A;  1UQX A;  2BOJ A;  4AOC A; 
#chains in the Genus database with same CATH topology
 1LU2 A;  5JR7 B;  3SC7 X;  1A34 A;  2VVD A;  1I5P A;  2C1F A;  3ZDV A;  3D6E A;  1KDK A;  1UCX A;  4QPI C;  4B1L A;  1TG7 A;  4XPV A;  3B9C A;  4BQ5 A;  1W2T A;  5A1F A;  1RYY A;  3OJB A;  1FYU A;  1QJX 3;  2JWP A;  2VUD A;  1W2U A;  4FAH A;  4YRD A;  3U07 A;  1B35 A;  3K48 A;  1KDM A;  2ARB A;  5FZH A;  2ATF A;  5JSP A;  3ZVX A;  1NE4 A;  5G05 L;  4HON A;  3ZYR A;  4B4P A;  1KFU L;  2MHF A;  3TNP B;  3WCS A;  1XC6 A;  4BHP A;  1MVQ A;  2GME A;  1HLC A;  2J1S A;  2Y6F A;  2DCK A;  5C3O A;  2BYV E;  3OGV A;  1Q8O A;  1J3Q A;  1WLC A;  4AWD A;  5FZI A;  5EFU A;  5JPN B;  5IK8 A;  1IG3 A;  1RHI 1;  5H9P A;  1F8V A;  1ZZC A;  2VQT A;  5CKM A;  3T1M A;  4AXO A;  3RVH A;  4EE2 A;  3OCP A;  4AL9 A;  4JKL A;  1YI9 A;  1GUI A;  2ZEY A;  2FQP A;  1QKQ A;  2V4A A;  4LUM A;  3LDR A;  4RS5 C;  4ZS3 A;  3H8U A;  4IEW A;  3BUC A;  5A7O A;  1PZ9 A;  1AXY A;  1FMD 1;  3LA2 A;  3AMM A;  3K3N A;  1DU3 D;  4TLF A;  1Z7S 2;  3NJX A;  5FMC A;  4COW A;  3RZJ A;  3MW2 A;  1UIJ A;  4XCA A;  3VL9 A;  5FO8 B;  4AEJ A;  4IV3 A;  2Y0O A;  4HKO A;  4YNI A;  5SV8 A;  4FPJ A;  2D6O X;  4XF0 A;  1O3R A;  4QXH A;  5L7O B;  4LK7 A;  4OCT A;  4KWL A;  1QEX A;  2HWD 2;  1REE A;  1RED A;  1N3O A;  4QKB A;  4QGN A;  2KD7 A;  5BNO B;  3VHO A;  5AFE A;  4Q4Y 3;  4LO5 B;  3POS A;  4CDW A;  2I07 B;  1OD3 A;  2HWE 1;  4GMP 1;  4MGT A;  2XBO 1;  4MGQ A;  5A6Q A;  4UFH A;  3UKT A;  3PIG A;  1RUD 2;  4D69 A;  4XUN A;  4XF4 A;  5CB7 A;  4CE8 A;  2D6P A;  3X29 B;  2PAK A;  4BQX A;  5KR7 A;  3A7Q A;  1K3I A;  1VBC 3;  2BTV C;  3HNM A;  3LAG A;  3M3I A;  4FOW A;  4Y5T A;  1YRZ A;  5DXD A;  3TB0 A;  1RUN A;  3AYA A;  1Y43 B;  3ZXF A;  1Q43 A;  2EAL A;  2ERF A;  3B00 A;  1R08 2;  4HKW A;  3H1W A;  4QX3 A;  4XJW A;  4EZH A;  2XJT A;  2RS3 2;  2QQO A;  1SLB A;  2VNR A;  4YFW A;  1RUF 2;  3UT0 A;  3JBG 2;  3KZ4 C;  4C90 A;  3WNO A;  5A32 A;  1UIK A;  5FPZ A;  2VMH A;  2ZX2 A;  3WF3 A;  5LZ6 A;  2YPD A;  2QQW A;  2H6B A;  4FPL A;  1JZ2 A;  1V00 A;  2H6C A;  1RVF 3;  5FLJ A;  3RRD A;  1F35 A;  2I2S A;  1Q8P A;  2DVG A;  5JZG C;  1H2K A;  4CP0 A;  3QBQ A;  1SCR A;  1W8T A;  2IVJ A;  2QZ3 A;  4WV8 A;  1NA1 A;  1BKZ A;  3DUI A;  3I2H A;  5D8A C;  5FBZ A;  3SCF A;  3BIE A;  4JKK A;  3GYD A;  3WW1 A;  3O1M A;  3N9Q A;  5LBF A;  2R32 A;  3HQR A;  1LKN A;  2DTY A;  4TN7 A;  4AQ2 A;  4BB3 A;  5BNP B;  4Q4X 3;  2QJV A;  3LIH A;  4C8D A;  1ZM1 A;  5I0U A;  4QKF A;  5LK7 B;  1AR9 3;  1X36 A;  4KG8 A;  1QDO A;  2PLV 1;  1Q8Q A;  1SMV A;  4LK6 A;  5T54 A;  5A70 A;  4J1X A;  3VZM A;  2HWF 2;  1MZ5 A;  3P3N A;  4M0H A;  4AVB A;  3MID A;  3VKM A;  1MZE A;  1VAL A;  4I0A A;  3AXE A;  4K21 A;  3OUH A;  4WM8 A;  3USU A;  1OQD A;  4FFI A;  4XTM A;  5JI7 A;  1EYB A;  1OF4 A;  1R1A 2;  1W39 A;  2ZXQ A;  3EBR A;  2A3Y A;  2YV8 A;  1ZRC A;  2WNU B;  3ZFG C;  1VBD 1;  4TYS A;  3ON7 A;  4HSJ A;  1WBL A;  1XE7 A;  1W3V A;  1OHF A;  1IKQ A;  4GZ9 A;  2V4V A;  3J8F 1;  2B8M A;  2EAK A;  2Q8C A;  3S7E A;  1ZRE A;  2XWJ B;  4AI9 A;  1PK6 C;  2WS9 2;  1W9T A;  4Q27 A;  2O8O A;  3V64 A;  4CZS A;  2GSY A;  5FMB A;  1BEV 1;  1FI2 A;  1W6P A;  1HV1 A;  2ORX A;  5A6Y A;  1IHM A;  5LY2 A;  4O9G A;  4LR4 A;  2ZGK A;  1V9U 1;  3J7N A;  4OHV A;  3WLU A;  3CJI B;  2W0X A;  5C71 A;  2WQ4 A;  1JOP A;  4QGL A;  3PU8 A;  1PO2 1;  3U78 A;  3CDZ B;  1ODN A;  4YZ3 A;  4F3J A;  4JZR A;  2RHP A;  4YZ5 A;  1X9T A;  4NE9 A;  3D8C A;  1O4Z A;  4CEW C;  1OBN A;  3I49 A;  4LE3 A;  2W68 A;  2BP6 A;  1VBB 3;  3ETQ A;  5EJZ B;  1EAH 1;  2UU8 A;  3VBF B;  1UU4 A;  1ASJ 2;  3D0S A;  3C7E A;  4YM1 A;  4CDX C;  4OHW A;  5IFP A;  5I8Y A;  4ZZ5 A;  4DB5 A;  2V5Y A;  1G9C A;  1RIR A;  2Y8K A;  4QQO A;  3VKO A;  3WNN A;  5HCA A;  2R0F A;  1AR8 2;  3GF6 A;  1COV 1;  3LE0 A;  3AX4 A;  3WF2 A;  3NL1 A;  1UOB A;  5FOJ B;  3ITQ A;  2ZS6 B;  2RDN A;  3DPR A;  3VHN A;  5F3I A;  2X09 A;  2ZEX A;  1R09 1;  4O65 A;  5CAD A;  2TBV A;  2NN8 A;  3ALQ A;  3VBS A;  3QAC A;  4XAC A;  5LEJ A;  3V65 A;  4CUC A;  3GNE A;  3R05 A;  1RUD 3;  1SBD A;  1YQ5 A;  4UWD A;  5IHR A;  1RTV A;  1H0B A;  2A3X A;  2IXL A;  5GZD A;  4QX5 A;  1X50 A;  3NNM A;  3BTX A;  2W47 A;  1LOD A;  2CU5 A;  2YYO A;  2DF7 A;  4Y20 A;  1RL3 A;  5FPX A;  1OQE A;  3PIJ A;  1R08 3;  4AFD A;  1ND3 A;  5KBF A;  2CTV A;  2RS3 3;  5CYY A;  1MVE A;  2BNM A;  1HB2 A;  1RUF 3;  1O8S A;  3FMG A;  5GJ6 A;  3VDD A;  4E4Z A;  2G9Z A;  4LIV A;  2Q5T A;  4QX7 A;  3ZSM A;  4X8N A;  4UYB A;  3WNX A;  1EUT A;  1SAC A;  3FUQ A;  4LO4 B;  2PFW A;  4AG4 A;  1CAW B;  2JDY A;  3UGG A;  3WP6 A;  4QX2 A;  2ZAC A;  2RS1 1;  3S7I A;  3BTY A;  4CVU A;  3ZXK A;  3I54 A;  4WBB A;  3J7L A;  4BWO A;  2ZKN A;  1Y9M A;  3BOD A;  1VBE 1;  3PVN A;  4P9G A;  5GZC A;  2WNO A;  2RJ2 A;  3THP A;  2ES3 A;  3OYW B;  4UW5 A;  4Y33 A;  5BNN A;  3MFC A;  4Y22 B;  