4UT7L

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
ASQSVLTQPVSVSGSPGQSITISCTGTSSNADTYNLVSWYQQRPGKAPKLMIYEGTKRPSGVSNRFSASKSATAASLTISGLQPEDEADYYCCSYATSRTLVFGGGTKLTVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7L00
3EGSA 1ACYH 4KFZC 3BAEH 5BV7L 3JXAA 3QDJD 2XQBL 1YC8A 4A6YB 4LLQB 4HBCH 1I9IH 2FIRT 1B0GA 1MCEA 1JGVH 4FFYH 5DRNA 1OAYL 2R39A 1FN4B 1NGPH 2ORBL 3BWAB 1DUYA 4JFXB 1P7QD 3RUGB 4D94A 2XN9B 4YC2C 3MRRA 4LGPB 1BM3H 1EUUA 1SY6A 2XXMB 4D9LL 3FQRA 4RRPG 1JHKL 2YD4A 4XCCL 5CSZB 2Q6WA 3M8OH 3IJHA 1NAMH 3RWEB 3OG6B 4OJFL 5FO9B 2VLRD 1UM5L 1FVEB 4PJCF 4JDTH 3RY4A 3GDBA 4RWYH 4HQQH 3TPUA 2VO5A 4ZTPH 3I6LD 5FDYA 4U6XB 1CFTB 3LS4L 4TSBL 2GK0B 1WBYA 3CDCA 2ZZUT 3QDMB 3RPIB 1HQRA 5KTEH 2GY7B 4GUPB 2DN7A 1Z9SA 4AM0A 1P6FA 2NZ9C 3QZWA 1MVUA 1ETZB 3B9KD 2CKBB 2Z8VC 2ZNWA 2X1PA 3EDFA 4PJCB 3GI9H 3NCYS 5DJCA 3WS6A 4HKBB 1P84K 4R3SB 1BVLA 4XCYB 3VD5A 5FGBA 5DMYA 5GZNC 4C55A 5CD5C 4FQLL 1IKNC 3PJSB 3H7BA 3GMRA 3SDAD 3VRIB 5TDPB 4DGIH 2W60A 3BQUA 3GSVA 5B38A 1Q1JL 1B0RA 2QSQA 4BZ1L 2ZSWB 3EYFB 3UPRB 1RZ7L 3DARA 1I3UA 3IGAB 3DRTA 3LHPL 3T2PA 3UTPE 1KG0B 1ZLVK 3CZJA 2P4AB 3WS3A 1C16B 5K9QG 2FWOA 1HILA 3FB8A 5DUMH 4PGBA 3FRUA 1KPRB 4X6DB 3IDGB 4Y4HB 4X6BB 2QADC 2VDPH 2EE2A 3MXWL 3WXWL 4W4OC 2DQIH 1JGEB 2EIZA 5HHOE 3C8KB 1Z2KA 3MUJA 5FUOH 4I18C 4ZO6A 2XI9A 4GBXC 5C0FA 1N4XL 4TQEL 5HHNA 4BM7A 3UDWC 5IR1B 4YC2B 1T7XA 4X80H 2YD2A 4GAGL 1DVFC 4OGAC 2DQUH 3MLWL 3RNKA 4KRLB 1NFIB 5CCKH 1JYXA 1DQTA 5IMLB 3QEGL 2VTFA 4K3JH 4PRPA 5C70A 3JVGC 3TO4D 5DVNA 2VR9A 4R6UA 5GIRA 2Z93B 3DNKA 4JRXE 4P5KA 1EV2E 2EYTA 3IRPX 1QFUH 1ADQL 5JUEH 4NRXB 1UH2A 4OZIB 5B39B 2PXYA 1LO0H 4DKAA 3TM6A 3TIEB 3FB5A 4LCCC 4CN4A 4KKCD 2NY2D 4DEPC 1KN4L 2YRZA 2BSTA 4JPIA 5F9OH 5FF6A 1X44A 1X5GA 3PL6C 5IGXH 3EYOB 4N0FA 4JFHE 5I15L 3MRCA 2BVQA 2GEEA 4LPUA 4I0PA 5DEGB 1T20B 5K9KB 4AMKH 3D0LB 5FYLH 3TBYB 3RWDB 2PW1B 2R2CA 3D87B 1BX2B 4ZFFA 2MCPL 5E1HB 2APFA 4WTWA 1Z5LB 2IALA 5DRXA 1LE5A 2BVTA 5CUSH 4I3SL 2HT4D 3MGTA 3INUH 3AMKA 1J1PH 4JKKA 4ZG1A 1N5AB 1E27B 4M93C 4NYLA 4UQ2B 5EZIH 1IGTA 4H26A 4Q6IA 1NCWL 5EO9B 4UDUB 3H6JA 3BH9B 4NIKB 1U3JA 3W9DB 1OGTB 2OBGA 2F8OA 1EJOL 1OTTC 2MWCA 5D2LA 2VKWA 3LKSA 4LCWE 1IC5L 4AL8H 1IL1A 5DJDA 3QRGH 4FQXA 2VLRA 4KHXL 3RL2B 3PV7A 2QEJA 2ADIA 5CEZE 4LHUD 2NY6B 4L3EA 5KN5A 1HHKB 3HLAA 1YMME 1SHMA 1YEIL 3OGCA 3CLFL 1I8MB 1NDMB 2UYLA 4DN4L 4HHAA 1CR9H 4JFED 3L3OA 4OZGE 5I75C 3MR9A 3VXQB 4F37F 3WLWD 2EC8A 4FQHA 1G7QB 4OLWH 4Y19A 5EU6B 1WTLA 1IGML 3OJVC 1YEJH 2PYEA 4HUWA 1NL0H 1AY1H 2Y7QB 4X9FA 4LSVL 2FSEA 4QRUB 3ELAT 3ZHDA 5MHSD 2P5WE 1S78C 3BD5A 5E9DD 5DLML 3O2WL 1RIHH 1FFPA 4JB9H 1EO5A 4JR9H 1VGKA 1J12A 1CFQA 2EDXA 1RIVH 2KZWA 2VDOL 1ZA3B 1MPAL 2VQTA 4NT6A 4OKDA 4HULB 5KVEL 3JV6A 2QKIA 3KPPB 2GJZA 3HC3L 4P49A 3KNBB 3HI6H 2ADFH 3DX8A 5J3HD 4NKIL 5CGTA 3NCCB 1MWAB 1W0VB 3WFDH 4UBDD 2DI9A 4AZ8A 4WV1A 2J1KA 5FGRA 5I1HL 3FQWA 5FA4B 1H5BA 1NDGA 4QF1B 4S1SH 4POZD 2FH6A 4QRPD 1RVFH 4DTGL 1ZLVH 3WNNA 4AIXA 2D03H 1IKFL 2X4UA 5EOCJ 4M93B 4XP1H 2X4TA 4YHNB 1EHNA 1Q9OB 5EDXA 5BZWB 2R2HA 4EI6A 5IW6A 3CX2A 1VFAB 3TYFB 3EZJB 1E4XH 1V3LA 4JJ5B 2FR4B 3V95A 2F15A 1GGBH 3MV7E 4MA3B 1XGTA 3WD5L 1F4YH 1GZQA 5DHVA 3ZKSD 3WBDA 3HE7B 3LEXA 1D5MB 1FNSH 1D5XB 5KS9F 1TETH 2X4RA 2X70A 1ZMYA 4IHOA 4R4NC 1X5LA 1FPTL 2V7HB 1U92B 1F3JA 1OTSC 5A16A 2PW2B 2Z91B 1YUHA 1IAOB 3GK8H 4OLUL 5KVDL 4KDTC 1CU4H 3EO9L 4ZS6D 1Q94B 1IT9H 1SBSH 1FE8L 4HV8A 1T1XB 5IVXA 2VLMD 2ZCLH 1DQMH 5JO5B 4Y1AE 1PSKH 1G6RB 4IRSD 4GQ9L 4PREB 2X1OA 5KS9B 5I16B 1GHFH 3L5XH 2V7NB 2IANA 1F97A 3SE9L 4G7VH 2XZAL 3CH1A 5SWQA 3EO1B 4GKSB 5AG9A 3L9RA 4EIGB 4O00A 1VCAA 5MEPB 5DMKB 3AC0A 4Z76B 4YEFA 3BP5B 1QBBA 5MEOA 3QUXC 5L9DH 2HG5A 1NEZA 2IADA 2UWEA 2J8UA 5D1ZD 1CGXA 4J3TA 1ES0B 1RFDH 3FN0L 3FQXB 3ARGD 4J4PC 2I07B 4HKJA 5EZOH 4EJ1C 3AY4A 5IVZB 3L3KA 1T1YB 2NY7L 5J9PA 1BFTA 4LFHD 4S1QH 1JNJA 1EEQA 2MTPA 2A9ML 2IBGA 1CGSH 3O6LH 4KROC 4PLKD 4NNPL 4NO5A 2BVEA 1NEUA 4OGZA 2D3VA 4MDIA 3QIWC 5C0GB 3VXPA 3BVNB 4PBXA 4LQFH 3BW9B 3L3DB 3F12A 3OKNA 1CICD 2BNQB 3P73B 5CSGA 4XPHH 3TBVA 4IMLA 4P5TC 5D9SB 3BOVA 3LN9A 2VXTL 3GBLA 4KQ4H 3X11A 5H35A 5I19L 3T0DA 3O6FB 1KENH 1MELA 5LWYL 2V2TB 2Q86B 4TSAH 4JO2L 4EQ3A 1AIFB 2P47B 3QUMH 5DI8B 3DO3A 2EECA 4PJ7A 1A3LL 1V7ML 1QFOA 3FZUD 3HMWL 4R90L 3MOBL 5C0DA 1F3DJ 2AI0L 4PGEB 2P8PB 4C56A 3I75B 5FDWB 4NQVA 3MLTA 3FO0H 2A6KB 3CUPB 4N8PA 5D1XB 5HTSA 3WIIL 3GMQA 1CFSA 5CIPH 4WI5A 4JVUA 2UZXB 4PJEB 1CG9B 1U36A 2AJXH 4JRYB 5SX4H 3WIFA 5DJAB 4JG1L 4PJXE 3ZKQD 2A77H 4JPWL 2BNRE 3LD8C 2D7OA 3RIAK 5EULV 2D4DA 3IJYB 2FL5B 1JBJA 3QUXB 4O02H 3NIDE 4WDIB 4U1IA 2F5BH 1YEFL 1KJ2A 1MQKH 3I9GH 2W07A 4QCIA 3I3EA 1JPSL 3QHTC 3UZVB 4QHUA 3WDIA 4BSWA 3U0WH 4PV9B 2VLKD 4L4VD 3U6RA 1H3VA 4HPYH 5AZ2L 5GJTH 4N1EA 1OP5K 1VA9A 2JJVA 2F54E 1G7JA 1S5IH 3ES6B 4JQIL 1BQHB 2CJUL 2OCFD 2G9HB 3NFSH 3O3EA 1ORSB 2DYPB 1FG9C 4HC1A 5I1AB 3TZVB 1BFOA 3WFEH 4X4YB 4Z8FL 4L3AA 4JFFD 3SJVB 3W5MA 1L6XA 4P3CL 4M6OH 1AXSA 1YJDC 3GJEA 5E8DH 2Y07H 4FNLH 1F4XL 1UM6H 4KJPC 2ZUQB 1LO5A 4X7EC 3VWKB 