4UT7L

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
ASQSVLTQPVSVSGSPGQSITISCTGTSSNADTYNLVSWYQQRPGKAPKLMIYEGTKRPSGVSNRFSASKSATAASLTISGLQPEDEADYYCCSYATSRTLVFGGGTKLTVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7L00
2C9AA 3TBSB 4Z76B 4X9HA 4KJYB 3UTOA 2QADD 4LPUA 3UDWC 4NWUL 4G8GB 1MRCL 2PO6B 1KTLA 2BSSA 5IBLD 1C7SA 3FHQA 5C0BE 2UY7A 3GHEH 1YMHB 1KEGH 4W4OA 2OR9H 1ZXQA 2ITDA 5C9JA 3T4YA 1X5KA 3RWHB 4Q2ZA 1NCCL 3I02B 3L95B 2EDOA 1A5FL 3LKPA 3V6ZB 4D9RE 5ESQB 3C60A 2HVKA 3MODH 4ZFOL 2DLTA 4WCYL 2K3TA 3DVFA 1HINH 5HGAB 4KRLB 2JB5L 1Y6KR 3QWOB 4S1SL 5KAQF 1WIUA 4I3SH 3O2DL 1F4AA 2ZZUT 1NDMA 5EIQA 4YK4C 2NY3C 3OV6A 5BQ7B 4YHZH 4IEFB 3QEQE 4NQED 1J11A 4NQTA 1KJ2L 4ZFOB 4LLUA 1KACB 3VH8A 3MCLL 5TF1H 2CUIA 1HCFX 3L5IA 4P4KC 1Q72L 3SKNA 1D9KC 3V0VA 2Z8SA 2FX8L 3GI8H 4WU7B 4ZUVA 5SX4I 3SJVD 1F8TL 3BP4A 3P4OA 1OAUL 3MJ7A 3OPZH 2XWJB 4PUBH 5C86A 4RA0C 2IH1A 1A64A 1MAKA 4YHLL 1A6VL 4HCRL 5ESAB 3OKOA 5F9DC 5IMOB 4X4ME 4GRWE 1ZS8A 5T1LA 3R06B 3KHOA 3DXAA 1HHHA 2W0PA 2YN5A 2X9WA 2N1KA 1IT9H 1PX4A 3WFZA 1OAZL 1P7KA 4YR6A 3MXWL 4N5ED 4O4YL 1IGTA 3VWJA 1FORL 3MPCA 3BRFA 5DMKA 4OGXL 4XB8A 4PJDB 1EO8L 3SO5A 1DZBA 3BIBX 1DBKH 5FYKL 4Z76A 2AEQL 3M1BB 1ITCA 4LVHC 4JZJB 2HT4D 2GHWB 1FG2A 3EDDA 5CKGA 1EUUA 3O11B 4WU5A 3HPJA 4OZFB 1KTDB 3RVTD 1T5XB 4HS3B 2OP4L 4HG4K 5FO9A 2Y23A 5DHVA 1I7RB 4XXCC 5D2LE 1D9KD 4BZ1H 1HDMA 3P11H 1OD7A 5E8DL 3UTPD 3L1OH 4H5SA 2ZCHL 3OR6A 3EZ8A 3DSNA 3IXTA 5IMLA 1MIML 2WSKA 4MNQB 2AEIT 2XG4A 3OXSB 4I0PC 4ZS7L 3VXQB 1BAFH 3MV7B 4LVEA 3TV3L 1GHFH 4HAGA 3KR3L 1HEZB 1YY9D 5CFHA 5I8EB 1EBPA 4P46D 1PQZA 1N6QL 3QAZB 5C09A 1S5IH 4ZSOE 1QLRB 3MBEB 5ERWB 2BVQB 3T0ED 1WAAE 1K2DA 1OCWL 1P5VA 4OLXL 2PYEA 2AI0H 2ARJB 3P73B 1MFEH 3VA6A 2EC9U 5C0FB 4G8EB 3VG0H 3WIHL 4DVBA 2YXFA 2I9LB 1QLRA 3X3GH 4RAUB 3VXSE 4HJ0D 3GIZH 1QSEE 2YD7A 3QDGB 3G6DH 1QOKA 2DQDH 1NDGB 4G6AC 4Z7NE 2P8LB 3A6BL 3QCTL 5DJ6B 2VIRA 3D2UB 4D8PB 1X5FA 1TZGL 4P4RB 5J89A 1ZS8B 2AERT 5C08A 3E1F1 3MGTA 1NGXA 4K55A 3X13A 5E7BA 4OQTH 2QADC 4JO4L 4X5WB 4XVSL 4PR5B 5IESH 2IMNA 1YC7A 2IH1B 2IQ9H 2FZ3B 4X8JA 5JHDA 1NBVL 4KKCD 2AQ1A 4XAKD 3NA9H 2CRMA 5TDPA 4Q97A 2N56A 3OKLB 1F45A 5KS9E 4W6WB 3MV9B 4MAYB 1DLHA 3GMQA 3NH7H 3OWEA 4EBQH 1S7WA 4OJFL 4RA3A 5IROC 1P84J 1K6QH 1FO0B 4JZJA 3MMEA 4MD4B 4J4PC 5E2JA 4OZIB 4PJEA 5LCVH 3TJHD 4OFKA 3KYNA 4APQC 3MLPA 2V2WA 3L3DA 4XCFL 4U2ZA 1BLNA 4HXBL 2CDGB 2DS4A 5TDOA 2GCYA 4P5MB 3RVXC 3VWJB 5A2FA 4XBGA 4GKZA 4M5YH 5DRWA 5IQ9B 2A0LC 3LOWA 3HB3D 4H8WC 3UAJD 3K74B 1SJHB 4KI5D 1HHHB 3CXHK 3VFGL 3D18B 4G8IB 5IOPB 4K3HA 1CLOL 4DOHE 1G0YR 2VOTA 4XVJH 1CG9B 5L2KE 3LRHA 3RWHA 3DX7B 5FM8A 4I18B 1YYML 4OFIA 1MJJA 4RFNB 5KVGH 4KKAD 5EZOL 2V2TA 1Z9LA 1JYWA 2ZG1A 2BVOB 2P8PA 3MROA 4W68A 2E7LA 5IGXH 2AJYH 1QLFA 3DX8A 4JY5H 4LPVA 5F7FA 2Q8AH 1QSED 4CU6A 5HI3C 5CEZH 4JQVC 3V4UL 4OF7A 5F96H 2G5BB 3QEQA 1YEHL 5D5MA 1IQDA 1T04A 3RI5F 5EU7E 3TWCL 4ZXBA 3NFPA 2JELH 3ET9F 2WWMD 5BQ7A 4XC3L 2GJ6D 2NZ9C 2RQ8A 3S4SA 1XGRB 2A83B 2H6PA 5DVNA 2ATKA 4X4XB 3EOYG 3BIKA 5I18H 4P4KD 5KSBF 3FT4B 1E28B 3PG2A 4RNRB 5IHBA 5L7XH 3JTTB 5CSBA 5HYQB 4V1DD 3SEPA 1MCEA 4PREB 1PSKL 2YD1A 3TA3D 5A1AA 4MA1C 4K23H 3LZFL 5F71A 1QA9A 2G2RB 5FOBA 3S97C 1CBVH 1ED3B 4PJ8D 4QRTA 3QNZA 3IU4L 2V2TB 1TXKA 4OUOA 4TUKH 2RR3A 4WI7A 3X17A 3C8HA 5E2VL 5JDSA 3Q2CA 5KZCB 1NCUA 4XP6L 1YEEH 4HKJA 3SKUD 2LAGB 4KKBC 4ERSH 1EPFA 1BVZA 4LVOB 2VDPL 1WTGT 2Z35A 3NZ8B 3Q6GL 4DWHA 3TLRA 3WIIL 2DM7A 3HI5H 2Z31D 5CMAA 3PABA 4X4ZA 5BOPA 2Y25A 3DOSA 2VZOA 3O4LA 5KTEH 1U3HB 3HUJE 4Q7DA 3P0VH 5K9JL 3O6MH 3VMNA 3MZGB 1V7ML 4PJBE 1ZGLB 4N0UB 3LKQB 4DGVL 3EYFB 4KK9D 4DGYH 4CGTA 5E9DD 2H2PC 2OK0H 1A5FH 5HDQH 2BFVH 3SGDH 4ZAKA 12E8H 2ICES 4JN2A 4N8VA 3NH7L 2RFXB 1JK8B 4ODTL 1DLHB 4OFYD 4ZUWA 1F90H 4ONFH 3DBXA 4YQXL 3RWGB 3NPZB 5FHAH 4UI2A 5DQ9B 5TDPB 5DLMH 2C3VA 1UGNA 3W9DB 4N8CH 5C0CD 1AD0B 3ZT6A 1DLFH 2X09A 1X7QA 2OZ4A 2ITCB 5GRVL 5JIIA 1N6UA 3TYGL 5KG9A 2GTZB 2UZXB 5ETUB 4U1MB 1RUML 1FLRH 1HHKB 4GKOA 3ZDZE 5FKPA 2AJXL 1DANT 4OZHE 3VFRA 4PJFB 3H9HB 3PIQA 1R3JB 4AY0A 5I6XC 1A02N 3K2MC 1D3CA 4N1CA 1J12A 1TITA 5C09B 5E70A 4LHUB 4P2QD 5I8EA 4LLVA 1XGPA 1NAKH 1H3PH 2YPLD 4P3CL 1TPXB 4MAUH 5IB4A 3VFMB 2FX9L 4QF1A 4B7IA 4ODSL 3QEGL 1F58L 3MUY1 1I4FB 3QJHA 5HGDA 3P4NA 5EBWB 4K8RH 2NY6C 3SKOA 1MIMH 3ZYOA 4BSWA 1IM9B 4XPHH 3QEHB 2VR5A 4NO2A 5DEFB 1HH6B 4Z7UE 1QRND 4M43H 4QHKI 2R1XB 3WNLA 1LK2A 3SBWA 2LVCA 4I48B 