2K46 A;  5IK5 A;  5FLI A;  3DF0 A;  4NIG A;  1IZ3 A;  4D3W A;  3WD5 A;  1NZI A;  4V1P A;  1RUE 1;  1C8M 1;  5FYV A;  1PVC 2;  1AJO A;  1QXR A;  3HPN A;  3IDB B;  4LE4 A;  4A7K A;  3LA7 A;  4B7K A;  1HB4 A;  3NAP B;  2HWF 3;  2D7F A;  4IV1 A;  5CBL A;  3DV8 A;  5JPM B;  4UI9 L;  4BPZ A;  1R1Z A;  4LOT A;  1UOJ A;  4LHS A;  5IVB A;  4XET A;  3IDC B;  1OH4 A;  2SLI A;  3TBD A;  4LO6 B;  2FCU A;  3SIT A;  3OBT A;  3ZFF B;  2BV4 A;  2P4E A;  2PHW A;  3P6B A;  1J3P A;  1SFP A;  1GWK A;  3OPT A;  4BXF A;  5FYC A;  1LOG A;  2HWC 2;  2CNA A;  5A1A A;  5BNO C;  5C8W A;  3AC0 A;  4Q4Y 1;  3E6D A;  3FBM A;  1CPN A;  1PZ7 A;  3I3E A;  3OBR A;  4QB6 A;  3HQU A;  4NWW A;  1KEX A;  3PVO A;  5CVR A;  2WQ8 A;  1YFW A;  2Y6G A;  5A33 A;  5FZO A;  1DLC A;  3AZX A;  3CL1 A;  3CF6 E;  3ZXG A;  3WW4 A;  2ZGT A;  1ACC A;  1IQA A;  2AGS A;  5KHJ A;  1AYN 2;  1NLR A;  5J09 A;  2JEN A;  3ZOI A;  4EQV A;  3GBF A;  1J1L A;  3S0M A;  2Z4F A;  3H50 A;  1FOD 2;  3B02 A;  2BFU L;  2VQA A;  1H30 A;  5FPA A;  1Y9Q A;  4UFJ A;  1WD3 A;  1IG0 A;  2OX0 A;  4PLN A;  5CNA A;  5FZ6 A;  3EHK A;  3OG2 A;  1KJL A;  4PIX A;  4AGR A;  5FFO C;  3TEZ A;  1DGR N;  1DLL A;  1LOF A;  1CX1 A;  2AEY A;  1ASJ 3;  5FQ0 B;  4NII A;  3MIG A;  3ZYG A;  5A1L A;  1OF3 A;  4TXW A;  2XL9 A;  2JEC A;  1LOC A;  3AZV A;  4MHU A;  2YC4 A;  3WDU A;  4BDV B;  3Q8E A;  1LHW A;  2WAO A;  3WOG A;  1YIF A;  4ONU A;  3AYD A;  2WLP A;  4XQ4 A;  5FWE A;  5KXE A;  5SV5 A;  1A6C A;  1BMV 2;  4EN0 A;  2R0H A;  3EO6 A;  5DAV A;  3UKN A;  2ZZJ A;  4E8D A;  2Z69 A;  1GU3 A;  4KWJ A;  2EID A;  1GP6 A;  5BNP C;  1IS6 A;  4FAG A;  3K51 A;  3HT1 A;  4OZX A;  1I6X A;  5HI0 A;  3MIC A;  3VBH C;  1MS8 A;  3ZFE A;  1JHN A;  4XMI A;  4FP2 A;  3A0K A;  3DCQ A;  5GLU A;  1S0F A;  1AR9 1;  3RI9 A;  2EIG A;  4FXK B;  3O1U A;  5EPA A;  2WNE A;  1LHV A;  3FX3 A;  3PUH A;  5JXI A;  2ADD A;  3B5L B;  3CEW A;  1ZBE 2;  2FBE A;  4A45 A;  1DGL A;  1JW6 A;  2GN3 A;  2ZCW A;  3T0A A;  2WNU C;  2O14 A;  4BQ4 A;  4W6W A;  2E7T A;  5FZB A;  3ZYP A;  3GZU C;  1SQ4 A;  2ZX1 A;  4CCO A;  2ORZ A;  4H55 A;  2Q8D A;  2VOW A;  2FDG A;  3LCP A;  4MGY E;  4QB1 A;  3WP3 A;  5FUN A;  1JYW A;  2R30 A;  1DF0 A;  4HAN A;  4N43 B;  4IEO A;  3BYW A;  5L73 A;  4ARX A;  2ZGM A;  2O8Q A;  4BIS A;  2GNB A;  5IK7 A;  3MIF A;  2EA7 A;  4FPK A;  3TNQ A;  4TWT A;  1TME 2;  3AL6 A;  4NUB A;  2A7A A;  4Y1V A;  3B01 A;  1UY4 A;  5GLW A;  3I2G A;  3LKJ A;  4GUL A;  5KXC A;  5FKC A;  5CAZ A;  2OW4 A;  5K7P A;  3AM2 A;  1VP6 A;  4XFH A;  1F5J A;  1GMM A;  4QQL A;  5GLV A;  5F3G A;  1OUS A;  2I74 A;  5JMC A;  4LUK A;  5E88 A;  2VR4 A;  3MUZ 1;  1GQG A;  3CHX A;  3OEB A;  1OA4 A;  2WNV A;  4AI0 A;  4XDP A;  1N3Q A;  1VRH 2;  3M1H A;  1YWK A;  2ARA A;  3ES4 A;  2B46 X;  3F95 A;  1I3H A;  2E32 A;  2GDF A;  1O7F A;  4RL7 A;  5EHD A;  3VBF C;  4CP9 B;  1VBB 1;  2XB6 C;  3U4X A;  4HPK B;  4K1Y A;  2HWC 3;  5FXX A;  4AGV A;  2WFF 2;  1HX6 A;  2IVI B;  1N1T A;  3N35 A;  3ZXD A;  2BVV A;  2BVB A;  1QQP 1;  2B7Y A;  5T5O A;  2XJP A;  2GND A;  4S2F A;  5KC5 A;  1RUG 2;  1W8H A;  2PHF A;  4F8A A;  2C9A A;  1G7Y A;  1NG0 A;  1ODM A;  2W95 A;  4IE0 A;  2CL2 A;  3MGU A;  3R4S A;  4XTP A;  5JXG A;  2A6W A;  1WGP A;  3L9J T;  3KHC A;  2FDK A;  1ZRD A;  1DYK A;  5ISL A;  2PAE A;  1OSG A;  4I02 A;  3R0R A;  1VAK A;  2H0V A;  3I59 B;  4LKF A;  4QWN A;  1HXS 1;  3BKZ A;  2XLG A;  1ND2 A;  3BPZ A;  3CLP A;  4XIK A;  1HKD A;  1NA1 C;  1YQ6 A;  1J58 A;  2XUE A;  1YLL A;  1YQ2 A;  1Q3E A;  1SZB A;  3OGR A;  5DUW A;  4CCD A;  1ULC A;  4W8J A;  4XUR A;  4BQY A;  2OPW A;  5FO9 B;  1RUH 1;  2RJK A;  2VNV A;  4BQW A;  4CEY C;  4X8P A;  4Y26 A;  2EVX A;  1AZD A;  2LTN A;  1W06 A;  3H0O A;  3VBO A;  3PLQ A;  5FZ1 A;  4E2G A;  1HRI 3;  3AB0 A;  4LNV A;  3LFI A;  4FXG B;  5DDJ 2;  3AP9 A;  3WIN E;  5C3R A;  4IEP A;  5HCB A;  2ZAA A;  1YFY A;  1OOP A;  3CIH A;  5EQU A;  3ZXJ A;  2HEW F;  3K75 B;  2RM2 2;  4LJH A;  1H6X A;  1D0H A;  2BER A;  1AYM 1;  2W52 A;  4N9H A;  1AL2 1;  2CGO A;  2YGM A;  5F37 A;  1PGL 2;  3OB8 A;  3DXT A;  2EF6 A;  2YZ4 A;  2P6H A;  4J1W A;  3DKQ A;  2P2K A;  2PTM A;  2YBP A;  4FFG A;  2QQJ A;  5C70 A;  1VB4 A;  1AUY A;  1NCR B;  2VOT A;  3D4K A;  3MPB A;  3NAP C;  4R9C A;  3ZYI B;  4FTS A;  4EJR A;  2WIN B;  3IMM A;  2XL7 A;  2W1Q A;  4BQ1 A;  4A4A A;  2X5I C;  3VBR B;  4GA9 A;  1JYC A;  3IZO A;  4MGS A;  2JDN A;  2Z5W A;  2OQ7 A;  2OT7 A;  3H7J A;  4JV4 A;  4P9J A;  3UET A;  3PJY A;  2DUR A;  2JDU A;  4N53 A;  3H8X A;  1W9S A;  2HWB 2;  2OUJ A;  1MQT A;  2WDB A;  4AHX A;  1HN1 A;  3WG2 A;  2GC0 A;  4DRV A;  3HEI A;  5FZ9 A;  2VG9 A;  2W87 A;  4FQ4 A;  1C1F A;  3H42 B;  1YXW A;  2RVA A;  2ZOE B;  3Q8F A;  1CJP A;  4Z82 A;  4I30 A;  3TN9 1;  1NLS A;  4QPI B;  4ZPI A;  4YVW B;  1TME 3;  2WZR 3;  1POV 1;  1PGS A;  5EZW A;  4Y1Y A;  4A41 A;  2D43 A;  2D3S A;  1W6O B;  2DUQ A;  2R04 2;  