5T1KA 2YN3A 4F7PA 1P9MC 1U8JA 3RDTB 4LAJH 1L6ZA 1DUZA 5CWSB 3IU4L 2J88L 3UTQB 3HNTH 4H5SA 2DWEA 1KXVC 4MZ3A 4HJJL 5TE6L 3B8YA 3VW3H 4MXVF 5F1SA 2NZ9D 4N9GA 3RVTC 5TPWH 3IDJA 5I18H 4P0DA 1YQ2A 3AB0B 1NCBL 3QA3A 3LS5L 5DGQA 1CLYH 1KBGL 1IC4H 5GRWA 5CD5D 3MOQA 4LSRH 3PQYA 5TDOA 1SJXA 3FCTA 4QXUH 4WVRA 4HWNA 1I75A 4FQ2H 1YMHB 2CXKA 3L5JA 1KF9B 3M1BB 4D3CL 4KMTH 4QOKD 4BSVB 4TSCH 1HEZB 4A6YA 4LLQA 4TYUA 2IAMD 4G9DB 1IAII 1CD8A 5D7SH 5KOVC 3BWAA 1FN4A 4G80B 3RUGA 4YHLL 2XN9A 4YH6A 1KV3A 4DJMA 1ZLUH 3IFLH 2F74B 5GISH 2A6JB 5I66B 5F96L 5FCUL 2QADD 1ZHNB 3LZFL 5CSZA 5DQJB 1SEBB 1JHLL 2CDFB 4IDJH 3RWEA 5FO9A 4XVTH 2F58L 3LY6A 1FVEA 1QNZL 4GBXD 5C0BB 3WE6B 4UU9B 1KACB 1Q0YL 4P9HH 1CFTA 1DVFD 4OGAD 4OQ1A 5H94B 3QDMA 1DFBL 2IWGA 5GZOC 1PY9A 1QPXA 4GUPA 1YPZF 4QRRD 1JNLH 4I2XB 4N5EC 3QAZB 4K2UL 3TIDB 4KJQC 4M6NL 2CKBA 4PJCA 3W82A 1KC5H 1B6UA 1U3HB 2HT3C 4HKBA 4R3SA 2IPTL 4XCYA 1PGRB 4MCZA 5FGSA 1S9VB 1E28B 3PJSA 4Y2OA 3WKMH 4ALAH 3VRIA 5TDPA 4GKOA 3QIBC 3K74B 2VXQL 5JA8B 5DT1L 4K07A 5ADPL 1WLHA 1AO7B 1U41A 4GG6A 1KFAH 3WNKA 1T0NB 2ZSWA 3EYFA 2KUTA 3UPRA 1JUFB 3IGAA 3G08B 3PL6D 5C0AD 4UZGA 4YHIA 1KG0A 5CLWA 2VLKA 1HCVA 1MUJB 1KYOJ 1FL6B 1GGIL 1HIML 1KPRA 4X6DA 3IDGA 3G6AA 4Y4HA 4CDGC 2O5YL 4X6BA 3WV0A 1EHLL 2AV1B 5JOPD 4JN1L 2EIBA 1JGEA 5EFIB 4E41E 3A67L 3T1WA 3C8KA 5IT2H 5GJSH 5D7JB 1AGEB 4NQEE 4M61B 5J11B 1MJ8L 3PXJA 5IR1A 4EIZC 5J6HA 3DSFL 3MMEB 1OP5H 5KJRL 3QI9C 4XAWH 5DD6B 1OTTD 1NFIA 2IFGA 1YEKL 5E6YA 4AIZB 1WBZB 2NXZC 3OMZA 4KK5D 3MBEB 5IMLA 1T0PB 2Z93A 4RMSA 1A9BB 1X5YA 5D7LE 2APVA 4OM1H 2CKNA 3TT1L 4EDWL 4NRXA 2YEZB 4JAMB 5B39A 4OZIA 3S96B 4LRIC 4OD1H 4F9PC 3TIEA 4N0YL 3VXMD 3RTQC 5HHMB 3KPTA 5SWZD 5I2IB 3EYOA 5DUPH 2J7LA 1S7SB 2VDLL 3FO9B 5DEGA 1S78D 1T20A 3PG2A 3D0LA 3TBYA 5I1EL 4PJ9C 3RWDA 4JM2F 2IBZX 4HUKB 5I30H 5ESVB 1BX2A 4OF6A 2GFBB 1DBML 3VE0B 4P2OB 4HJ0C 2XXCB 1Z5LA 1MCDA 2XZZA 5F21B 1F5WA 2VYRE 3WMSA 4U0QB 4OQTH 4UIKH 4HMDA 4CUCA 1N5AA 1E27A 5ACMA 4UQ2A 4EXKA 1EERB 4X9BA 4ORGB 4RAVB 1S9KC 2VZ1A 4G6ML 5EO9A 4UDUA 3SO3C 6FABH 3BH9A 5AWNL 4W4OA 3W9DA 1MSPA 1AJ7L 1OGTA 4L4TE 4K71B 3K46A 3BESR 3HKFA 5I8KL 3RL2A 1IGCL 1BOYA 2IFFH 2CLVB 2M8XA 3NIGE 5CEXB 1T66C 3S88H 3F58L 4WHYG 1I8MA 3ARUA 5GRYA 2OXGA 4Z9KB 1TJGH 1D9KB 3VXQA 4N0UB 4JQVC 1G7QA 1F00I 5EU6A 5C86A 4YAQB 3QUZB 1RU9L 4CVZB 2YS4A 5EZJB 4LRNL 1PDKA 2J8HA 2Y7QA 1WVZA 5L2KE 4QRUA 3MYJB 4R4ND 4PG2A 3QO0A 2B4CC 2OZ4A 3DMMC 1MEXL 2WUBH 4PRID 4Z7NF 1QYGH 5BV7B 3C2AL 3CSYB 3CXHK 3NCYP 5L8LB 2I60H 1ZA3A 3NA9H 4ODXB 2NMSA 1A7PH 4QKXB 4QY8B 5BOZG 4QXTB 5E2VL 3KPPA 5DZNA 3VRJB 3KNBA 3TWCL 2GJ6E 2EIEA 2WQ8A 3QQ4B 3BKJH 1MWAA 3GHEL 1OTUC 5D96C 2N56A 4QXGH 2B0SH 5FA4A 3T8XB 1D6VL 4YPGB 5F9JB 5GS0L 4J4PD 1S5HB 1HHGB 4XP4L 5C08E 3QCVL 2VR4A 1CL7I 4O2CB 1CCZA 3OJDB 4YHNA 1Q9OA 5BZWA 3DX6B 3OR7A 5B4MC 2YZ8A 5HI3C 1FYTD 3QFDB 1VFAA 4KROD 3S35L 3TYFA 4JJ5A 1FG2B 4GSDL 3TJHC 2Q76B 3QIWD 3MO1B 4MA3A 5D1QB 5JQ6L 1B6DA 3C87A 1G7LA 1MI5E 1QPPA 1T4KB 3HE7A 1D5XA 1R24B 1DQLL 2R0KL 3WNMA 1B90A 4P5TD 3HG1E 2ZP0T 5BQ7A 1U92A 1N6QH 2PW2A 1IAOA 2XKUA 1SVCP 1AE6H 1Q94A 2W9LA 3V7AE 5CZVL 2X9XA 3L3JB 4XP9L 5JO5A 1G6RA 4ZUTB 1YN6B 4PREA 1D7FA 2DTSA 4OUUB 3I6KB 4TVSa 3DGGA 4U6VL 3D69B 2V7NA 2IGFL 1P4IL 1FORL 1QD0A 4YR6B 1FHGA 4PD4K 4RISH 3EO1A 4GKSA 4GS7C 5LGJB 3KPSB 3K2UH 5I1IH 5MEPA 1BJ1J 2MHAB 5DMKA 3DPBA 4Z76A 2D7TL 4K7PX 5JIHA 3ARBC 3BP5A 4WUUE 2ENYA 3KDMB 3DBXB 2EC9T 1ES0A 5BRZE 3FQXA 1H8OA 1RUPH 2I07A 4K94C 5IVZA 1UXSB 5DJ0B 1T1YA 4MQXC 2CGRH 4GW1B 4OGXH 4BYHA 4G6AC 1Q0XL 5I1LB 4KY1H 3MRFB 4OCYH 4YDIL 3WXVH 3CFDB 4XX1G 2EH8L 5EG6C 3Q0HA 2OJEB 3OF6A 4ZDHB 2A74A 5C0GA 5DZOA 1HQ4B 4WI2A 3BVNA 1RJCA 3VD9A 3L3DA 3OKKB 4RGOH 5GSVB 2BNQA 3P73A 5LBSH 2Z8RA 1QSZA 2CQVA 4CW1B 1UQSB 3AXLB 1QBMH 3SE4A 3UTPD 1A6VH 4EBQL 4OCSH 1MHPH 3SKJL 1A2YB 5IB3B 4JO3H 3O6FA 1HWGB 1NC2D 5TE4H 1NMAH 2CUHA 1NCAL 2V2TA 2Q86A 5GGTL 1KJVB 2VDRL 3ZE2E 3W0WE 3KYKL 5HHOD 1G9MC 1AIFA 1WZ1L 2X9YA 2ZG3A 4OIIH 5DI8A 3TN0C 2W65B 4Y5XC 4ODTL 3BXNB 3QDGE 1HOCB 1UWEH 1BF8A 4PGEA 2P8PA 4DCQB 3H0TA 3E3QE 2H3NB 3I75A 3NPSB 5FDWA 5GS2H 2YBRA 3ZYJA 1U8NB 4NUJB 4KJPD 4PBVC 2A6KA 3CUPA 4KVNH 5D1XA 3DVFA 1OSPL 4PJEA 1CG9A 2NY5C 4PRNB 5F8RC 4OT1H 2VQUA 3ABZA 4JRYA 5DJAA 2O93L 3HNSH 3OKYA 3MJ8A 1SBBA 1J18A 3VXUB 3EFDH 4JRXD 3GKZA 4DKEH 3LRSB 1M71B 3IJYA 2ATKB 2FL5A 4YDJB 3KPQB 5AG8A 1B3JA 3QUXA 4WWKC 3TA3C 4WJ5B 4HSQA 4WDIA 3RVTD 1F11B 1N7ML 2Y5EA 4NC2B 3DUUB 5DVMA 1WEJH 1W72B 4X7DC 5SWSE 4BQ9A 1YJDH 1ITBB 4PV9A 1FCCA 1EEYB 4O9HH 4JFHD 4WIQA 4JZNB 5JW3H 4TTGA 2WUCH 3S6CA 4WFEE 4L9LB 5K59F 3FHAA 2F53B 3ES6A 3W39B 1BQHA 3JZ7A 3MRMB 2G9HA 1JF6A 1ORSA 3N1FC 2DYPA 1BGXH 1KYOK 3LV3B 1GJIA 5I1AA 3TZVA 4X4YA 4W81A 1KCVL 2K7QA 5T3ZL 5F71A 4Z0XA 3SDXB 4U1NB 3SJVA 1RY7B 2XKNB 1NBYB 3N85L 4JHWH 4GKNB 4WFGD 2R0WH 4MHHG 3MTRA 3FHQA 4M8QA 1YC7A 2HFEB 5I1JL 4LHUG 3RDTA 4LCWD 4KKNA 3VGGA 3LQZB 5CWSA 3K4ZA 5B3NA 3UTQA 4N8CH 5JIPA 1FLRH 3T65B 2ZPKH 3THMH 5CEZD 1L7IL 4IOFC 4LSUH 3RGVB 1YMMD 1DJSA 5GZOD 4OB5H 1R0AL 4N5ED 2VLJB 4ZFOB 2EZ0D 