4UT7L

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'ASQSVLTQPVSVSGSPGQSITISCTGTSSNADTYNLVSWYQQRPGKAPKLMIYEGTKRPSGVSNRFSASKSATAASLTISGLQPEDEADYYCCSYATSRTLVFGGGTKLTVVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7L00
1MJJB 4J8RB 5C0FA 3S96B 4S1RL 5CZXD 2EIZB 5F7DB 4QRUA 2YOCA 4X4ZA 3ZE2E 1Q9OB 4YBLC 3W5MA 4XNMB 4GAJL 5IM7A 4ELKB 3RJQB 2EZ0C 1NAKL 4A6YL 2A6JA 4NFBA 2M2DA 1L7TL 4LRNL 4M6ML 1JPST 5IESL 3EFFA 1BWWA 3BH8A 4XB8A 4D9QD 3KWWA 1P84J 4R96A 5EBMA 3OKKA 3QDAA 3TO4A 5LXGH 2NR6D 1AO7B 4NHUB 3LSOA 4ONHA 3C8KB 4NP4H 5DSCA 3F62A 3B9KC 3S4SB 4G8GB 4GRLC 3KVQA 5MEPB 3O8XC 2OR7A 3UX9B 5C2BH 4NPYB 3GSUB 5AYQA 3EBAA 4H20H 4U1MA 5BV7B 8CGTA 1C5DA 5FYJE 4PJAE 4Y19E 2FO1A 1NBZA 1N5AA 2KQNA 4MJ6B 4OZHA 2RJMA 1MWAH 4NC0B 1U3HC 1JYVA 2DIAA 3X14A 2VXTL 5IFJA 2LU3A 4GXUM 4P5TC 3IAPA 2BX5A 5IR1B 2YXFA 1G7HA 1LP9B 4LHQB 2AQ3A 4JFXA 4G7YH 1YNLH 4E5XA 3TPUA 2DLHA 5ESVA 4O02L 3THMH 1FYTB 4CVXB 4P4KA 4YC2C 3MLRH 1NSNL 3BIAX 5I73B 2PCPA 1NAMB 3OAUH 2XN9B 2H2PC 2HLFC 1C1EL 3QWQB 4OLUH 4UILH 2ARJQ 3TEUA 5ADOH 4GG6E 2XQBL 4HFUL 4IIQA 4UB0L 2GFBA 2BY3A 3AAZB 4OF8A 5DEGB 1FFPA 1AGEB 1U36A 5DUBB 1D5BA 4G9FB 4W70A 1QR4A 1NDGA 4DKFL 5D71L 2VLKE 4YBQD 3HE6B 2DQDH 5FGBA 1QLRA 2E27H 3R4DA 4AENB 1AJ7L 1Q0XH 3QEHA 3RVVC 5HDBF 1SYVB 3ARDA 2ITCB 4LVHC 1CD1B 1NANI 1P4LA 5IB1B 3DOSA 3NVQA 4LHJB 1N64H 1DDHB 1WJ3A 1UA6H 4MLIA 3E3QE 3WUWB 4QRTA 2G5BA 5GRVK 2DIJA 1OAXH 3PP3K 1OP5H 5ACLA 4WJ5B 1HH9A 2DQCH 3MUZ1 4KMTL 1ZA6A 3FB6B 5IHZA 1GHFH 4APQA 2Q6WB 3BIBX 3NBNA 3TCLA 3E6HA 5FV1L 1A6UH 3BKCH 5ICYB 1A1MA 1M7IA 3MJ9H 3IRZA 2YD3A 1FORL 1U92A 4E41D 5CUSH 3RU8H 5D7KD 2AXFB 1U8QB 1BVLB 1V3JA 2VDNH 1E4WH 4LLDB 5F7WC 4PJCB 3SCMB 5JW4N 2ICWI 4XP9L 3QEGL 5L9DH 1VEOA 2VSCA 4NT6B 5KTEH 3B5GA 3BP7B 2EICA 3QP3A 4MXVE 4UT7L 3H9SA 1H8NA 3BSZL 4CUCA 3PGDB 1AKJB 4YE4L 3B2UD 5HGBA 4PJGF 4OLEA 1T89A 4U6YB 1OL0A 3WN5C 1FZKA 3NGBC 3S7GA 4OGXH 3HE6D 3VFVA 1RHHA 4WWKB 2DQJH 3UTSE 3FN3A 3HPJB 3RWFA 4KZEH 3M1BB 2XTJB 4YXKL 2NXYC 1CT8B 4HUVA 3BDYL 3EDJA 2VLME 1X5AA 4BM7A 5I1KL 4LVNB 3PHOA 4JANB 1A0QL 3ES6B 2EYRA 5GS1C 5HGDA 4MAYA 4D9RD 4Z78A 3NOIA 1NMAH 1QLFA 1U91B 2ZPKH 3I84A 1UXWA 2HFFB 1KBGH 2Z93A 3HMXA 2PXYC 5DVNA 1VFBA 2XRAL 4U3HA 3C5ZA 3VXPA 1EHXA 2CUMA 2X4QB 5DMIL 1FJ1A 2VDOL 3AS3A 5FUCC 5CP3A 2EXWC 3ULVE 5IVXA 4PGBA 3SDCD 3L3GA 3GB7A 2VZ1A 2Z31C 1BQHA 4OZHF 4LFHD 3RWHB 4X8JA 4IDJL 4P9HH 4LVOB 1D6EA 5DVLA 4QHNB 4Q9BA 2CPCA 5EO1B 3LQMA 3ZHLA 4RBPH 4HC1L 1OAYL 1BOYA 5KSBA 1Q9LB 7FABL 4K07A 2BXYA 3H0TB 4W81A 2QSQA 2MCPL 1MIMH 4KXZH 5E5MA 1LO0L 4HBCH 2AJSL 5J1AA 3MLPA 3G04B 2FD6L 5IFHH 5C6TH 1AKJD 1U8MA 3OGCA 2R0KH 4JO2L 4YDIL 5IB3A 1YYLL 2NY1D 5D6DC 5J1TC 5EU6B 1F4AA 2DQHL 4O2CA 4GRLA 4KQ3L 3SE9L 5CZKA 3O8XA 4I0PB 3SO5A 4G3YH 3FT2B 4Z7QE 3HI6L 3W2DH 3EZJB 5JUEH 1KCRL 2XTJD 1IAIM 3O2WL 2NX5B 1G9MH 2IH3A 4PY8J 3WHXA 4GAGL 1B6UA 4CGTA 4I5BA 1U3HA 4M1CD 4YHOH 2ZG2A 4C54A 1G6RB 1NGPL 4NRYA 5HI4D 1M71A 1BX2B 4P5TA 1MUJA 4WUUA 1MCEA 2OJEA 3V6FA 1CQYA 2DJSA 3A6CL 2R2EA 1GAFL 3G5VB 5IV2B 5C92A 2GJ6E 4Z7WB 1UWEL 1A6WL 1HINH 4RFOL 1AE6H 4WNQB 3RTQC 1K2DA 2VOTA 15C8H 5JW4M 3SDDD 3GJFB 5HHOD 1GIGL 4PLJD 4YDJA 1AGFB 4Y5XC 5ISZB 1OAUH 2GTWB 4Z5RA 1MCNA 4L5FH 4TSCL 1IBGL 3NCBB 4OM0H 3FHQA 1MOEA 5B39G 5L2KE 4BUHA 1XR8A 5KOVC 4OI8A 4X98A 4TUOA 1MCWM 1DBJL 5F7EL 1QBMH 4HIXH 4O58H 3QCVL 2IH1A 1VB9A 4JFFB 1CGVA 3ROOA 2DBJA 3F7RA 3MREA 3O3DA 3OB0H 3RWDA 1VFAA 3G5YB 3D0LA 4HD9A 3VD5A 4MD5B 1IC4H 1KIPA 4BQ6A 5E9DA 2AERT 1Z9SA 3HRZA 5HYEA 2O61A 1F8TL 3H9ZA 3KG5A 4K2UL 2ADFH 2QTEA 2YEZA 1QSEA 1FL3A 3HUJE 1T83C 3QHZL 4WI9A 1WZ1H 2NX5D 4J6RL 3NFPA 2VXSH 4R2GB 4MJIA 4X5WB 1KCVL 4HK0B 4X7TB 5HD8C 3WIHL 5JOPE 1K6QL 1FIEA 5FA4B 3PNWA 1WBYB 1ZGLB 2XNAA 2GJJA 4NKQB 2CRZA 4YUEL 5FUZH 3BXNB 1UEMA 3VFGL 4C56E 4JO3L 1INQB 5J7CC 4G6JH 2VXVL 1K5NA 5GIRA 3I75A 3QDJB 3K8KA 2A83B 3EW3B 1ZT4A 3TV3H 3TBWA 3KPSB 3WLWD 4BH7B 4BFGA 1MREL 4NKIL 3UTTB 4XMKH 3GMLA 1ZEAH 1A8JH 1UJ3C 1QBLL 2MOVA 3DV4A 1IZKA 1KN4H 1MVFA 1JZ4A 1CR9L 3C5JB 4I2XE 3U2SB 4Y5YA 2HVKB 4JPKL 4WU7B 3RVUD 1G84A 4PYGA 3EAKA 3MMEA 1AXTL 2EDLA 2YZ8A 3REWA 1PVHA 5DJZA 4RIRA 2BVQA 1MFBL 2W60B 4ONGL 2VH5H 4XNXL 4MD0B 4AK1A 1ZE3C 4IRJD 3H42H 1IZJA 2M1KA 3T0VA 5EDXA 2VXQL 3ARFB 2JCCA 2VQ1B 1OLLA 4X0KB 1N8ZA 1CLYL 1JPFB 4H8WC 3BQUB 2V5MA 3P4NB 4LPVA 2WUBL 5DDHA 3OBAA 4NBYB 5BV7L 1A64A 1P4IH 5FM5O 2V2TB 3GHBH 1ZANH 2IFGA 2RCSH 1C7TA 3KXFD 4LARL 2H2SC 5KSBF 5KW9H 4M7LH 3KPMB 3CD4A 5MHSE 1YY8A 3HG1A 4IRZL 3B83A 3SGEI 4M7KH 1YA5A 1AD0B 1I8KA 2IG2L 1IGYB 4R2GD 5EORH 4UAOB 4YGVA 3CVIH 4KPHL 1M05A 2CSPA 4M48H 4I3RL 4NUGL 2F53D 1M1SA 5FB8A 4YK4C 2VITA 3IXTB 1S9KC 5JPNA 5BOZG 5E4IA 2AGJL 4N5ED 1U42A 3BRDA 1KJVB 5CJBA 5JQ6L 1WISA 4YEFA 1NAML 3V0AC 5GRYA 1JWMA 1O7VA 2J1KA 4FQCL 3QDJD 2Z31A 3KPSD 4OZFG 5T1MB 1TZHA 1F4XL 1OAZH 5EBGA 4PJBB 2I9LB 4HDIB 4ZFGH 3FO2B 4RMVA 3LEXB 5EBLA 3D69B 4UMGA 4BQBA 4DW2L 4UTBL 4MDJA 4P2QB 5F89A 4BK4A 2GITA 3QEQA 3U7YH 3GSVB 3MQIA 2G75B 1JFQL 5GRUL 5E1HB 3SE3A 2JJTC 4DUXA 2Y5EA 3DX9B 2QHRH 1KLFA 4QHLB 3GUTB 