3WQ0 A;  4COY A;  4NIA A;  1KQR A;  2VTF A;  3VZN A;  2Q1F A;  2C9K A;  4XAA A;  1QGL A;  1FPN 2;  5A3M A;  5FZE A;  1VBA 2;  5JLV A;  4FPC A;  1LEN A;  1FT9 A;  1XYP A;  1VRH 3;  2DYC A;  5FKB A;  5AC9 2;  3FL7 A;  3GZE A;  5A7W B;  3SNM A;  1CAV A;  3ZSL A;  3E6C C;  3FHI B;  3O1V A;  5F5C A;  5FZ8 A;  2C6S A;  2XDV A;  4LBN A;  4L11 A;  3IDA A;  4AEM A;  2PYT A;  5KXB A;  1ZYB A;  4K6B A;  2UYB A;  4JAA A;  4UT5 A;  5HBA A;  1RIT A;  2VOK A;  4NN0 A;  5BYN A;  3ZN6 B;  1TMF 1;  1VMF A;  1VMH A;  1H4G A;  1ZZ7 A;  2WUH A;  3RSJ A;  1CPM A;  4YZ2 A;  2Y38 A;  4FFH A;  3ZYH A;  5A3O A;  4QKD A;  4QDR A;  1MS9 A;  1Y9G A;  1ZRR A;  4YGB A;  1RUG 3;  3RI8 A;  4CCJ A;  2JIJ A;  1HB3 A;  4RD7 A;  3KV4 A;  4DOU A;  5IVJ A;  1V70 A;  5FP8 A;  2HBU A;  2ZGN A;  5FYZ A;  2OVU A;  5FMO S;  5LW9 A;  5FTT C;  4OHX A;  3VDB A;  4AVA A;  2VMC A;  4HBN A;  4O7X A;  4HFS A;  2DWR A;  3J9S A;  4AVV A;  4AED A;  5A3L A;  3N7L A;  4HG6 B;  2VH9 A;  4XFI A;  2ZPX A;  1PGW 1;  4TSV A;  5JOX A;  4NHK A;  4BM8 A;  4M0N A;  4IEY A;  4DIQ A;  2E51 A;  3HVD A;  1BEV 2;  1HRV 2;  1OVP A;  2PHL A;  1U0A A;  3IAP A;  4RR3 A;  2B42 B;  4Q4V 1;  5ACA 1;  3SCG A;  3T2P A;  1I9R A;  1WLT A;  2WII B;  3CZU A;  4CDU B;  4XQD A;  4CPB D;  2QBX A;  5LK5 A;  3SKV A;  1VAM A;  2PAM A;  3I2J A;  4IW3 A;  1XB9 A;  1QJY 3;  2QQI A;  4D6R A;  4DPN A;  1UYY A;  1GOH A;  5J36 A;  2DBI A;  3WDV A;  4IEV A;  1SLI A;  4G4F A;  3GJA A;  3AP7 A;  2BBV A;  1QJU 1;  3CQO A;  4XUP A;  1D0G A;  4MX3 A;  1SEF A;  3LGR A;  3OPW A;  3AJY A;  4BMB A;  3CJX A;  5FZ4 A;  2JD9 A;  3A23 A;  4YZ4 A;  1ZX5 A;  3K46 A;  5FIX A;  4GWJ A;  1S0J A;  3IM0 A;  3POG A;  4M00 A;  5FPB A;  3WDY A;  4BU2 A;  1X8M A;  1CJD A;  1K5M B;  1MEC 3;  2HEY F;  1OLQ A;  2NMN A;  1J3R A;  4ATE A;  1GOF A;  1O3S A;  5JZG B;  3SHR A;  4RFR B;  2W46 A;  4OUM A;  2KXL A;  1UNB A;  3ZPY A;  1MZ6 A;  2A71 A;  2J7M A;  3AMQ A;  4LIU A;  1CGP A;  2BQP A;  2VQU A;  3W59 A;  3PVB B;  5F6L B;  1H8T B;  5LAT A;  2D44 A;  1QH7 A;  4WM7 B;  4AE2 A;  1RUO A;  2R1D A;  2ZGL A;  3IN9 A;  1QMJ A;  1E5S A;  1EV1 2;  2R04 3;  2VUA A;  1LOF C;  3JCI A;  1DGW A;  1H1M A;  4QPG A;  5DPN A;  2OYZ A;  2YXS A;  3FE5 A;  4H2A A;  1GQH A;  1FPN 3;  4GJZ A;  1VBA 3;  4B4R A;  2GAL A;  1SFY A;  1W8W A;  1CQ9 A;  5CKN A;  2ARC A;  5C3S A;  3OD0 A;  1PX4 A;  4OUS A;  1S4C A;  2XJR A;  4AFM A;  4RQP A;  3AKP A;  4LOR A;  1BBT 1;  4FVV A;  4OQ9 A;  5LA2 A;  1REF A;  4IGP A;  3J26 N;  3ZMO A;  3UES A;  1ZBA 3;  2Q4S A;  2BDR A;  3WR0 A;  1RMU 2;  2NYY A;  2WLQ A;  1AHS A;  3SEE A;  4K9S A;  3ROU A;  4DS0 A;  3O14 A;  2JB8 A;  2MEV 1;  5GLT A;  5JOY A;  4XVH A;  4Q26 A;  1W6N A;  2R06 2;  1HRI 1;  3AKT A;  2YHJ A;  4LBQ A;  4LHK A;  5IJR A;  5A6X A;  1OXC A;  5DAB A;  4CU8 A;  1DCS A;  1OT5 A;  1KJR A;  5FZM A;  3WQ7 A;  1OMI A;  2W2I A;  2RV9 A;  3D82 A;  3VKN A;  2BGP A;  3BU0 A;  1TE1 B;  3IIA A;  4AI8 A;  3M3C A;  3ZKY A;  1RB8 G;  4CXX A;  3O7O A;  4KBZ A;  4Q0V A;  4EWD A;  1D4M 1;  1CX4 A;  1YHF A;  3THD A;  1O5L A;  2D6L X;  1N1Y A;  1NCR C;  1IKP A;  1T6B X;  1ULF A;  3C7F A;  4HOO A;  3ZSJ A;  1H4H A;  1UOG A;  4YVS B;  2ZGQ A;  4DMI A;  3PMS A;  1XPW A;  1CZT A;  3N9N A;  5L9R A;  1TZO A;  3ZX7 A;  3MHZ A;  4CEW B;  1K12 A;  4QD2 A;  4AI1 A;  4L2N A;  1CN1 A;  1XE0 A;  1LAJ A;  4WVM B;  2ZX3 A;  4A6S A;  1MR5 A;  5L19 A;  1NQD A;  3KF3 A;  1UMI A;  1GAN A;  1S2K A;  2JE8 A;  4MZU A;  5JXH A;  3TEY A;  4F83 A;  3B3Q E;  4LO8 A;  1YO8 A;  2UWC A;  4XHB A;  4YW5 A;  3KV5 A;  4YVW C;  3ACL A;  4UFL A;  2Y34 A;  4IND A;  4XXP A;  3ACG A;  2WZR 1;  1OPM A;  4HVQ A;  3N9L A;  4RSU A;  4E8C A;  1W90 A;  3WNK A;  4KI5 M;  5A7Q A;  1W99 A;  2QCS B;  4AK3 A;  4DXS A;  2J1T A;  3NNG A;  3N7M A;  4A2U A;  2DVF A;  1JZ7 A;  1OLM A;  2DV9 A;  3WEZ A;  2ZEW A;  4MLO A;  2A1X A;  2JDP A;  3MW3 A;  5FP7 A;  4JTO A;  4XUT A;  5F3E A;  4DXR A;  4ZHN A;  1UYZ A;  3RFR A;  5C4W A;  2IZW A;  3O12 A;  2PHD A;  5IT6 A;  5C8C B;  3SLI A;  5FPL A;  4OHZ A;  3WG3 A;  3LPG A;  5JMO A;  4PI0 A;  3B7M A;  2F4P A;  1G6N A;  4LBJ A;  4U2A A;  1C5H A;  2VPV A;  2VCA A;  2W5F A;  4OI1 A;  2ZKL A;  3WZ1 A;  1UMH A;  2GC1 A;  1LTE A;  4IQP A;  2Z79 A;  4CDQ C;  4E2S A;  4R4X A;  2HYX A;  2VZQ A;  3OEA A;  5CFD B;  2P3I A;  2GH8 A;  1PM7 A;  3O1T A;  2WA4 A;  4JQR A;  5C9A B;  1IOA A;  2WYF A;  3NRU A;  1UAI A;  1BVP 1;  1XYN A;  1NY7 1;  4KQ7 A;  5IW0 A;  4E4H A;  1H6Y A;  1LGB A;  3VBO C;  3H8O A;  1A8M A;  2RR1 3;  2CSG A;  1W6Q B;  5IVY A;  4E2Q A;  4Y4Y A;  5FZD A;  2XJU A;  2FDF A;  4FSJ A;  1XNA A;  5T50 A;  3RG0 A;  3V0B B;  3RZH A;  2R07 3;  1CAX B;  1RMU 3;  2P1B A;  1BXH A;  4QQH A;  4EN6 B;  2VOX A;  1LEM A;  1GV9 A;  4XFC A;  3RJR A;  2IFR A;  2R06 3;  4CDU C;  5C3Q A;  2YFZ A;  4QX0 A;  1VPH A;  3VBU A;  5ABJ B;  5J96 B;  5EWS A;  1KS4 A;  1NQJ A;  2BJS A;  5I91 