3ZTJH 4E0RB 4WFFE 4KJQD 3RA7L 3FAXA 3BGAA 3QPXH 4XBEH 4KKAC 1Y0LA 2HT3D 4Y7MA 4WFHE 1ZEAH 1H8NA 4J12A 1EA9C 1JF1B 1CXKA 2PF6A 2NX5B 2KKQA 4MNGE 1DBJL 4OZHF 3UPAA 3QJFB 2DM4A 3QIBD 3EOTL 2DQDL 5IMMB 2P5WD 5E94B 4LIQL 4NZDA 4GG8B 5MP6H 2VDML 3SGEI 3M1BA 4BSVA 5CEZH 1BPVA 5C3LD 5GHWH 1GC1H 4G9DA 4PB0H 2C4FT 1BF2A 4HG4K 5DSCB 4G80A 4OLVL 4PJAE 5L6YL 3UTOA 4NO0B 4PJDE 5BVPH 3CJJA 5I66A 2AJ3B 4PJBE 2KBGA 1ZHNA 3I85A 5DYOB 2FX7H 1C5CH 5DQJA 1SEBA 2CDFA 3KS0J 1PKQB 4FMKA 1ZT1B 4UNVA 5C07B 4ZFGH 5HHOA 4YHML 4ZS7L 4AEEA 1YNLL 5C0BA 3H42H 3WE6A 4UU9A 1T03L 4H1LB 5CINL 1ZANL 5J13B 7FABL 3IS1X 4OFYD 3CCHB 3KYMA 4GLRI 4MAYB 5H94A 4LGRB 1KLFA 3HI1B 3QI9D 3KYAA 3VD3A 5B8CC 4I2XA 1UZ6F 4Q9RL 1OT1A 4GW4B 4W68A 4LSDA 5DD5H 3TIDA 2E9IA 3ZTNL 2AJVL 2CR3A 1P9MA 3IVKA 2NXZD 5D7IF 4FQ1H 1YQVH 3MV7D 1U3HA 5GQBA 4G6JH 1CL7H 1ZHBB 4PJ8B 4ZO7A 5FUZH 4ODSL 4QHNB 1E28A 4JRXA 3KJ6H 3MCLH 4R7NB 4YE4H 3UBXB 4KKBC 5JR1H 5HSFA 4CKVX 4XBGB 4XZUB 5FV2A 4HXAH 5DGRA 4LLWB 2UY6A 4KPHL 1AO7A 3VFUA 1I85C 1ZOXA 1J8HB 1T0NA 1VPOL 3RTQD 3KYNA 1CQKA 4X6CB 1FH5L 1JUFA 3KR3L 1EGJL 3G08A 1UVQB 2CRIA 4HK3J 5HGDB 4KXZI 3W2DH 3RWIB 5JTWA 1MUJA 4Y1AD 1FL6A 3HE6C 4IRZL 2GTZB 3R8QA 1YPZE 4WEBH 3F7YB 4PJ9D 4WO4D 2NXYC 5T1DH 1RZFL 3P9LB 5IFJB 5B22A 3VI4F 3VGHA 4LCYB 2AV1A 3C5SA 3ZE0E 1XF2B 5EFIA 3RL1B 3JWOL 4HJ0D 3S34H 3UO1L 5D7JA 2BHYA 1AGEA 4M61A 1F4WH 5CLTA 4LFHG 3LQAL 3GKWL 3O3DB 4HFWB 4NWTL 4F7EB 5EIIB 3P0YL 1KCLA 4MNQB 4HZAA 2EDNA 5LXGL 4XWGH 4Q9BA 3MMEA 3MCKA 4OCWH 5DHVH 5SX5K 1ED3B 3U30C 4S0TD 2CDEB 3HNVL 4AIZA 1KIPB 1WBZA 3MBEA 4M6AA 2VUYA 1N0XL 4FFWC 1T66D 4GAYB 1A9BA 2AV7B 5KSAC 4DOHB 1ZGLM 3OXRA 1RPQA 4DW2L 5J89A 1MCSA 1PG7H 3L5HA 1AC6A 5FHBL 3VFSB 2YEZA 3K81A 4JAMA 3S96A 4E9LA 1H8SA 3BPNC 4XPTH 2A73B 4HH9B 2PYFB 2NY0D 5HYJB 1JZ7A 1X5ZA 4QLRA 4S10A 3O8XC 1XGYL 5JHLH 3QR2A 4LBEB 3V4VL 1S7SA 4ONFL 2JCCE 4XNUH 3FT4B 3I02B 3HZMB 2P8LB 2A9NL 3DMMD 4Y16C 4EN3C 1CVRA 3RZCC 3P0VH 1NFDE 1EIBA 3MRPB 5ESVA 3ZHKA 1J0KA 1I3VA 3WSQH 2GFBA 3VE0A 4KQ3H 2FEEL 4P2OA 1N5YH 1YEDB 3SDDB 1QBLL 3BPOC 1OD7A 3E6FB 3V52L 1G9EA 2H32H 4W6YB 4BZYA 2ITCB 2VRAA 4WU5B 2LVCA 4DVRL 4ORGA 4RAVA 2X9WA 3V4UL 5ADOH 4ETYA 2MOVA 2BNRD 1JPST 1WIOA 2ERJC 3TV3L 4KZEH 3VH8B 4P99A 1A02N 5HHXH 3GJFB 4YO0B 3KJ4B 1WUNT 2V9RA 3O3UN 2CLVA 1WWCA 2DLGA 3VRLF 5CEXA 3G6JB 3AREC 1HCFX 3ZKXC 3Q6FB 1V5JA 1INEL 1U58B 3LQMA 5IBTL 2GW5A 3PWPB 3MRDB 5HI3D 1YN7B 5C6TH 3S36L 3ULVL 2A1WH 3T1FA 1D9KA 3MX0A 2Z92A 4CADB 4N0UA 3G5XB 4XC3H 3QFJB 4PIRF 3TJHD 3ALWA 1QUNA 4YAQA 4CVZA 1IC7H 5C2BL 1EHAA 4N8VB 3EYUH 5EZJA 4K7PL 3V5DA 2F54D 1SY6L 4K9EL 4J3VA 2XTLA 4NQDB 3T4YB 3MYJA 3LRGA 4LK4A 4LVNB 1ONQB 3BPNB 2C26A 2X4OA 3CSYA 5DMIL 2ZCKH 4ODXA 5BJTB 3LDBC 3B3IB 2BRRL 4QY8A 1G9NH 2RR3A 4QXTA 5E2JA 4LLUB 3VRJA 3K4AA 4X4ME 3QQ4A 2FZ3B 3H9YA 5CZKA 2CRZA 4GAFB 4DGYL 1KJ2H 5HXMA 3VGAB 1GAFL 4OI7A 5HYQB 5LCVH 1X5AA 2CSPA 3ARBD 3OKOB 1KCRL 1JYVA 1OLZA 4QRSB 4B5EA 2Z4QB 3HR6A 3H9SE 1X4XA 3T8XA 1U93B 5F9JA 1D3CA 1HHGA 3FO1B 2G60H 4FTVB 4KAQH 3UTSE 4XP6L 4MQXD 4O2CA 4MZ2A 4G6AD 1TZGH 2WP3O 1NLDL 3OJDA 4P4KC 1N8ZB 3DX6A 4NQCE 4Z7NE 3SO5A 3QFDA 3PDDA 2E8ZA 4O2EB 2GAZB 3B9VA 3KVQA 1FG2A 1YEEH 1RD6A 1B2WH 2Q76A 5EA0H 2VDNL 3MO1A 4HC1H 5D1QA 1L7TL 2BOCA 2PKDA 1T4KA 4DQOL 1RK0B 5KVMC 1AH1A 4PRHE 5EORH 3UYRL 5TQ0L 2DQTL 1R24A 4Q7DA 1U95A 1IBGL 5E99H 3CX5J 1OB1B 5T5FL 4GMSH 3KHQA 3CFIC 5SX5H 4WW1B 2VL4A 3OAYK 4HX1B 2BP3A 3MV9B 1JYNA 2P24B 3DHJA 4FQIL 5CAYB 3G5VB 5ALBL 3SGEH 3L3JA 4J6RH 4KV5F 1FO0H 1P6AB 3KPMA 4Z7WF 4KJYB 4ZUTA 1TDQA 4HAFA 2DTMH 4KTEH 4OUUA 3I6KA 2FYYB 5EIVA 1QHOA 4UT9H 1HKLH 3TN0D 3D69A 3G5ZB 3MLUL 2X09A 4YR6A 1U8QB 4KRMB 5T3XL 5LGJA 3OBAA 1NUFA 4FRWA 2IJ0C 3KPSA 3BAEL 3UC0H 3HC4H 2ICWB 2MHAA 2K7PA 3J7HA 2R4SH 4OKVB 3LN4B 3LDBB 1I9IL 2GJJA 4FG6C 3ZL4H 2YD9A 4FFYL 1UXSA 1NGPL 2EXYC 4M1GH 4PJFF 1BM3L 4WUKL 5I1LA 3MRFA 4HLJA 4GLRH 2HWZH 3CFDA 4MA8H 3UTTB 4U4BA 1OOAA 2OJEA 2VXUH 4WWKD 4ZDHA 3T0BA 3TA3D 5IROC 1HQ4A 3PGFH 4JDTL 5CJBA 1CN4A 2VXSL 2PNDA 4P2RE 3IFOB 2G5BB 3TPKA 3HFMH 4K3EL 5E6IB 1F90L 3OKKA 5E70A 5GSVA 1BFSA 4LEOB 4CW1A 4PJFB 4IRJC 2WLZA 1ADQA 4NPYB 4ZMAT 3IU3B 1UQSA 3NCJH 3AXLA 3MV8E 4YXHL 4U6TA 1K2DB 2MQCA 4Z78B 1A2YA 1FGNH 1RURH 1FYHB 5IB3A 4MS8C 4X5XB 1EZVX 5JORA 5DHYB 3QEUB 3TP4A 3MLSH 4P2QB 1WFTA 5HBBA 1KJVA 1XF5B 3EYVB 2YKLH 3GM8A 3QG7L 32C2B 4E41D 4LEXH 4PB9L 2ILLA 2QQLH 4PTTB 4NQED 3RRQA 4MNHB 4NZRH 3TH2T 4C83B 3BXNA 4F37K 2VKXA 4ZFZA 3J8F7 4KHTL 4FA8A 1T3FB 1HOCA 3OWEA 5DEZA 1YECH 4GRWB 4Q2ZB 4JREB 4M02A 4DCQA 4R0LB 1I3RB 1A7OH 4UOW1 2H3NA 1DEEA 1U8NA 3GFUA 4NUJA 2Q3AA 1KGCE 4BSJA 3NVQA 4TRPL 3KPLB 2AEPL 5BZDB 5IB5B 1E4WH 4PRNA 1P7KB 1EMTL 4PUBH 5JZ7C 4NJ9H 2P7TB 1MCPL 3VXUA 1RZIB 2B20A 4IOFD 2NTFB 3OAZK 3LRSA 1M71A 5D7LD 3QUYC 2ATKA 5HY9B 3KPQA 1TNMA 1I1FB 2X2YA 5CEYB 3K1DA 2ZCHH 3GSOB 4WJ5A 1G7MB 5I17B 5DURD 4J8RB 1F11A 3WFBH 1U3YA 3VDCA 1UH3A 3DUUA 4KKAD 5D2NB 1UACH 4X80L 2CDGB 3TVMB 2FBJH 1W72A 5IOPB 2DMKA 1EEYA 4U7MA 5CBEB 3LB6C 3JUYA 3WFCL 1FGVH 3HZVB 2OJZH 3TGXA 4RDQG 2BMKB 2ZWLT 