2Z8SA 1GZPB 2F5AL 2Q1EA 1ADQL 3IXAB 3RNKA 3ZO0A 3GMPA 4GQ9H 3ARFD 3U7WH 4JRXB 2OX5A 5IFAH 5F7FA 3MV9B 4XP1L 1KACB 5L0QB 4DAGH 4H5SB 4TVSa 4DQOH 4HJ0C 2IBBA 1FVDB 3QUXA 3SOBL 3IGAB 25C8H 2Y72A 1TENA 4WHTA 5FF6A 4YAQB 1FFNA 2ARJB 3DVIA 1I7TB 5CWSB 1BQLL 2PETA 4F7PB 3SKMB 2VQUA 4LASL 3QCTH 4B5EA 5BS0E 1I9EA 3C08L 2F5BH 5HPOA 1GL4B 1EBPA 4GW5A 3TVMA 2FR4A 3UO1H 5ICXB 3LEVL 3WIIH 3RTQA 3D18A 5A16A 2G9HA 4P2OB 1X5HA 2ID5A 4GAYB 1MJ8H 4KHTH 5D2NE 1FVEA 1S7QB 4BSJA 2CUHA 1D6VH 3G6AA 4XNYL 3VFRB 4MAUH 1JHLL 3RDTC 3QPQD 4MJ5A 2AKRA 4P3CH 4YHLH 4Y4HB 5CBAA 1CYGA 4XMPH 4LPYA 1XGYH 1FNSH 1T7XA 5FEBA 4OBSA 2J4WL 1NKRA 2AXGA 1T21A 1K85A 4G9DB 2VXUH 4BSWA 1IAIH 3MZTA 4LIQH 3BKYL 3RWJA 1A7OH 2Y5TA 1C08A 3OXRA 2ZKHL 1S7RA 5BO1L 3U30C 3I02A 1I7UA 2QADB 3H9SE 2VLJB 1S7SB 3TT3L 1FE8L 4YHPB 3MOAL 4L3AA 3IFLL 2DDQL 4YHKH 1D5ZA 2EDXA 4X9IA 3V5HA 4YPJA 1XAUA 3QO0B 2YN5A 1JN6B 1T83A 2X4RA 2COQA 3MRGA 1SBSH 3QJFA 5E5RB 2HFTA 1V8HA 1EBAA 4D9LH 3MJ7A 1QYGH 5HGAA 1FAKT 1K4CB 1UKSA 3VFUA 1C5CL 4AIZA 3WXWH 4BFBD 2XZAL 1JGDB 3VXRA 4EQ3A 1XGPB 3FT4A 2HG5B 4YJZL 3VMNA 1NCAL 5FGCB 4F7TB 4MQTB 3H9YA 2P8LA 2X4SA 4N0YL 1U6AH 5I15L 4ORZC 5I1JH 5AD0A 5FAAA 1UJ3A 5CLTA 3QIBA 3SJVE 3VXQA 5J4MA 4HWZA 1NJ9A 4PTUB 4F37K 3FO0H 1YEKH 4DKAA 5D7LB 4XHQA 5JR1L 1SQ2N 2F58H 3T08A 3AC0A 4R90L 5I6XC 2FZ3A 5BJTB 4PRID 4BK5A 3LB6C 1MJUL 1HEZB 2QQQA 1OM3L 2VDPH 5SV4A 2ZCKH 2V2WA 4LLQA 5HBBA 5HYJE 4MWFA 1RPQA 4YXHH 1DL7L 5TJWK 4F58L 2FL5A 1KPRB 1PFCA 4G8FA 3HI1B 3W0WA 1GH7A 4NYLB 2HFGH 3ARZA 1UCBH 2VLJD 3J7HA 3IVKA 2AV7B 4L8SA 5FECB 3BD3A 5D1ZC 1FL5B 3HLAB 3QZWG 1G6RL 3C60D 3P2TA 1YEHL 4P2RB 4KAQH 5F7LB 5IVNA 1KB5A 4BFEA 1MHPL 2IANB 4LKXA 5F44A 2EH7L 3SPVA 4UQ3A 2X44D 3MJ8B 5FM8A 4CDGC 4XPAL 3LKQA 2BHUA 1VGEH 4LBEA 3VXUA 1I4FA 5DMGC 4ZFZB 3RWCA 1HHIB 1CICB 3BN9C 3GSNB 4EUPA 1IGCH 5JOFB 3FRPA 3JTTB 2BFVH 4JRYD 4KKCD 3LN9A 3T2PA 2C5DC 4FZ8L 4JY6B 4ZUWB 4HKXB 5EU3B 3O6FC 1F6AB 4J4PD 3BPCB 5SWZB 5GGRA 2R4SL 3VFNA 5ADPH 4Z0XA 3K0WA 1R5VA 4NRXA 5MEND 5INCB 1DBMH 3UJTL 3DROA 1MVUB 3MLZL 2JJUA 4P5MA 2NPLX 3LHPL 5FM5M 3F7YB 3NCJH 1Z3GH 5D7LD 4ZNEA 3M17A 1ZLUH 1TTUA 4X4MA 2HKFH 5JNYB 5C0DB 2CKNA 5H8DA 2WBWB 2BJML 3U0PB 1QEWA 4OJFH 3DTXA 3UJJH 2C7UA 5GGQH 4JFDA 3SGKC 2DRUA 2DWDB 4RRPG 3VRLF 1TETL 1G0XA 2DKMA 4NWUL 3AM8A 4PD4K 3MRPA 4U2YA 3UYOD 3CFDB 3ECBB 1SEBA 3BZ4A 5DYOB 3L6FB 4IHOA 5K9JL 3O2DL 2FSEA 4XZUA 12E8H 1DVFC 3SGEH 3HTLX 4PJ9A 2FHCA 1LNUA 3FL7A 4EI6A 1ORSB 3V6ZB 4OAWB 1JHKH 2V2XB 4P2RD 1BM3H 1X3DA 4D0DA 1KG0B 4OB5L 5I18H 5C0AB 1DQDL 4Y4FC 1KB5H 1JPTH 4PR5B 4PG2C 4GKSA 3HRPA 4R97B 2FBOJ 4UBDD 4JO4H 1JNLH 2VAJA 3HC3L 1CICD 5DD6A 1HYRC 3CNKA 4LNRA 3MLTB 3GI9H 5ERWA 5IEHA 3FQTB 2HLAA 1BFSA 4EUPH 4XCEB 3W5NA 1TTFA 1I1AC 4G6KH 1FPTL 4O2EB 1W0WB 3P4MB 5JLZB 1DLFL 3U0WL 5EIQA 3JV6A 1S7XA 2DWEA 3HE7A 5F1IA 3MRJA 3C6SB 1RZFH 3MGOB 2RQ8A 2W9EL 3TJEH 5F6IB 4LP4A 4P57A 4ZMAT 4WFGE 1Z5LB 3Q2CA 4DN3L 4WV1A 4R26H 4C4KT 3PDDA 4Z7VB 3IF1A 3FQXA 1OQOA 3U36A 2ZUYA 4OD1L 3HC4H 1U8OB 4P46C 5C8JB 5D7IA 4V2BA 3EDKA 1KLGA 3ZHDA 3LVEA 1U58B 4N8CL 4JDZA 1UWGH 1EEYB 3OKOA 4GXVL 3U0TA 5I2IA 1UADC 4GRWH 2VL5A 1KEGH 4AT6B 2BSRA 1S9VB 4OZIE 1X5XA 3MA9L 4JFQB 5C0IB 2DKSA 3LMJH 3FJTA 1CD0A 2OMNA 3I3BA 4ZYKB 1RUML 1MCFA 2JCCE 2C3XA 3IDMA 3B6SB 2UUDH 4NZUH 4R4ND 1HHGA 3MNVB 4JFEB 4IRSA 2JJVA 3I2CH 5GGSB 3SE8L 1FNEB 1FN4A 5DF0A 4KJQC 1RU9H 3IS0X 3GKWH 2ADJB 3MYZA 3PWLB 4JZNB 4M9OA 3FN0H 1TVHB 5C0AD 4FXGA 1IAMA 1KTDB 1B2WH 1U93B 1GC1H 3UTPE 2GTZB 1VGKB 1DQTA 4JN1L 2BXZA 3CXDL 4G5ZL 2HAZA 2YBRA 3OZ9H 1LDSA 4QY8A 3QJHB 5EULV 5DQDL 3GJFK 1ZK9A 4OKVB 4JLRB 1P6FA 4X9GA 2B39A 1CBVL 1P7KA 4GKZA 1PGRB 5HI5C 4PP1C 4MMXC 3RVWC 2Z91B 4ODVL 2ZUSA 4ORGB 5FUCE 3VXSE 4NM8L 3P4OB 3QO1B 4F7MA 2UWEB 4JAMB 4X6FB 3JUZA 1OAQL 3VRIB 4HHAA 3QNXB 3DMMC 2J8UA 2D4DA 4HUXA 3DV6A 4FG6C 5EZOL 2PO6C 3CDYA 3RGVB 4M9PA 3WJLC 4F8QA 3FFCB 5E6IB 1YN7A 5C3LD 3WSQH 4Q6IC 3TWCH 1YMMA 3HAEG 3VD3A 4BUGA 2EE2A 3QEQE 4TN9A 4KKLC 1CU4L 5L7XH 1DSFH 4OLWL 2R15A 2RAMA 4BSVA 3JWDL 3MV8B 2MHAA 1RJZA 5TDOB 3O3BA 5FK9B 4FFYL 5T3XE 1QA9A 3MRHB 5D1ZA 5IBTL 3O6LH 1U8HA 3VFMA 3VGGA 1HOCA 1JE6A 3QUYB 5D1QC 4Y2DB 5FCSH 5TE7H 3FOLA 4MQXC 1A22B 5DJ6B 3TBVB 4KKBC 4NJ9L 3WFHA 3LPGA 2ZUXA 5DRXB 4K71C 4KVCH 1DBAH 1JZ7A 3QNZB 3HI5H 1NCCL 5E8EA 3KDMA 5I75C 4CN1A 3BZDA 1OTSD 4NNYA 1ED3B 2ZWLT 1PZ5B 1BAFL 3ZKND 5J9PB 3QAZB 4BKLA 3VXMD 3PDOB 4YHYC 5GPRA 5HHPB 3VGAB 4CJ1A 2A1WL 1P7QB 2NY2C 4CMHB 1T5WB 3V4VL 5JHDE 2DQTH 5ESAB 4M3KB 2IGFL 2VDQH 5C7XH 3C6LD 5E99L 7CGTA 4NQVA 4KHXH 4LCCA 4EN3B 5FO9B 4OLZL 5D96C 4KVNH 4OUOA 2YN3A 3WUZA 4ONFL 4R7DB 3ZE1F 1JPGA 1N2RA 1DCLA 4TPRH 5E94A 3TNNA 1OAKL 1X5YA 3RGVD 1FAIH 3UPRB 3QG7H 4J3OC 3VWJD 1YPZA 4MSWB 1BECA 5E6ID 1CK0H 1YNKL 5CD5D 4K8RD 4N8PA 3KS0H 3MV8D 4OZGE 1H5BB 4G8IB 2QR0A 1TZIA 2P5EA 4QRRA 3ARGD 1SY6L 5J3HD 4KDTA 3CCHA 1BD2B 4Z7UA 4OD3L 3MNWB 2NXZD 3L3OB 5D7IF 5T3ZH 3ZSTA 5DVOA 2H9GA 4Y2DD 3OKMB 4ZS7L 4PBXA 4OCSL 4R6UA 3ILPB 1NGWB 4JFPB 3C09C 4PG2A 2OYPA 1ZS8B 1S3KH 2PKDA 4PJ7A 3ARWA 5FOBA 3S37H 3S5LG 4S1SL 