3WCYA 4Y4FA 3LQMA 3HE7A 2X4OB 5EWIL 1BZ9B 5LAXB 4LARH 4OF5A 3ARSA 2A6DA 3CFJA 5L6YL 2FX9H 4JM2F 2C1PB 4NQDB 3LIZL 1A6PA 3WJLC 4MA8H 1ZHLA 3ESUF 4NC1C 3QI9D 1U8OB 2MTPA 3TBVA 4HUXA 4NBYB 4L9LC 1G7LB 1L7IH 1WC7A 3PP3H 32C2B 4XHQA 2YOCA 5I1AA 4QRTB 3W2DH 3WFBL 1NSNH 2W9DL 3QUKB 3LN4B 4XVUC 1P7QD 4KKBD 3E3QE 5HYQA 4PJHB 5D93B 4NQUA 5AUMB 5JORA 4YXKH 1IQWH 3P77B 3I6LE 3KPRD 3CFCL 4L3AA 3WO4C 1LO3L 2VZTA 1ONQB 4YUEL 1MEXH 1D7FA 1RHFA 1JWMA 2MHAA 2P5WE 1XF5A 3ARGC 4TSBH 1VGKA 2IAMD 2X4SA 4K7FA 5K9QG 2NY0C 1YJDL 3TIDA 1KPVB 5H8DA 5KVEH 3O4LB 2FJGB 1PX3A 3IKCA 3QDJA 5HDBF 4ODUB 4HUMB 4PB9L 4S1DC 1UH4A 3IETA 4LDEB 4YQXH 3UJIH 2AK4D 1DUZB 4KUCD 3RAJH 1RK0A 4XMLH 3TIDB 5F89A 4GAGH 1CLCA 3MFGB 4HIHA 5D2NC 1S8DB 1TZIA 3ARVA 4DJMA 2B0SL 1G1CA 4JB9L 3F6IA 3PWJB 4XH2B 3LRSA 1EK3A 3KPSD 2GAZA 4WFGE 1NFDA 1LNUA 3SCMB 4KK8C 4K3DL 3C5JA 1NCAL 3U9PL 3LEVH 3O41A 3BEVA 35C8L 3UJTH 2HLAB 4WTZG 4PP1D 1B0GB 3ZDYE 2HJLA 2FL5B 1SYVA 4L4VD 5GJTH 2W9EH 4H8WL 2XICA 5MERA 1T80A 3KPQB 5FO8A 1DLFL 2ATKB 4GRLA 3BD5A 2IBBA 5IEKA 3TBVB 5H37H 5HHOB 3DVIA 3C2SA 3QFJD 2Z91B 3H9SA 4G9FA 4KQ4H 4KY1H 7CGTA 5I2IA 1VEPA 3NIDE 1DL7H 4R6UA 3LB6C 3W0WA 1BJ1J 1DBAL 3TNNB 1JRHL 2X1XR 3V7AG 4WHDA 2ADIA 3NCBB 2VDQH 2HT3D 2FX7L 2A77L 2R1WA 1ETZB 4E41A 5H37G 1DQTA 4YXKL 1EJOH 1CXEA 1BPVA 4ODVH 3ULVD 1S7XA 3RY4A 4Z7VF 4OZHB 4BSWB 1AKJD 1YPZF 3LSOA 5IVZB 3DI3B 1TENA 1HSAB 4PG9B 3BZEB 3S7GA 4ZTPL 3TF7C 1FNAA 3B9EA 1FC2D 1AR2A 4EOWL 1TVBB 4ZUSA 2WMPA 4RIRA 2XZAL 4WHTB 2FB4H 3DV6A 3QDGA 5C0RH 5J8OA 1VHPA 3IFLH 3GJEA 1VDGA 4X7SL 4HUWA 1R3IH 4Y0GA 5I76B 5MI0C 1PZ5B 4PGBB 5DEGA 3NOIA 1C12B 1G7HB 3EW3B 3N1PC 1AC6A 4HUWB 4J7RA 5I76A 4HPOL 2FBJL 2UWEE 3H9ZA 2E27L 4TNWF 4Q9QH 4MJ2A 4NJAL 3DRTB 4AQ1B 4IRJB 4RMQA 3SKJL 1VEOA 4JJ5A 4NN5C 1IGIH 5C0JB 2A73B 2F74A 5CAYB 1A6UL 3O6LL 4KAQL 4MQ7A 4U49A 4MB4A 1RUQL 5BJTA 4OCNC 4NUGH 1IAIL 4GW1B 2RJMA 3B8YA 1JUFB 3MLZH 4UNVA 5I0ZA 1FFPA 1JMXA 4MLSA 3V0WH 4PGEA 3KPRE 2LQRA 2ZG2A 1MLBB 1NKOA 4BFEA 5IJVA 5F7EL 4U31A 3NMEA 5C0JA 1H3VA 4LSRH 1PYWB 5J6HA 3SN6N 2V2XA 3KDMB 2W91A 1T66C 3HPJB 1PGRB 4BQCA 1Q9KA 4LSQH 4QTHA 5HSFA 4HCRH 1S9VB 2OL3L 4Y5XB 3JV6B 3NBNA 3LKQA 3GMOA 4WFHE 1UC6A 2DWDB 2VDML 1JPSL 4KH2A 1JGEA 3RX5A 3VD9A 1HQ4A 5L8KB 2JIXA 2R4RH 1UXWB 5FO8B 5FCUL 1DBAH 1BGXL 3RVXD 4YDLC 4JZNA 3BP6B 5TF1L 3BKJL 1U2CA 4QOKB 3IRZA 1G7MA 3QQ9C 2F8OA 4XP5H 3OXSA 4KI5C 1MF2H 4X7TB 3ARFB 2OSLA 3GIVA 4P48A 1FNEA 1X6NA 2YPLB 4F57H 5IVZA 3S3SA 5GGTL 3QO1A 5KSAC 1OSPL 2JJWA 1CDJA 4LPXA 4G5ZH 1JTPA 4UQ2A 5F21B 3EO9H 4N9OB 4PJAA 3D0VA 2B1HH 2P4AB 4PJ7B 3L9RA 3QWRD 4CDHA 3VG0L 1HHGA 1EJ6A 3WIHH 5GXBB 3K4ZA 1I7ZB 4TSCL 4UDTB 4E41B 4H0HB 3BH8A 2Q7NA 3TT3L 2LU3A 1XF4A 3SKNB 3G6DL 3Q6FB 4XC3H 2O61A 2I5YL 2QV2A 2VAAA 4ZAKD 3M8OH 4OLVH 3CVHB 2B2XH 2OTUB 1PG7H 2A6IA 4UV4L 2OR9L 4LGPB 4OFYA 4CU7A 4PG2C 5CP7B 2AJYL 1NCDH 3QRGH 2C3GA 2X4SB 1F3RB 2PCPA 2R2BA 2VLJD 4LCWA 4X6CE 4OD2B 5JXED 1CI5A 5JORB 1QVOA 5DQDH 1CGSL 3BD4A 3DXAB 5C92A 3ZKQD 3VFUB 2PKDA 3K7UA 3C60B 5IWLC 2OZ4L 4JFHE 5T3ZE 4TPRL 1NLBL 1KEML 4LVOC 4JREB 3LKRA 1IQWL 1U8MA 3RP1A 2X70B 1REIA 5ILTH 2VN4A 2QSQA 4F80A 5FB8A 2M26A 4HIHB 1U42A 2JCCB 3FAXA 1XAUA 4GOSA 3TZVB 5EOQH 3IETB 2IQAB 4RMVA 5IVXE 4LCIL 3F5WB 2AJUL 5F7DA 1HILA 5LAXA 2EDBA 1KIRB 2H1PL 3ABZA 3RL1A 1HNFA 3ARTA 5E99L 4YEFA 3VGBA 2E7HA 4FFVD 5D1XC 1CFTA 4NQEA 1INQA 2IPKB 2QKIB 5TE6H 3THMH 4GRLC 5GRJL 1JCKA 1KT2A 1WK0A 4B5EA 5HHXH 4JFEA 2B2XL 2YZ1A 4P9MH 1M7XA 5IFHL 3QULB 3MA9L 3ZE0F 4U1JA 1A3RL 2WAHA 3P4NB 4JFOB 4QF1B 2J6EA 3I02A 5EUOE 4U3HA 2VXVL 4JPWH 3MRBA 4YHML 1ZEAH 4ACPA 1LE9A 4LSVH 1MRDL 5JLZB 4LSSH 1N6VA 4GBXA 1CE6A 3DYMA 1HXMB 1M71B 5DD3L 1KTLB 4Z7QF 1P53A 4WTXA 4Z8FL 1FFQA 1UCBL 2VKXA 3G6AB 5SX5H 1PFCA 3TBSA 4K3GA 3HNVH 4G9DB 2HTKC 4ZOAA 3QPQD 4ZTOL 5C6WH 4W70A 5FUCC 3G5XA 2DLGA 2ZCKH 4N5EC 2EDHA 4I48A 4LPTA 5GZNC 4I5BA 4J3OC 1M6OB 3LS4L 3K0WA 3FHAA 2R29H 1NC2B 3MXVL 3ZYIA 1YZZA 2I9LA 2DQGH 3ROOA 5A2JH 4Y5VB 2QJDA 2H45A 4R26L 4G6MH 4M7LL 4WV1C 1IC5L 3D25B 3OX8B 1NC4A 3TC9A 4F7PB 5GIRB 4KRPC 1U8PA 2PO6C 4ZODA 4U1GB 3IYLW 1OPGL 4N0CC 1FGVL 3MV01 3D5OF 4QKXB 1OTUD 4MZ3A 4LSUH 1MCRA 1MREL 4PTUB 4JFFB 2VWEE 4I0PB 5MEOB 3X11A 4F2MA 2YKLL 4NWUH 2BXZA 1KGCE 1A6TB 4FTVA 4LK4A 3GBLA 3UJJH 3T0BA 3GSQB 4TPRH 3BZ4A 2F53D 3RWDB 1DE4A 4CJ0A 2ZNXA 4NN5B 5MHSE 4ZNCD 4JFQA 3GHEL 4OFPA 4WUKL 3C60C 3AROA 3KYMB 4YGVA 2C7UB 2FSEB 1RAMA 4JPVL 3MRFA 3VXUA 4WUUA 