A;  1HJG A;  3JD7 1;  1QJY 1;  3KHB A;  4QX8 A;  2VMI A;  1K42 A;  2VVE A;  4EN8 B;  1WW4 A;  3AYC A;  3EXU A;  2WWS A;  4RHV 2;  4AOC A;  4QHB A;  2DCT A;  3KT7 A;  2YGL A;  4QXB A;  3KV9 A;  3FC0 A;  4AYU A;  3CJI A;  4TTG A;  3U0Z A;  3N3H A;  4CUA A;  1RUC 1;  2DCJ A;  3KQR A;  4YG0 A;  5JOW A;  2VOV A;  1QWR A;  3MPP G;  3N9M A;  5FYI A;  4LLF A;  2VZR A;  2XJS A;  3VLB B;  4YW2 A;  2XGX A;  2VZS A;  4MO3 M;  3LFM A;  4QMA A;  3WDT A;  1EPW A;  3BVC A;  4BE3 A;  1K5M C;  4B3N A;  2JEM A;  3D5O A;  3LSD A;  3R6S A;  4I0B A;  4C0B A;  1D4V B;  1V6J A;  4UBG A;  3HNY M;  1B35 B;  2DTW A;  4CRQ A;  1L3J A;  4FI9 A;  1ZA7 A;  4FPF A;  2LM3 A;  4I3G A;  5FXW A;  1H8T C;  1P8J A;  1ZZ6 A;  3JQW A;  3ACF A;  4BOW A;  4FOQ A;  4WM7 C;  2EXK A;  1XNB A;  1MZF A;  1OFN A;  4Z92 B;  2BNO A;  3ZXL A;  1HV0 A;  3KM5 A;  2BUK A;  5FY5 A;  3VN4 A;  5FYU A;  3VBH B;  1PO1 1;  2RMU 2;  3FHQ A;  4LPL A;  1F15 A;  3ZXE A;  2A3W A;  4XUO A;  3WF4 A;  4Q4W 2;  3ACI A;  5HCH A;  1YC6 1;  2WYS A;  1G8W A;  2ZML A;  3NWK A;  4XJ8 A;  4BIO A;  4WVV A;  3AK0 A;  2KM2 A;  5ERL A;  3LPF A;  5E1R A;  5H9R A;  5HCF A;  4E4D X;  3I2K A;  3OY8 A;  1WLD A;  1ZZB A;  1O5U A;  3P5B A;  1CAU B;  1RUI 1;  3AFG A;  1WW6 A;  1ZBA 1;  3WVJ A;  5GLZ A;  1AYM 2;  4ZXK A;  1QXP A;  3PVE A;  1HIX A;  4NJ4 A;  1CAW A;  4CA9 A;  1PIV 1;  1CIW A;  2QQK A;  1V6N A;  3NQH A;  3B94 A;  3M70 A;  2OPK A;  4K8R B;  1TQ5 A;  3GZA A;  4JDN A;  3THC A;  4AED C;  1WMD A;  2IFW A;  1JOD A;  1XJA A;  4HL0 A;  5FRE A;  3RZZ A;  1CVN A;  5I0S A;  1JU3 A;  2ZGU A;  3OYW A;  2GH2 A;  4S2D A;  1PZ8 A;  1OD5 A;  4V2W A;  5FYM A;  2JDA A;  5BUV A;  3LDK A;  3HIF A;  3U4S A;  2P37 A;  1V6K A;  2OZJ A;  1XE8 A;  4YVS C;  1H1I A;  1DYP A;  1AF9 A;  1WUV A;  1Z7S 3;  4A42 A;  2WA3 A;  2WL1 A;  3VD3 A;  4PDW C;  2C0Z A;  4Y1Z A;  3MZH A;  3MEP A;  2FDI A;  3T3Y A;  4LO7 A;  5BV6 A;  3AP4 A;  2DU0 A;  2HWD 3;  5F2W A;  1W8N A;  4ZZ8 A;  4OUE A;  3HWJ A;  4DUX A;  2W9X A;  1CON A;  3ZFF A;  4H3W A;  3ZN4 A;  5BNQ A;  3IBM A;  3WSO A;  5KC6 A;  1WCK A;  2JD4 A;  5TSW A;  5DAX A;  4UF0 A;  2R6Q A;  3V0A A;  2QQP A;  2D98 A;  2QFE A;  4ISR A;  4OYU A;  1HQL A;  2XXZ A;  2E33 A;  4QXK A;  3A22 A;  4RGK A;  4X6Q B;  5CG9 A;  1N3P A;  4GMP 0;  5F5I A;  4QM8 A;  1X9P A;  4GAL A;  3NKT A;  4MXV A;  3K4A A;  4LQR A;  1TEI A;  2D97 A;  3T1L A;  1QNY A;  2DVD A;  3FN9 A;  3U1X A;  3RNS A;  1QJX 1;  1QH6 A;  4FP3 A;  2PHT A;  4MUV A;  2Y26 A;  4GD4 A;  3POI A;  1W6M B;  4XQW A;  4WVW A;  4YM3 A;  4AGG A;  4XFA A;  4XBQ A;  3POF A;  2VBD A;  4YGC A;  1B09 A;  1NA1 B;  3JBG 3;  3I97 A;  5GZG A;  3NJZ A;  4GH4 A;  5C8C C;  1NCQ C;  1YQC A;  2O0O A;  1HQN A;  1XOY A;  2XG3 A;  4XUQ A;  4R9B A;  4P5H A;  5CKQ A;  4CEY B;  2VW0 A;  1CIY A;  3BU7 A;  1W2N A;  3I7D A;  4YW1 A;  3DEM A;  1W28 A;  1G9D A;  3QCW A;  1WA4 A;  3I3M A;  5LBE A;  4XFG A;  1FAT A;  3JZV A;  5I8T A;  4RGA A;  3H7Y A;  1JN2 P;  4HZF A;  1RUJ 2;  1UD1 A;  3I2F A;  1IS5 A;  5D21 A;  5FK7 A;  4GKY A;  4NHX A;  5GAL A;  3A0N A;  5C5T A;  1PX3 A;  5FV3 A;  4AQT A;  1W8Z A;  2X29 A;  2X53 S;  4UXA A;  5CFD C;  4QT6 A;  1YJL A;  4TZD A;  5M0T A;  1QF3 A;  5T5P A;  5C9A C;  4WM8 B;  1C5I A;  4YG3 A;  5IVV A;  4PIZ A;  5A7P A;  4XW3 A;  2RMU 3;  3T4H B;  2VMD A;  3T0B A;  1UZY A;  4ERO A;  2E7Q A;  2XOM A;  2ZHL A;  4ZON A;  4YW4 A;  2VMF A;  4Q4W 3;  5F5A A;  3LOI A;  3SQO A;  5FZF A;  1GSL A;  1RXF A;  2JG8 C;  2RR1 1;  2YPJ A;  3O5S A;  2X5I B;  3N9O A;  2AYH A;  1AR6 2;  1IQD C;  1R1A 3;  3AVR A;  5CA6 A;  3E1F 1;  1AR7 2;  1WCQ A;  2C4X A;  2R07 1;  1W6P B;  3LSE A;  2C24 A;  3U37 A;  4BZ4 A;  1H9P A;  4QPY A;  2AR6 A;  3AKR A;  1AX2 A;  2OZ6 A;  4GB3 2;  4IGQ A;  5FR3 A;  5ABJ C;  5A3N A;  5K0U A;  4ZU7 A;  2VW1 A;  2WS9 3;  1N1V A;  1XRU A;  5ANQ A;  5FZG A;  4MG2 A;  2P17 A;  3N7K A;  1GZW A;  3KD4 A;  4MYE A;  4AF9 A;  4MHR A;  1S0E A;  4C1X A;  1MS0 A;  2DCZ A;  4M4R A;  1Z78 A;  5FP9 A;  2K2S A;  4ASK A;  1PMI A;  1VBC 1;  3FLT A;  4IGO A;  4ZS2 A;  1G9B A;  3Q8C A;  1DBN A;  2G19 A;  2ET7 A;  3DPR B;  1J1T A;  3WG4 A;  2TUN A;  3KGL A;  3SKJ E;  2CV6 A;  5BPX A;  2HBT A;  1UWW A;  2VEC A;  3VBS B;  4ARY A;  3F2Z A;  2PQQ A;  4M01 A;  1RVF 1;  1D7P M;  4MAD A;  1AR8 3;  3MLJ A;  1C57 A;  1CES A;  4JGZ A;  2A73 B;  4XF1 A;  4WZF A;  1B35 C;  4Y20 B;  3MYX A;  3O0V A;  3NNL A;  2WSV A;  3HJR A;  4LBK A;  1A8D A;  5HV0 A;  5CFC A;  2WAB A;  3CNA A;  2W1W A;  4P9W A;  5C7G A;  3APB A;  3UJO A;  3VDD B;  5JAX A;  4Q4X 1;  5F5Q A;  3URF A;  3GCX A;  5T52 A;  3RZL A;  5APA A;  4E9K A;  2VE1 A;  2GU9 A;  3ZM8 A;  4P9I A;  2JG9 A;  5K8S A;  2JE7 A;  5JVV A;  1QOT A;  4PI2 A;  5IWF A;  3WQB A;  2ARE A;  3PL0 A;  5DZF A;  3E5Q A;  4AHY A;  4ES8 A;  3HMY A;  3AVS A;  4B29 A;  2XVL A;  5BNN B;  4ASM B;  2XVG A;  2RDS A;  4LKS A;  1RUJ 3;  4KGG A;  3T08 A;  4W4Z