1BFVL 4JZNA 2EDFA 4L9LA 2KZ1B 2F53A 3W39A 2W0LA 3MRMA 1FAKT 4IMKA 2JIXD 1RZKC 2BVOB 2I27N 3N06B 3LV3A 1R5IB 3BKYH 5D93C 4L8SB 1UCTA 3WNLA 1NJ9B 4UAOB 5T1LD 3SDXA 4U1NA 1ZAGA 1NBYA 1N64H 3KXFE 3CIQA 4GKNA 3SGJA 4JY5L 1V3KA 1TVDA 3U4AA 4XRCA 4L4TD 4YBQC 5IMKB 4MYWB 2HFEA 4K3HA 3LQZA 3CDFA 2NY1B 1G6VK 1OGAB 4HFUL 4WI3A 4NC1E 3JWDH 3T65A 2DQCH 4Z7OF 5D5MF 4MCYB 4TTDC 2OSLB 2JJSA 3OAYH 4Y5YC 5K59E 1MLBB 3RGVA 3MLVH 3U82B 1R3IH 1RUAL 3T0VA 5CUSL 1K6QH 2VLJA 4ZFOA 3IXTB 1BJMA 4E0RA 3O41B 4NZUL 5IHZB 5T1MB 1J1PL 1W0YT 3TNMB 1MCWM 2DLFH 4KI5E 2WINB 3F6LA 3FONA 4G6FD 5EZIL 1BBDL 1NANH 1JF1A 3E2HC 4DZ8B 4EUPH 4JFOB 4X7SL 5D5MB 2APWA 5GGVY 1MY7A 4KKBD 3QJFA 4X98B 5IQ7H 5L2KD 5IMMA 1U8IB 5E94A 2W0FB 2XTJE 1JWMB 4C4KO 3PHQA 4GG8A 3KLHC 5EOQL 5I73C 4XVJL 2MCG1 4X7FC 3C8DA 1NMCB 4X6EB 4WI6A 1H15B 2HYMA 5EC1B 4F2MB 3O2DH 3SN6N 3F7QA 1R3KB 4XTRC 2V2WB 1K3IA 1E0OB 1QSFE 5DSCA 3SGKA 3HAEG 2Y1VA 1M7DB 4Y4KB 4MLIA 3HE6D 2AGJH 1WZKA 1KIRB 2NXYD 5F7NC 2GJ6D 2AJ3A 1C7SA 5GGVH 5DYOA 2YR3A 1FC2D 1YEJL 3CVHH 1PKQA 2KQNA 2ZG2A 1AY1L 1ZT1A 5C07A 2WBJC 4OZHE 4XNXH 2J8OA 2Q7NA 4H1LA 4BZ2L 4JB9L 4JR9L 5C08D 4K3DH 3LOWA 4V1DE 1JPGB 4MAYA 1IMHC 2Z35B 3CMOH 3HI1A 4X6FB 1DANU 2ED9A 3VFRB 3B2UC 4QRQA 4GW4A 4O4YL 5DVOA 5DUBB 5I1DB 2HVJB 5JA9A 1HNGA 3RWJB 1ZHBA 4PJ8A 3WFDL 1MI5D 4JHAL 4QHNA 5KSAD 1HINL 3O9WB 4JFYB 3K1KC 1T6VN 1OW0C 5D7LA 4R7NA 1Z9OA 2OX5A 3UBXA 1L0YA 4XBGA 4XZUA 4LLWA 1DL7H 3HG1D 4GAJH 5DD1H 2E8YA 4LVOC 1J8HA 1GYAA 5DK0B 1JK8B 4R9HA 4BFIB 4X6CA 4KJWC 3O8XD 4Y2DD 5IF0A 1MFEL 1UVQA 2C3WA 3B8SA 5HGDA 2HN7B 1MJ7H 5IJVB 3NCBB 5HVGB 3RWIA 2X7LB 1B88A 1QFWL 2HKHH 4XVUC 2Y72A 3OAZH 1VERA 4O5LH 3SE3A 4ZXBB 2GTZA 3A0OA 5E8OB 1O0VA 3X17A 4Y16D 3F7YA 4EN3D 1UZ6E 3P9LA 3ZT6A 3RZCD 1Q9WB 4FABH 4Y4FC 1CZ8L 1F4YL 1XF2A 5D7IE 3RL1A 3V8CA 1WSST 4JFZL 3EZ8A 3ULSB 2FX9H 1MHHB 4WUUD 1WISA 3O3DA 4I5BB 5BRZD 4F7EA 5EIIA 5LQBL 4RGNE 4OZFG 4MNQA 1NBQA 1CDUA 3GRWH 3MJ7B 1EAJA 2HJLB 1IT9L 5A2FA 5E2WH 3BZFB 1ED3A 4XP5L 2R0ZL 3MSPA 4TUOB 1DQML 4U6YB 1QSVA 2CDEA 4RX4A 2H1PH 1KIPA 4L4JA 1T5XB 3QXAB 5DC4B 1GHFL 1A1MB 4UQ3B 3RX5A 5E08L 4GAYA 3ARED 3W11C 4LLVB 1EEZB 2AV7A 2Z8SA 2NY3C 2FO1A 3V0WH 1HYSC 2R2BB 2YOCA 3VI3F 4WNQB 3VFSA 3ZSTA 2AK1L 4OF3A 4LMQE 1RFDL 2XZQH 2BX5A 2A73A 4HH9A 2PYFA 3ALXA 4OV5B 5HYJA 3ZLQC 4S1QL 1QRKA 3QXUA 3ZKNC 1J1OL 4LBEA 3CX5K 3MJ6A 4MLSA 5BS0E 3W0WD 3FT4A 3I02A 2P8LA 1YNKH 4J3OC 3FB6B 4M1CC 2DICA 3A6CH 1SEQL 4Q9QH 3QDGD 3MRPA 4TNWF 5EOTB 1NUNB 4LQFL 4NKMB 1I3GL 3LH2H 1FVDB 2ZKHH 1YEDA 5E2UL 3SDDA 4JO4H 4YX2H 5C0JB 4R2GD 4ONGH 4YDKH 4B53A 3E6FA 3W9EB 4OCLC 3ARDB 4PG9B 3QH3A 2DQJL 1YYLH 2ITCA 4WU5A 1JE6A 4HUNB 5KBNC 2GJ6A 1KEGL 2F19H 1PD6A 2ARWA 5EO0B 3MFFB 4TUKH 3VH8A 3GIZH 4TSAL 4Q0XL 2LU4A 3GO1L 4YO0A 4F58L 15C8L 2XNAB 3G6JA 5ECJE 3LAFA 1JL8A 3Q6FA 1I7TB 2OQJB 1U58A 5DTFB 3QWRA 4P4KD 4JHZA 5C1MB 3PWPA 1KB5H 2R2EB 1WCBA 5SWSD 4MJ5B 4CADA 3G5XA 4X4ZA 4BA8A 3QFJA 2J3SA 1K8IB 4LARL 5HHQB 4ELMB 5ANME 4FQCL 2W9EH 3BHBB 4R97B 3HZKB 4XX1E 4ZO8A 3IDXL 4N8VA 4WFED 4I4WB 3IAQA 4YK4C 1YY8B 3FN3A 4UV7H 3ZTJG 4JM4L 1TJIH 5KSVA 4NOFA 2A77L 5KSAA 2CMRH 4J3WA 4U1MB 4NQDA 3T4YA 4UTBL 2ESVE 1F02I 3X3GL 4WEMB 2FEDC 3ALPA 3SDYH 5F8QC 5C3TA 4Y5VC 3MLYH 1S3KH 3RVXC 4ODHH 4JVWA 5IEKB 3ET9F 5BJTA 5I6XC 3FJTA 3WLBB 5L88H 1KN2H 3B3IA 4JFDE 1DQQB 4LLUA 4P2YA 4HD9A 1RI8A 2FZ3A 2WAHA 4HPYL 4G7YH 5EUKB 2CKBL 4B41A 5C0CB 5KSBF 2VN4A 2SEBB 2CK0H 1ROWA 5HYQA 1EFXD 3OKOA 3MLXH 4QRSA 4YFLF 1G7PB 2DDQL 2Z4QA 3NMEA 5FYLE 1U93A 4OTXL 4FG6D 2HFFB 1VSCA 4LDOB 3FO1A 1DDHB 3WFEL 4ODWB 3BIAX 3VGFA 4FTVA 4WFFD 5M7QA 2EXYD 2UZYB 3UYOD 1N8ZA 3D39B 3QCUH 1DSFH 4WFHD 2JK5B 5KSBB 4BQ6A 2Y07L 1YEHL 2GAZA 4ZNEE 3BI9X 3LKNB 2OXHA 2C4XA 4CVUA 1BEYH 3GBNH 5GGSA 3WUWG 3N0PB 1X5FA 1XCQB 2QSCL 4GXUM 4LSSH 2AKRA 4PY8I 4HS6B 1AXTH 3AFLA 4HBQA 2Q87A 3OJMB 4IRJD 3VXTA 1ITCA 1E6JH 5IW3A 2RB8A 2J6EA 2XICA 2CRYA 3I6GB 3IXAB 3G04A 4FHBD 2ZUYA 1D5IL 3MV9A 4RAUB 2P24A 5ISZE 5I18L 4MS8D 3G5VA 4PJGF 4KK6C 3JTTB 2RBLA 1CLYL 2W91A 1IC4L 4MJIE 5JW4R 3RBGA 1QRNE 2FYYA 3GI8H 3G5ZA 1A0QL 4D8PB 3H9HB 1U8QA 4YHOH 4APQC 3HUJF 4NC1C 1C12B 3PWNB 1C8PA 3V6BR 1WITA 2IPKA 2EEAA 1OARL 5TH2B 4PJGB 1BQLH 4PJ5E 3LN4A 4KRNA 4LSPL 4R7DB 1OSZB 3VWJC 1T1ZB 3MLPA 4OCXL 4EOWH 4RRPA 3L3GA 2R9HD 2RCSH 5JZ7D 3IFLL 2W59A 5GISL 1U6AH 4KI5C 5CGMA 4YFDB 2R4RH 2PR4H 3QUYD 1PZ5A 4UT6H 2YPVH 3VXRE 4Z7WE 1P2CB 4XVTL 5BO1H 2E6PA 2XTJC 2G5BA 1IQDB 5E6IA 3ARSA 1FIGH 1H3PH 2AEQH 1DQDL 2RIKA 4LEOA 1AP2B 5C9JB 2P49B 3I2CH 4PJFA 4NPYA 3IU3A 3LB6D 4S11A 3P4LA 3NTCH 2VH5L 3T0EE 4Z78A 4X5XA 1JZ2A 5DHYA 3VGDA 1P4BH 3QEUA 1FFOB 4PRBA 4P2QA 4GMTH 4DN3L 1XF5A 4KK9D 3EYVA 4OFVA 32C2A 2D7MA 4ALAL 1LDPL 4AG4L 3B5HA 4L1HA 4MNHA 5GGUB 4C83A 1QHPA 4DFIA 1VFBB 1T3FA 2ICCA 1X6LA 4Q2ZA 2YPLE 3MNWB 3KAAA 3REVB 3KXFB 2BSSB 1KT2B 3RU8H 1I8KB 3P40A 3VFGL 5FM5O 4EVNB 3SQOH 2HFGH 2ZOKA 4M6MH 4YBQD 2PTUA 3KPLA 5IB5A 5IFHH 1GPOL 3WDHA 1P7KA 4LF3B 1MCJA 2P7TA 2V17L 3ULVF 2BCKB 1DQJB 3B2VH 1I9EA 1RZIA 1FNHA 1RZJC 2NTFA 2ARJB 5HVHB 1F8TL 2AABH 1I1FA 5CEYA 