1AHWB 4Y4HC 3S8WA 1X5HA 1CE6B 1FHGA 1T1XA 4MD0B 1HI6A 3WIIH 2F58L 3FRUB 2N7BA 2VLJA 3RZCA 1QO3B 4FOMA 5HBBA 3LN5B 2IADA 1N59A 1QYGL 2Z93B 1EZVX 1MAMH 1OAXH 1WBYA 2P46B 4U6YB 4M48H 5D1XB 4X4YA 5I15L 4X6CA 3V52H 2YD2A 2ZPKH 2JE8A 1IC5H 4KI5E 3FT4A 1QRNB 4UV4H 1AFVH 3E2HC 2WQ8A 2NY5H 4KWUA 1T0PB 1WSST 2V5SA 4R26H 5DJAB 4L3ED 3QG6A 4NHCL 1BFTA 4ESKA 1BX2B 5FKAB 5ADOL 4X80L 2HFGL 1VERA 2QKIA 3BQUD 2VDRH 5GISH 3KXFD 5C3LD 5I1IL 4ZO8A 2XRAH 4TVPL 1N64L 2JCCE 3U7AA 5E6YA 3RGVC 5EO1B 5HGBB 2VQ1A 5I8KL 3IDGA 4L8SA 3GK8H 3H3KA 5D7LA 4OCWH 4KTEH 2IGFH 2Y5EA 1JYVA 4JM2D 3UTZA 2YD8A 2X4QA 1X4XA 1Y0LA 4OZGB 5DC0A 1N2RB 1HN1A 1AR1D 5E03A 3CSYA 3FFDB 4L1DA 2ZP0T 1NCCH 5EZLA 5FGSA 1IM3A 4G8GE 4GRWF 5I1KL 4CUCA 1JZ2A 3HZVA 1OAQH 3TVMD 4NJ9L 2CDFA 5I1CH 2BNQA 3OPZL 1MQKL 3LKPB 5KVGL 1TJGL 3VRJB 4HHAA 3TBYA 5EOCL 2VC2H 4OFDA 3BGMA 3VE0A 1I9RH 2VKWA 5IMKA 4G7YL 5DA4A 3MOBL 3RY6C 5HYJD 15C8H 4MVBC 4QHNA 2HMIC 1JGLL 3QIWD 2Q86B 3SOBH 2EXWC 1LQSR 5TGBA 3ARDA 2FX7H 4ZXBB 1VESA 3U1SL 5I8OL 4MMZC 3FRPA 4XWGL 3SCMC 4XCNB 1A6UH 3O6LH 3PJSB 4KAQH 5F88A 4Z0XB 4X4MA 3KPPA 4GMSH 2H32B 4KY1L 4XCYB 3HC4L 2APTA 3OG6B 5T1KB 1ZHNB 2BVOA 2P8PB 3RWCA 4IOIA 5TJWK 4J3TA 4PJ8A 4G6FD 2D7NA 1LO3H 4PJ7A 1V3MA 2ESVA 4X8JB 1AXSB 3KJ6H 2P44B 2HJFB 2DMCA 4P5KA 1E4JA 4PJGF 4JFPB 2Y1VA 4AQOA 1H15A 3D85A 4TULH 2NTSP 1U3HD 4WEBL 3DGGB 3D18A 5F7WC 4K3EL 1DN0B 1EXUB 4AYFA 5MI0B 25C8L 1MY5A 2VIRB 3D2UA 2X1QA 4NRXA 3MJ9H 3MRJA 4RZCB 3L5JA 4KV5F 5HVHC 4P5MA 1QSEB 1HQ4B 1U6AH 2JLLA 2EEAA 3IFLL 1ZHKB 2BHZA 4LRNL 3I6GA 1BLNB 4L9LB 5DD5L 3EJYC 4JQIH 3P73A 1WAAF 5M94B 1S9VA 4OF0A 1FH5L 1FH5H 1QTYT 1OGTB 1UJ3B 3QI9A 2HFEA 1GAFH 3L7EB 4MJ5B 4RGNC 3KPRB 4QLRA 4MWFB 1MFEL 4V1DB 1T2XA 1XZ0B 2ESVD 2J1KA 4M03A 5BZDB 1A7QH 3QG7L 3V52L 1W0YT 2NYYD 3B6SB 1XGTA 4QRRE 3NVQA 3U6RA 5F9OH 1NUGA 5JZ7D 4TSAH 1CD8A 3HMXL 1DBJH 1WBXB 4GUPA 4PRIE 4XP5L 3GSOB 2Q1EA 4TUJB 3WIFA 3H2WA 4DZBA 1NSNL 2DWEB 4XPGL 3WMSA 1R3LA 2FHCA 5ANMB 1CICD 5I16A 5ADPH 5JQHC 5BV7L 5DJZB 4LP4A 5IB5B 1IEAA 1NLDL 1QLEH 4MNHB 2VYRE 5CEZD 3QUYA 3ULUH 4F7CA 4PY8J 1T0MA 2DI9A 1JE6A 2NX5A 5J9PB 3PP4L 3IDUA 3VFVB 4AT6A 1I3RA 2RB8A 4PJDA 5EBGA 5FCSH 3MBEA 4KHTL 1DR9A 1QNZH 3K4AA 4GAJH 4FQIL 2LV4A 2P24B 4AIXA 5JW3L 5DURB 4KDVA 2E9JA 4MB5A 4LFHG 1VPOH 3U7YL 4FTVE 2O5YH 3X3FL 1KTRL 3C9NA 4PP2A 3BX7C 1MREH 3EFDH 2EDLA 1ZAGA 5IMLB 4KROC 1RZJH 1KPRB 4L4VA 4O00A 1J1XL 2BDNL 5EB9A 1JZ4A 4B50A 1YJDC 3P9LA 1RZJC 4M5YL 5HGHB 1MEXL 5CILL 3MJ7B 4ZXBC 1GZQB 5F1NA 3U2SB 3BP5A 3M17B 4WW2C 4XRCA 5LWYH 1JPTH 1KLGA 5E94B 3HI1B 3RWCB 2R0ZH 2XFXB 4OBSA 1J05B 5LBSL 3BOVA 5B39G 4DKEH 1LEGA 2KBGA 1CYGA 1CDIA 3EIFA 5DHYB 4POUB 3T04D 1FNSL 3I75A 3QIBB 3MLVH 5FIEA 5I71C 1GPOL 2VLKB 3BDYH 2BNUB 3ILQC 5C0IB 1J87A 1IJ9A 3RQ3A 2GJ6B 4QRUA 5GRUH 5A2LH 3LIZH 4K7PY 4W81A 1WFUA 4APQA 1OW0A 4GXUN 3U4BH 1R24B 3FQTA 1YNLH 3BP7B 3CFDA 1AKJA 3LMJL 4MA3B 1MPAL 4ORZC 1BQLL 2X9XA 4JKLA 3P0YH 5DYOB 2DBLH 1FYTD 3FQNB 4EI5B 4P9HC 2XKSA 3RIAK 4NGHL 3TZVC 3CSYB 3FFDA 4I3SL 5E8NB 2VL5B 4F33B 4NO5A 4N8CL 1S5HA 1MH5A 1HXYA 4CKVX 1J18A 3N1QC 4GAFB 4HLZH 4GXVH 3ULSB 1TZIB 1INDL 3CC5A 1T4KA 3B3IA 3KLDA 3LQZB 5J1SC 2JF1A 1J8HB 2VQ1B 5CEXA 1FNFA 3B4NA 4KHXH 4CW1A 2BFVL 1UCTA 4FQ2H 1Q94A 4YPJA 4Q9BA 3HUJF 3MOAL 4YHIA 3NIGF 3LRGA 1A3QA 3MJ6A 1MHCA 2V9QA 2C26A 3KPTA 4HWBH 2JB6B 3TWCH 2VLLA 4L8DA 2I24N 2KZ1B 1EEUA 3CD4A 4YHKL 1CDBA 4P0DA 2XWBA 3L3KB 5HYSG 4LU5L 4KDTC 4X0KA 3BVNB 4JRXE 3QUZC 4KUZH 1YEKH 4YXLL 1HHJA 5IVXA 4PJHA 2XTJC 4LF3B 5ILTL 4K9EL 4NZUL 5FGBC 2ADFL 4NC1E 2ADJB 3G5YA 4JCMA 1BBJB 2GJZB 3UEZA 3WV0A 3CXDH 1MLCA 3PWPA 1UQSB 3OGCB 4D9QE 1G7LA 1YNKL 5C07B 3HS0A 5D9SA 1OWWA 4WTWA 4ZFZA 5DQDL 1YECH 2MKLC 5D7SL 3QP3A 4KGLA 4P9HL 4M7KH 1Q9WB 5F9WC 3ARBB 3GGWA 2F15A 4ZNEA 4EKXA 4TTGA 2IBZY 4NC2B 1LP9F 4X6BA 5CZVH 1O7SA 3QWQB 4GRMA 4H0GA 2X4OA 1XFPA 3RL2B 1DBML 1HSBA 3FT2B 1HQRA 1GGYA 2VDLL 3BDXA 3C2AL 3D48R 5MEPA 4UAOB 3BWAA 1C5CH 4E42B 3UPAA 4NO2B 1GPOH 2FIKB 3BDYL 4CL7A 1UWXK 4ZS6C 5IVNA 5CIPH 5EOTA 3V4PH 4OKVB 4PB0L 3UTTD 3RZWA 3UBXG 2VH5H 1GC1C 4WW2A 3GMNB 2AJVH 3JWOC 2XZCL 2QBWA 5HDQL 1ND0B 2X4UB 1S7VA 3LDBB 4OAWB 3RGVD 5I1CL 4YHKH 5GS0D 2X4NB 3WUWA 3EGSA 1XGPB 3V8OA 6FABL 3TN0C 2ZJSH 4FXLA 5CLWA 1KIPB 5DSCB 3VXOB 2YPKB 5DFVC 1S7RB 3TH2T 2NLJB 1IL1B 1OQOA 4WV1B 4G6FB 3U0WH 3MBXH 5C9KA 5DD0L 1V3JA 5B38B 5AD0B 3SGJA 4ZD3H 1MFDH 1NQBA 4P5TC 2ARJQ 2R2HA 3GSNL 3AREA 4YAQA 5IW1B 