A;  4V2V A;  5JR2 A;  3RS6 A;  1OLR A;  2SBA A;  5AVP A;  1Q8V A;  5EXO A;  3RWN A;  3RYR A;  4IV3 C;  4SBV A;  3OF1 A;  4KGQ A;  3OSD A;  4XDO A;  1GIC A;  1D2Q A;  5K9Y A;  1GBG A;  1NUK A;  1NX9 A;  2PEL A;  2RS5 2;  4FBF A;  4HMZ A;  1H9W A;  4NMI A;  4OLL A;  2X8K A;  3GHM A;  5FYB A;  1IPJ A;  1PVC 3;  2ZHK A;  3QD6 A;  3WUD A;  2WQZ C;  1WZX A;  5KXD A;  1QOS A;  3M2M A;  3WW2 A;  1FNZ A;  1KIT A;  1BLZ A;  1Z7S 1;  3QH7 A;  3WW3 A;  2P3K A;  2VZT A;  1MPX A;  2Q8O A;  4CDW C;  5KHI A;  1LES A;  3VBR A;  1AR6 3;  1JTZ X;  2QDR A;  3ZR6 A;  1DHK B;  5BY5 A;  2X05 A;  3O1O A;  4NID A;  1RJ7 A;  2NP0 A;  5A33 B;  5FZO B;  2QUO A;  3BB6 A;  5IAT A;  3A21 A;  4GB3 3;  3PNA A;  1XSQ A;  3LEK A;  4CTE A;  5LA1 A;  2CWM A;  4KBB A;  2J42 A;  4JRA A;  4P08 A;  1WBF A;  4R9D A;  4QPI A;  3CZJ A;  1RUD 1;  4XXA A;  1C28 A;  3LDB A;  1W6O A;  1AYN 3;  4BLI A;  4EN9 B;  4N7U A;  5F9T A;  2FZ1 A;  2YBK A;  5J37 A;  3VHP A;  5C6C A;  1T6G C;  1FOD 3;  3VZK A;  3E5X A;  4S2H A;  2DBN A;  4I3P A;  2WJS A;  2VUC A;  1H2N A;  1R08 1;  4NOT A;  5JCT A;  2RS3 1;  4JGY A;  3NVC A;  5FBJ A;  2OA2 A;  1RUF 1;  3HAG A;  2JKB A;  3JBG 1;  4ES9 A;  1FX5 A;  1I1E A;  1BZW A;  1RHI 2;  4RGG A;  2VNG A;  4Z1V A;  4Q2F A;  3H3U A;  4JC1 A;  2A75 A;  3UL2 A;  3BGA A;  4A6O A;  1UYX A;  1XXN A;  2VQ0 A;  4HVR A;  5CZK A;  4OVE A;  5FUP A;  3ZN6 A;  3M4F A;  5IFT A;  4C1W A;  4HSL A;  1SLC A;  1UN1 A;  1VE0 A;  1FMD 2;  5FYH A;  3POB A;  5KWR A;  2GNM A;  1PNF A;  2DCY A;  2WN3 A;  4IER A;  5D1I A;  2VMG A;  5K4L A;  2ZHN A;  4HK9 A;  2WFP A;  2DDU A;  1DGR A;  2R49 A;  4WM8 C;  5FZ7 A;  3O1S A;  1MS5 A;  4IEZ A;  3JU9 A;  2X10 A;  2UWB A;  4ORF A;  3VZO A;  2JE9 A;  4PBP A;  4RS5 A;  4AFB A;  1C4R A;  1QXJ A;  5A7N A;  2HWF 1;  4H14 A;  4P9L A;  3NV1 A;  3MFA A;  1E5H A;  3N36 A;  4KH9 A;  1UY0 A;  4EWE A;  5LWB A;  4A3X A;  1ZBE 3;  1NXD 1;  2QQM A;  3MBW A;  2HWE 2;  1F4A A;  3ABZ A;  3JQX A;  5A3P A;  2XBO 2;  4ASL A;  5JDB A;  2VC9 A;  4NPR A;  4OUL A;  3ORJ A;  3RMX A;  1KGY A;  1YYN A;  4AFA A;  1NOV A;  3WX5 A;  1UX7 A;  3FWE A;  2K0G A;  1F31 A;  2V5D A;  3U75 A;  4AAP A;  1AX0 A;  2CAU A;  2XQR A;  1WLW A;  4KU8 A;  4KWU A;  4RFT 0;  4CXY A;  2WAA A;  2WS9 1;  2WNV B;  2B5H A;  2E7A A;  3EB7 A;  3RZM A;  3RZK A;  1WMX A;  5JIU A;  5FAX A;  2WKK A;  1YCI A;  1LNS A;  5E89 A;  1IS4 A;  3H8R A;  1QNW A;  2RS5 3;  3MF6 A;  3WP4 A;  4XBN A;  3ZSE A;  4QAW A;  5J3U A;  4FTE A;  1ULE A;  2WBK A;  3FJS A;  3IPV B;  1W04 A;  2XLA A;  5DG2 A;  4D0Q A;  5AFB A;  1BVV A;  2PHX A;  3DPR C;  3WF1 A;  2VZ1 A;  2NZ9 A;  4K8F A;  5FYY A;  3W9A A;  1JU4 A;  3VBS C;  2IXI A;  4HET A;  5JSR A;  1YUD A;  3AXD A;  1ASJ 1;  2A6Z A;  2FMY A;  2PA7 A;  3NW4 A;  3EMR A;  4P14 A;  2PQS A;  4GKX A;  3J7H A;  1QY4 A;  2WFF 3;  2XML A;  1JS9 A;  1S2E A;  2DVB A;  1AR8 1;  4NHY A;  4S2G A;  4CCC A;  5JZG A;  2W3J A;  3MO4 A;  4HN1 A;  2QKD A;  4GIQ A;  4KG0 A;  1M4W A;  3FUO A;  1ND3 C;  2C26 A;  3WNP A;  2PLV 2;  3VHR A;  3M3E A;  4XBL A;  2ZX4 A;  5D8A A;  4I2O A;  1ND2 B;  1WW5 A;  2XLF A;  3KV6 A;  3AFK A;  4G3Y C;  3G6J B;  2HYK A;  4JCK A;  3VDD C;  5J98 B;  3W21 A;  5B4N A;  4CCK A;  5E16 A;  1RC6 A;  5ACA 3;  2NMO A;  4JTN A;  2D3P A;  2WT2 A;  3LEI A;  4AI2 A;  2UY9 A;  1FNY A;  3POJ A;  4D7Y A;  1PM4 A;  3CMG A;  5FZL A;  4PBO A;  1VBD 2;  3VBO B;  5C33 A;  1GYK A;  4ZXE A;  4HLT A;  2XH6 A;  2YY1 A;  4L8Q A;  3S5Q A;  2CDO A;  1XBF A;  1LGN A;  3J8F 2;  5FYS A;  3O1R A;  1RHI 3;  1H2L A;  3QLQ A;  2XHK A;  1GR3 A;  3ZPO A;  3VB9 A;  3ME2 A;  4JDM A;  2VCB A;  5JI9 A;  5LRS A;  3BN6 A;  4AEK A;  4PLO A;  5E8A A;  5BNN C;  4Q5O A;  1OPO A;  2QE3 A;  1W05 A;  4JHT A;  3ZFG A;  4RN5 A;  2Y6J A;  1V9U 2;  5DDJ 3;  3VDA A;  4IXL A;  3IAQ A;  3H9A A;  4UOJ A;  2BGO A;  1FMD 3;  3UYJ A;  3ELN A;  3MIB A;  2OKX A;  3L2H A;  4SLI A;  2WO2 A;  1US3 A;  1XND A;  2VAU A;  4IV1 C;  3WNL A;  1PO2 2;  1PK6 A;  1V6L A;  2RM2 3;  4Y1X A;  4Z8B A;  4M3C A;  3BI3 A;  2VL4 A;  1ST8 A;  1JXN A;  2W08 A;  3WUC A;  1M06 G;  2FZ2 A;  1DQ2 A;  2PHR A;  3ASI A;  2KA3 A;  3H1M A;  2PMW B;  1EAH 2;  2Y6K A;  3KVB A;  4J25 A;  4XAB A;  4B4Q A;  3TOJ A;  1HW5 A;  1PVC 1;  1RXG A;  1SPP B;  3FFQ A;  3LD8 A;  4GJY A;  4D6Q A;  4DUV A;  4XJU A;  2OII A;  3JUU A;  2EXH A;  1COV 2;  3TRS B;  3OUI A;  4IE7 A;  1NE6 A;  3WHT A;  1R09 2;  2HWE 3;  4D94 A;  2VUJ A;  4WVM A;  2XPJ A;  4UW6 A;  2HWB 3;  4L0P A;  3I2I A;  4CDX A;  2VTX A;  2HWC 1;  5FP4 A;  5EYY A;  1QJX 2;  4MXW B;  3KGZ A;  4OZO A;  3P3P A;  5AVA A;  2MNG A;  1LHO A;  3MV1 1;  3ATG A;  1SLA A;  3FBY A;  1QIQ A;  4N7I A;  1WCD J;  5LRR A;  4XEZ A;  1POV 0;  2AC1 A;  3K2O A;  3PTY A;  1URX A;  2QDN A;  2LAL A;  2V72 A;  1XNC A;  3DN7 A;  4E27 A;  5EIY B;  2CDP A;  1AYN 1;  2WR9 A;  1CD3 G;  4GAZ A;  3A4U A;  3TAY A;  4NRO A;  4ZU5 A;  5FY9 A;  1X8E