2D31B 1CD1B 3QIUC 2FB4H 3GSOA 1G7MA 2F8VA 3VWJB 5I17A 4J8RA 2VZTA 1WC7B 4F7CA 4XMKL 4CMMB 3MFGB 3O2VL 4M7LH 3QB7C 5HVFB 5D2NA 3BYTA 2CDGA 4P59L 3TVMA 4F7TB 2XACC 4NP4H 3VDAA 5IOPA 3ZT5A 4RFOL 5CBEA 3HZVA 1UCBH 2BMKA 3NAAH 4MNGA 3QEHB 2QR0B 5D6DA 3N1MC 3KLHD 1DUYB 2X4QB 4RMWA 2C3XA 2XTJB 3SE8H 1EHXA 4U6HB 5JW4N 4IBLT 4WEUD 3LMJL 4XTRD 2BVOA 4OM1L 4MAUH 1Z3GH 1R5IA 4HIJB 1A6UH 5CMAB 4M1DH 4L8SA 1TVHB 3SBWC 1NJ9A 3TH4T 1IILE 1H3XA 4OD1L 3U2SA 3FFCE 3PGCB 4RGNC 4HIIB 3E1F1 4PJBA 2DBLL 4TPRH 5E4EB 5D8JH 2OR9L 5L2JB 5IMKA 3P30L 2WBJD 5I9QC 3ZZ1A 1OGAA 5E56A 3MLZL 1WTGT 3N50A 1KJMA 4MCYA 4NSKB 3C60B 5BMFL 1G84A 2OSLA 4KVCL 3EW3B 1HHHB 4HH8A 1MLBA 4JM2D 3QEQB 4FFVD 4ZAKC 3DXAE 3B2UD 3O41A 5IHZA 5T1MA 1R3LB 4OQTL 4UIKL 3TNMA 3BDYL 5FFLA 2WINA 3U46B 3T08A 1WGOA 4WRLA 1G0XA 2HH0L 4OLYH 4DZ8A 3CSPA 5CKGA 4JFOA 3MA7B 5L0QB 5D5MA 3FMGH 3V9FA 2P5EE 8CGTA 3DV6B 2QL1A 3EOAB 1U8IA 2W0FA 3QIUB 5F9DC 1JWMA 3EOYG 4PGBB 4QGTA 3FRUB 1OPGH 1S9WB 4X6EA 3BUTA 2DOCA 3IFNH 5EC1A 4KJWD 4F2MA 3RY6C 4ZTOL 2AK4E 4OSUL 1R3KA 2V2WA 5C6WH 5F44A 3DRQB 4K7FB 4G8GB 1TJGL 1R3JB 3AGVA 4XVUD 1C1EH 1M7DA 4Y4KA 2K3TA 5E8EA 3U7YH 1KIRA 3FQNB 2YUZA 3BSZH 2BVYA 5FHAH 4Y4FD 4Z7QF 4XT1C 3E8UL 1HKFA 2DL2A 3U4BL 4M7KH 1NGWB 4NWUL 1S7UB 5C0RL 4HKXA 1FAIH 3H9SD 1MFAL 1T5WA 1P5UA 2YHGA 1J7VR 2E27H 3UTSD 2B8OT 4PRPB 4ZPVB 5C09E 1JPGA 2E9JA 4LSTL 4POUB 2Z35A 4X6FA 1GSMA 3R8BB 2PO6B 3VD7A 4NQCD 3BDXA 2EYTB 3VFRA 2FGZA 1BLNA 2JKXA 3WNPA 4ZUUB 5E2TH 5DUBA 1JPFB 5I1DA 3BRDA 2HVJA 3C5ZC 2I26N 1PG7X 2DQHH 2YD6A 4BH7B 1CLZH 3KPRB 1K4CB 5CJQH 3CLEL 4AQ1B 1FZJA 2IEPA 3C6LC 4YBLC 3SEPA 1H9VA 1Z0MA 1J0YA 2NY3D 3O9WA 4JFYA 5BV7H 4PRHD 2BSTB 4PJIB 1HYSD 2B0SL 4MA7L 4NN6C 2XQBH 5JDSB 5ETUB 3SGDI 4N0FB 5D4QA 4JPKL 4HDIA 3U36B 1ULVA 1I7UB 2ORBH 5EBGA 4KKLC 5DK0A 2X89A 3ZKND 1A6PA 4IIQC 3RX8A 4D9LH 4ZFFB 4JFPB 1JHKH 2HN7A 4XCCH 5IJVA 1JGLH 4ZD3H 3QDJB 2X7LA 2C7UB 2EC9U 1TTFA 4OJFH 3GBML 4ZXBA 2HA1A 5E8OA 4FZEL 1UM5H 4YHKL 1S8DB 4M1CD 2JCCA 5DA0B 2WP3T 5IWLC 2YZ1A 1D5BB 1Q9WA 1P7QB 5C8JA 3T0AA 5CJ8A 1UKTA 1I7RB 2JF1A 5GGTA 2Y06L 3ULSA 1FNGB 3LS4H 4TSBH 1MHHA 4G8EB 3LKSB 1A5FL 4I5BA 2VLRB 1CT8B 4JG0L 5F9WB 4O2FB 5FGCB 5CILL 3MJ7A 4UOW0 1AE6L 5TF1L 2HJLA 1XIWC 5C7XL 4CN1A 5KN5B 3BZFA 1GVIA 2HT2D 5EN2B 1P84J 4FQLH 4TUOA 4U6YA 4AY0A 4XNZC 1IAIL 5IHUL 1ZKAA 1HDMB 3QXAA 3L1OL 4HS8H 4FQHB 3GIVB 1A1MA 4Z77B 2VZUA 4UQ3A 4OM0H 3B9KB 5DD3L 4LLVA 4P2RD 1EEZA 4RISL 2EDHA 5MENE 4FXGB 2CH8A 4BZ1H 2R2BA 1RZ7H 4F15B 5I1IL 2UV3A 1CTOA 2AEWA 2Q8BL 1AFVL 3LHPH 3SDAB 1VADB 3MV8D 1A7NL 4GW5B 1RUPL 1I8IB 3WYRA 4OV5A 1BD2E 4JVPA 1CBVL 1QSEE 1BZ9B 2M26A 3ARFC 4BUHA 4XWOC 3MXWH 3WXWH 1J8KA 4KY1L 4OF7A 2VSDA 3WXVL 1A14L 4I0CC 5FM8A 3VCLB 3FB6A 3C09B 1N4XH 4TQEH 4RMTA 2FEDD 5LGHL 4LMQI 4ZSOE 4BKLB 3CGTA 5EOTA 5T33L 2A6IB 3OKLB 4NKMA 3OZ9L 3RVXD 5JHDE 1FVDA 5GGRA 4RGOL 3RWFB 5C0JA 4PRAB 3CK0L 1RIUL 3B9AA 3LCYA 3MLWH 4YUEL 3W9EA 1I9JL 1KGCD 3ARDA 4M62L 1QBML 4PG9A 5EBMB 1K8DB 2HJKB 3QEGH 4X4MA 5DWUL 4OZ4B 4I0KA 4Y4FA 4JO3L 1V3JA 2MKWA 2X4TB 1X5KA 4HUVB 1MH5B 2X6MA 5EO0A 1WF5A 3MFFA 5KW9H 5IW6B 3FO2B 1ADQH 3UEZA 4ERSL 1A6WH 1JZ4A 1UM4L 3O4LE 2EDTA 2XNAA 1F6LL 1XGTB 4CU8A 5IVXF 1EO7A 1I7TA 5DTFA 3TO4B 3RKDD 1UWEL 1KN4H 5D70L 5E5MA 4LPXA 3CFEB 2R2EA 4MJ5A 4NQCA 4HXBL 5I15H 1K8IA 5HHQA 4ELMA 5INDB 4KVNL 3BHBA 1BP3B 5GRVK 3PV6B 3T0EC 4M00A 1YUHB 4OT1L 4RIRB 4I4WA 2KDGA 1I8LA 1YY8A 1FBIL 3R06B 2NY2B 2MCPH 2UWEF 2J8UF 1CF8L 1FV1B 5ICZB 4U1MA 4L8BB 4G8FB 4QTIL 2F8XC 4EUPG 5GGQL 1WFNA 3MRBA 1LHZA 3BWUC 3UJIH 4KK6D 3KXFD 3AS3A 2W9DH 1NCWH 5IEKA 5E7BA 2BXZA 5HGAB 3WLBA 1YJDL 1DQQA 4O9HL 4PS4H 2UWEB 1IC5H 2DMBA 1GIGL 2ZNXA 5EWIH 1ODAA 1IAKB 2WUCL 5EUKA 5C0CA 2NCMA 4APQD 4YEEA 3IF1B 5T5NF 2SEBA 3WO4C 1PZUB 3NACL 5GPRA 2VNCA 5GRUL 5IMOB 1YEIH 4JGUA 1NC4D 3CLFH 4DN4H 1LEGB 1QLRB 1G7PA 5F7HA 3BT2H 2HFFA 1ZGLB 4XC1L 2B1AH 4ODWA 3I3DA 3EHBC 2VL5B 4UILH 3HPLB 5JPMB 1IGMH 3A6BL 3D39A 3B4NA 4KI5D 1CDGA 4LHUB 3ETBF 2R0WL 2JK5A 5KSBA 3LKNA 4LSVH 4JFEB 2NW2B 4XMPH 5JXEC 3VFVB 2GT9B 1EAPB 3STZB 3RI5F 3IDYB 1ZT4B 5DLMH 1XCQA 3EO0B 4G9FE 4GKZB 1C08B 1RZGB 4A2MA 2MQ3A 1FLRL 2FBOJ 4HS6A 4ETQB 3SDCC 1MPAH 3MODL 1QSFD 3D3VE 3I6GA 1M6OA 5KVEH 1CQYA 2RJMA 3HC3H 4RAUA 5E9DB 1OAXL 2P8MB 2XFXB 4NKIH 5DJ2B 2VISB 3JTTA 3STLA 1ZEAL 1BMGA 1T0MB 1AR2A 3K8KA 4P46C 4OCRL 4WGVB 1IZJA 3EJZC 4R4BB 3QT2A 3H9HA 4DTGH 2N4IA 1IKFH 1C12A 3PWNA 3VG9C 4Q97A 4V1DD 2Y23A 3TNNB 5F72S 1REIA 4PJGA 5TH2A 5CEZL 1JI1A 4R7DA 1OSZA 5A3ID 1UB6B 1LE9B 1T1ZA 2CD0A 4QTHA 4J2XA 3F7VA 1NCDL 2QQNL 4QRPB 2EICA 3WD5H 1RUML 4JCLA 4CMHC 3S5LG 1JVKA 2FX7L 3WO4B 2E3VA 5CKAA 2OI9C 1LVEA 5DFTA 3GJFK 4XCFL 1P2CA 3SQBA 5I74B 3V6OE 1PFCA 2V5SA 4GRLC 3V7AG 2QQKL 1IQDA 2XY1A 3OGOE 4OLUH 5KVDH 5E4IA 2JJTC 1AP2A 1FE8H 2ICWI 3HUJE 5A40E 5IJKA 3WIHH 5JW5B 4CVXB 4U0RC 3SGDH 1EBAA 3RFZC 4GQ9H 4E42B 3V6ZB 1CE1L 3BD3A 1UFUA 5EU7C 3O6ML 4NN7B 4YFEA 3SE9H 2XZAH 1YQVL 1SM3H 1IGIL 3HI5H 5IG7B 5FUZL 3MRIB 3D2UD 2DLHA 3G6DL 1JRHL 2C3GA 2VC2L 4IRSB 1JHTB 4P4RB 5GGUA 4L5FL 4NGHL 2NY4C 