1YEDB 2WIIA 1EHAA 4XVTL 4QRRB 3T3PF 3KYOB 2AAVA 4JKMA 3I50H 3E0GA 4E41E 3PL6B 2PYFB 4JAMA 5DUPL 1NANI 1PKOA 2Q6WA 1JGUL 1FYTE 4KTDH 3IFPA 4J3VA 3WL9A 5C7XH 1OAXL 1X5AA 3MV8D 1HXMA 5HYJA 2WP3T 1RUPL 5ANME 3KS0J 1RJLB 4P3DB 5C0DB 1GGBH 1LE9B 2VDLH 1YNLL 3DBXB 1RUAH 5J6GB 2VLRB 1NJ9B 1U93A 4EXKA 4X7DC 2AGJH 3AAZA 2RFXA 4F7MA 5B8CC 1MQ8A 3LH2L 3W11C 4MNGB 4M61A 3O6FC 1KC5L 3VWKB 3O3EA 2IC2A 2CDEB 1CQKA 1LO2L 4WW1A 1I1AD 2F54A 2X7LA 2P5WA 4OI7A 1AJ7H 3MZTA 4PLKC 1AP2A 3BKYH 2CPCA 2G75A 5EBMA 3KPOA 1BFSA 1E0OB 1MHPH 3P9WB 3TH3T 2ADGA 1RURL 2BY1A 3FCTB 5EORL 2XG5A 2F53B 5JXEC 3VXPB 3CFBB 3CX5J 5B3NA 3RVWC 3S3PA 1FDLL 2IG2L 5DHVH 1JMZA 2IAMB 4U1IA 3L6FB 3KJ4C 3MRIB 3UAJC 4Z77A 4AEIL 3LKRB 4XNQB 4RX4A 1AGEA 4I18C 2ARWA 5EC2A 5HJ3A 4ZS6D 1J5OH 4MDJA 3MRDB 4P5TA 1LO0L 1MCPH 1WEJH 5TPWH 4XCFH 1MCWW 1KXVC 2R1YB 4NO0A 4PJBF 4XNUL 3OAYK 1Z9OA 1XIWB 1BIIA 1B88A 1I8IA 3V5DB 5IR1A 5DJ0A 3W11D 5T1KD 2EECA 5D71L 1SVCP 5E8DH 1V7MH 2X4PA 3K81A 1EAPA 5F9WB 3K1KC 4KRPB 1LD9B 5J3HD 4J12A 3FONA 4ALAL 4I9WE 5C6PB 3U4AA 3UROR 1FZJB 3JZ7A 5IHZB 1OGAA 1KV3A 2DQDL 4J2XA 1LDSA 2EO1A 2D0FA 5FYJH 4Z95L 3GSRA 5JIPA 4NQSA 1CXHA 4L4TD 4M6NH 4DZ8B 2OR7A 1E4WH 3SO3B 5F6IB 3GBNH 2ORBH 2EYTA 1VACA 5GRWA 5IUSA 2XWTA 4JLRA 3IDXH 3P4MB 4Y2DA 1F4WL 3NIFE 4QHMA 5DDHA 4QHUA 2Q7YA 3OKNB 4TOYH 5HHMD 5EC1B 3MLWL 4ZFGH 5LBSH 4RRPA 5KS9A 1E27A 5T3XE 4P4KB 4XWOC 1Z0NA 5E8OA 4IRSD 4PGDA 1QPXA 4MHHG 1UA6L 5AWNH 2XA8L 4XP4H 5DJCA 4OCWL 5D8JL 4IOFD 4CN6A 3TESA 3HMWL 3CPLB 3VJ6A 2J88L 1YA5A 3QUZB 3O3BA 3IXAB 3MOAH 4LQFH 5D7LD 5IG7A 4QHKJ 2H3NA 4NWTL 4HWZB 5DTFA 1CIUA 3T2PA 2G5RA 4JREC 2ICCA 1F02I 1FV1A 3OJDA 2I60L 1PYWA 3D0LA 4KRPD 1S7QB 3OHXB 3ZE1E 5B8CB 5HHQB 4U1KA 1ZT7B 3LH2H 4KHTH 4XNYH 4QO1A 3GO1L 4FHBD 5GZND 1RJZA 3LV3A 2DM4A 5M7QA 3N85H 1AO7D 1AGCA 3PGDB 2DBJA 2PTVA 1TQBC 3GSNA 1L7IL 3OL2A 3VFGH 2FGWH 3REVB 5ISZB 1I1FA 5DJ6A 5E9DB 2AGJL 1VFBA 2P8LA 3ARPA 1XT5A 4LLQB 5KVMC 1ZWIB 1T20B 5HYSA 2VB5A 3OZ9H 2AVGA 3R0MA 5HHPB 3MX0A 1P4IH 3F7YB 2D7PA 4PJ5B 1DVFB 2NXYC 4KUCF 1KG0A 2HA1A 1EO5A 2R0LL 2J12B 3VRLE 5IB1B 1U8JB 5CD5D 2IFFH 5CCKL 3CZJA 4Q6IA 4XI5C 4HXAL 5GS1C 2MCG1 4TN9A 1A21A 2HN7B 3VFTA 5I6XB 2YC1A 1QZ1A 5GRXG 1PG7L 3PF2A 3UYPA 2YZ8A 4YNYB 1I7UA 3LEXA 2MPAL 5CZKA 4FQXC 5IQ7L 1P2CB 3QZWG 4G5ZL 5EG6C 4C83B 5CILH 3MV7A 3QEUA 4LGSB 1HIMH 1W8OA 2W60A 3S35X 4UZGA 3ZE1F 4LLYB 3U82B 2K7PA 5FHBL 1QFWM 3B9KD 5JW4Q 2V17L 1U41A 1B3JA 1H0DB 5FM5O 1P4LA 4C56D 2Q76A 4M9PA 1SBSL 4Z95H 3P0YL 1SBBA 2XZCH 4Y19E 2WWKO 3RNKB 2VLKE 2JCCF 1CQYA 4YDVB 3L5WB 4QOKD 1SEQL 2WUBH 5JOFA 3GJFA 1TLKA 4G6KL 1N7ML 3BJLA 5D7IE 3PL6C 2YUXA 1PLGL 3PWLB 2I9TB 2QQLL 5DQJB 5D1ZC 2CO6B 3KLHD 4UBDC 5KSAA 4R7NB 4PJ9C 1WITA 4NNYB 5I17A 4MX7B 2XQBL 4WFHD 1WCBB 4QXUH 1Y18B 1UB6B 3KAAA 2IANA 4GRLB 4RQQA 2MSPA 5JW5B 1P4IL 4JQXA 2QQNH 4JPKL 4FQ1L 4PJIE 1BAFL 1S78C 3V0AC 2R0KL 3QI9C 4LSRL 3DTXB 4HK0B 3U0PA 3L3JA 4HUUA 1RJYA 3QXAA 3AS0A 5I9QB 3HZYB 3QEQD 5D6DC 4UTAL 3CMOH 2FD6L 1NFDB 2ZUSA 3AAZB 4D2NA 1A1OA 4XH2A 4ISVB 2ICWJ 1UM6H 3BAEL 1R5IA 1DJSA 2VDKL 4XP1L 1PY9A 5D96C 4KQ3H 3VFOB 2FBJH 3FAWA 1NMBH 3I6KB 1D5BB 4PRHA 2PTTA 3LY6A 5JW3H 2WLZA 1DQDH 3HC0A 4NJAH 2HJKB 1UM4H 3MACL 4IJ3C 5JIHA 3QNXB 5IV2A 2DL2A 1BEYL 2B1AH 3ROLA 3PGCB 4BJLA 5HHOD 2E8ZA 3QT2A 5DFWH 2D7MA 3OB8A 2P1YA 4MB3A 4Y2DC 3NA4A 4PJXF 1T0NB 4EJ1C 3VXRA 3QQ4B 3BH9A 3RKPA 1NCBL 4G43B 4DCQB 1OSZA 3K8LA 5ADPL 3I3DA 5B38A 5BMFH 3HG1B 2AXGB 2MQ0A 4NQVB 4QT5A 3WLBA 1R0AL 5JO5B 1AO7E 4Z7UF 5HGAA 5I66A 1S7RA 1W8NA 3LN4A 2AKRA 3QR2A 2D9QB 4IDLA 2DMKA 4JJHA 1EVUA 2GT9B 3EYSH 4QTIL 5E1AA 5T3ZH 4UT9L 1MCKA 5ID0B 5HYIA 3WUWB 2IWGA 4HG4J 4LKXA 1KOAA 1Q9OB 2NY5L 3WE6A 1KXQE 5F8QC 3VXMA 1T1ZB 1TQBB 3MCKB 4Y89A 1AXIB 3MLRL 1KJVA 4Z18A 4P46C 3L5XL 1QSFE 2NY0D 3TVMC 4ZO9A 1I8MA 1BGXH 1OT1A 1QRKA 2CIKB 1XR8A 4ZUUB 2JJSA 5GGSA 3RJDA 1FIGL 2QR0A 2P48B 4L3CA 5TDNA 3HPLB 4YC2C 1ODAA 4UNTA 4OLYL 3KPNB 3ALWA 5GGRY 1NBYB 3X12A 4HK3N 4LEOA 3T3ME 4N5UA 2CIKA 4WWID 4XMKH 4MCZB 1G9EA 4ETQB 3E6HA 2OI9C 2ZCLH 2A9NH 1OQXA 4R3SB 4IS6B 2OJEA 5LGKA 1YQVH 3C6LA 4EUPA 4DN3L 4OCXL 2IMMA 3ARGD 1IEBA 5F44A 5EFIB 1ORQB 1P6AB 4Y4KC 1NCAH 3U9PH 4FQJH 2E7CA 1IAIM 4TRPL 5D7JC 1N5AA 1W72L 4R9HA 3O4LD 4IDJH 1YY8A 1R3JA 3RA7L 3BXNA 4Z5RA 4HT1H 3HG1A 1BVLB 5C07E 1WF5A 1YEGL 3TJEH 4Q9CA 1CD1B 1X4YA 2P5EA 5KANI 1UWXH 1GJIA 5FKPB 3U9UB 5F72S 1Z6JT 4JM4L 3SO3C 2P5WD 3LKSA 1UYWH 1JV5B 2Q8BL 1PAMA 