A;  2ZAH A;  3KT1 A;  4HXC A;  4O9E A;  3W5N A;  1V0A A;  2EIB A;  2G9G A;  2VXJ A;  2R7E B;  4AI3 A;  4DNY A;  5AC9 3;  2I45 A;  3KS7 A;  4LHN A;  3GAL A;  5FMO L;  5I0T A;  2RS1 2;  2D6K A;  4F7Z A;  3ST7 A;  4Y24 A;  2YUE A;  2G4I A;  2YFU A;  4UFM A;  5FZ0 A;  4KWK A;  1VBE 2;  4LBO A;  2D5F A;  2J1V A;  3C2U A;  2RE9 A;  2B39 A;  2G9F A;  5FY7 A;  4B1M A;  3BCW A;  5FK8 A;  1OA2 A;  1WKY A;  3PUA A;  3DYM A;  2AH2 A;  1GOG A;  2P3Y A;  2WSU A;  3ZFE C;  1D2S A;  1Q56 A;  3SIS A;  4MGK E;  5JWP A;  5F6K A;  2E63 A;  1RUE 2;  1W03 A;  1C8M 2;  3AKS A;  3D3A A;  4GWI A;  1MS4 A;  4AHW A;  1BMV 1;  5T5J A;  2UWA A;  4OFG A;  4QDS A;  4AED B;  3RMY A;  2CGN A;  1AX1 A;  3LOB A;  1W8O A;  1ZNP A;  2QQL A;  1S1A A;  1NAE A;  3DGT A;  2LUW A;  4EYU A;  1ZZ8 A;  4EZ4 A;  3HD8 B;  1CWP A;  2JKX A;  2VU9 A;  2XKO A;  4COU A;  4LLO A;  4M4P A;  4XJ9 A;  1VBD 3;  2XKP A;  2EIE A;  1OQ1 A;  4RA0 A;  4NAO A;  4RR3 B;  1EP0 A;  4PDW B;  4MET A;  1S0D A;  1S0G A;  2XWB B;  1US2 A;  1PMH X;  4Q4Y 2;  4PIY A;  5DUV A;  1ZBE 1;  2W92 A;  3AL5 A;  2CAV A;  5L7O A;  4NR1 A;  4IL7 A;  4DZG A;  4JHZ A;  1BEV 3;  4ZY9 A;  3VL8 A;  1WCS A;  4E4S A;  1HRV 3;  2VME A;  4L99 A;  1OH3 A;  5BNO A;  1DZR A;  3AJZ A;  4YW7 A;  3FLR A;  2GMM A;  4OMD A;  4QGM A;  5FXZ A;  3TEW A;  1Q5O A;  3OBZ A;  4W6X A;  1LRH A;  2WNV C;  4N8M A;  1PO2 3;  1UY1 A;  5T3N A;  3DYP A;  1TME 1;  4Z07 A;  1OLM E;  5I93 A;  2ZMK A;  1ENR A;  4NIH A;  4ZU4 A;  1JMU B;  4P5Y A;  4K7J A;  2VW2 A;  4OI2 A;  1EAH 3;  1IPS A;  1W2A X;  1S55 A;  3HR9 A;  4D8M A;  2VZP A;  1KS5 A;  3WT3 A;  5F32 A;  2AEZ A;  1F4H A;  1R64 A;  1XNK A;  1VRH 1;  1COV 3;  3BAL A;  3MLL A;  5FY8 A;  2PXJ A;  3HOB A;  3ZMN A;  4OI0 A;  1R09 3;  3T09 A;  3RYP A;  5F39 A;  4Q8K A;  2ZA9 A;  3M8L A;  3NMB A;  3LEM A;  5FY1 A;  3UGF A;  1NCQ B;  2JB4 A;  4COZ A;  4DUW A;  1KRI A;  2WZE A;  1T2X A;  2IXC A;  4BK4 A;  2WFF 1;  2JIC A;  2ZMN A;  4PT6 A;  4Q4X 2;  2IWG B;  4QPG B;  4CUG A;  3GHN A;  2BOI A;  5DZE A;  3OBA A;  1LU1 A;  1V6I A;  2BZD A;  3POY A;  4NWV A;  1AR9 2;  1ND2 C;  4NAM A;  4JGY C;  1ZRF A;  1GWM A;  1RUG 1;  2ETE A;  2VNO A;  3RPQ A;  3W20 A;  4CUB A;  4D7T A;  1YIP A;  4K20 A;  1EV1 3;  4XFB A;  4DEV A;  4RQP B;  2Q30 A;  3ZN5 A;  3AZY A;  5BNP A;  3UKV A;  3H1Y A;  4H7L A;  4YPJ A;  4BCU A;  1BJQ A;  1GNY A;  1WME A;  3GGL A;  3VBH A;  2MPF A;  3IT8 A;  4CSW A;  1YFX A;  3K3O A;  4NO4 A;  1F5F A;  3NV4 A;  1JUH A;  4AQ6 A;  3RQ0 A;  4BXS V;  5JOZ A;  1GQP A;  1K5J A;  1UZ0 A;  2RG4 A;  2RS1 3;  1W6N B;  2JG8 B;  1XSR A;  3CBN A;  2BEO A;  3ES1 A;  4LBQ B;  2GP3 A;  2Y33 A;  1OOP C;  4XDQ A;  4GQ7 A;  3PME A;  1UXZ A;  1VBE 3;  1Z0H A;  2DVA A;  2R16 A;  5A80 A;  4XC9 A;  5GM0 A;  1CAU A;  1ENS A;  2WNU A;  1LED A;  3D0J A;  1LHU A;  2YDE A;  3B9I A;  3INA A;  3KF5 A;  4Q0Q A;  5CIS A;  1NKG A;  1DQ5 A;  3MIE A;  2LRO A;  2R1B A;  2GNT A;  3VV1 A;  1RUE 3;  1DYO A;  1C8M 3;  1O91 A;  4FCA A;  1ULG A;  4X6R B;  5DDJ 1;  2ZTN A;  5FLH A;  3THT A;  3K77 A;  4OMC A;  3WDX A;  2J1U A;  1AJK A;  2W91 A;  2RM2 1;  5FMD A;  2XJQ A;  5E6H A;  2O1Q A;  5LEK A;  4I09 A;  2BNN A;  2WC2 A;  1PGL 1;  2ENR A;  2ARX A;  2BPA 2;  4P00 B;  1G86 A;  1VBB 2;  4N53 C;  1W2O A;  1L7R A;  2IXJ A;  1A78 A;  3RDI A;  5LY1 A;  1MQT C;  4NHL A;  2YU1 A;  1FAY A;  4QHZ A;  1LGC A;  1ENX A;  2LS6 A;  1W0O A;  1QQP 2;  4MGZ E;  1FV2 A;  1C3H A;  1GLH A;  1SBE A;  2WT0 A;  2IXH A;  3VBF A;  4A44 A;  3JB4 C;  3W58 A;  1MEC 1;  2GC3 A;  2HWB 1;  3E6B A;  3B69 A;  4L9B A;  5FZK A;  3HQX A;  4IEQ A;  4DQA A;  3IDE A;  1C1L A;  4FPY A;  4IEX A;  2A6Y A;  4MV2 A;  5A7S A;  1HXS 2;  3L2Y A;  2D3R A;  3BTZ A;  3C7G A;  4XHX A;  5F8P A;  1BHG A;  5FZC A;  5C4W B;  2R04 1;  2VZO A;  4I0W B;  2WN2 A;  3OTF A;  4A3Z A;  1RUH 2;  1SDW A;  1FV3 A;  5IAX A;  4URT A;  1FPN 1;  4MOA A;  3UV9 A;  1VBA 1;  1W6M A;  3QOP A;  1J83 A;  4NRQ A;  4UW3 A;  1PHM A;  5DAW A;  5DZG A;  2JX9 A;  3T4V A;  4HN0 A;  4L97 A;  5AC9 1;  5F3C A;  3KWV A;  1O4Y A;  1XQN A;  4YW3 A;  3VD7 A;  1DIW A;  5EP9 A;  2VTX J;  1S0C A;  2B9V A;  4GXL A;  1X82 A;  3CO2 A;  3FFZ A;  4YLZ A;  3WXP A;  5IVC A;  3KCC A;  3ZIW A;  4CEY A;  2C5D A;  2BOJ A;  3UJQ A;  4P9X A;  1AL2 2;  1GNH A;  1SLL A;  1O8P A;  3PUS A;  1BCX A;  3AMH A;  5FRA A;  2W1S A;  4PJY A;  5IK4 A;  2BW8 A;  3RGB A;  5HV4 A;  1OKO A;  3DYO A;  5LCW L;  5CG8 A;  1SCS A;  4IV3 B;  4CU7 A;  1DDL A;  1QHD A;  2D5H A;  3PU3 A;  4Y22 A;  2UYA A;  4QQ2 A;  4Y5S A;  4XF9 A;  1U5X A;  2JIG A;  1NXM A;  4LA3 A;  4UAP A;  1V6M A;  5GKA C;  4RR3 C;  4BQ2 A;  3KQ4 B;  3NAP A;  4CU9 A;  1JZ5 A;  3W5M A;  4DXT A;  1JZ3 A;  2Y6H A;  3PTR B;  3BPS A;  1A3K A;  3DL3 A;  4LBL A;  1SFN A;  5I8S A;  1PNG A;  3PJQ A;  1ULD A;  4CDW B;  3VBU B;  2X5I A;  3T2O A;  3UGH A;  3TN9 2;  2ZEZ A;  2EXI A;  3I3B A;  2Q1Z B;  4KL1 A;  