3FN0H 1U8JB 4OFDA 1NKRA 3RY5A 4ESKA 5B3JF 2BDNL 1VFBA 2VAJA 4RGND 4UV4L 3MNWA 2NY7H 3KXFA 4H20H 5I76B 2BSSA 1KT2A 5DQDH 1I8KA 4EVNA 4YQXL 2A9MH 3CVIL 1FLTX 4UIMB 5H8DA 3RNQB 3T09A 2KH2B 1A3RL 3W2DL 4NNPH 3MRLB 1LP9B 1LILA 1MCCA 2BY3A 4J7RA 4NKQB 5D1ZB 3VXSE 4HGMA 4LF3A 1DLHB 3ARGB 1EDQA 2E7BA 4HUMB 2BCKA 2FATH 1DQJA 4UTAL 3NGBC 4HIEB 3NPZB 3VG9B 2ARJA 4AEIL 2YMXL 2PETA 4P23C 3MACL 4DKFL 2D31A 4LASL 4ZAKD 1CD1A 4HJGB 5D6CA 2CPCA 3VWJA 3RWCB 3VFPB 2AS5M 1WC7A 3B5TA 3RHWF 4HS3B 2Z31C 2VXTH 5EUOE 3BGFC 4F7TA 5I19H 1IGFH 4OGYH 1CICB 4DK6A 2ZUWA 4JO2H 1FIEA 3QEHA 2DBJA 2QR0A 5BS0D 5CIPB 2WANA 3L5IA 4BFEA 2X4QA 1J05B 1FDLH 1V7MH 4XNYL 4KZDL 1JJUA 4HCRL 4U6HA 3HMWH 4R90H 5K9JL 2A6DA 3IAPA 1AKJD 2AI0H 4HIJA 5CMAA 5ID1B 1PG7L 3NZ8B 1TVHA 4M7JH 4U0RB 5F6IC 4FOMA 3WIIH 4KMLB 3PGCA 2D7QA 1QEWB 4MB3A 5E7FA 4HIIA 1DTUA 1CGTA 6CGTA 4QNPE 1AHWB 5C0NC 4NCDA 3CFJB 4D2NA 5IQ9B 2FCBA 3BGMB 2HRPH 4JPWH 5L2JA 4FQPA 2O26U 3EDKA 5C2UB 1F3RB 4GG6F 5HHVL 4RGMB 1MCBA 4M5ZL 2YXMA 3BKML 4AEHL 3P0VL 4NSKA 3C60A 4G42B 1HHHA 2QHRL 1JPSH 4MCZB 1Y18A 3QEQA 4KQ3L 4LLMB 1N5YL 4P9ML 1VFUA 3O0RL 2DQEL 4X6DF 2WK2A 3C5ZD 35C8L 1R3LA 1OAZL 1CK0L 5AZ2H 1JGUL 4P9HC 3U46A 1U8HA 4GG6B 1NMBL 1RUKL 3C6LD 3ARRA 5J1AB 1NH6A 3MA7A 1SJVA 3GGWB 1AGBB 2CJUH 1BIIB 2IAMC 3DV6A 3EOAA 4YHIB 2VLKB 5J4MA 3QIUA 3FQTB 1BQSA 2WSKA 4L4VB 2ESVD 5BOPA 4Z8FH 5HHXL 1S9WA 3MV11 1FCGA 1LDSA 3VA2C 2B4CL 4KKLD 4Q74A 4ZOBA 3G6AB 4H0GA 5JNYB 4JKWA 1N2RB 3I84A 3DRQA 3RJDA 4K7FA 4G8GA 5KG9B 2H2SC 4OUOA 1R3JA 1F4XH 5C6TL 4U05A 4JANB 3WN5C 2A1WL 3ZYZA 4JFDD 2AJUH 5JOEA 1G7IB 3FQNA 3GJFH 5SX4I 2J88H 4JFFB 2PCPB 5J6HB 3ARWA 3SCMC 1S7WB 3P11L 4OZIF 5HYSG 5HPMB 4LPVA 5TE6H 5HYIA 1NGWA 2RGSA 3ZHLA 1S7UA 5FYLD 5IBLC 5IESL 3CSGA 4WCYH 4ORZC 1UYWH 3TFKC 5E24E 3BN3B 4ZPVA 5E8PB 1L0QA 3JWNC 4WTZG 2HLAA 1XIWD 2F5AL 2PO6A 1R6VA 1KBGH 2ZCKL 1CDJA 3VXNB 4ZUUA 3BMWA 3REWB 1JPFA 1VESA 3DUHA 1MCFA 5EC2B 4BH7A 3KPRA 5FM4A 1UADC 1K4CA 3GMMB 4BQCA 1MRDH 4D3CH 3EYQC 1ZVSA 4PJIA 4Z7QE 2KPNA 5ETUA 5JDSA 4OD2B 5TQ2L 1CXLA 3PWJA 3U36A 1I7UA 3TYGL 3GMPB 4YHLH 1IQWL 1JMZA 3DURB 3HCVA 4KAQL 5ISZD 5MEQB 3D25B 4M5YL 1WAAE 5F96H 3ARFD 1TZGL 2EDYA 4JFPA 4XWOD 1CTNA 4QOKB 3V4PL 3QDJA 2C7UA 3ZDYF 2IAMB 3NZHH 3FQUB 4MJID 2OK0H 1QNZH 1QRND 5JPNA 1S8DA 4LPYA 2OP4L 1WCQA 3Q5YA 5CHNA 1D5BA 1P7QA 3X12B 4NOBA 3F5WB 3TCLB 4H25A 5FKAB 1Q0YH 4WFGE 1I7RA 2QADB 2Q20A 1FNGA 2WIMA 2MQ0A 3FN9A 1DFBH 2DQGH 4YZFF 4G8EA 2D9QB 4PJ5D 4I18B 1XR8B 4GBXB 3GEWB 3ZDXE 1CT8A 4K2UH 4KK5C 4O2FA 1A6AB 4BELD 1KEML 1Q72L 3DJ9A 4K94L 3CU1A 1UZ8B 5EN2A 3GSNH 4J6RL 4M7ZC 1I4FB 1DVFB 1RUQH 1KTRL 1W72L 1RHFA 5D2LE 4LCIH 1HDMA 4QRRB 3VXRD 2DS4A 3GIVA 3BZEB 4Z77A 4L1DA 1HKLL 4LOUC 5DT1H 1N59B 3B9KA 2E7HA 4L3EE 5D72H 4FXGA 3UC0L 3EFFB 3QXTA 4NNXB 1TIUA 1AD9B 1YEGL 3BUYB 2WV3A 3SDAA 1VADA 4L3CA 1BWMA 4GW5A 1PVHA 3QO0B 2JE8A 1I8IA 4B7LA 4Y19E 1GXEA 1F58L 1GGIH 1HIMH 5F7MC 3T0ED 4PJHB 4D9QD 2L7UA 3RVUC 2GIYA 12E8H 1BZ9A 5DJ6B 2O5YH 1R3HB 4LCCB 1LO3L 4KI1A 1EHLH 2PYEE 4JN1H 4P57B 3VG0H 4DEPB 1XT5A 3Q1SL 3A67H 3PL6B 5C0AB 5KVGH 1EO8L 5EH1A 3VCLA 4I8DA 1G9ML 2LTQC 2FGWL 4L29B 4BKLA 4X0KB 4WU7B 3S4SG 1TFHA 3OKLA 2A6IA 3N1PC 3HFML 5EIQA 2YPLD 5FECA 5KSUB 5TJWK 3RWFA 4PRAA 1RMFL 2VB5A 4R96B 5KJRH 3PF2A 2E9WA 2HP4A 3NCJL 5DA4A 1CFVH 1JNNL 4YIQB 1K8DA 5EBMA 1YEKH 1MFDL 4ZFOL 2JLLA 2V6HA 1TQCC 2HJKA 8FABB 3UP1A 5IWLA 4OZ4A 1FFQA 1HZHH 4MVBC 1O7VA 2LV4A 2NY5L 2EKJA 4HUVA 1F2XK 1MH5A 2FJFB 3OR7B 5F70A 4I48B 2Y5TB 3TT1H 1S7RB 3FO2A 4LEXL 4EDWH 4Z7VB 3V6OC 2QJDA 3EHBD 4NZRL 3NABL 2EE3A 4N0YH 1G7LB 3TO4A 5KAQF 5F7UA 1NKOA 3CFEA 2YWYA 1SJEB 2C5DC 1RULL 3AM8A 3MRQB 1LO2H 5INDA 5H37H 5JXED 5I75B 5BQ7B 3PV6A 5CJ5A 1CDCA 5BW7C 5I1EH 4RIRA 4PUBL 4NJ9L 3R06A 3BP7B 1P7HL 3VXMB 3FOLB 1PBYA 1IM9D 1FV1A 1DBMH 3SDCD 5ICZA 4L8BA 5SWZB 4G8FA 4KRPC 2EDKA 5AUMB 3DGGB 4CJ1A 4J1UB 1NCCL 3O3AB 1I1AC 3FFCD 4U49A 4DAGL 2Y36L 4G6MH 3TJEL 3ARFA 5AWNH 1HH9B 5IVXE 2FBJL 5HGAA 4Z7UB 1AJ7H 1FVCB 3UROR 3FKUS 4P46D 1FGVL 3O6KL 4PP1C 1QRNA 3EJZD 2IANE 1IAKA 1IGCH 2LTQB 5AAWA 3IF1A 1CLOH 1QP1A 1U91B 5IMOA 3F58H 3ULUF 3NH7L 2GI7A 1LEGA 1QLRA 2V2XB 3LEVH 1ZLUK 4EEEA 1U0QA 2J8UE 1ZGLA 3DXAD 3PUCA 2XV6B 3BKYL 2A74B 2VL5A 3HPLA 5JPMA 4UMGA 1UGNA 1N64L 4AQOA 1RU9H 1MIEL 4PRDB 4LHUA 1MCKA 2VITB 3DETC 3FT3B 4GJTB 4LLAA 1A1OB 4HT1L 4JFEA 2P5ED 2NW2A 3VFVA 2GT9A 1EAPA 3STZA 4G3YH 3U1SL 1ZT4A 4GRLD 5LVEA 1MEXH 3EO0A 4GKZA 1C08A 1RZGA 1JFQL 2OMNA 4KTDL 3OHXA 2DQCL 4HWEL 5I1CL 4JKPL 3C2AH 3CXHJ 4ETQA 1IFHL 2AK4D 2V5YA 3MUGA 4OF0A 4FFZL 4PJEF 1R3IL 1BJ8A 1RV6X 4HGWB 5LKNA 5MI0C 1K6QL 4U33A 5E9DA 3TWCH 2P8MA 2XFXA 5DJ2A 5GSRB 2VISA 4ELKB 4PRIB 3GHEH 4HKZB 2FJHB 2ZUUA 3T77B 3H0TB 4NZJA 4GO6B 4NUGL 1CGVA 2YBRB 1T0MA 4NFBA 1Q9LA 3EDEA 1DLFL 1D6VH 2NY4D 1X5HA 1ZLSL 4PJ7E 4R4BA 5GS0H 3H7LA 4OLXH 5FA3B 2CUMA 1KCSL 4YFLI 2XWTB 5HJ3B 3QCVH 1J0JA 2FNBA 1UENA 5A1AA 3HAEB 3MJ8B 2FIKB 5C09D 3TNNA 4C56E 3O2DL 2YSSB 4LAQL 1LE9A 1UB6A 1NGQH 3WEXB 3S35H 4LNRB 2ZUTA 5DHXB 3K8LA 1ZTXH 2AGJL 3GMNB 4QRPA 2FDBP 1EZVY 5GGVL 