2APBA 1R3KB 4R7DB 4D9LH 2VLRE 2XQYG 4NQCD 2FNBA 5KVEL 1DQML 1E6JH 5IV2B 3H42L 1WWBX 5ESVA 5KG9B 4IRSB 4AG4H 3IJYA 4XPGH 3C09C 2Y72A 1G6RB 5T33H 1FRGH 4FMFA 3LKNA 3ZE2E 5FF6A 3GNMH 2CO7B 4ONHA 1RULL 4R0LC 4KJWC 1UENA 4R2GD 1MH5B 1P69B 5T5FL 5HI4C 1HYSD 5E5MB 5JOEA 1IGYA 1U95B 4NSKB 3MGOA 2WINA 3UTSD 4PLJD 4XX1G 5C0BB 1CFQB 4FTVD 2VDOH 4K94L 2JTDA 2ESVE 3LQAC 4IRZH 2EDEA 3CXHJ 3OAUH 4EEEA 2Z4QA 2NY2D 5EU5B 5D7JA 4F3FB 4HGKC 4X98B 5GHWL 4QWWC 1NL0H 1ZA6B 2DKUA 1CR9H 2ZUTA 3X3GL 4HX1A 2FYYA 4OZFG 1EHXA 2KQMA 3PDOB 5KOMC 1QQDA 3PGFH 1YN6B 5EO0A 2E27H 3QXTA 5DJ8A 4FXGA 2L7JA 3PHQB 3TPKA 4ELKA 3I9GL 4POYA 1JNHA 4IM8A 4UT9H 1MFDL 5JMOC 3DV4B 3MGAA 4ZSOA 1CGYA 4K7PL 1NGYA 1BWMA 3QDMA 2OCFD 5L9DH 3QPXL 4HIIB 4PTTB 3NFSL 2OL3B 5C0CA 5D5MF 3TO2A 3T0VA 2FCBA 3NAAH 2AXFA 3TCXA 3F7PC 2E8YA 2HT4C 5SWZD 2GK0B 3L1OL 1QSZA 3IU3B 4PBXA 1NUFA 4QXGL 1E6OL 4NZTL 3RUGB 2XKNB 2DYPA 1X5IA 5D7JD 2A6KA 3VRIA 5KW9H 1TPXC 3A67H 3IFNH 2OL3H 5H2BA 2Y7QA 3WN5B 3H42H 1P2CA 3TBTB 1IBGL 4M5ZL 4JRYD 1KPUB 5I73C 2YEZA 3TZVD 4HKBB 1MCOH 2FJFA 3RNQA 2BC4B 4NNPH 1IAOB 3WLWD 2VO5A 5JQ6H 3G5VA 3BKML 3PHOB 1RVFL 4J3XA 4CN4A 1I1YA 2NW2A 2B4CH 3OKEB 1LEKA 2QQNL 4DKDC 4DKFL 4OF8A 3TYGH 4BFBD 4HKXB 3LPGA 1KCKA 2CRYA 3AREC 3QXVA 2HT3C 2VERN 3GM8A 4OD1H 3DARA 3MFFA 1FZMA 4LHUD 4RRPG 4XXCA 5TH2A 3ALXA 5BV7C 3KG5A 3ZKSD 1VFBB 4KK6D 4FQ1H 1O0VA 4DUWA 1NKRA 2WBJB 4XNXH 2OI9B 1RIUH 1JPFB 4GQ9H 3H3PH 2ATPA 5EBLA 3RIFF 1U92A 3PGDA 4HJ0C 2EIEA 1A6AA 4GFTB 5JA9A 3QHTC 5C2BH 1RK1B 5GSRA 2YD6A 4UILL 3UBXB 2IQ9L 4L29B 3QIWA 4H1LA 3LD8B 3S5LA 1BECA 3RDTD 4H88H 1L9NA 3G6JA 5B8CA 5HHQA 2GCYB 1DDHA 5E4EC 3C6SB 1NGQH 3HE7D 3JV4B 3WJJC 4P99A 4ZPTB 2ZOKA 5CHNA 4QRPA 3ZHKA 3GDBA 3T4AA 5DRXA 4LLDA 2M1KA 1FE8H 4M1CD 3BQUB 2NTFA 4AM0B 3CDGB 1VSCA 3RTQC 1N3NA 2H41A 2Y07L 5FCUH 3I6GB 2APWA 5HGGS 5I74C 4JKPL 4AK1A 1IAKB 4OLXH 4TSAL 4FNLH 1FFRA 4PJFF 3S5LB 4KJQC 3FTGB 4MSWA 5E6ZA 5SWSE 2FD6H 3I85A 3L3OB 1KEMH 4MJ4A 4LLWB 4LRIC 2XTJB 2N7AA 3IJSA 4LCYB 4ZYKA 1N4XH 3Q1SH 4P46B 2C1OB 1X5GA 2VAJA 4N8VG 5IK3A 3MGTB 2ZOLB 4QHLB 1JNLH 3NIFF 3Q3GB 2HJFA 1DVFC 5BXFA 4HUVB 4D8PA 5BCAA 1G7PB 1FNLA 5JNYA 5F8RC 3H9SD 4G9FD 3MLSH 3N50A 2HKHL 1T1YA 4FABL 4I0PD 1CFVH 4TTDC 3CDYA 1AY1H 2G9HA 5BVPL 3NCFB 1X5XA 3MRPA 3NABL 4HEME 1MOEA 2DQUH 3ISWA 5CD3B 1JGDB 3VFPA 4YO0A 3N06B 1WZKA 3B5GA 5IGXL 4HH9A 3G5VB 4ODWB 5GRUL 4JFZL 8FABB 1NEZG 2DQIL 4OLEA 3PJSA 2ERJC 4Z0XA 3O45B 3T4AB 5J11B 5FGCE 5F96L 3IGAB 1P84K 3MLVL 3MUHL 2CKNA 2OS7A 4WEBH 4KZEL 4M9OA 3TBTA 1P4BL 2MCPL 1D9KB 3IAPA 3HUJA 4JY6B 4QRSB 4MD5B 4NO0B 4CU8A 2X05A 3AM8C 3MRNB 1DEEB 2P7TA 1FORH 4WNQA 5DC9B 1F4XH 4P59H 1F13A 1JPFA 5EC2B 4NPYA 3SDCA 1MCQA 4H25A 4MJIB 4HJGB 1V3KA 1CLOH 5EUKA 2CIIB 4K2UH 1Q1JL 1AIFA 1BQHB 1T5XA 1T21B 1CTNA 2X41A 4M6ML 5BW7C 4JHAL 3JWOL 2EDXA 4NRZA 3MRRB 2VISB 1CGUA 1MHEB 1T2QH 3M1BA 3MBED 3STLA 3V5KB 4EUPG 3C8KA 2VDNH 5EO0B 3NPSB 1BD2D 1IAOA 5EUOF 3HI5L 2WBJC 4Z78B 1A6ZB 1W0VA 3DYOA 4KDTA 1KCSH 4NQCB 3BPLB 1MVUA 5C2UB 3NTCH 1G6RH 1LGVA 1ZA6A 3KWWB 2AV7B 1JF1A 3KLAB 4O51A 3QBTB 5CJQH 3MV8A 3WS3A 4Z7OE 1SM3H 5D1ZB 3IF1A 1MFAH 4YPGB 2VXSH 1MSPA 1ZVHA 2ZUQB 1A7OH 3CUPB 3BMVA 2LE9A 3STZB 1MJ7L 2Z93A 1DFBL 2MMXA 3DJ9A 4ZQKA 1HIML 4HWEL 4NT6A 2PW2B 3HR5A 4HZLA 3NFNB 1G6RA 3EYSL 4QTIH 4JFHD 4RGOH 4Y16A 5T3ZD 3EJYD 1M05B 1Z5LA 2BNQD 4GKSA 5JPMA 3IS0X 1A3LL 3ESVF 1JPGA 3WHXB 1TTFA 5GGQL 3SKMA 1X5YA 3PNWB 4MNQE 4JO1H 4PJXE 4ZMAT 3H0TA 1UEMA 3P0VL 4JEGB 4K94C 3KLSA 4J23A 3BGFB 4O2CB 1CLYH 4AENB 1CD1A 4K9EC 1DBMH 5FOJA 2EDWA 1EDQA 1AY1L 2B20A 2V7NB 5DVOA 4PRPA 3KXFA 2EZ0D 3EO1B 3SDCC 2BP3A 1RULH 4OD3L 4OD3H 5DFTA 4F3FA 1G7IA 2DQJH 2HTLC 4CMMA 3X11B 5I1EH 1RZFL 2GQHA 2VQUA 4ELMA 4Y8DC 4KQ3L 3MNWA 5D6CB 2A38A 3CLEH 4GLRI 1KJ2A 4BK4A 4NP4L 4TTDD 4JGMA 3IJHB 3SKJH 2Q8BH 1VFMA 4U6XA 4RWHA 3HR6A 4EI6B 1DQQB 1QBMH 3E6HB 4S1RH 1BJMA 1QR1B 4MCZA 1JP5A 5DVKA 1F6LL 5E8PA 4JPKH 2YD9A 3D39A 1LO2H 4PJDE 3SY0A 4LVNC 3TA3C 4CVZB 1XCQA 1EIBA 4PY8I 4RMWA 4I5BB 4A6YB 3DIFA 1QACA 2AEQH 1P9MC 4A2LA 2GSGA 2BOCB 1A7OL 3ARDD 3V6FB 3WNKA 1EFQA 4XT1C 3M07A 5DA0B 2BOBA 1JJUA 3EZJB 3BRGC 5TE7L 1XR8B 4C55A 3ETBF 5GGQH 5GJTL 3C8DA 4BYHA 1AD9A 4ZPVB 1N5AB 4ONGH 5HY9A 4ZTPH 2EKSA 3O3AA 3VXTA 3LD8C 2AK4B 2WBJD 1N5YH 4J1UA 1VB9A 4MSWB 4XNXL 2FRGP 4IOSD 4AMKL 2SEBA 2VRAA 3V4VL 3TBWB 1UZ8B 3BQUC 1SM3L 1DFBH 5JO5A 4DW2H 1MF2L 4AIZB 4FQLH 4X0KB 1RIHL 1RIHH 1ZLSH 3FZUC 2GW5A 2PXYD 