3VFPB 1K3IA 1WFNA 3ZDXE 3FO1B 1RIUL 3QDGE 3V6OC 2W9DH 5JW3L 1S7UA 2YA2A 1Y18A 4W6YB 1H15B 5KS9B 1L6ZA 1LDPH 1TQCC 2CXKA 4ZPVA 1I1AA 1VA9A 2OP4H 3ESVF 5DJ0A 5GSRA 3QT2A 3PG2A 1JHTB 3F7PC 3B9EA 1MRDL 3QUKB 1AQDB 2H41A 3FB7A 4JFZL 5C71A 5IK3A 3FT3B 1P7QD 2DBLL 5I1AA 5GISH 4ZUVA 3WEXA 3C87A 1PKQE 4FQIL 4M93C 3GMMB 2HJKB 4P46A 2GAZB 1BREA 1VACA 2X4OA 5HHQB 3NACH 3O3EB 3MXWH 1LD9B 2V5TA 3KPLB 4XPFH 3HMWH 2VIRB 2VR4A 3W81A 3WLBA 3X3FL 2HWZH 5GXBB 2ESVA 4HWUA 3P40A 4QRPB 4YWGL 5DFVC 1DBBH 4PGZA 43C9B 5JIIA 4X80L 2I25N 4PJEF 3AREC 1FBIL 1A4KA 1A6AB 5CIPB 3MRBA 1I9IL 1YYML 1QSFB 1BEYL 3GM8A 4XPHH 1QVOA 5ILTL 2J8UF 1AI1H 2WMPA 4XCFL 4FHBD 4L3EE 1TTGA 2FBJH 2HN7B 4MA8H 4CN6A 4QTHA 2EDQA 2NYYC 3C2AH 4FQLL 2ZOKA 4R0LC 1B0GA 3GSNL 1AHWB 1OB1A 2W65B 4EBQL 2UVFA 1J18A 4Z7OF 1UB5A 4RMSA 1KC5H 2R1YA 4HF5H 1ZVSB 5DRNB 1E27A 2HFEA 4HUWB 2ZUVA 3QPXL 4U05A 3VXUE 5HYSA 3G6DH 4NQEA 3QH3B 1OSZA 3FZUD 1AGDB 3KYOA 1LEKB 4FP8H 1RZJL 3UPCA 5HVFB 1XF3A 4Z76B 1T1YB 1I8IA 5EZIH 3ARRA 5C0EB 1YECH 1OT1A 3E2HB 3BDBA 2MCG1 1LEIB 5LGHL 2FX8L 3GHEH 4OD2A 3U9UB 2AEIT 1A3RH 2APTA 2F54B 1FH5H 4GOSA 1LO3H 3CFIC 3O6KH 3WJLA 3JVGA 4F3FB 3NZ8B 4YIQB 2YK1H 2OTUB 3ARQA 1SVZA 1TDQA 4Q6IA 1RURL 3I9GL 3LQZB 2ED9A 5BRZD 4HXAL 4ZNEE 5HI3D 3RIAF 1K8IB 3D3VB 1TZGH 2CKBB 5KSVB 1KELH 5CD3A 1J0KA 3KNBB 4D94A 4GRWE 3FHAA 1XGQB 1KENH 4JFDE 2QQNL 4U7SA 2XXMB 4JHAH 4E42A 2GEEA 4RGND 4U1SB 3IYLW 1K9TA 3HNVH 1CDJA 1ZHNB 1EHLH 3TNMB 1TNMA 2GK0B 1G7MA 3OHXB 5D1QA 5IJKA 5I30L 3VGEA 5CS7A 4RQQA 1D5IH 5DMJB 3CU1A 3DRTA 4NBZB 3VE0A 2E9IA 4HGWB 4KK8C 2P5WA 4PJBF 5JDJA 1J8HB 5BCAA 3E1F1 4LHUB 3P73A 2MQ0A 5IW3A 4Z77B 5IQ7L 2WANA 2DQGH 2VSDA 2DQFA 3PWJA 3BE1H 3MLXH 4NCC1 1KYOK 4JHWL 2APBA 4UT6L 5D5MA 3SQOL 3QUMA 4NQDB 2KPNA 4E0RA 4PJ5E 4Q9CA 3PL6B 5FO7B 4OCLC 1X4XA 4N90E 3MZGB 2EIBA 5GJTL 3QFJB 4OCYH 3PP3H 4ZFFA 3DJ9A 4Z7UF 3ZSSA 3GSQA 3UTZA 1DQQB 3FTGA 2YD2A 1WC7B 5CZXC 3VG9B 2GI7A 4MHHI 1H0DA 3HNSH 5C0BB 3VFWB 5DJ2B 4JY5H 5AAMA 2H3NA 1FGVH 3RNQA 1WCBB 4M03A 2C3GA 1S5HB 4FABH 4M1GL 1T80A 1FCCA 2R29H 2X2YA 5FKAA 4NN7C 4JRWA 3EZ8A 4PLOB 2UZIL 1JF6A 1XGTB 1KT2A 2BY0A 4QXGH 5GGRY 3D6GA 4MDIA 3IDUA 1RIHL 1A7NL 1QBAA 1P69B 1WZLA 4F7CA 4A6YH 1KTRL 2NR6C 1KEML 3DYMA 5E6ZA 4NQSA 5GRZA 1MHEB 1GGUA 2W0FA 2DTMH 2QSCH 3MTRA 5DI8B 4X4YB 4XRCA 2V7HA 3DXAB 5EN2B 1NGXB 2PTTA 2Y07H 3V9FA 3IDXL 4WTZA 4DN4H 4QHUA 2AEQL 3CFJA 3KLAB 3SY0A 3TN0B 3BWUC 1HHHB 3D39E 4KK6D 1WWBX 1G7QB 3QXWA 3QUZB 1DFBL 1INEL 1UM4L 1GGBL 1DQJB 4FQXA 3TT1L 4PGDB 3V6OA 3WIFA 1IQDB 5C0RL 3ORJA 5C0ND 2NW3A 5H94B 3PGFL 3GDBA 4GSDL 4NQDD 4JFHD 4QYOB 4Y0GA 4N9GB 3CGTA 3OR7A 3QUMH 3PL6D 5D9SB 4LAQH 5JW5A 3QFJD 3JTSB 1UYWH 4J1UB 4JQIH 2WQRA 1J88A 4QCIB 1NBQA 4CADB 4Z7NE 1N6QH 2E8ZA 3RI5K 5C0BD 3EYSL 5E2VL 5BMFH 4N1CA 4OF3A 4QRSB 4GW4B 2NTFA 1XF1A 2XZCH 4G6ML 5FKPB 1JGUH 4PJXA 2PW1B 1U2CA 1CFTA 5B3JF 1ND0A 5I1IL 3BEWA 3GBML 4DCQB 3DUUA 2E6JA 5ENWB 2UVEA 5LVEA 1U8PB 1QQDA 2ERJB 1F4HA 1OPGH 4YBQC 5D6CB 3MUY1 3PQYD 3GMOA 1R3LB 4W4NA 2EXYD 1TQBC 1BBDL 4UB0H 1HZHH 2X9WA 4M4PA 5D72H 3E8UH 1A4JB 2J5LB 4ZD3L 4L8BA 4JREC 3QEUB 1JNNL 5D71H 2AXJA 4JR9L 5E8NB 1JNHA 2R0WL 4KKAD 2VN7A 3DXAD 1DUZB 1AGBB 4RGOL 1R6VA 4UU9A 5BV7C 4R0LA 1EEZB 1IC7L 3S35L 5T3ZE 3UAJD 4Y89A 2ZCLH 1Q8MA 2AK4E 1M7XA 1JWUA 3UJIH 2OTWA 5F3HA 3L3JB 1HDMB 1I1FB 4PRAA 4LP5A 5EOCH 4MCYA 3NCMA 1NCBH 5J6HB 4LLAA 4XNUL 4JG1L 2A73A 4RX4D 1YEJH 4ZFOA 5TPWH 3ARBA 4ELMA 1U9KA 1ES0B 4HPOL 1JV5A 3WFZA 3TBYB 4RNRA 1OGTB 5E6YA 1IM3A 1MHCB 1HHKA 1JF1B 4HFWB 2DJUA 2CMRH 3S34H 3MV7B 5DMKB 1X5JA 5DUPL 1MFCL 3MRDA 1RJYA 4RMUA 1A9EA 1RJLA 2AEPL 5I73C 2X4TA 4LCUA 4L4VA 4V1DA 3FMGL 1DP0A 1S9XB 2CK0L 1YEGL 1UC6A 3STLA 1FORH 1Q9WB 4LSDA 4G43B 3D25B 3T4AB 1NGQL 1LO4L 1RFDH 1OWWA 5GS2D 3D9AL 1U95B 2R8SL 4BZ1L 3PWUA 3D85B 4MNQB 5E70A 1B6DA 4M4RA 3QWOA 5BVPL 3B2UC 3DO7A 5F8RC 3IDYB 3LY6A 4JDTH 1P1ZB 4XP9H 5TE4L 3QEGH 3CMOL 3HE6C 1YPZE 3IJSB 4LPWA 3NAAH 3V2AR 4QF1A 3UTQB 3W39A 3B4NA 4HULB 2B1HH 1I1CA 4FQ1H 1U41A 3N85L 4QRRE 4U1JA 4OUUA 3F8UB 3ZKSD 4I9WE 4LSQH 5K9KA 4G42B 2VWEC 2A77H 1UFUA 2GT9A 4R3SB 3PV6A 4DZBA 5ALCL 4KJPD 3LKNA 4BQ8A 5I1KH 5A3ID 9CGTA 4J12A 3CLEL 5DEFB 5KJRL 3NA9H 3QQ4A 3TIEA 4AQOA 4KROB 4PJ7E 5DJYB 2BNUB 2EO9A 4KY1L 1UENA 1R0AL 3FAWA 3T0DA 3B9KD 4LPUA 3SDCC 4C59B 1X5ZA 3G6JB 1S7VB 1P6AB 4PJDA 1OARH 5EOTB 1CE1H 1F58H 4UIMA 5E4EB 2I5YH 2IADA 4WWID 2AJVL 5IGXH 3QIUB 3MR9B 4YHMH 4UIKL 4PRHB 2ZSVB 2ARWA 4V2CB 3GO1L 4EXPX 2P49B 3DO3A 1WT5C 1D5MB 4IDJH 4XC1L 4NHCH 2H32A 1MAJA 1CE6A 2YPLB 3MCG1 2NY1C 3F6IA 4YNYA 5HHNA 5CJXC 4D0CA 2IFFL 4L29A 1EZVY 4UNTA 1EVTC 2SEBB 5DJDB 5IB5A 2Z92A 2JIXD 4LLVB 2XTJC 1HIMH 5IKCB 4WTXA 4YDIH 3BKJL 4M1CC 4LVNC 1CD8A 2DQHH 3IDNA 1J5OH 5HI4C 3UPAA 4HIJB 1IGMH 4B41A 2HT3D 2BCKA 2JJSA 3MLYH 2DL2A 3QG6B 4M8QB 3NH7H 3BIKB 1JRHH 3ZTNH 4Z7VF 3O2WH 1BFTA 4I18B 3MRQA 4HKZB 4KI1A 5FYLL 4L3CA 2ICWJ 4F33A 1J12A 4QRQB 1HXMA 1CL7L 3HKFA 3SDDC 3Q5TA 2BHYA 2DLGA 4PLJC 2Q76A 4WHCA 4NQEE 4JN2B 4NDMA 3WCYA 5C07E 1UWEH 1OTUD 1A6WH 1HH6B 4LVOC 3L5XL 3ESUF 1T4KB 