4TNWK 1M4KA 3QP3A 5HD8C 2GCYB 2XQYK 3CVHL 3QHZL 4P23D 5EZLB 2AXHA 1DQLH 1FYTB 1DCLA 4KROB 2R0KH 3T0WA 2VAAB 2AXFB 5FO8A 3BQUC 1W8OA 3QIWB 2Z31D 1KCUL 1ZVYA 4UT7L 4G5ZL 4PGDB 4K3DL 3T3MF 5IBUG 3RVWC 3HZYB 2VLLB 4XP9H 3PWUB 5JW5A 4CVXA 1BOGA 5DFWH 4JPVL 4E42A 3V6ZA 4P5TB 3V6FA 4U6VH 3QPQC 4Z0XB 1CWVA 1P4IH 4PD4J 2X1XR 4NRYA 5IG7A 3CXDL 3MRIA 1EVUA 2A0LC 2AW2A 1UH4A 4MWFB 4F9LA 2P44B 4IRSA 1JHTA 1PAMA 4P4RA 4M8QB 2XPGA 4H8WC 3TEUA 4F3FB 5I76A 5C0ND 1Q0XH 3V2AR 3RNQA 4UIMA 4YDIH 3FOMA 5K9OB 1MJ7L 3MRLA 2OLDA 2CLZB 1LP9A 2HKHL 5D1ZA 1MCQA 1DLHA 3ARGA 2APTA 1OQXA 5E00B 1XZ0B 1ZK9A 1ZWIB 4HIEA 1Y0LB 3MJ9H 4G43B 5ESAB 5MEND 5CP3H 4OZFB 3LD8B 2WIIB 4HJGA 3WL9B 2IH1B 3RWCA 1JV5A 3VFPA 5H2BB 4LHJB 4NM4H 2PXYC 4HS3A 4NCC1 4OFPA 3SKJH 3IYLW 4XPAH 1BD2D 4QWWC 1QSED 3PP3H 1MVFA 1CICA 1NCAH 3PQYE 2VDRH 2VE6B 3KYKH 5A43C 5CIPA 4I0PC 4LVHC 2IF7A 1J05A 2ID5A 1MREH 3MA9L 3DROA 4Y0GA 5JHDD 2WBWB 1NC2B 3V0WL 2H2SD 5ID1A 3F65A 3GMOB 3QXWA 3NZ8A 3K4DA 3DVGB 5HHOB 3RUGE 2ZOLB 1H0DB 4HWBL 2XN9E 2XZQL 1OSPH 4WGWB 1QEWA 3MREB 1CGUA 1UKSA 1AHWA 3CFJA 4Q6IC 1LGVA 3SCMD 5IQ9A 3BGMA 3KYMB 1GC1C 1NFKA 5LJYH 2HJFB 1D6EB 3F7RA 4TOYH 4JJHA 5IBLD 2EZ0C 4FQXC 3IVKB 3O4LD 3TFKD 2B1HH 1N7MH 1U9KA 4G42A 4MMXC 4WW2C 2BVUA 5HYEA 3AROA 1KLUB 3QDME 4LLMA 2QLVB 1CFBA 4JRXB 4YX2L 2YK1L 3IB4A 2HTLC 3H3BC 1A7QL 2J6EL 3F7PC 3HR5B 5J12C 4PJCE 3VFUB 1Z0NA 3KYNB 1E6OL 5J1AA 2F19L 5IFAL 3EYQD 1EVTC 5FUCE 3GGWA 1AGBA 1BIIA 4UNUA 3K7UA 1BZQK 1OAQL 2H9GA 3FQTA 3PHSA 4L4VA 4RA0C 3TT3L 1N26A 3WHXB 4WTXA 5T3ZH 3BDBA 2NLJB 5E95B 5JNYA 2D7NA 3CFCL 1N2RA 3N85H 1QLEL 1M1SA 3BD4A 3CU7A 3C5SB 4HPOL 1NUDA 5KG9A 1KSRA 1JPTH 3I3BA 4JANA 5HI5C 1E4JA 2G2RB 4J3UA 5I1JH 1MCIA 4Y89A 1G7IA 4X6DE 4HMEA 1G1CA 1UEMA 3RWHB 1FZMB 3ECBA 2PCPA 4JFFA 1S7WA 4UV7L 1TITA 1TJIL 3MCKB 5HPMA 2CMRL 3RAJL 5I0DA 2BZDA 4GT7A 1MHEA 1R0AH 3BP4B 2LAGB 1H5BC 1I9RL 1TVBA 3AVEA 4LCWB 3VFWB 4HK3N 2YC1B 3RA7H 5E8PA 1TZIA 3MGOB 5FYKE 2HFTA 1AXIB 5E0QA 4BJLA 5L7XL 2DIJA 3OXRB 1LO4L 1TZHB 3VXNA 1YMMB 3REWA 2BK8A 1DBJH 1KN2L 4M43L 5EC2A 2QQQA 4OZGB 3EOTH 1J0IA 1WJ3A 2DQDH 4LOUD 4LIQH 3HS0B 3GMMA 4G7YL 3K8MA 5I71C 3D85D 1J5OL 4G9FD 2HAZA 1MJUL 2ZJSH 2APBA 1DP0A 4OD2A 1IKNA 1K3ZA 1J11A 4HG4J 3D3VD 1EK3A 3GMPA 4OLVH 3QIBB 4WO4C 2P5WB 2MPAL 1RHHB 3DURA 4AK1A 5MEQA 1MJJB 4WY7L 3C08L 3D25A 3RVUD 1V7NL 3NFPB 1FNAA 5HGHB 4QOKA 3SKNB 3WUWB 3DUSA 5IP4A 4NFDA 1YYML 2GQHA 3KPNB 2IAMA 3NCEB 3FQUA 3DSNA 1MFBL 4YHMH 4ONOA 4ZS7H 2R8SH 1YNLH 1X9QA 3KHOA 3X12A 3F5WA 1T03H 3TCLA 2OL3H 5FKAA 4ZYKB 5CINH 4DZBB 1VEMA 1ZANH 2R15A 7FABH 3S9DB 3N9GL 3U7AA 3QDAA 2P48B 4I18A 1XR8A 3WN5A 1E6JL 4GBXA 4Q9RH 1W0WB 43CAB 1TTUA 3BRGC 2AJVH 3MXVL 1A6AA 5E1AB 3AY4C 3BX7C 3UDWA 4MVBD 3OAUL 3K0WA 3IKKA 1UZ8A 3IS0X 1I4FA 1DVFA 4ODSH 2XWJB 2VDQH 3OX8B 3QI9B 3T1FB 2Z92B 2VZ3A 4QRRA 3BZEA 3ZDYE 1N59A 2Q8AL 3GSXB 2NXZB 1MIML 4KPHH 2R69H 1AGDB 2NY0C 3JVGA 3MV7B 5D7KE 3MUZ1 3EFFA 1FH5H 3V5DB 3KR3H 2H26B 4NNXA 1EGJH 1AD9A 4JQXC 1TPXC 1BQLL 3BUYA 4OV6F 4C58B 4DFHA 4XNQB 1LK3L 4ZOEA 4YZFE 4IRZH 5EU6E 2K1MA 2RCSL 4PJHA 1AQKL 4LPWA 2XG5A 1RZFH 1INDL 4YHPB 5DJ6A 4LCCA 1R3HA 2VDKL 4XNMA 3RTQB 2X4OB 4P57A 1NAKL 1W8NA 3OV6A 2WWKT 3PL6A 5C0AA 1DE4B 2Y4SA 4KRPD 1OM3L 4FQJL 5ESQB 5F89B 4Y1AB 4G8IB 3LQAH 1Y6KR 4L29A 4NWTH 1Q9KB 2VZSA 4WU7A 4X0KA 3P0YH 4PJ9B 4WO4B 4X9GA 1I1AD 1FRGL 4W6WB 4DK3A 5KSUA 4U2YA 4NC0B 2IMNA 1B4JH 3B9EA 3U0TB 5LXGH 4R96A 1EBPA 1NLBL 1IEAB 1WWWX 5ILTH 1CDBA 4YIQA 5GRJH 4OCMC 1OWRM 1SMOA 4PP1D 1MRFL 4XXDB 3VXSD 8FABA 4U2ZA 3VDBA 1G7HB 4IJ3C 1N0XH 4UB0L 1RSFA 1P4BL 5TE7L 4U31A 1I1YB 4XPFL 2FJFA 3SO3B 5M95B 4I48A 2Y5TA 3NIFF 1S7RA 1G9NC 4DW2H 5AYUL 5FHBH 4ZUSB 1DBKL 4Z7VA 3H8NA 3C8HA 4WENB 4LQ1A 2BOCB 4P48A 1J87A 4XI5C 2DIBA 1XGYH 1SJEA 3DETD 1H3GA 3RU8L 1U95B 2W0PA 3MRQA 3NA4A 3V4VH 4ONFH 1RZ8B 5FOBA 4DGVH 2H32B 2UY7A 4OQTA 2A9NH 3KWWB 3PDGA 3G9VA 3BP7A 3VXMA 1JTPA 3FOLA 1IEHA 5I8EB 1AC0A 1QACA 2NY0B 5F7FA 1VDGA 5SWZA 3KPMB 3AS2A 1QBLH 3QNZB 2AABL 5J1SC 2WLYA 1RZKL 2FB4L 3QO1B 2AXGA 4TULL 5AUMA 4J1UA 3DMMB 3O3AA 4RQQB 3MV01 3W81A 4M7LL 5DK3A 3V4UH 1HH9A 4Z7UA 5DR5L 1FVCA 1JMXA 1MAML 5KS9E 1UCBL 2J5LC 3NIDF 2R29L 3NAAL 5SV3A 2X4SB 1U91A 5DD0L 4YHZL 3VH8G 1PX4A 2H8PA 4PPTA 3CD4A 3OQ3B 5D96B 1INEH 1QTYT 4PJXB 5LG1A 3CDGB 5IBTH 2V2XA 3TCXA 5ACZB 3S36H 3ULVH 3DV4A 2BNRB 1W2KT 3CZFB 5IB2B 4U1SB 4YBHA 3SKOB 4EI5C 1QQDB 3EOBB 1T6WA 4PRDA 4MQ7B 3U7WL 2R1YA 1A4KB 2VITA 3FT3A 3GMLB 5GS2D 5HD8D 4BH8B 4U7KA 1SY6H 1S7XB 1A1OA 4TPRL 1FL5B 4I9WE 3BKCH 5D8JL 4RMRA 2FRGP 3MQIA 1S7TB 3BPLC 1DBAL 2R0LL 25C8L 3BQUD 5I1KL 1A6TB 1X6NA 5JORB 4JO1L 4WHTB 2BNQE 5DMIH 3RVWD 2F54B 2E7MA 2H2PC 3ULUE 1DZBA 3U9PH 2XWBB 4HGWA 5DMGC 5M94B 1UB5B 2QTEA 3QPQD 5BW7A 5GSRA 4ZFZB 4ELKA 5F6HI 4PRIA 4HKZA 4KDTA 4PLJC 2FJHA 3T77A 4IM8A 1GAFH 2A0LD 1DEEB 2Y6SC 4OD3L 4X8JB 5FA3A 2XWTA 1V3MA 3P77B 2O5ZL 5HJ3A 4XP6H 5KOMC 2W0KA 3HAEA 4NHCL 2FIKA 3IFNL 4GS7B 3ARPA 2YSSA 4XMLH 4OIBA 3WEXA 3ARBB 4LNRA 4OFKA 2E6JA 1C1EL 1FJ1B 4PJEE 3U0PA 2VDNH 3GMNA 1MAJA 4J4PA 4YXKL 4UINL 