1B9ZA 1MIEL 4A6YL 1QFUH 3R0NA 1JRHH 1FIGH 1KXTB 3CDCA 4P3WA 4OZHF 2B4CL 4P3CH 1CZ8L 1CZ8H 4L3EE 4PRNA 1A1MB 1IARB 3AMLA 3FB7A 3GSUA 5SWZA 4Y4KD 2DTSA 5D1QA 1KJ2H 2DQTL 1G1YA 1YPZB 4EN3A 4YBQC 1O5DT 4D0CB 1B4JL 5GS0C 3ULUD 4AEEA 5FA3A 4FQQA 1JPGB 4TQEL 1U58B 1DQQA 3NPSC 1KIQB 1BFVL 2AJ3B 1KJMA 2HTLD 1LDPH 4U7SA 1JWUB 1KNOB 2VLKD 1WFOA 2FO1A 3VG9B 3KJ4B 4S1SH 3W2DL 3L3HB 1I1CA 5C2BL 2BMKA 2X10A 1U8MB 3KPMB 3ARXA 3FB5B 4Z7WE 1WZLA 2XACC 3S96B 3HZYA 5BMFL 5E1AB 2VXQH 1A2YA 1OD9A 4XBPA 3HI6H 1FPTL 4JDVA 4JO3H 5F7UA 5FUZL 3FO2B 3QZWA 4JFXB 3OKEA 4WUUD 3DVNB 4QT5B 1CFVL 1V05A 3WSQL 5HHME 4X6DB 1IGIL 4G43A 4DCQA 4GAJL 4UIKH 3KYKH 1WZ1L 4K9EH 3NZHH 5L2KA 3AGVA 4PRDB 3BPCA 3Q48A 3BKYL 5TE4H 5IB2B 3QUYD 3L7FA 1EO8H 4Z7UB 2NY6D 1YN7A 1M7IA 4IMLB 4LKCA 3UPRA 2OTUA 1JRHI 2CGRH 4H1LH 1IGCL 2E9WA 4NO3A 4CADB 3FMGH 1OAYH 3Q5YA 3QCVL 1QFPA 4EQ3A 4PJXB 4HBCH 5E94A 1FVDB 2C4FT 3CDFA 3HE6A 4I9WD 4Y1AA 5D1XD 3FO9A 2H9GB 4MMXC 4U6HA 1GH7A 3D0VB 1EHLH 2NXYB 4PY7B 1R3HB 5TQ0H 3TH4T 4ZDHA 5I1EL 9CGTA 2W0FA 3DGCR 2VDPH 5LKNA 3FQWB 2AK1L 2CLVB 4PGCB 3CX2A 3DMMA 1AI1L 3JBG7 4JANB 4TUOA 1D9KA 4JO1L 1PKQB 3WS3B 3KNBA 5EPMB 3DWTA 3B9VA 3GUTA 3BP6A 2D7TH 1MCDA 2Y06H 2VWEC 3SGDI 4G6ML 4YNYA 1UXWA 5BS0B 1NFDF 2QQLH 4KK6C 3ILPA 5B4MD 3CLFL 1ZKAA 4X9BA 1JGEB 2OJZH 3PDDA 5EA0H 1MNUH 3NA9L 1EEZB 4X98A 4PJ9B 3GMOB 1A6WH 1K4DA 3QHFH 4JM2B 2HH0H 4CMHB 2V5TA 3RZCD 5EZJA 1IKFL 4FQCL 3ULUC 1U8HB 3MRRA 5ISZD 2HLFD 4NM4H 1U95A 4NSKA 3HI6L 1S3KL 3ZL4H 5JXEA 5GGTH 3LDBC 3KPMA 4LLQA 1JF5A 3OGOE 4APQD 1P9MA 2AV1A 3B5HA 5EUKB 2KDGA 2DJUA 3L3HA 4H1LG 4H26A 5FV1L 4GS7C 3HE6C 2DKMA 3HTLX 4G7VL 5I30L 5C0EB 3RWEB 2RHEA 2VR9A 1IILE 2BRRL 1XGYL 4ORGA 2WW8A 5D7IA 4ZYKB 5FA3B 1XF1A 2EEBA 4PJCA 2NR6D 1ACYH 3DMMC 1FJ1A 4H0IA 5T33L 5AYQA 2H2SC 4O5LH 4IIQC 4PRID 1JV5A 1G9MC 3TFKC 1IMHC 5I1GH 1K5NA 4EDWL 5FDWB 3CFIC 3V6BR 1CICA 5B21A 4BH7B 1GHFL 5DJDA 4GKNA 2YC1B 5IF0A 3S34L 3JVGA 4KK8D 1OGAD 2NTFB 1QFUL 2XY2A 5DUBA 4HH9B 4ODWA 3D85D 3S37X 5FDYA 3LN9A 1PZ5A 2DKSA 4PGBA 4L4TA 4P59L 3RVWD 3T77B 2FO4B 1MCOL 2BY3A 2ICWB 2O5XL 3B2VL 2FIRT 3SOBL 1T5WA 3QQ3B 4BH8B 3TN0A 5D1QD 5CJXA 4NQXB 3IU4H 4M02A 1J1PL 2VC2L 3BMWA 1YNKH 3C87A 2V7HB 4BELD 3IVKB 1NCWL 4YE4L 2EKSB 2W65B 3CZFB 4KK5C 4GMTL 3LSOB 4WWKC 4DVRH 2BVTA 4U1NA 3SGJC 3CFKB 3HC3H 4Y2DB 1T7WA 4P2RD 4OB5H 3OAZK 1A14L 4UDUB 4B53A 1TETH 3QUMH 3QPXH 3MNVA 1ZLUK 3B2UD 4EZMA 4DKAA 5E00A 1NBVH 3X12B 2HG5A 2CXKA 3GK8L 3DI2B 4N90D 4M1GL 2RGSA 2FO4A 2FEEL 4XVSH 2J5LB 3VFSA 3CDGA 2EYRA 1B0RA 2PW1A 4JY5L 2Q8AL 5IHUH 3ALPA 1G84A 2X9YA 2CUMA 1MJ8L 3MLUL 5EN2B 3CPLA 3SGKA 2OYPA 1UH3A 5H35A 4HAFA 4HKZB 4NHCH 3DX6A 1UM5L 1XEDA 2DICA 4LAQH 2RIKA 4MCYB 4L29A 3VXSB 2VDOL 3NN8B 2BHYA 1XF2A 1RK1A 1RZ8A 3BUYA 1F97A 5D7IB 4NGHH 4BQ6A 3NCEB 5DDHB 2IJ0C 5SWSB 3FN0L 3HLAB 1FN4A 1LEIB 4X6DF 1RZIA 1L7TL 2XWTB 4JLRB 3W9EB 4ZFFB 1OWRM 3MRLA 1JFQH 1Y0LB 4EIGB 1UKQA 1CLYL 2MJWA 4XPFH 1UFUA 3L5HA 3S37H 4HF5L 4PRIB 5KSVA 4WEUD 2BHUA 2Z8RA 1M7DB 3HAEA 4ELKB 5F1KC 5IHZA 1FVEA 3ZKND 2CXGA 1T22B 1ZHBA 3I84A 4KKLC 1HOCB 4PRHB 1W72A 4GW5B 1QFHA 4ONOA 4GS7B 5CIPA 3BHBA 1HWHB 2QADB 1SJEA 4D9LL 1CDYA 1J7VR 4ISVA 4HFUH 2E6PA 5FO7A 1ADQA 2F54E 3U0TB 4NZDA 3DMMB 5C0BA 2R2EB 4LSPH 1YDPA 4OCYH 2VLJE 5DS8A 3ZDYF 1FPTH 2DQEH 3MLTA 3QUKA 1CL7H 1CL7L 3IDNB 4PY7A 1W72H 1LK3L 3W82A 2X1PA 3HE6B 4UUJB 3BHBB 1BBDL 4FQHB 3WNPA 2X44D 3WDJA 2P5EE 5ACZB 3GIZL 1RURH 3CH1A 1UKTA 4DKFH 1AHWA 2EXWD 2VDNL 4KK5D 3LEYH 1EBAA 3T2OA 2AI0L 4MQSB 1KBGH 2PYFA 1BZ9A 4PRIA 2CKBA 2X4TB 4OV5A 5HDLA 3OXRB 3KYOA 3FOMA 4NOBA 3CGTA 3GZKA 4KTEL 5ACZA 3REWB 1XGUB 1LK2B 1FCGA 1IKNC 1Q72H 3QDJD 4HF5H 4EUPH 5A3IC 1EO7A 1U3ZA 4UQ3B 1WT5C 3SDCD 2GITA 4ODHL 5IB3A 3PXJA 4OB5L 1SEQH 4NFBA 3VXOA 2HT2D 4IRJC 4MA7L 4NQCE 3NN8A 1CF8H 4OI9A 4YHMH 1OTSD 4C83A 1BD2A 4LVHB 1AE6L 2ERJB 3DXAE 3ZKMC 1C16B 4HPYL 1SJEB 1A6WL 3P9MA 3BZDA 3MNZB 4W6XB 3INUH 4JFYB 3QH3B 2ZNWA 3OX8A 1U8KB 2QL1A 3MA9H 5MEQA 4FFZL 3IDMA 4PS4L 1DQDL 4N68A 1U8NB 2I60H 4IRSA 2D03L 2MPAH 1HYRC 1V7NL 3OAUL 1M7DA 3HAEB 2BCKA 4EI5C 2GYSA 4OBRA 2X4RA 3MTRA 4ODBD 4WI5A 1M6OA 4O2FA 4JGUA 3NCCB 1YEDA 4CVWA 4Z7NF 3SDDA 5B39A 4OLUL 2DD8H 1T03L 1UWEH 5F3HB 2O5ZL 3NCJL 1MQKH 4HUVA 1ZT1A 4GRLD 3S5LG 5A16A 3QEGH 4OGAC 4WUKH 3GJFK 1GGIH 3GGWB 2NZ9D 3MRHB 4N0YL 3IAQA 1AXTH 1DN2A 1ZK9A 4JG1H 5A3ID 2V5MA 2GUOB 4XBPB 4XPBH 2AQ3A 4YBLB 2VH5L 4S1DD 1WJ3A 3TN0B 2GT9A 3DX6B 3PL6D 