3AZW A;  1HRV 1;  1O3Q A;  1VRB A;  3N7J A;  2J22 A;  4AVS A;  4ATF A;  1EY2 A;  4YWA A;  2E9Q A;  4YGD A;  2J1R A;  2VBP A;  2AZ5 A;  2VY0 A;  3C7O A;  2V09 A;  4Y4R A;  3KMH A;  4CDQ B;  1DG6 A;  3Q9O A;  1UKR A;  5CIR A;  1HB1 A;  1VR3 A;  4LEJ A;  4CCN A;  2VZU A;  2CWS A;  4FPG A;  4RHV 3;  2CHH A;  4XMA A;  5A32 B;  1TVG A;  1UMZ A;  2XR4 A;  3C7H A;  3TWI A;  4HVO A;  3KVA A;  2XJV A;  3R4U A;  1OC1 A;  4A7Z A;  2WRA A;  1KFX L;  3HN1 A;  4J6G A;  1TMF 2;  4Q0P A;  1POQ A;  1YEW A;  3WQ1 A;  4PHZ A;  1HJF A;  1QQP 3;  2F4L A;  1UYP A;  3LWC A;  3JB8 A;  4AVC A;  5FQ0 A;  1BYH A;  3ILR A;  1U5Y A;  3NV2 A;  2BFU S;  4JVA A;  4NPL A;  4Y5Z 0;  5C5U A;  5LBC A;  1SDD B;  2FD8 A;  4Q1R A;  1NYW A;  4URA A;  3SH4 A;  4QPG C;  3VKL A;  1Q8S A;  4XZU G;  5T55 A;  3S6P A;  2VGD A;  1ULP A;  4PQQ A;  5I0D A;  1GP5 A;  1GFF 2;  1UX6 A;  4LA2 A;  2NLR A;  1HXS 3;  3POW A;  1E5R A;  4AVT A;  2XON A;  1ZZ9 A;  1JZ6 A;  3RWK X;  1GNZ A;  2BWA A;  4RQP C;  4GWM A;  3T2T A;  1LUL A;  3PUQ A;  3S30 A;  1EV1 1;  1PGW 2;  3USU B;  1VB2 A;  3OY8 B;  1LJ7 A;  1RUH 3;  1ALY A;  1UY2 A;  1UZV A;  4CCM A;  2FHR A;  4QQP A;  4PF1 A;  5T5L A;  4CCL A;  4BH9 A;  1GP4 A;  1LEC A;  2BU9 A;  5ACA 2;  4Q4V 2;  4LBQ D;  3ZYB A;  4JX0 A;  3WNM A;  2YBS A;  3UK9 A;  3T30 A;  4A7Y A;  3AP5 A;  5DUX A;  4IE5 A;  5JIA A;  1UW8 A;  5FO7 B;  2EAA A;  5B4X A;  4C91 A;  1AYM 3;  1RMU 1;  2VBB A;  1AL2 3;  1NT0 A;  1DGW X;  1SHW B;  1WMF A;  5I0R A;  3I2D A;  3VGI A;  1Y4W A;  1TNF A;  2YC0 A;  2R06 1;  2WT1 A;  4YSF A;  2VVF A;  3VD9 A;  3GJB A;  3LA3 A;  1QJU 2;  4N43 A;  1VLN A;  4YYO A;  4CPB A;  3OGG A;  5LA9 A;  1MS1 A;  2QTW B;  2TNF A;  3CU7 A;  2ZGP A;  1WD4 A;  2ET1 A;  3WG1 A;  3LQC A;  1APN A;  1VIW B;  2VCM A;  3H3L A;  5L7O C;  4AR2 A;  4Z2W A;  5LA0 A;  2BBA A;  4W50 A;  1DZQ A;  3CKH A;  2YU2 A;  4LMF A;  4COV A;  1OVS A;  1UXX X;  5HXM A;  1UPS A;  2F17 A;  2DU1 A;  4UFI A;  4UF0 B;  3DXU A;  2JDZ A;  3V0A B;  3SCH A;  3USS A;  4CP9 A;  3TN9 3;  1LCL A;  4N90 A;  1KD7 A;  1U12 A;  3C8X A;  3S5A A;  1POV 3;  2VM9 A;  4QXC A;  3M3O A;  4GWN A;  4HPK A;  1UQX A;  3WP5 A;  1WA6 X;  3Q8B A;  1ENQ A;  5FPV A;  4LT5 A;  3MV0 1;  1JI6 A;  1F9K A;  3OPZ A;  1JZ8 A;  1EUU A;  4YW6 A;  3ZYJ B;  4AFC A;  2WWU A;  1O3T A;  3GBW A;  5FY0 A;  3LF7 A;  4YFZ A;  1ND3 B;  2Y6L A;  2QZ2 A;  2NM1 A;  4YM0 A;  3NNJ A;  3III A;  1QJE A;  3WCR A;  3OD4 A;  2QQU A;  3GM8 A;  1AXK A;  5C4W C;  1JYV A;  4C0H A;  1XYO A;  4QB2 A;  1QU0 A;  4GH4 B;  1BBT 2;  2RDR A;  2WWJ A;  1LOE A;  1W8F A;  2IC1 A;  1YFU A;  1ZVF A;  4XAE A;  3I59 A;  2DUP A;  1RGS A;  5JXJ A;  3J7M A;  1TMF 3;  2MEV 2;  1HRI 2;  1W0P A;  2K9Z A;  2Q0A A;  4HT1 T;  4ZKT B;  1E5I A;  1PVX A;  4IE6 A;  1D4M 2;  5D2A A;  5J1X A;  4DO0 A;  3AMP A;  1OUX A;  2WZP P;  4LOS A;  1L7L A;  4MH0 E;  3O1P A;  1CR7 A;  3MI8 A;  3EYP A;  4IV1 B;  5HPO A;  1UZZ A;  3GDB A;  1JYT A;  4PCR A;  2W94 A;  3B93 A;  4Y1U A;  2P3J A;  4UFK A;  2E6V A;  2GAU A;  1LOA A;  5FXV A;  5B2G B;  4N9I A;  4ET7 A;  5DUU A;  2W1U A;  5FYT A;  4EV0 A;  2ZZQ A;  1BQP A;  4PLM A;  5LBB A;  4BJ0 A;  1JOB A;  5J7M A;  5H9Q A;  4QX1 A;  2B9U A;  1NCR A;  2DUO A;  1XU1 A;  1AXZ A;  2Q1M A;  1UU5 A;  5G04 L;  1OUR A;  4FOY A;  2G1M A;  4Q4V 3;  3WF0 A;  1JHJ A;  2GZW A;  3GXU A;  1TNR A;  1GZ9 A;  3VBU C;  1LOB A;  3S57 A;  4Q0U A;  5K0U B;  4BME A;  4R4Z A;  1AR7 3;  2CGP A;  2HWD 1;  1DZT A;  3ZSK A;  2B4K A;  1GZW B;  3MDP A;  2WZR 2;  4XIO A;  3ZXA C;  3VZJ A;  5KHK A;  5JUV A;  2ZGR A;  1UF2 C;  3VZL A;  2GC2 A;  2Y0I A;  3CJI C;  3MIH A;  5DQ0 A;  3C3V A;  5IVE A;  3DEC A;  1ULO A;  1QJU 3;  1LR5 A;  1DFQ A;  3P1I A;  3FLP A;  3UNP A;  4YVW A;  1H8V A;  2Z2S B;  3NJY A;  4MVT A;  4O61 A;  1X7N A;  3Q8A A;  1U5Z A;  2VD7 A;  3NKG A;  1QDC A;  4RHV 1;  4Q1P A;  3T2Q A;  2HKX A;  1U5I A;  1UO9 A;  1HDK A;  5FOB B;  3IPV A;  4LKD A;  5A3T A;  3ECQ A;  4JGZ B;  3NNF A;  1F2N A;  5FDB A;  1UOF A;  2H0B A;  3NJV A;  5A7W A;  3ZO0 B;  5DMY A;  4IDZ A;  5LAS A;  4QU1 A;  2FCT A;  2OXB A;  5DAQ A;  2WO3 A;  2FMD A;  3AZZ A;  2QQN A;  5CFC B;  1DQ0 A;  3RZG A;  4AZZ A;  3I3Q A;  1FXZ A;  4U36 A;  3R4D B;  3WY6 A;  3IMN A;  2VUL A;  1W9F A;  3SMH A;  2YB7 A;  4IES A;  3LEG A;  4OI4 A;  4XF3 A;  4YZ1 A;  1OI6 A;  1QOO A;  4AHZ A;  2JJ6 A;  2TEP A;  2PN5 A;  1GKB A;  1S0B A;  3ZFE B;  3RJ2 X;  2EXJ A;  5KHG A;  3HN3 A;  1NY7 2;  1YQ8 A;  3SH3 A;  2HH9 A;  4YM2 A;  5EV7 A;  1V6O A;  1W8U A;  5DN2 A;  4DEQ A;  1VMJ A;  1STM A;  4AAX A;  4CP1 A;  2JG9 B;  2Z42 A;  2D93 A;  1XU2 A;  1IGO A;  4CDQ A;  4XIL A;  5IYY A;  1G9F A;  4H7M A;  1SLT A;  3LB9 A;  4IEU A;  1BBT 3;  4XZP A;  2NPI A;  5F2S A;  2QNK A;  2JDM A;  2RMU 1;  3LZZ A;  4Y3O A;  5L9B A;  3GCW A;  1L7Q A;  1QJZ A;  2D6N A;  4BIF A;  2A6X A;  4Q4W 1;  3KT4 A;  5FY4 A;  2MEV 3;  1MAC A;  4JKM A;  3HBZ A;  