4JRYE 4WHYH 4HIHB 2VWEE 3BSZL 3FRPG 5FHAL 1FO0B 4XPBH 2GCYA 1GZPB 5EBWB 3UYRH 5TQ0H 5FUCC 3L95B 5EZLA 1OAUH 2V5TA 1FYTA 1QFWI 3SDXF 2OS7A 2VAAA 3U4EB 2AXFA 4H8WH 2AEIT 3MNVB 3QIWA 2PXYD 1R5WB 1LQSR 4FQIH 3GSQA 2YD1A 4PGDA 4QWWD 5ALBH 3HZYA 2VLLA 4MB5A 3MLRH 3PWUA 1T21B 3S97C 4P5TA 5E2TL 3T2NL 3GNML 4I0PD 4JY4A 3QCTL 3BPLB 3ROLB 1CLZL 1OCWL 3MLUH 5CJQL 1ZV5A 1AI1L 4Y4HC 5T3XH 4W6XB 1FSKC 3QHFL 1FFNB 3G5YB 4MWFA 2JTDA 4XRCB 4I3RH 3H3KA 1QO3B 4ISVA 3TN0B 4Y5XB 3SJVE 4F3FA 4MX7B 2FECL 4OLZL 1S7VB 1IGJA 4WUKH 2FD6H 5FK9B 5C0IB 5K9OA 5C92A 4NZTL 5CD3B 1JGLL 2CLZA 4ZD3L 1MF2H 3T3ME 1XMWA 1A7RL 1J10A 4FQXD 2VXVL 4UUJB 5TFSH 3R1GL 3X3FL 2VXSH 1MRCL 1XZ0A 5E00A 5HDBF 1ZWIA 4K3EH 3FONB 1NPUA 1F90H 3TO2B 4G43A 3OPZH 4L3ED 2DJ4A 3PNWB 5ESAA 4OZFA 2CO7B 2WIIA 4Q6YA 3WL9A 2IH1A 1F13A 2DAVA 5H2BA 1FC1A 2HTLD 4JN2B 3MRHB 4WWKB 4YXHH 3TA3B 3JWDC 3B5GA 3PHQB 4Y19D 3QRFM 2XIDA 2ZUSA 2B5IC 4NO3B 3D9AL 2VIRB 5D71L 1TJHL 2PYED 3GB7B 5CJOL 5F3HB 1KTLA 2VE6A 3QG7H 4YWGH 2E9BA 4PB9H 1WV7T 1WBXA 4HS8L 1TENA 4MXVE 5IKCA 5H37G 2R56H 4KHTH 4OM0L 4XBPB 1EJ6A 1NC2A 1ZS8B 1OF2A 2OR8A 3GMOA 2AJSL 3DVGA 5HI5D 4E41B 5I1GH 2ZOLA 1H0DA 2APXA 3PABB 4TRPH 2AEPH 4NQEB 3MREA 3RI5K 3CH8A 4IEFB 1EMTH 3QQNA 4NKOB 3KG5A 4YGAB 1MCPH 1Y6MR 1FSKB 3HA0A 2HJFA 4KH2A 5CSBA 3Q2CA 4KDWA 1D6EA 4HWZB 5TDNB 3S37H 2ADGB 4QRQB 3DX9B 4XHJC 5C0BE 1U8MB 3EDDA 5I8OL 4X6CF 4Y8DC 2Z0BA 4HF5L 1UA6L 5DO2D 2NY6C 4PGJA 1SYSB 1KLUA 1KELL 4R26L 3OB0K 4IOSD 3IKCB 5D7LB 1P5VA 4I2XE 2GYSA 3WFCH 5AZEL 1NBVL 1BFVH 1A21A 3HR5A 2DF3A 4MSWB 5DURB 4JKMA 2J4WH 4JE4B 1BZ7B 5IF0B 3I50L 4XCNB 5C0EB 5KW9L 2N7BA 4XVSL 1FNLA 4PG2C 3WHXA 1A6WL 4HIXL 3BEVB 1AO7E 3U9UB 2NLJA 4HUXB 3C6SA 3LKQB 5KZCD 4EZMA 3IJSB 4JY5H 1WAAA 2B5IB 4YLQT 2NYYC 2ZUXA 2JIXB 2G2RA 3NIGF 3O3BB 4K8RC 4UNTA 5T1LB 2IAND 4HFUH 3RWHA 5E8NB 1FZMA 4LP5A 4LSQH 4JDVB 5INCB 4EUPB 4PYHA 4LU5L 1EFQA 1XF1A 2YUWA 3MBXL 1RUAH 3BP4A 4NJAL 3PGDB 4XCEB 4L4TB 1MFNA 4LCWA 4NZUH 5CFHA 3VFWA 2BJML 2YC1A 3PP4L 3RVVC 3MGOA 3S3SA 3UJIL 2W9DL 1RJYB 2NR6C 1BBDH 4YGVB 1TZHA 4X7SH 5HYFA 1YMMA 5B8CB 4PS4L 4OZGA 3Q48A 1OAKL 4FXKB 3RIFK 5EWIL 3HS0A 4JRWA 4U1JB 5EOQH 5ENWB 4XVJH 4WW2A 3ILQC 4Y2DC 4G6FB 3HE7C 3CVHB 4L8CB 2I5YL 2EH7H 2UZIL 1MCOL 5DJYB 1T7VA 3GSUB 1IVLA 5L2KB 3BT2L 1TMCB 2B1AL 3QIBA 3GHBH 4GRMB 2P5WA 1RHHA 4S1RL 4UILL 1MJJA 3NFPA 3OL2A 5HHME 3L3IB 5HGHA 5FXCH 3SKNA 2LABA 3WUWA 2IQ9L 2AQ3A 3KPNA 5IIEB 1WT5C 3G6JF 5BXFB 2DD8L 4XMPL 4DUXA 3QH3B 3HE6B 2JB5L 3RHWK 4BZ2H 2NXYB 4DZBA 4ZYKA 2GJ6B 2LU3A 2YPKA 1Z9MA 3BEWB 1ZVHA 1KNOB 4O58L 4C56D 1PW3A 1W0WA 43CAA 4O4YH 3HMXL 4YNYB 5F7LB 5E1AA 5C08B 1NANI 4OFYA 4JHAH 2Z8WC 5K93A 1HINH 4OAWB 2XWJA 1WCBB 3OX8A 3QI9A 3U30B 5HDLA 4ODUB 3VFOB 4YXLL 1GGCH 3GSXA 2QHLA 5GS1C 1A8JH 5HGGS 1AGDA 3MV7A 4XI5D 2YA1A 2DJSA 2H26A 3TBSB 5KSVB 1MFEH 1MI5B 5KSAB 3UJJL 4H0HB 2CIKB 4N0UE 1QFWH 3ULUC 4XNQA 3S5LB 3SE4C 5F7EH 4LRIA 5F1OB 3HG1B 4F9PA 4YHPA 4W70A 4BQ8A 3LIZH 3M07A 3RTQA 5IVNA 3O6FC 1CZ8H 1YNTB 3O8XB 4UDTB 4JFZH 2PTTB 4Y2DB 4R2GC 3E3QC 1DE4A 2FHFA 2CUIA 3DLQR 1GOGA 3E0GA 5ESQA 1F42A 5F89A 2BSED 4Y1AA 1DANT 4G8IA 3OB0H 2WNGA 4HCRA 4JZOB 1Q9KA 3FT2B 5LQBH 2DL9A 1WZLA 4PJ9A 4WO4A 2XZCL 4Y16B 3V5HB 4EN3B 3RZCB 4KU1A 1J1XL 1KIUA 3U0TA 4JZJC 4IOIB 4TVPL 4XP5H 2R0ZH 1IEAA 3BPOB 1BECA 4XXCC 1T2QL 3WIHL 3RBSA 2VN7A 1KJ3L 3PHOB 4WUUB 4XXDA 5D1XC 5T1KD 5TGBB 3ARYA 3E6HB 5BRZB 4XB8A 1G7HA 5E08H 2VWEC 4CJ0A 1SM3L 1I1YA 4BK4A 2YRLA 3HI5L 4MD4B 5ALCL 3GSRB 3BE1H 1RZJL 4ZUSA 1VGEH 2AK1H 2VERN 2ERJB 3EJYC 1OLLA 1K5NB 5GGSB 1M05B 3FAWA 5FYJL 4EI5D 5JLZA 5DVKA 2WWMC 3AREB 2AKRB 4AH2B 4CRPA 3B9DA 2X05A 3ZKXB 1J1OH 4H20L 5GRVL 3ZYIA 5IHLB 3ZE2F 5DQDL 3VXTB 1RZ8A 3PQYD 2C3VB 1DR9A 2H32A 5J6GB 4JQVA 4JEGB 3G04B 3KWWA 1URLA 2EE6A 4HWUA 1SEQH 5GS1B 2FATL 5I8EA 3B43A 1QKZL 4LKCB 1I3GH 3LPWA 2JELH 1PLGL 5E2UH 3QNZA 4K3GA 2XRAL 5IK3A 2H2PD 4JQXA 4K23H 3QO1A 3TZVC 3NIFE 4Z0BL 3W0WB 5DMGD 5DQ9B 1F45A 2ZSVB 2DQJH 3DMMA 4RQQA 2XN9D 4KUCD 1U8PB 3QDGB 1ACYL 4PLJD 3QUKB 1KEGH 3UZEA 2DLTA 2IPKB 1KB5B 1JYWA 4R8WH 1IGFL 4OGYL 2Y6SD 2ZUQC 4HBCL 4R2GB 4J3XA 3VWKC 4Q0XH 3GO1H 3RDTC 1JGVL 3L3GB 3S35X 1PY4A 4F58H 2X4SA 4QYOB 15C8H 1FDLL 4X7CC 3LEYH 2XQYG 3KPSE 3H3PH 1TCRB 1ZE3C 4PJXA 3CDGA 4JZJB 3QDMD 2BERA 5ACZA 3M8OL 2BNRA 1PZ5B 3EYSH 3T04D 1NAML 4A6YH 5JXAH 2YN5A 3QQ3B 3CZFA 4LARH 5IB2A 4M7JL 4FQCH 4U1SA 3PDOB 3SKOA 4NFCA 3D5OF 1QZ1A 1DBBH 1QQDA 4RWYL 2HLFC 4HQQL 3AB0C 3EOBA 3IDXH 1WFOA 4ZTPL 4MQ7A 3X13B 1A4KA 3GMLA 4BH8A 5HVWA 4JM4H 5IHBA 1S7XA 4P4KB 1FL5A 1MCHA 4ZUWB 2HRPL 5KTEL 5SWSB 4MD0B 4JFQA 3L6FB 4UTBH 4OIAA 1S7TA 4I77H 3X3GH 4GRWF 4F57H 1CD0A 1A6TA 5IUSA 2YA2A 4QRTB 3GI9L 4WHTA 2CLRB 4PRBB 2F54A 4X5LA 4DVBB 2XWBA 3DX7B 3OR6B 1UB5A 1MCWW 4DGIL 3BO8B 2IQAB 1K4DB 3P9MB 2OYPA 2CKBH 4Y4HD 2EDRA 3T0XA 2ED8A 4E5XB 2YWZA 2ZOKB 2DDQH 4D0CB 4OTXH 4X8JA 3BFOA 2R9HC 3P77A 5DUML 2VOTA 4N1CA 1ZA6B 4WWID 1JCKA 4FS0A 2VDPL 5FYKD 2K9UA 2DQIL 4D0DB 1EFXB 5FYKU 3ARBA 4IS6B 1YEHH 5FUOL 2EDLA 1BHGA 1UC6A 1FJ1A 1MNUH 3QAZC 3TBWB 2AJUL 4NNYB 1FNFA