3AUVA 5D6DA 1BJ1H 4E9LA 4O02H 4I3RH 1OLZA 4RFOL 5HY9B 3T1WA 4L4TB 2OQJB 4CNIA 1FVCB 5IM7A 5FM4A 1RY7B 1S9WB 3SE3A 1U58A 1ORSB 4C54A 3WUZA 1W0WA 4WFFD 4HXBH 2J8UA 4R97B 5JZ7C 1AGBB 1I7TA 3FB6A 3PXHA 2BOCA 1RZ7H 3DYPA 1KCLA 2W0KA 3CCHA 4HFUL 4PV8A 4O2FB 1SBSH 1RUKH 3GSWB 3ZMRA 5CMAB 4BUGA 1NCTA 4YHIB 2H32H 1OTUC 4EDWH 1HILB 2XQBH 4LOUC 4KMLB 3OAYH 4CDGC 1NUNB 2JKXA 4ORGB 1S9WA 4MNGE 1JZ3A 4X5LA 2A9NL 3MNZA 3OKNA 2VLMD 4PRBB 1ZANL 2VUOA 5FXCH 3WEXA 4BSVB 3ES6B 5EUOB 3QPQC 5FYKE 3TPUB 5E56A 4JO4H 4OQTL 3T65A 1PLGH 2HVJA 4Y4FD 5E7FA 2A6JB 5KANG 2R23B 3MA7A 5D2LF 4AEIH 3L3JB 3L3IA 3G5YB 3RPIB 3VI4E 4P2RB 5BRZA 3UYRH 1QFWH 1S9YB 3PWUA 4BSJA 2DD8L 4PJ9A 1T03H 3EO1A 2VE6A 1FZJA 5CUSL 5KVDL 2NMSA 1WBZB 4NM4L 3BIKB 1A7QL 4U0RC 3PWPE 2YRLA 3W0WE 4LBEA 5BVJA 3QQ9D 5D2NB 3ZKMD 1T83C 4DW2L 1IBGH 4M5ZH 2NY7L 4CVZA 4WJ5B 3VFNB 5KSAD 4OV6F 4OT1L 2Y9RT 1QLFB 1AFVL 3BKCH 2VITA 3QDME 2AS5M 5C0EA 1ZVSA 3RWJB 3HI1A 4LSUL 5DR5H 2H9GA 5DUMH 1C16A 4D9QD 1RI8A 4L8BB 3QFJB 1YEFL 4HIIA 1MJJB 4LLMB 1Y6MR 1JZ5A 3PQYD 5DS8B 2YD4A 2IAMA 5JW4M 3ZDXE 2CKBL 5GJSL 2JK5A 4YPGA 1YDPB 5SWSD 4OZGE 5HI5C 2ED7A 4PRHE 3H6JA 5IVXF 1MI5D 5SV3A 1I8KA 2DQGL 2XA8H 4KDWA 3AXLA 1W2KT 4JGJA 1LO4H 4AENA 2X89D 3DO3A 3H8NA 1I3UA 3DX9A 4M6OH 3MLWH 2J6EH 3SQOL 2CKBB 5HI4D 4P49A 4OV5B 2PNDA 2EDTA 1I8KB 4OZIA 5GGTA 4HSQA 4P2RA 5BRZB 3KXFE 4L8SC 1DBKL 5FYKH 5I71B 1A2YB 1WFTA 5CGYC 2EC8A 5I74B 1J1XH 1T21A 2BDNH 5L2JB 5D7LE 3T0EC 2DQEL 1KLGB 2CJUL 4F37F 3ES6A 1J0HA 4XNZB 5SWZE 1U8LB 3VXNB 4GUPB 4YLQT 2R39A 4NM8H 1H0DA 1LHZA 3FQRA 3IDYB 3MLTB 5HDOA 2AJSL 1KJ3H 1B0WA 2EIZA 3MRNA 1XF2B 3IDXL 4WW2F 4G8GD 3BPOC 2F5AL 1B6DA 3O6FA 5D1ZA 2D7OA 1Z9SA 2IH3B 4U1KB 2DI7A 5C0AA 4U4BA 4BZYA 5FYJD 2HFEB 2GFBB 3B83A 1ZOXA 4RAUA 5C71A 2ZCKL 5ICXB 5IFJA 5GS0H 1S3KH 1EGJH 3BXNB 4Z5RB 5IW6B 2B1HL 1GGCH 3TO4D 4P2QA 3E2HB 5TQ0L 3T08A 3HNVL 3VFSB 4L4TE 1XR9A 1MCIA 4J8RB 2R9HC 4JFDA 4CVXA 1R5WA 5AYUH 1DVFA 1CGVA 1PQZB 2J8HA 1Z2KA 3B9KB 1QR4A 3G5ZB 2PN5A 3MR9B 4WO4A 4XZUB 3S96A 4F7EA 1DP0A 2A6JA 1KCVL 4WI8A 5CGYD 3RY6A 1OTTC 2BVPB 5HD8D 2ZG3A 4IS6A 5A2IH 4QHLA 5TE4L 3GKZA 5AAWA 1A47A 5IEHA 1VKXA 4RAVB 3QDGD 4P5KB 4Y19A 1ZT4A 3BUYB 4HV8B 1GAFL 1D6EA 4JHWL 1AXSA 3SQOH 1VENA 1JHKL 3X14B 3VGFA 4M93B 5L7XL 2AP2A 1U8IB 3CSGA 4LU5H 4YIQA 1I7RA 4LSQL 3RKDD 3GSRB 1I1AC 2NW3A 1MRCH 4JHBA 3S6CA 4C58B 4L3CB 4Z7WB 3W5MA 3TNNA 3ARBC 3VU2A 1ORSA 3FONB 5I2IB 4EI6A 3WD5H 1CU4H 1SYSA 1YYLL 3MCKA 4ZPTA 4G42B 1YEIL 3AS3A 3K80A 3U48A 2R8SL 2I27N 3ARWA 3F7RA 3RTQD 1V7NH 4ENEC 3UO1L 2IALB 1X5LA 1EERB 3BZFA 43C9B 1I8IB 2XN9E 3ULVF 3SCMD 2XY1A 2GTWA 3QDGE 4UINH 1GOGA 3P11L 3QJFA 1IZKA 4X7SH 1QUNA 4GQPH 4ZO6A 5LGJA 1VKXB 3PHSA 1RFDL 3JVGC 1NGZA 1YUHA 4QHUB 4RFEB 5F7YC 4PRPB 3RVVD 4Y2OA 2PF6A 3IJSB 1NMAL 3P4MA 5IMMA 1NGWB 3FKUS 4ZD3L 1KLFA 3SE8L 4X7FC 1I9JH 4F7EB 5FV2A 1I3GL 2DIBA 4UV7H 1IGFH 3NACH 2DI8A 4YX2H 5EU4B 5K9OA 4NWTH 1CIDA 2H32A 3T77A 4K7PH 4Z7VB 2CK2A 4EOWH 3U36B 1QR1A 3QDJB 1ES0B 5C7XL 4QXWA 1YMMB 4GAYA 2PTTB 3BW9B 3I3BA 4M8QB 4TOYL 3RNQB 3BN3B 1T4KB 2UYLB 5CSGA 4HZLB 4JDZB 3C09B 4IHOA 1C08B 4DFHA 2UVFA 1JNLL 5GSVB 1BF2A 5JUEH 3GUTB 1OVZA 1A3LH 4GW4B 4XX1E 4MGXA 3GMRA 5DJ0B 1PKQA 5ENWB 4AEFA 4FXKB 3WXVH 5L88L 5GGVL 1ZT4B 4UNUA 1MCJA 5IB3B 1PG7X 5E24E 5IEHB 2XYCA 1WFNA 5ESQA 1J1OH 5DRZB 4ZDHB 3VXRD 3GFUA 4R97C 4U0RB 4G6JL 4YH6A 2VXSL 4P23A 1DL7L 1VPOL 3U7YH 4DOHB 4KQ4L 1JYXA 1OTSC 1M4KA 4PBVC 4BUHA 5KSUB 2BSSB 1RZ7L 1R5VB 3QFDA 1NGYB 4QRUB 4OSUL 1QSVA 4QWWD 2MOVA 3H0TB 1KN4H 3P30L 1OB1B 1CK0H 3A6CH 4YHZL 1CDUA 4H8WH 3BPCB 1XCTA 3MLYL 4GH7B 4LVNB 3TA3B 4Y4FB 4NRZB 1JZ7A 3T0EE 2CUHA 3DX9B 5JPMB 3DETD 4LASL 3WFEL 2ZWLT 3KHQA 3VI4F 3MRLB 3HZKA 2W0LA 4P23B 5BVPH 3G9AB 1PEWA 2ENYA 1IL1A 4YK4B 4YHOH 1QYGH 3T0WA 4JO2H 1AO7A 4QXTB 4LPYA 3WO3B 1WZMA 3MRGA 3TV3H 2V17H 4YC2B 2XNAB 4HH8A 2F8VA 2COQA 3BE1L 4LHQB 4MD5A 4Y1AD 4YFLI 5D1XA 3O2WL 4WO4D 3WBDA 3ARUA 4N90E 1QBML 4PRAB 3QJHB 1L0XA 4S1RL 2Y36L 5A43C 1IGYB 2YRZA 4PV9A 3MV8B 3CVHL 4NYLA 4YUEH 5E2UL 2BJML 4PYHA 5EIIB 5H35B 3V5HB 4XAWH 2ZCHH 5EN2A 1J86A 1JWUA 1W0VB 4M8QA 2VSCA 3FO1A 5DD6B 5JQ6L 2DM3A 2VITB 4PJHF 1U3JA 4U7KA 2R15A 2IPTL 5J13B 2DQCL 5JOPE 4WI6A 4KZEH 1VADB 3MC0A 4JFED 3O6ML 4XMPL 2NCMA 5K9OB 3PQYE 5JXAL 2Q87A 5SWZB 3HG1D 5ITBL 1FC1A 2G9HB 3WSQH 3SDAD 4OM0H 2ZSWA 3WKNA 3U9UA 5I16B 1QSFB 4UDUA 3W9EA 4GRMB 1T7YA 4FQ2L 1FN4B 2X42A 1RSFA 2DBLL 1GOFA 5ELIA 1Z0MA 3EFFB 