4CW1A 2M8XA 2A6DB 3ARTA 3CDGB 2CKBL 3QIUD 4OLVH 1P9MC 3G5XA 4FQJL 4WFED 3RWEB 3PXJA 4UV7H 2O5YL 5ANMB 2ZZUT 3MUGB 1NH6A 2ADGA 5JIHA 2C3VB 1T03H 1RIVL 4HGKC 4XCNB 1FDLL 4PGCA 3DSFL 1MQKL 1ZOXA 4TSCH 1IBGH 1K8DB 3MRMA 5KG9B 1LO2H 2H32H 2FNBA 3QRGH 2YPKB 3V8OA 5I76B 1NL0H 1RV6X 3LDBB 4HEPG 3LRHA 2ZUWA 3Q3GB 1KJ3H 1DBJH 3RKPA 1FVCA 4WO4A 1UEYA 3IETA 1IKFL 5JORB 1S7TA 1YQVL 5EU7E 1MIEL 3SDXA 1ZTXH 5J06A 3PJSB 3U83A 2NLJA 4FQ2H 4HJJH 3PHSA 1F8TH 1RD6A 3EFDH 2JB5H 1NLDH 3MROA 4K2UH 1I1YA 1F97A 4JEGB 2ED8A 3MRNA 3T04D 3QHZH 2P5WE 1FZJA 2E6QA 4LSRL 1YN6A 1MCQA 5E2TL 4P4RA 35C8L 3L3KB 1KPVA 2X9XA 4ETQB 3S36L 3Q6FA 4E41A 5D5ME 2YD6A 2ITDB 5IMLA 3WLWC 4U1HA 2BOBB 3ZTJG 2HJFB 1OY3B 5DD0L 3ZKXC 2XZQH 1PLGL 2VXVH 3ZDZE 5I8OH 1NMBH 2L7UA 4PJHA 2V7NB 3RVUC 3HS0A 2EKJA 5TDNA 5EA0H 4UTAL 3LZFH 1KIRB 4MA1B 3T4YA 2GJZA 1PYWA 2CDGB 2PXYD 4JM2A 5HHXH 5GGVH 3ULSB 3NABH 1CVSC 1FG2B 4IRJC 3GSOB 4AG4H 1OF2A 3VRJB 3WNLA 3WFBL 2X1OA 5JXED 2B4CC 1YJDH 1JGEB 3NPSB 4ODTH 4S1QL 2A9NH 1NC4B 2EDEA 1P7HL 1T5XB 3VWKD 4XNXH 3C9NB 1XEDA 2ZUQB 4TRPL 1EO7A 1GZQB 3S3SA 5DRZB 3ULUH 2AV1B 2VXQH 2CDEA 4I77H 4YFLI 1UVQB 5D2LF 4JVUA 2V5SA 2WUBH 1G7LB 4R2GC 4ESKA 4M6NL 2FH6A 5BV7H 2RFXB 1NEZA 3DUSB 4KKNA 4RWYH 2BRRH 3EOBA 5FYKH 4IOSD 4LCWA 3WS6C 2ORBH 3CFCL 1KGCE 3EGSA 3HPLB 3FQUB 4OI9A 5KVFL 2WWKT 4N5EC 4GRMA 5KSAA 3V6OE 1DUYB 1PDKA 2DTSA 1VPOL 3SDCA 1S8DA 1UJTA 1AIFB 2IAMB 1I7ZA 1NCUA 3K1DA 3EOAA 1VCAA 4I3RH 1U8QA 3B9VA 4ALAL 3KPQB 4QXWA 4LLDA 1GJIA 2PNDA 2B1AH 2VR9A 4HLZH 4PPTA 1NAMH 1RK0B 4GQPH 3BZEB 3GMQA 3W82A 1BFVL 5F9JA 3LN4A 1OGAE 3DBXB 1WT5A 1ZHKB 5GQBA 5TF0A 2GSIA 1VADA 3Q5OA 3PGDA 2B5IB 2R23A 2VO5A 1YEDA 4LNVA 5FYKU 4TTDD 5DD5L 3ARFC 3CH8A 3O45A 1U0QA 2NY5H 1ZA3B 3MLVH 4X83A 5KS9F 1LE9A 4L9DA 1KCSH 1NC4D 3V0VA 5EPMA 4OFKA 2C3WA 4JO1H 4TVPD 1RUQL 1CZ8L 4POZD 2Z35A 1B4JL 2F5AH 3UC0L 1ADQH 4C57C 4G8EA 4XHJC 4JY4A 4WW2C 4Q0XH 4BYHA 2VB5A 4NKOA 1KSRA 1ORQA 5AWNL 3U7AA 4XCYB 4QGTA 1ZHLB 5I74B 4N0FA 4NWTH 4PJAB 3OKLB 4Y19B 3S3JA 1JZ6A 1T20B 5C0GA 3VG0L 4DZ8B 1CGSL 4UAOC 3JSSA 2E9BA 2Z0BA 5BZWA 2QQLH 3KYMA 3LCYA 5B38G 1J11A 2AJZA 3ULUF 3EJZD 3KGRA 1JBJA 1BQLH 4XI5D 5ID0A 1UH4A 2EEBA 4P59H 4LASH 2BNQA 2CIIB 3SDDA 3FRUA 3NIDE 5HHOA 2NMSA 3C08H 2BOCA 3D1MC 4LDLB 1A3LH 1BZ7B 3LV3B 3BJ91 4ELME 3QPQC 3KLDA 2Y36H 4LLWB 3SDXF 4PRDB 4GKNB 4PV9A 1J1XH 4AMKH 3OXSB 3FFDB 2HTLD 4KJYA 3SDYL 3MGTA 1NLBH 2EC8A 3OKNA 1HQ4A 1LILA 5DD3H 3RAJL 5HJ3A 2HH0H 2OQJA 5E2WL 1QSVA 2EDFA 2YA1A 3DECA 3GIVA 2CRIA 2H26A 2FCBA 3O2VH 2F19H 3IU3B 3ETBF 3Q1SH 1JPSL 4L9LB 2XYCA 4DUWA 2J4WH 3CFEB 2CGRH 3P0YL 2O5ZL 4LKCA 2VLKB 4MHHG 5DA4A 3TYGL 3VFSB 3PGCA 4XAWL 2O26U 5AEAA 2J88L 1R5IB 4KI5F 1MNUL 5FOJA 3W9DA 3D0VB 3GK8H 3JWDC 4X6CA 3KPNA 5L0QC 3GBLA 1AQKH 3LD8B 3CSYB 1HXYA 1PW3A 5F72S 4JZJB 5CGMA 1U3ZA 3BAEL 4JM2F 4CVZA 3RPKA 2D0GA 3TT3H 3FCTA 1IRAY 3MOAH 2E7BA 1PEZA 2XWTB 4N0UB 4KUCD 5F3BB 1W72A 5L88L 3O4LA 3QXAA 1IT9H 5EOQH 2D7PA 4K3JL 1XZ0B 2X7LB 1KTLA 1TJHH 2XPGB 4O2FA 3AU1A 1ERNA 1MLCA 4LEOB 3MOBH 4XWGH 3EIFA 4NJAH 4XVJH 1JMZA 4HKBB 1WZMA 4R7NA 1G6VK 5DJXB 1EDQA 2X42A 1C5CH 3MXVL 1Q1JH 5DUML 1Q72L 3U4BH 1HSAB 3GJFA 3EKCA 3OJ2C 3DRQB 4RA3A 4HG4K 4K3EL 3RY6C 2CLRA 1U3YA 4WU5B 4PJDE 5GGTA 1TJIL 4QHKI 4OTXH 5DJAB 1T3FB 4ZSOA 1N5YH 1YC7A 4IRJA 3BN3B 1U8NA 4H1LB 4JG0H 4QOKB 2VDLH 5J13C 5IJVB 4ODHH 4D9QE 3RWIB 2QADC 3LPFA 4N8VA 3EO1A 3MBEB 4TSBH 4XXDA 5HHVH 5I1CL 3FO9B 1LK3H 3KXFA 4K94H 4YX2L 5KVEL 2OL3B 1DL7H 5T5FH 4F58H 2F8XC 1ODAA 4X6DA 2Y23A 4ZTPL 4M62H 2YRLA 5T1KB 1GPOL 2EDBA 1A7QH 3WS3B 1CLOL 5J8OA 1FC1A 4HZLB 4IMKC 4P23B 2FATH 2XKNA 3CXHJ 1UQSB 1G6RH 2F53A 3PWVA 4UINL 3TM6A 4JFYB 5JHLH 1YMHA 1M6OB 1MHPH 4HPYL 2EDDA 2NY4B 1KTKE 4KKCC 5D8JL 2WBJB 3LN5B 1JGVL 1BBJA 1QFWM 3QDJA 4J4PC 3P4LA 4MS8D 2LAAA 3PE9A 5F9OH 3T77A 1DLHA 1BJMA 3FQNA 1PX3A 1SJEB 4Y4KA 4XTRD 3TC9A 3S4SG 4YGAB 4NQCA 4RDQG 5EO0B 5TFSH 2HVKA 2P24A 4LGPB 3GJFH 1WICA 1G7IB 4YHIA 3UEZA 1BOGB 4YHNA 1O7SA 3T3MF 1B0RA 4P9ML 1I9JL 5EO9B 1UM5L 4IS6B 2R4RL 5CHNB 3GJEB 5GGTH 3UJTH 1E6JL 1I7RB 4JPWL 4POYA 1GGIH 4FXKB 4QOKD 4XVSH 4UDUA 5IQ9A 3ROLB 2IEPA 2VKXA 4BZYA 1XIWB 2B4CH 5EB9A 3WXVL 4QT5B 3SDAA 1FO0B 2AP2A 2CR3A 3BEVB 3MBED 5JDSB 3C8HA 4YXLH 2YD9A 4RAVA 1Q9KA 4WW2A 5KVMC 2BSTB 3BWAA 4EVNB 2JTDA 2YZ1A 4NWUH 3ILQC 3BMWA 1OCWL 4MA3B 4ZUUA 2D31A 3MO1B 4DTGH 5FFLA 3VH8B 1LE5B 1T04B 2YXMA 2R1WB 4P99A 4WI5A 2VAAB 4O51A 4DKEH 1LO5B 3LS4H 4UBDC 5KVDL 5IWLC 4O4YL 3MLUL 1CICC 2X41A 3K4AA 3LIZL 1R3IH 1A9BA 3L3DB 4OB5H 4U6VL 1UACH 1X5IA 5K93A 4L8DB 2WBJD 4X6EA 2GJ6B 2FWOB 4AM0B 1JWSA 1LP9E 2VC2H 2VJXA 2NW2A 5IIEA 4NM4L 2I9LA 4E41E 2D3VA 1J0YA 2IPTL 5D7KE 2BDNH 2R56H 1WWCA 4L8CB 3TBTA 3GI8H 4GS7B 3P9LB 2VISB 5CMAA 4Z18A 1MCWW 4FZEL 4D0BA 1T7YA 1MCOL 3OX8B 2G75A 3WUWG 4G80B 3B9AA 3KS0J 4PJHE 2FJGB 1HHJA 2BVOB 4EDXA 5L2KB 4MD4B 2BSED 3QI9A 2WIIA 4HBQA 4PJ8A 4DN3H 4I3SH 4TVPL 5I8CA 1LK2A 1UM6H 4QHMB 2JELH 3VFTA 1RUKL 3IDIA 1HKLH 4OD1H 4F2MA 3O4OC 2PUQT 3MV01 1XIWD 1MCDA 4HH9A 4R4NC 1KIQB 3MODH 4GW1A 3SO3B 2ED7A 4YAQA 3MA9H 1NC2D 