1WWY A;  4NHM A;  3ILN A;  1AL0 G;  2HEV F;  3KCY A;  2J1A A;  1N47 A;  1PMJ X;  2PHU A;  4R52 A;  5FCC A;  1O4T A;  3U14 A;  4LTA A;  2A5Z A;  1R1A 1;  3TYJ A;  2GMP A;  4DRR A;  3ACH A;  1JBC A;  2ZJC A;  2DFC A;  1JZ4 A;  3JD7 2;  1QJY 2;  3E97 A;  2CY6 A;  4AW7 A;  1CZS A;  3GZT B;  1D4M 3;  2AAC A;  1YNA A;  3PHM A;  4LKE A;  1CZV A;  4DXZ A;  2ADE A;  2HLE A;  3MW4 A;  3OGS A;  5ANN A;  4CDU A;  3ZIX A;  4QKN A;  3POE A;  2P5B A;  1RUC 2;  2YRO A;  3NO8 A;  1WW7 A;  3MUY 1;  2E26 A;  2Q8E A;  1Y3T A;  3KB5 A;  2EIC A;  5A3W A;  4P9Y A;  1YI7 A;  2BRT A;  3MF9 A;  1LB2 A;  1DQ1 A;  4IET A;  4YAR A;  1JYX A;  3ZFF C;  3AYE A;  4I01 A;  3I8T A;  2ZGS A;  1JH5 A;  1SPP A;  2XVK A;  1MEC 2;  1SBF A;  1UY3 A;  1X33 A;  4WVZ A;  3IWZ A;  4FFF A;  1IS3 A;  4NRP A;  2WO1 A;  1W3X A;  3H3Z A;  3I3D A;  1C8N A;  2IXK A;  4BA6 A;  3VUO A;  3OGJ A;  1K5M A;  3WHU A;  3HNB M;  1Y7B A;  1UKG A;  4UW4 A;  4CU6 A;  5C3P A;  4K1Z A;  4MXW A;  1PO1 2;  5FP3 A;  3DKW A;  3ZYF A;  4JGY B;  1H8T A;  5FZA A;  5A6Z A;  2N7G A;  1N1S A;  2CYF A;  1UU6 A;  4Q0S A;  4WM7 A;  1EPZ A;  2JXA A;  4GH4 C;  2VJX A;  3RYK A;  4BQ3 A;  3N9P A;  2VZ3 A;  3K4Z A;  3OOX A;  1MS3 A;  3V56 A;  4CCE A;  1RUI 2;  2XHN A;  4W65 A;  1ZBA 2;  3U10 A;  5BXX A;  4LIT A;  5L9V A;  3AKQ A;  1PIV 2;  5IUQ A;  2UUR A;  3VD5 A;  1OOP B;  1VAV A;  4YGE A;  1O59 A;  4G9S B;  2YMZ A;  2HJI A;  4M3C E;  2ILM A;  4DFS A;  1YJK A;  2FDJ A;  3WDW A;  2D6M A;  2FCV A;  2KR2 A;  2ZAB A;  2L9L A;  4QDQ A;  1OA3 A;  2OS2 A;  3ZR5 A;  4RS5 B;  2YC2 A;  4AQS A;  1RUJ 1;  4HK8 A;  1OKQ A;  5DG1 A;  5GZE A;  1JUI A;  2YG0 A;  3GBG A;  1W0N A;  2WZ8 A;  3AP6 A;  4XJZ A;  5FWJ A;  3BTA A;  4JRL A;  4CP2 A;  1W9Y A;  4K40 A;  2RDQ A;  2GP5 A;  3AMN A;  4B8E A;  1XNT A;  4N53 B;  4CYD A;  3VD4 A;  3BIW E;  1S0I A;  3T0D A;  2W39 A;  4M3C F;  4R9A A;  1MQT B;  3J4U H;  2FDH A;  4YVS A;  3SEP A;  4IE4 A;  3VDC A;  2XQX A;  4D7S A;  4QPW A;  3BOP A;  4PDW A;  2NQY A;  2VZV A;  4XYX A;  5FJH A;  5GZF A;  3BOW A;  5F7U A;  3PDQ A;  4CEW A;  5K0U C;  4N43 C;  4WZC A;  1AR6 1;  4GMP 3;  5EJ3 A;  4YG6 A;  2BGC A;  2XBO 3;  1AR7 1;  2V73 A;  5FZ3 A;  5IVF A;  3JD7 3;  2OUH A;  2E53 A;  3E5U A;  1W9W A;  4LXL A;  4BK5 A;  3ENR A;  4FO9 A;  4NRM A;  3KCX A;  4GB3 1;  4L92 A;  4BLJ A;  5H9S A;  5J48 A;  3NV3 A;  3KSC A;  1RJ8 A;  2J1E A;  5EYX A;  3SXW A;  1OFS A;  1RUC 3;  5L36 A;  2A6V A;  1UL9 A;  2VO5 A;  1AVB A;  4LUL A;  2DFB A;  2ZGO A;  1S2B A;  2RJL A;  3M3Q A;  1CAV B;  1ZA4 A;  4XJA A;  4MGI E;  5CEH A;  4PQ9 A;  4BYY A;  2P34 A;  3O0W A;  4ITC A;  2QQV A;  1FOD 1;  4JQT A;  4JGZ C;  3TEX A;  1UZW A;  4K3U A;  4QU2 A;  4XFF A;  2E31 A;  4FTB A;  1K45 A;  1BK1 A;  1J84 A;  1NLQ A;  4LHL A;  4Q8L A;  5JSO A;  1KXG A;  2LW8 A;  3N4M A;  1HN0 A;  3FZ3 A;  4EN7 B;  5CFC C;  3ILF A;  3OUJ A;  5D8A B;  3FHA A;  1NCQ A;  4B7E A;  5C8C A;  1JYI A;  3VKF C;  2D40 A;  3JXS A;  5FJK A;  4KU7 A;  1VJ2 A;  4EWA A;  4R8H A;  3IKW A;  5IAV A;  2XUM A;  2JDK A;  3I4I A;  3WV6 A;  1GZC A;  1IPK A;  3SH5 A;  1PO1 3;  4FQZ A;  4LBM A;  4XCB A;  2PLV 3;  1SG3 A;  1H2M A;  1ZRI A;  2JG9 C;  4JDO A;  2JDH A;  2RR1 2;  5CFD A;  4MSV A;  5LB6 A;  4UBH A;  3EJK A;  3O0X A;  1HQW A;  3HT2 A;  2LRP A;  5C9A A;  1H1A A;  3K4D A;  2BWC A;  2R07 2;  1RUI 3;  2Y60 A;  2ZX0 A;  4KNC A;  4Q29 A;  4XE9 A;  3ZLI A;  3M7A A;  2UY8 A;  4DIN B;  3ZFG B;  2P6C A;  2IUW A;  1PIV 3;  1LHN A;  1ONA A;  1O6U A;  1W6Q A;  2A70 A;  4FOV A;  3ZDS A;  2JG8 A;  3J8F 3;  4FPO B;  4DY3 A;  1BK0 A;  2AEN A;  3ZKU A;  4PF5 A;  5HXV A;  2AUY A;  3V0B A;  1GZT A;  4FT8 A;  1DP0 A;  4RYD A;  4TLG A;  5CU1 A;  3HBK A;  1PK6 B;  4XOG A;  3U11 A;  4M3C B;  1CAX A;  4IUG A;  1JYN A;  3I2O A;  1G9A A;  4CXW A;  3NST A;  2B45 X;  2OQ6 A;  1E57 A;  2WO7 A;  4QHO A;  2ZBJ A;  3ETP A;  3PUI A;  3QH6 A;  4W6Y A;  1V9U 3;  2QVS B;  3EQE A;  1WCU A;  1VBC 2;  3PUR A;  4NVP A;  2Y64 A;  1DQ4 A;  2F6B A;  3MLK A;  5ABJ A;  5A3U A;  4FPH A;  4DY5 A;  2ID4 A;  2VCC A;  3IB3 A;  2ZHM A;  1I5Z A;  4FPE A;  4KMQ A;  4Z2A A;  3KLS A;  2VXR A;  1QJF A;  5FUI A;  3VBR C;  5F1R A;  1JOJ A;  4NPM A;  2RS5 1;  5DAP A;  4OQ8 A;  1NZC A;  4HKL A;  5EJ1 B;  4D6S A;  1DQ6 A;  2GN7 A;  1GWL A;  4P02 B;  4CDX B;  5KHH A;  1RVF 2;  4OHY A;  3LIG A;  3G7D A;  1RIN A;  1UPI A;  4QM9 A;  5FPU A;  1J59 A;  4ISQ A; 
#chains in the Genus database with same CATH homology
 2JDK A;  2WRA A;  4UT5 A;  1OUR A;  3ZDV A;  2VUC A;  1UZV A;  2WR9 A;  5A3O A;  2JDH A;  5A6Y A;  1OVP A;  2JDM A;  5D2A A;  1OUX A;  5A70 A;  2JDY A;  2VNV A;  2BOI A;  1OVS A;  2BV4 A;  2VUD A;  3DCQ A;  5HCH A;  2JDN A;  5A6Z A;  1W8F A;  2JDU A;  1OUS A;  1W8H A;  5A6Q A;  2CHH A;  2XR4 A;  2BP6 A;  2JDP A;  1GZT A;  5A6X A;  4CE8 A;  1OXC A;  1UQX A;  2BOJ A;  4AOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...