3OPZL 3BX7C 1UKQA 3MRCB 5E56A 5I71B 2CXGA 5DHVB 1XR9B 4MQSB 3T0EA 1RUMH 2Z8WC 3K80A 4HS8L 4D9RE 1A02N 1MWAB 4HUUB 5CEXA 2OZ4L 4QNPF 1C16A 2AJYL 2VWEE 4RMQA 5I16A 1A3QA 2HVJA 3SE8H 4PY7B 4OF7A 3IJYA 3B3IB 3VI3F 4ODWB 1MI5A 1FSKB 4LCYA 4C55A 1CCZA 1QO3A 5DZNA 1UWXK 4X6DF 1CD9B 5D7SH 1R5WA 3G08B 4P49A 3CXDH 3RY6A 5L8KB 2R0LL 2P44B 3O6MH 4GAFB 4KUZL 1EXUB 5F6IC 5C09B 1YEIL 4PRIA 1AC6A 3LS5L 2CIKB 4I2XB 5C08A 1SJHA 2NCMA 4TTGA 3LKPB 4ODVH 2DKUA 4G9DA 2FEDC 5C0FB 4NM8H 5GGUA 5BVJA 4PJCE 5IVOA 4XCCL 4QRUB 3AXLA 1OAQH 4YHZH 4JQVC 2OM5A 3FOMA 3EFFB 3ZDYF 5FDWA 4PRPD 3BH8B 5IHLB 2GHWB 1CWVA 1EO5A 4EOWH 3C60A 1KFAH 3SKOA 2P48B 3KWWB 4R96B 2YPVL 4LOUD 5FYJL 5EBMB 3OKKB 3TO4B 3G6JF 2BNRD 3PWPD 5E00A 2AJUL 4XPBH 1JTOA 5HPMA 2XTJE 3LSOB 4ONHB 1QG3A 2PR4H 4I13B 1Y6MR 1EFXD 1QHPA 4I3GA 4U1MB 3WKML 5DVMA 1OTSC 4JRYA 1C5DB 2EDKA 3LOWA 1NBZB 1N5AB 5C0CD 4OZHB 3ZKNC 1XT5A 5EUOF 4J4PA 3OF6A 3L7FA 3X14B 5IFJB 4WFHD 3HCVA 5MENA 1F4WH 2X09A 4CKVX 2X1PA 1G7HB 3TP4A 3C6LC 5GHWL 3MNZA 3WBDA 4JFXB 1B90A 4RFNB 5HHOE 3QFDA 4E5XB 4Q97A 3TPUB 4GLRI 1PG7L 5ESVB 3CC5A 4HIIA 5C09D 4MNHA 3H2WA 1T7WA 3F65A 4M43L 1NFDA 3BP6A 3BZFA 4P4KB 3AS1A 3V4VH 3RGVC 2Y1VA 1F4YL 2PCPB 4UQ2A 3VWJC 5C70A 5JW4Q 4NO5A 5E6IC 1I3VA 4P2YA 1FFOA 5CD5C 3V4PL 4Y7MA 4F9PA 1CFBA 3T3PF 2DYPB 4IIQB 2GFBB 2KBGA 4RSVA 1FFPB 2DQEH 3ARGC 4NUJA 2Y25A 1D5BB 5J3HC 1Y6KR 3VXOA 1NDGB 1A1OA 2OTPA 3MLWL 4JKPL 4OZ4A 4NO3A 1MPAH 1QLRB 4S0SD 4Y2DC 4HS6B 3QEHB 3TO4D 1QFWH 4X6CE 5SWSD 3UBXA 5E2UL 1SY6H 3ARDB 1FV1B 1QD0A 2NX5E 3BW9A 3HC0A 1P4LB 2DLFH 5IWLA 5DMYA 4X4XA 5AAWA 1CF8H 4DFHA 1U2HA 4XVTL 4PB9L 3QHFL 4QRTB 2G5BB 4ODSL 1HH9B 2V5YA 4S1SH 4GBXA 1ZA6B 4Z7WE 3K1KC 4APQB 1J1OH 4CMHC 5JW3H 1MEXL 1GSMA 3BT2L 5DQ9A 3TCLB 3JWOL 3QBTB 3E6HB 1A14L 1NBYA 4UUJA 4KFZC 4G7VL 5ESQA 1A1MB 1M7IB 4MMZC 1XH3A 4EN3C 1U92B 2XV6B 2P4AB 1T1XA 4MA7L 4XGZA 5GRJH 2UZYB 3Q6GH 4JFZH 5MI0B 4P4KD 2EDJA 4PS4H 4U49A 3BP5A 1MAMH 4LSVL 1NFKA 2Q8BH 4NFCA 4Y16D 5IW1A 2LU7A 3X3GL 3CFDA 2OL3L 3V0WH 5K59F 2FJFA 2DYPD 1H5BC 3H9SB 4GG6A 3UTOA 4MNGA 1YUHB 5FHAL 5IG7A 2V9QA 1MCIA 4OM1H 4I4WA 3SKJH 5HGBB 1GXEA 4J23A 2X10A 3BUYA 1TIUA 2A38A 3DMMD 5TGBA 1J1PH 1FZKB 2FO4A 4KDVA 4GG8B 3VFVB 1RHHB 3KXFE 3P11H 4TUKL 4AEIH 1I8MB 5C0AA 3U1SL 2HT2D 1DBKH 4JHBA 1TVDA 3RWFB 4O9HL 3OGOE 3B9DA 4WGWB 4HUVB 3WNNA 4XCFH 1GGTA 1E6OL 3CPLA 1FNGA 3PHOB 2EYRB 1T1ZA 5HGDB 4MAYB 4CN4A 4XP5L 4Z78B 5T1LA 2OK0L 1QLFB 3ULVL 2F53E 2C4FU 3PABA 4EBQH 1YNTA 3FZUC 4NNPH 1UXWB 2Z93B 3VJ6A 1TCMA 1MFDL 1F02I 3MRLA 1XF5A 1VFBB 4APQD 3QDJE 3C5ZB 4U1GB 5H35A 1DQML 4Q9RH 4JCMA 3KPSE 4KKBD 1FJ1B 4UNUA 1I3RA 5IVXB 3U46A 4PGBB 2BRQA 1WAAA 3GB7B 5ALBL 3TA3A 1BQHB 1CG9A 1ZVYA 4X8JB 5HI3C 1S9WA 5LGHH 1D6EB 4FRWA 4LU5H 1EEUA 2DN7A 3RY4A 1E4KC 4JQXA 1FO0L 5I19L 5KSBB 2R2CA 2LTQB 4KV5F 4BZ2L 4U0RC 1RURH 2CJUH 5E5MB 3ARUA 2D9CA 4RGNC 5J1AB 4OCRH 3BHBA 4JB9H 4WY7H 5EFIA 1FNLA 3L1OH 3V8CA 4NC1C 1U8MB 3LRGA 3OGCB 5FYJU 1ETZA 3KJ4B 2D7TL 2YKLL 5E08L 4LCIL 3R8BB 2X40A 2PYED 1MCSA 2PF6A 4O2CB 3SKNA 3OJDB 4GRLB 1CS6A 2YWYA 3O8XB 1AHWC 4MQ7A 3CDCA 4NZRH 3UTSA 1WBZB 2Q7YA 3NIGE 2XWBA 3ZE2F 4K7FA 4QXUL 2IH3B 2VLRD 3V7MA 3WHXB 4I5BB 1U3HB 3DHMA 4LSSH 2FLBT 2YR3A 2IQAA 3VXMA 1KOAA 4NRYB 1NPUA 5AZ2L 3WV0A 1M71B 1CFSA 4KMQA 4P5TB 1MUJB 4WUUB 5AG9A 1SHMA 2OJEB 5EH1A 3V6FB 3I3DA 1IEBA 4UT6H 1DEEA 1E28A 3C6LA 4JHWH 2BVTA 2R2EB 4KQ4H 3OG4B 2O93L 2UWEA 1QRND 1D7FA 3E2HC 1K2DB 3IAQA 4LSPL 1EUTA 4LSTH 5FA3A 2GW5A 4PJBE 3GEWB 3UYRH 3VWJA 4ERSH 1OP9A 4YDJB 5JA9A 1CL7I 4P2QE 5DQJA 4PJAF 3TBSA 2IPUG 4Z5RB 5D4QA 4LLMA 5AYUH 1JL8A 2FYYA 3ARGA 3MRHA 1BLNA 4NP4L 4LSUH 2HRPH 1XR8B 5CP7A 1IEAA 1XGRA 2UZIH 1LEGA 4X98B 1KNOA 4TUOB 2YD8A 4H20L 2IH1B 3RI5F 5DT1H 3ROOB 3MREB 1KEMH 3O3DB 4KK6C 3RWDB 1MWAL 1VFAB 3D0LB 4LVHB 1KIPB 2XWJA 4XP6H 1VENA 4NSKA 5E9DB 1X7QA 1O5DT 1CXIA 4U1IB 3HRZB 2O61B 4MB5A 5C0NC 1F00I 3R1GH 4S2SA 5E8DL 2YEZB 1QSEB 1FL3B 4L4TD 2ZOLA 3HR6A 5C9KA 2VABA 3MRRA 4MLSA 3NFPB 4G7YL 1YNLL 4MJIB 1PQZB 3CLFH 1UM4H 3PL6C 3VW3H 2PW2B 5FUOH 1L7IH 3THML 5C0RH 5CEZD 3PNWB 4WUUD 2XNAB 3MLRL 5GRXG 1T0MA 1V7NL 3EO9L 3OAUL 3VG9C 2R2HA 3PGFH 3CVHA 1S5IH 1K5NB 2B2XL 5GIRB 5I66A 1G7JA 4UILL 4OLUL 3I75B 5ADOL 2EE6A 5FO9A 3WE6A 1CGTA 3C5SA 1ZT4B 4KK9D 2FIRT 3TBWB 4R7DA 5BW7C 3UZVB 5SWQA 1RVFL 1WIPA 4PRIE 3DV4B 2KL6A 4Y5YB 5E2VH 4KTYA 5DO2D 2EXYC 2DQDL 3MMEB 1UH3A 3REWB 3RZCA 4RIRB 1H5BA 2BVQB 4K8RH 4BFIA 5DLMH 1X5LA 3GBMH 3CSPA 1JVKA 1J0ZA 3U6RA 2MNUA 1UB6A 1IAOA 2VLJE 4X6BA 5BXFA 4KKAC 4WENB 5CEYA 1N64L 1YY9D 5EWIL 3NGBB 2JCCB 1UA6L 3STZA 1D9KD 1N8ZB 2OJZL 3UAJC 3TN0C 4W4OA 1AD9A 2AAVA 3QUZC 4OFDA 4PJFA 3LQAH 5D7JD 2NXYB 3P9WB 4AIOA 2DQCL 1JNNH 5E9DD 4NO0D 4A2LA 5IF0A 1GHFL 2W0LA 1FIGH 4U3CA 3TJHD 4WIQA 1YY8B 3BKMH 3GSXA 3HG1B 4RGOH 1QSED 4GMSH 3S35H 1I8KB 3HUJA 1A6UL 3BKCL 2A0LD 3T09A 4MJID 4MXVF 4YGVB 4JRYE 5KVGL 1V7MH 5CUSL 4DKDC 4ZOAA 1M05B 1FNFA 3BPOC 5FGSA 3RU8L 4PJIA 3RWGA 3QCUH 2DQUH 4JG1H 5B39A 4Z9KB 5FB8B 2VITB 1AH1A 5JPNB 2VDNL 4PY8I 1E4WL 3CFKB 4OCXL 1XGUA 2CUIA 3MFGB 4HPOH 3G5ZA 5MENE 4U1KA 4C56A 1JWMB 2HJKA 5KTEL 3CVHH 2Z31B 4TUJA 1J10A 2PYFA 1AY1H 3QDMD 3HR5A 5D7LE 5BRZA 2GCYA 2VIRA 5HHMD 5IMOB 1TZHB 1O0VA 2YD5A 1I85C 1E4KA 4LRIC 5EBLB 1NFDE 3IDGA 3BD4A 2ERJC 4MDJB 5F89B 3L5IA 3QXDA 2GITB 3QEQB 1NGQH 5FHBH 1PSKH 1LO4H 4U6XA 5B4MD 3D9AH 2KKQA 2J5LC 3PP4H 3VFOA 5BZDA 3ZYIA 1NKOA 4FTVD 3GSWA 3RNKB 3GKZA 4YFDB 5TE4H 3GMPB 3KJ6H 3VDCA 3ULVF 1V05A 1C7SA 1NMAL 4KGJA 2ZPKL 4IMLA 4P2RE 1W0YT 4XBPA 3QUXB 4KJPC 5EZJA 1QOKA 5A3IC 4WI6A 4Y1AD 1OTTD 3N85H 1FL6B 4WHTB 2OR8A 5FF6B 4OFPA 1FFNB 3QIWD 5F96H 3HG1D 2Y7QA 4OFIA 3OR6A 1EGJA 1JCKA 2H6PA 3F7VA 5SV3A 1RZ8A 4GW5B 4IOIA 3RPIA 3TVMB 2FR4B 4NKDA 2R0ZH 4U0QB 2FB4H 5CILH 2JK5A 1NDMA 4C58B 3RTQB 5EC1A 3D18B 5GZOD 1SEQH 3QDHA 5A16B 3VXTB 2G9HB 5D1XA 1FVEB 1P5UA 4ZTOH 5A43C 2WLZA 4Z7QF 1MIML 3G6AB 3MOQA 2EDTA 4HBCL 5LG1A 3MJ9A 4MJ5B 2QJDA 2AKRB 5CBAB 5IFHL 5C6TL 2JE8A 2R0KL 3IDYC 3ZT7A 3KNBA 2XFXA 1IQWL 2AXGB 1T21B 4HEME 1FQ9C 3T2NH 1XGQA 5EIIA 4BSWB 3ZL4H 1MHHA 3TNMA 5JUEL 3W2DL 3RWJB 2Y5TB 2XG5A 4WFFD 5E8PA 1C08B 3OXRB 1S7RB 1G9ML 3I02B 1I7UB 1EEQA 4YR6A 4MNGE 4YHOL 3MRIA 2IFFH 4R9HA 5T5NF 1D5ZB 1R3HA 1NQBA 3V5HB 5EU4A 2HT3C 3MCLL 3MRKA 1Z9MA 4ZOBA 1RZIA 2X4RB 3MRGB 3QJFB 4CNIA 5C0AE 4NFDA 3HMXL 5I8KL 1FZOA 4OZFA 1HINL 1AE6L 2WQ8A 4JPVH 4KROC 4BH8A 1AO7D 2Y06H 3MJ7B 2EDRA 4EI5A 15C8L 4RWHA 5HGAB 3VFUB 3NIFE 4N0CD 2FX9H 3GMNA 3HZVA 5EC2A 4DOHB 4G8GD 1HSBA 4AIZB 1BZ9A 2NNAA 3VXRB 3FT4B 2X4UA 5BS0A 1EGJH 2FX7L 4ZQKA 3TVMD 5TF1H 3VFWA 2DMKA 2CO6B 1OAUL 1OTUC 5F9AC 5DTFA 5E4EC 4XB7A 5E95B 4L5FL 1MH5A 2DD8L 2EDHA 4I0CC 2P8LB 1CDGA 4OM0L 2X4SB 4PUBH 3QIUC 5FDYA 5AD0B 3DVGB 3QIBB 3VXQB 5D2NA 4ZAKA 4HWZB 1NJ9B 2HKHH 5F1KC 4KK5D 4O5LH 4HWEL 3HUJF 5JXAL 4Z7VE 1G9NC 1QLEH 3PQYA 1QBML 4HIXL 3O0RL 4K7PH 4O58L 3U48A 1WAAE 3DI3B 2FZ3B 4QTIL 1T2QH 3CK0H 2YUZA 1OW0C 2X4NA 2Q8AH 2D2OA 1FYTD 1IC4L 4OSUH 5H37G 2B20A 2O5YH 4LLQB 1H8SA 4MWFB 3BFOA 2ADFL 2FL5B 2FRGP 2XN9D 5TDPA 3W0WB 3IDJA 1WZ1L 4KTEL 2VXSL 3IVKB 1UZ8A 5EBWA 4LQFL 4N68A 4L8SB 1QTYT 3D87B 5E1AA 2UY7A 4G9FD 3J8F7 4RX4A 3TIDA 1EMTH 1HWGB 1KB5B 2E9WA 3ZYJA 4YQXH 2D7NA 5CEZL 4LKXB 5FUZL 5IB2A 3SPVB 4UQ3B 4WDIA 4G6JL 3NTCL 4KTDL 2W9LA 2HJLA 3LKQB 1Z6JT 4LBEB 3VXUB 1L6XA 4JGUA 5DHYA 3TV3L 1I4FB 2D7OA 4KRNA 1MY5A 4OZFH 3RWCB 4ZO8A 4EUPB 1KLUA 1REIA 3VXME 3PXHA 4QCIA 3VXRD 1CIUA 1KN4L 3HFML 4LSRH 4RAUA 1U8LA 3OWEA 2A6KA 5CJQH 4UOW1 3KLHD 1JP5A 5HDQH 5CJ5A 3S36H 1ZV5A 4ZUTA 5A2LH 2O5XH 2UWEE 5GGRB 3VFNB 2IMMA 3O9WA 2VERN 2YC1A 1I85A 1MCCA 1R5VB 2VH5L 4NRXB 5DD0H 3QB7C 5F9WB 3QIBD 1WK0A 1H3TA 4KWUA 3DROB 4S1DD 3SJVA 3H42L 4P5MB 5TQ2H 5JXEC 2ILLA 3M17B 4NZTH 1A1NA 3FFCE 3A6OA 4ZOCA 1RZ7H 3TH2T 3VWKC 4GRWB 4PD4J 4BELD 1QEWB 3W9EA 3DTXB 3GHBL 5I1LA 3MV8E 1UXSA 3EYUH 4JFDB 2RCSL 3F58L 1U8KA 5KW9L 4M7LL 3IU4L 3WFBH 3D5OF 5HYJA 3SCMD 3MRPB 1KB9K 4HKJA 1F3JA 4M7KL 4WEMB 3W0WD 3BZ4B 1RUPL 2GUOA 3DGGA 4IHOB 2FSEB 4XZUB 2QSTA 2VN4A 3CVIL 3QA3A 3T8XA 2WINA 3DI2B 4LDEB 3MBXL 1KPUA 4PJ9B 1LNUB 4M48L 4EI6B 4OQTA 1IEHA 1BWMA 3VGHA 4D0DB 3B9KA 1ES0A 1QNZL 4WWKD 3B2VL 4WEUD 5D93B 4GKSB 3KHOA 5GGSY 3RX7A 1V3LA 5M7QA 1H3VA 2V6HA 1OAZL 3MACH 2VUYA 2D0HA 1JYWA 2CDFA 4LNRB 3QQ9D 5KVFH 4ZFGL 4EZMA 5ERWB 2ZCHH 5IEHB 2HLAB 2ICES 1AR2A 1S9YA 1HILA 4L1HA 3U7YL 4YH6A 2C4FT 4MA1C 3JV6B 1S7XB 2DWEB 3HE7B 5F1IB 1YEEL 3MRJB 1XF4B 4MYWB 2LFGA 4ALAH 5GS2H 4P57B 4PV8A 1BGXH 2QHRL 2FIKA 4WV1B 3MJGX 4TTDC 1NFIA 3L95A 3IF1B 3FQXB 3QZWA 4GQ9L 3U36B 3U7WL 3RHWF 3MV11 1WVZA 2EYSA 4LF3A 1EO8L 5D7IB 2ADIA 5JZ7D 5IFAL 1KLGB 1ZT1A 3HN3A 4NQXA 1HK6A 3DX7A 4DAGL 2JIXA 2FGZA 4JDZB 1XCQA 1TPXB 4POZC 3OKOB 3OMZA 3AS0A 2ZUTA 3T2OA 2ZUQC 1ONQA 3U30B 3U0TB 5I2IB 1T1WA 1BFOA 2VL5B 3HZMA 4PP2A 2BSRB 1BVKA 1DTUA 2N1KA 4N9OB 3QQ3A 1HI6A 2ZNXA 3QCTL 4F80A 4RGMB 3IDMB 3EOTH 5IP4A 3RVTD 1HHGB 5F88A 4PJ9D 4IRSB 4PJFE 4JHZA 3EJZC 3O41A 5AWNH 1FN4B 2D03L 4XI5C 5EU6D 3AB0B 1MJ8L 4OF5A 4OQTH 4D8PA 4UV4H 4FXGB 4P0DA 4J3WA 2E8YA 4I0PD 1D6VL 4MAUL 1PY9A 2YBRB 2OCFD 4P3CL 4QY8B 1YDPA 2GK2A 5MEQA 2Q20A 2HTLC 1P7KB 4GKZB 3WO4B 1FNSL 3KPPA 4PJIE 3V4UH 1J7VR 2XG4A 4MX7A 5IOPA 4TYUA 4RRPA 1K3ZA 4PJEB 1I8LC 2VXUL 2BHZA 3HE7D 4F7MB 3I50H 3ZYZA 4HAGA 1IAIL 4LIQL 1A7OL 2B5IC 3NCEB 2YS4A 4OFYD 1RZKL 2WNGA 4HHAB 4EXKA 5I0ZA 4HT1H 2ICWA 5T1DH 2J8UB 2Z9TA 1OW0A 5BRZE 4U3XA 4HUXB 3DV6B 1H3PL 4YHKL 1NGYA 4XNZB 3H3PH 1YN7B 3EOYG 1YMMB 5CJ8A 5E2WH 4ZO9A 1N59A 4ODXA 5ISZD 4BSVB 1SBSL 1JPSH 4RGNE 2MHAB 1RJZB 2OSLA 2QKIA 3O3BB 5DD1H 2JKXA 1QA9B 3F5WA 2H8PA 4NC1E 4XC3H 4D9LL 2J88H 4M7ZC 1HQRA 4OZIA 4GMTH 1QYGL 1RUAH 1MNUH 1U8HB 2P43B 3QG6A 5CJOH 3VFMB 1HOCB 5T33H 3WXWL 4M5YH 5IVXF 3WN5A 3FOLB 1NANH 1QFOA 3S98A 4JFFD 2G60H 3WFEH 4IRSD 3WFHB 1N3NA 4CU7A 4FFZH 3DHJA 1EX0A 3GRWA 3BD5A 1U6AL 4K3JH 5I1JL 3L3IA 5FO8A 1M7DA 5E8EB 3KDMB 5I17A 3S6CA 4ZPTA 1IAKA 3JV0A 4NNYB 5GS1A 3LEYH 1YEKL 2UYLA 4MB4A 2A74A 1A6PA 4PTTA 2F58L 3BO8A 3DNKA 4UZGA 4BKLB 1IVLA 2PXYA 3CZFA 1DQLH 3RZWA 3B8YA 3LKRA 4AH2A 3RWEA 2VDPL 3MLSH 2ZCKL 5HVHC 2QV2A 4LHUG 2CRMA 3V52H 4YXHL 3VXSA 3X13A 4NQVB 4LCCB 3NFSH 3OKEB 4OIIH 5IT2L 2ATPA 3TO2A 1G9NH 1N4XH 3V95A 4QWWD 4L9LC 1TJIH 4R8WL 4ZOEA 2A9ML 1JPGB 1ROWA 1N2RB 3VWKA 1UCBL 1V3MA 5E94B 3TNNB 3EYQC 4QXTA 3UTTD 1F45A 1YPZB 3IFOA 1RMFH 2QQKH 1YMMD 4KAQL 3LD8C 4JE4B 3RX8A 2AJ3A 4YO0A 2QR0B 3PF2A 5KSUA 1TZIB 4K23H 3AFLA 3RL2A 2P5EB 3BDXA 3FQRB 4M1DH 4QRRB 5MEOA 5IVZA 1B88A 1VGEL 3PJSA 3CCHB 3DVFA 2FHFA 4Z7UB 2QEJA 4X7EC 5D6DA 3DWTA 1IGCL 2EE3A 2H9GB 3EJYD 4XBGB 1CLOH 4HV8A 4RZCA 1HE7A 3BQUD 4MS8C 4PJ7B 5FOBB 2L7JA 2DLTA 4NQDE 4JFHE 1IL1A 2EC9U 4UINH 1JZ5A 1J9CT 4PRBA 3RUGA 2D9QB 2BC4A 4FQQA 4XTRC 2A2QT 3KYNA 4XHJD 5SX4I 1S7UB 1Y18B 3GRWH 1DBML 3QFJE 4ZPVB 3E6FA 2MWCA 1I1AB 5DJ0B 3NCJL 1Z3GL 5GSRB 3U9PL 3HAEA 3V7AG 3EO0A 2HKFL 5CSGA 4ZO7A 5C0BE 2IWGA 1UWXH 3FQWA 3FB7B 3LPWA 5IK3B 1U8IA 2EE9A 2YUXA 3DX8A 4F15B 1G0DA 4OJFL 5CFHA 5I1AB 5EUKA 1FG2A 4P48A 3UJJL 4HUKB 4ZUVB 3MGAA 5C0JA 1CXKA 5JHDA 4KZDL 3WEXB 1WLHA 5I1GL 4LGRB 4P46B 1VACB 1MLBA 4HX1A 1NBVL 2EDYA 4Y5XA 4J3VA 4N1HB 3IFPA 3PQYE 5I9QB 2EEAA 5FCUH 5EZLA 12E8L 2ICEA 3MBEC 3WLBB 5DFWH 2ESVB 5K33A 1VFUA 3FB5A 1BVZA 4K7PY 5F6HJ 1JHKL 1BM3L 4P2QD 1A4KB 2NY7H 5I18L 3DXAE 2G5RA 2CR6A 3WXVH 3MRBB 1KB5L 1JPTL 3T0XA 4OZGA 3V7AE 2P5ED 1QVOB 2J6EA 2VKWA 4JO4L 1JNLL 1DEDA 5T3XH 2DQIH 4J3SA 1B0WA 5IMMA 3N9GH 5J11B 2ZOKB 1B0GB 1OCWH 2WBJC 4JRXD 1OB1B 4QHKJ 4GJTB 3DURA 2VL4A 3IFNH 5EU5A 4G6KL 3MV9D 1AIFA 1UB5B 1T22A 2R1YB 1RZFL 1E27B 4O4YH 1N0XH 2BVYA 2HFEB 3MLUH 2W59A 2XT1B 1J05A 2R2BA 2VQTA 5I1HH 3LKSA 3QDGA 5TH2B 4OZIF 5HYSB 4NQEB 4X5LA 1GGCH 4R26L 1OSZB 4C4KO 3UYPA 3KYOB 1I8LA 3HC4L 2JCCF 4Z0BH 1XF3B 4MJ4A 3VXNA 1I8IB 4J3XA 3HAEH 3MRFA 3WKNA 5DR5L 2VTFA 4W6XB 4R4FL 1L9NA 4OD2B 2FJHA 1AGCA 2FGWH 3MJ6A 3H9HA 3L7EA 1KEGL 1KJ2A 4P2OD 3WJJC 1MCOH 1FFQA 1PKQA 1ZA3A 3LMJL 3P3YA 4Q6IB 2IBGA 1VHPA 1XIWC 5DC4B 4GKOA 3NFNA 4NZUL 2ESVD 3P0VH 2WW8A 5CZVL 4Y4HD 5CD3B 1IGFH 3S5LA 3WD5H 3H7LA 4DVBA 2CO7B 3I2CL 2B0SL 5LWYH 4PG9A 3I6KA 4ZDHA 4C83A 2I26N 1RU9L 3GKWL 4U6HA 4E42B 1R24A 3FN0L 1G7MB 1B2WL 3S3PA 1GC1L 5E8OA 4RQQB 3ARSA 3OZ9L 5LCVH 2J6EH 3DRTB 3VE0B 2QADD 4L3EA 1KYOJ 2QHLA 3S8WA 2P5WB 3PV7A 2AK1H 4NRZA 5FXCH 3P73B 2R69H 4U1NA 4HWBA 3TYFA 2DQFB 3PWJB 3H7BA 3UMTA 5D5MB 1D3CA 1JF5A 1S78D 2OZ4H 3QUMB 1ACZA 1IFHL 5LBSH 1CTOA 2DM4A 5INDA 8FABA 1F3DH 4E0RB 3HB3D 3INUH 3TCXA 4CL7A 5ICZA 1CFNA 2BVEA 1ULVA 4JKLA 4YHYB 3O3AB 2NY6B 4GO6B 1QZ1A 1C12A 4ZFFB 4ZNCD 4GS7C 3GSQB 2NY2B 3UTZB 4EKXA 4M61A 3FTGB 2J8HA 1RULH 3F7QA 4BQCA 1H0DB 3TWCL 4KUZH 1I9RH 3ZKQD 5D96B 2EH8H 5L7XL 1DSFL 2H3NB 4OLXH 2VZ3A 4XPTH 3RNQB 2IPKA 2P7TA 5F7HA 5KAQF 3VGDA 3SGJC 3QYCA 4K55A 1PX4A 4LMQI 5F21B 3FKUS 1GVIA 4XCCH 1KJ2H 4HCRA 3SGDI 5JPMA 3O6LL 1KT2B 4MCZA 4MDIB 5DJ8A 4Y88A 4LOUC 2RR3A 4AEHH 5TE7L 5ITFA 5CSZA 4F7CB 1DANU 4NCC2 2PTVA 3H3KA 3SO3C 4NQSB 2W0FB 1OQXA 1A6ZA 3PWNA 4X5XA 2JJTA 5I71C 4LLYA 4XRCB 5DVKA 1DBAL 2V7HB 4X7SH 2ICCA 3HI5L 2OR9H 2PTTB 3EYVA 2EO1A 4QHUB 3CFJB 4F57H 3SY0B 4OLYL 5F7NC 5DJCA 4Z8FL 4EEEA 3ARXA 2P47B 4NNXA 4FQXB 4H8WH 2WSKA 3WIFB 1AFVH 1FSKC 2NW3B 1HSAA 1ZWIA 2ATKA 4CMMA 3WKMH 2DQTL 4GUPA 3ALPA 1L0XA 3PHQA 1ZSDA 3OV6A 1TQCB 2DIBA 1FZMA 5IEKA 2IAND 4HWBH 4KHXL 4OZGF 3ILQD 3X12B 2J2ZA 3OR7B 4PJ5A 3CX5K 3WFDH 4KVNL 1H9VA 3HZYA 2NY6D 1PEWA 5IMKA 5ID1A 3GM0A 5JW5B 1ACYH 5C9JA 5TQ0L 2YRPA 4TPRL 3TF7C 1F5WA 1FAIL 3QG7L 4WGVB 2HYMA 1CK0L 4Q2ZA 1CLZL 2MQCA 4WFEE 5BQ7A 5J0BA 3BESR 3RIFF 1PG7H 3CH1A 1QKZL 2NTFB 1I3GL 4M43H 4PJXB 2IALB 4RISH 4H0HB 5F7UA 1CFTB 3W11D 1ND0B 1IJ9A 3BEWB 3CIQA 3RDTA 2HMID 3ZDXF 3MBEA 5SWZD 3DUUB 3GMRA 1UZ6E 5F8QC 4BQ9A 1QQDB 2XZZA 4HQQL 3V4PH 3NN8A 1IC1A 4YPGA 4X7FC 3EDDA 3GMOB 4HCRH 5DHXB 3TO4C 4ENED 4JPIA 2DM7A 3KPOA 3QRFM 1EAPA 1HN1A 3R06A 5LGJA 4L8BB 4HZLA 4M00A 3S37L 1A2YA 1UQSA 1TLKA 3OJVC 1JNHB 5ACMA 3GBNL 1H3GA 3R8QA 4K3HA 2C1PA 4UU9B 4XBEL 4R0LB 1Q0YL 1PJ9A 4PBVC 1IMHC 1NGZA 1F2QA 2OP4L 1JWUB 2OTWB 3D39A 4RCAA 5F3HB 5SX4H 4M8VA 3RY5A 3RQ3A 4FQXD 1T2JA 4PRAB 4MCYB 5IW6A 2H1PH 5MP6H 3CMGA 2A73B 5GISL 1WGOA 4ZFOB 3DARA 4XVTH 1MF2H 3ARBB 4PB9H 43CAA 2BK8A 4OKDA 4ODSH 1JV5B 3O11A 1QUNA 3JUYA 1HYSD 4RNRB 4FNLL 1HHKB 5CGYD 3GIZH 3NACL 4OQ1A 3MXWL 3TGXA 4QLRA 5DEZA 4XPFL 4EJ1C 3CDFA 1CN4A 3MRDB 1RJYB 3HMWL 4HSQA 1A9EB 4P4KC 3A6BH 3CFBA 1RJLB 3BT2H 2X4TB 2HWZL 2Q86A 4L4VB 4LCUB 4V1DB 4D3CL 1BZQK 4G7VH 1DBBL 4OIBA 4Y16C 3STLB 1CDCA 2E7MA 1JMXA 4YLQT 3DX6A 3KR3H 1ZT7A 4IIQC 1KCUH 1RQ5A 3BVNA 2XKSA 3PWUB 3AROA 3BP4A 1QR1A 3QWOB 2ENYA 4LSVH 2AEWA 1IGTA 3WNMA 5IHBA 3EHBD 2FBJL 2BSTA 1NC2A 4X7CC 5CINH 3X3GH 4JKKA 3C2AL 4Y8DC 3VI4E 3S88H 1L4IA 2HT2C 2FEDD 2F8OA 4ETYA 3WFCH 3IRPX 3ARDC 2EYTA 1KC5L 4HF5L 5I1EL 1W0VB 1OD7A 2P8PA 4U1JB 4OUUB 3CUPB 2CLZA 5K9KB 4K3DH 4O9HH 4U33A 4FP8L 4OT1L 2EEDA 2GT9B 2V17H 2FWOA 3PV6B 4DZBB 2AK4A 3LKNB 4NN6B 5EZIL 4PRNA 1YECL 1JI2A 1TVBA 3QQ4B 3S37X 4APQC 2MQ3A 3RA7H 1A6TA 5JO5A 5AUMB 5DK2A 4GRWF 4JFED 1YQ2A 3GHEL 1SYSB 4H0GA 3WYRA 3ARBD 1A3RL 3RUGE 1P4BH 1LO3L 3O6KL 4XAKD 2YK1L 2E7CA 4RAHA 1MFDH 2X9YA 4UOW0 5HYQA 2VZUA 2WP3O 1QRKA 4MXWH 1A7PH 4JM4L 5MI0C 2Q87A 4UIMB 1TZGL 4NQTA 5L6YL 1T0NA 4L4VD 5E5UB 3O6FA 2MSPA 4V1DD 1KELL 1N6UA 3BGMA 5F97E 3SGJA 1F90H 4TOYH 3B43A 4Q9QH 4WCYH 4PRPA 4JJ5A 4NN7B 3OKDA 5ALBH 1KENL 5AZEH 1IM9A 4W68A 5D2LB 4JHAL 4EQ2A 1EHLL 3HNVL 2H32B 2Q3ZA 4XX1G 1CE6B 1EZVX 2BNRA 3PWPA 4NN5B 4KXZI 1D5IL 4TVPE 5I19H 3EYOA 4YNYB 5D70H 5HHNB 4D0CB 2DF3A 1RK1A 4L29B 3GNMH 1IGJA 5FV2A 3SGKA 5IB5B 1EFXA 3FFCD 2Z92B 3DYPA 2DQGL 3MLXL 2LQRA 2I9TA 4DGVH 1VESA 5C0CA 2D7TH 4F7EA 5F9DC 1KCLA 3IDNB 4QEGA 2C1OA 5ITBL 3P9MA 4ODWA 5GRVL 1DVFA 2BCKB 4ZO6A 2NZIA 1MFEL 3RIAK 1DN0A 2I07A 1KJMA 1CDYA 3OTTA 4PIRF 3MRQB 3OB8A 3HNSL 2P45B 3QUYD 1HKFA 4JY5L 1A5FH 4L3CB 4Y4FA 3DIFA 1FGVL 2A6IA 4F33B 1YZZA 4FABL 4PJGA 2W92A 3V5DA 5F1SA 2R29L 2Q76B 3PIQA 2HT4D 4B50A 1TJGH 3SKUD 1T0PB 4NDMB 4DFIA 3WL9A 4QXGL 4JZOA 4RMWA 5C2UB 4HS3A 1M4KA 4S11A 4CW1B 4LSPH 3SGDH 1XMWA 3G5XB 2LTQC 3R0NA 4P5KA 2DTML 2QSCL 2AABH 2ADGB 5I1DA 5ETUA 2Y07L 1TQBB 4PGCB 4BA8A 4DN4L 5JOEA 3MRMB 5SWSA 3QULA 2Y6SD 4EN3D 3KJ4C 4AQ1B 4JFOA 2D7QA 4YDLB 5I8EA 4JREB 1NUGA 4NIKB 3BH9A 2BVPA 4NBXB 2UY6A 3BJLA 1CQKA 2EKSA 4Z7NF 1FVCB 4WO4B 5DHVH 3IETB 4YDKH 3BMVA 1S7TB 1CFVL 4AL8H 1FRGH 4XNQA 4M7LT 4Q58C 3MX0A 2OLDA 4WTWA 1JUFA 1HNGA 3SDXB 3QUML 2GQHA 2NLJB 1MRFH 4LEXH 4LAQL 2KZ1B 3K2UH 3MROB 4Y5VC 1I1YB 1UYWL 5E8DH 4A2MA 4JQIL 1BD2D 1JGLH 3MRNB 1U8JA 1FZJB 2IPUK 2XICA 1N6QL 1DN2A 1YN6B 1W8OA 4P4RB 1KPVB 5BMFL 1F42A 5K9OA 3Q6FB 4E41B 4KK9C 2XZCL 5IMLB 1JGUL 5DK0A 4U1HB 2Y9RT 3CJJA 4UT9H 3JV4A 2FDBP 4I48A 2EC9T 1V7NH 3EO9H 1VKXA 4Y16A 2B2XH 4PJHB 5DO2C 1OPGL 3HS0B 1MCPH 5TDNB 5C07A 3I6LD 2F74A 2DYPA 3T4YB 2GJZB 1HZHL 1P2CA 1PYWB 4JM2B 3JXAA 5D72L 6FABH 3E8UL 1RVFH 1WEJH 3ZE0E 1OSPH 5ABDE 3RBGA 3DMMA 1YY9C 1OF2B 4HMCA 4M5ZH 5DWUL 2LV4A 1XF2B 5JW4R 1D9KC 2PO6A 4HS6A 1T7ZA 4WRLA 2ZCLL 1EJ6A 2VDRH 1CFQA 1LQSR 1PG7W 1FV1A 5D7JC 3UJIL 3ULUD 4A6YA 1AP2A 2GSGB 2WM0A 5EWIH 5EOCL 4QRPD 4Q7DA 3TJHC 1NCBL 3F12A 5MERA 3L3HA 1TCRA 1XCTA 4N0UE 1WBXA 2CDEB 4WO4D 1YEJL 3RKDD 2OJZH 5TPWL 1EERB 1RZGA 4H1LG 2A0LC 1VSCA 1MCLA 3IJHA 4NOBA 1VERA 4UI2A 5FYKD 1NEZB 3EOBB 5B8CC 1QSFD 1GRWA 4LCWB 2CMRL 3S34L 4WUKL 3EGSB 2DJ4A 2AJXH 2V5RA 1JK8A 1K4DA 3DLQR 4GRMB 32C2A 2AI0H 4XMLH 5KSAB 1YPZF 1DE4A 3SDCB 3ZHKA 1S8DB 4ZUSA 5KVGH 5DC9B 4EIZC 1I7ZB 3QQNA 5SX5K 1RFDL 3EOAB 1FP5A 3OKYA 4PREA 3P30H 3VGBA 2IQ9L 5CBEA 4OCXH 4TQEL 4Y5YC 4JDTL 4KI5D 1H3XA 3GMQB 2VE6A 5HGHA 2JB6A 4NGHL 3LN4B 5F9JB 2F9BT 3DVNA 1N7MH 5B4MC 4WI3A 3D2UA 4XP4H 5FYLD 2GSIB 4JM2D 1VADB 3NAAL 4QOKE 4XPGH 1F11A 1F3RB 1YUHA 2R23B 4WEBL 1YEDB 2NY1B 1NCNA 2B1HL 4PJ7F 2X89A 1FGNL 4FQ1L 2PYEA 5KN5A 4NKMA 3O45B 4GG8A 1MRCH 1SJXA 1J0JA 2F54D 3QR2A 1I8MA 3L9RA 4LSQL 1LE9B 4S1RH 3V0VB 3LRSA 5JIPA 5EPMB 4NO2B 2A77L 4U1LA 2OXGA 2Z35B 4HIEA 2VLRA 4GAJH 3ET9F 1OTTC 3D3VD 4ODUA 4G8EB 4JY4B 3NA9L 4NKOB 1NAKH 1ORQB 3QIWC 4WW1A 3G9AB 1L7TH 4LRNH 4M6MH 5IESH 3FN9A 4N0FB 3OL2A 4ZFOL 5C0GB 2Q3AA 1EH9A 4W6WB 1QRNA 2XOTA 5BZWB 1OARL 4LCWD 3KYMB 1CE1L 3ZZ1A 4CBPA 1F58L 2AJZB 4D2NA 3X11A 2I5YL 5GZOC 5HSFA 5IGXL 5ID0B 5KSAD 2DICA 2BNQB 3SDDB 4YHML 3FRUB 5HHOB 2X4PA 2BOCB 1J8HD 1WIUA 1NCDL 4LHUD 2DL9A 4H26A 1KULA 1OLZA 4HK3N 4HJGA 2B7DT 3VH8G 4NHCL 4PV9B 2DI7A 1FLTX 4TNVK 3UP1A 2FHBA 4KJYB 3MGTB 2VXTH 5B3NA 2IBZY 5FM4A 3N1MC 3OKNB 3MYJA 1HQ4B 5GSVA 1G7PA 5HJ3B 3LKOA 1RZKC 2OQJB 2R1XA 1OGAA 2EDNA 3GIVB 2H26B 5HTSA 3SE3C 5GRWA 1HIML 2MPAL 3I85A 4LKCB 2VDML 1IQWH 1IAII 4O02H 5T5NG 5JA8B 3FONA 3PGCB 4Z95L 4PGJA 1J5OL 3RJDA 3OJDA 3I6GA 1NSNH 1IGML 3UROR 5TE6L 1ZXQA 4Y2OA 1QPXA 4WI8A 3N1PC 3FB8A 3VCLA 3MLYL 1HNFA 4X6CB 3W9DB 3KPNB 4P3DA 3NH7L 4L4TA 5IB4A 1JRHL 3QUXC 1HXYB 3ZTNL 1WBZA 1C1EH 2N4IA 4CVZB 3AREA 2XQBH 3WHE1 4HFUH 3FCTB 3IKCB 4JJHA 1DANT 1W72B 3BYYA 5A2FA 3MCLH 3O4LB 3OG6B 4N0CC 3QXAB 4N1EA 4Y5VA 4DKFH 5HYIA 3ZTJH 1KTLB 4O2FB 3E0GA 3AU1B 1MLCB 2APWA 4PGEA 3TVMC 4X99A 3HMXH 5I8KH 3GGWA 1AJ7H 1Q94A 4UDTA 2LU4A 3TN0D 3DGCR 4HIHA 1C5BL 3QUZD 4JDVA 4R7NB 4HG4J 2WV3A 3MFFA 1H3UA 4OLVL 2BNQD 2W0PA 3CAFA 4Y8AA 3ZKXB 4FFVD 4H0IA 2KZWA 4G6AD 2FX7H 5CP3H 4KK5C 4UV7L 1T03L 2Z4QA 1KIUA 2CLRB 5L2JA 3MCKA 2DD8H 3QWRA 4LMQE 3HZKA 1LO2L 3TESA 2ZSWA 1SM3L 3QRGL 4KMTH 5HDBE 4ZSOB 1NL0L 4IRJB 1U8NB 4HWEH 4R4BA 5JXAH 4IBLT 1KJ3L 3ELAT 4PRPE 1N6VA 3O0RH 1R3JA 1D9KA 3T65B 4QTIH 4YBHA 5D5MF 3P77A 5D7JA 4N8VB 3EO1B 4XXDB 1ZTXL 3ME0A 4YZFF 4NO0A 5B38A 2HRLA 4HC1A 2BNRE 3KXFB 3PWPE 4FQ2L 4U1IA 4HJJL 2W07A 1CI5A 3EFDL 2JB5L 1NLDL 1BIIA 5H2BA 3ZDZF 4X6DB 2CQVA 4KTEH 1L0QA 5L8LB 1PQZA 4UT7H 5LAXA 1JZ2A 3BSZH 2CLVA 4LQFH 1G0YR 2PW2A 3BUTA 5B8CA 5C0CE 2I24N 2XKNB 4YE4H 3EDEA 4CVUA 2F53B 3PWVB 3O4LD 5ACZA 3ZT6A 1GOGA 1YC8A 1YMHB 1AXSA 4WFHE 5CEZH 2XZQL 2NQCA 5F93C 2VZVA 1D5XA 3KLHC 5I8OL 3NTCH 1NMBL 4KTDH 1BBJB 1EHAA 1LHZA 5EA0L 3LZFL 3H6JA 4YXKH 3QDMA 2BMKA 3T77B 3L5WA 1DLHB 2W1NA 4FFWC 5HHXL 1MAKA 3BDYH 3FQNB 5GGVL 3NABL 4Y4KB 4PB0L 5C09E 3QIBC 1QHOA 3HFMH 3U4EA 4NQCB 1A0QH 4S1DC 4AG4L 1G1YA 1II4E 4PJGE 2P24B 5DS8A 4MVBD 2X70A 4YHIB 5HVWA 3QXVA 2OI9B 4YHNB 1UCTA 1YJDL 4ODTL 2A9NL 3MPCA 5J1SC 1B0RB 2XRAH 3MV7D 2VZOA 4FTVA 3NA4A 5IBUB 4IOFC 5FGRA