3GKWH 4DVRL 4GMTH 5CJBA 1S9YA 3MLSL 4KZDH 3V95A 3PUCA 3QUML 4K3EH 4KTDL 4L1HA 5DGRA 4ZOBA 4I0CC 2SEBB 5HVWA 1ZSDA 5EZIH 3MRKA 2HVJB 1GGBL 2BVEA 3GMRB 2GJZA 3FQUB 1NGPL 2IALA 1A6VH 1T5WB 2FECL 5EUOA 1FQ9C 2UUDK 4KRMB 5GSVA 5IROA 3LS5L 3V9FA 2EYSB 1HHJB 3LQAL 5DMIL 4AM0A 2FLRT 2NY2B 4YDJA 5T3XL 1EFXD 3MJ8A 2AEWA 2EDYA 2Z31B 4K2UL 4QCIA 2D9CA 1JTOA 3EAKA 2Y07H 4XTRD 3B9KC 3VFNA 1NBYA 4JHZA 2YSSB 1NCBH 3TCLB 1ZLSL 3QIBC 3RJQB 1KULA 2NX5D 4N0UE 3VD4A 3RBGA 1RMFH 1FFNA 4BZ2L 3RDTB 4LSVL 4PJCB 2DN7A 3ARDC 4HV8A 1EZVY 4V1DE 3O2DH 5DMGD 2EDDA 4KI5F 5CWSA 4LOUD 1CXFA 3R4DA 2QHRH 4L3EB 4TNVF 3ARBA 3VXMB 1GSMA 2W65A 3N9GL 3T0AA 2VLRD 4KXZI 1P7QA 5INCB 1GC1H 2DQCH 4YGAB 3JWOH 3WFEH 2BXYA 43C9A 3PWPB 4DTGH 1HZHL 4JN1H 1H8OA 1CN4A 5GGUA 2AJVL 5BZWB 1NH6A 3O3AB 4G7VH 5CP3A 5GRYA 1NBQA 3ULUL 3RX8A 3U46A 2EH8L 1UVQA 3F7VA 4X9FA 5E8EB 5DFVD 5FAAA 4Z7OF 4UIMB 3ECBA 4WIQA 1Q0XH 5CHNB 2DOCA 1FGNL 1TTGA 4Q9QL 4PJAF 3VXRE 2J8OA 5C0AB 2D7TL 2IPKA 4H1LB 5FA4A 3GEWB 1TVDA 3ROLB 5FHAL 4XWGH 4NNPL 5SX5K 5EULV 3K2UL 5E8PB 4HHAB 3ZKXB 4CMHC 2BNRA 4H20L 4QRPE 1NLBH 4YDJB 1YECL 4M1DH 2Y06L 4JFYA 3QQNA 4WTZA 1R3HA 2OQJA 1KB5B 2JJTA 4U6HB 4XNQA 5EIIA 2VZSA 2WUCL 1N2RA 2J5LC 2EXYD 1GYAA 3DX7A 3LKOB 2PETA 4U1IB 2QHRL 4I77H 4OGYH 3RGHA 3MLXH 1EHLL 3QUXC 1GGIL 5JHLL 3FT3B 5SWQB 1NCNA 3QG7H 2XZQH 2KZWA 3EJZD 4P2QB 2AV7A 1MCLA 4X99B 3ULVE 3D39E 3KXFB 4PJIA 3ARRA 4PP1C 1EA9C 5IFJB 4RQQB 4NQCA 2HT2C 1TJHH 1XGUA 4R4FL 2X6MA 2QSCH 4QRRD 2A77H 4W4NA 5CLTA 2G75B 4XC1H 1T0NA 1MJUH 3L3DB 5J7CC 2O26U 4JQIL 4QRPD 1T89C 1UKSA 4PJCF 4Y5YB 3O3EB 4RMRA 3BGAA 4XPHL 3SBWC 1VADA 3CVHA 4DUVA 5DQJA 3F58L 3BEWB 2W59A 1K8IB 4OCRH 3WHE0 1MJ7H 3DXAD 4IIQA 1IKNA 5J56B 5FK9A 1TQCC 4GBXD 4MXWH 1HKFA 1N59B 3V5HA 3TO2B 3FO9B 3ORJA 1X3DA 3J7HA 1JBJA 4H25B 3L9RB 1NAMH 3UCRA 4FFWC 1Y6NR 1KIUA 2O93L 2M8XA 4HBQA 4PJXA 1LWRA 2WWMC 4NCC2 1NUDA 4LHUG 3TYFA 1DEEA 2P7TB 4Y8AA 1TIUA 5B38G 3UYOD 5ENWA 4WJ5A 5EZOH 3TM6A 3PHQA 4O58L 4MWFA 1MI5E 4FFYL 1IZJA 2FEDC 4JPVH 1YN6A 4TQEH 4P23C 3KJ6L 2OX5A 3BWUC 1RZKH 5EU7C 1S7UA 3T09A 3VFTB 3ECBB 4NZTH 4G8EA 1UVQB 4M8VA 1I3VA 4OF3A 3AXLB 1U8JA 2GY5A 3ZSTA 2WNGA 3MV8E 4MNHA 5MP6H 2WINB 3AS2A 1I85C 1YJDH 3BN9D 4A6YH 4AMKH 1JI1A 2R23A 4WY7H 2ENSA 4C4KT 1Q9LB 1A7BA 1HEZA 3KGRA 4YDVA 4EUPB 1F11B 2YKLH 3MOQA 3QXDB 2Y5TB 1WUNT 2X4UA 4K23L 1D5IH 4W4OC 3GSNB 3DROA 5CWSB 4OF6A 2FHBA 1JHTA 1PKQE 4GG6B 1OPGH 4OZFH 2A73A 2F74B 1RD6A 3QCUH 3VXME 5BZDA 5DVLA 1ETZA 3GKWL 2J2ZA 4IHOB 4Q9RH 2OM5A 2G60H 4OZFA 3GBNL 3DPBA 5BVJB 3G5XB 2I07A 3ZL4L 1N3NB 1HSBB 3LAFA 1I7TB 3FB6B 5CIPB 5D4QA 4QCIB 5I1DB 1AI1H 3HMXH 1WICA 3WYRA 3O3BB 1OF2B 4U6XB 5K9KA 2EYSA 5E5UB 4L9LA 2NW3B 2Q86A 5IESL 2XTJD 5IEKB 1U8IA 1IEBB 3MUZ1 3VXSD 5I0DA 3WDHA 3MLRH 4MA1B 1C5BH 2AK4A 3VRJA 4ZFFA 3JTSA 1TVBA 5E9DA 1G7PA 3CFKA 3UTTA 2F9BT 3FMGL 5SWSA 3C6LD 1A6AB 1RZFH 3JUYA 5I66B 4P5TD 4L3EA 4U6VH 2ZUXA 3UTTB 1FNHA 4GRWH 1U0QA 4MAUL 5CINH 2VLLB 2VUYA 2X89A 4LL9A 1MAML 4PIRF 5IIEB 4Y5YC 1UXSB 3QQ3A 4BH8A 3S35H 3V0VB 4M1GH 4NZRH 3T1FB 1XR9B 3SY0B 5A40E 4RSVA 3O8XA 1SYSB 4HC1L 5GGSB 2VR4A 3Q0HA 4S1QL 3OZ9L 5D96B 5ABDE 2HP4A 1Z5LB 4YFEA 1J8HA 4BKLA 3RRQA 2BC4A 2BNQE 1EAPB 2AJXH 1I1RA 1K5NB 3ULSA 3DLQR 3MRQB 5TF0A 5DUML 3EYOA 1Q9OA 25C8H 3UC0H 4NO5B 5T1LD 3DVGA 1INEH 1ZSDB 4AIOA 3BJ91 1KN2L 1D6EB 1JHTB 3IU3A 5FUZH 1K85A 3MXVH 3DROB 3MRHA 1IM3B 4XMLL 5HJ3B 2H26A 5CJQL 2EIBA 3UXFA 1SEBB 3EFFA 1OLLA 1ZT1B 2OZ4H 2KL6A 3QXDA 1ZLVH 1IT9L 3HZKB 1YMHA 3OSKA 1F00I 5DURD 5L2JA 3SDDB 1ZHLB 4Y4FC 2HKFH 3MR9A 4XZUA 5D2LB 1PZUB 4V2CB 2X4TA 2C7UA 4XBEH 4PJ7E 3V7MA 3VGAC 5I1LB 3ZKXC 4CVXB 5EZJB 3ZE0E 1IC7L 4JZOB 1IGML 1I1YB 1YMMD 1G9NL 2NW2B 1JGUH 1SY6A 5HDBE 4ZO7A 1DUYB 3SDXE 1N6QH 1H5BB 3CH1B 4DKEL 1RZKL 5KSUA 5DK2A 1MFCL 1U8KA 2DLFH 3WDIA 4OLZH 4OLZL 3LEYL 1QFOA 3P9MB 4HMCA 4YHLH 1VFAB 5F9AC 2QQQA 1D6VH 3O9WA 3WN5A 3QIUB 1A1OB 2GJ6E 4NM8L 4Y88A 2WUBL 1LO5B 2EDNA 1I9JL 4JANA 3MGOB 1MAJA 5EU6A 3FQWA 1JGVH 5HVGB 4LPWA 3FL7A 2GSIB 4GW4A 4O51B 4BZ1L 4MQTB 4E5XB 1OHQA 5DMYA 2VTFA 3QHZH 3FFCB 1WCBA 2HFGH 5HYJB 1CFSB 2E7BA 4NRYA 3U36A 4ONGL 3QO0A 5ESVB 1EFXB 4NO0D 1XIWC 2JJSC 2MKWA 2HH0L 1Q38A 2YPVH 3L7FB 5GRJH 5JHDE 3H7BB 2F53A 4PB0H 3BAEH 5EU4A 3QO0B 4LEXL 5DJ8B 4JG0L 3RBSA 1TNMA 1BD2E 1T20A 4UTAH 1QQDB 3LPWA 1J0JA 2HKHH 5AD0A 5JNYB 3G6JF 4PJIB 4JRWA 1RU9H 1WBXA 2PO6D 4R90L 1RUKL 2GKIA 1NGZB 1MLBA 3I6LD 5I15H 1P4LB 2GSIA 1AHWC 1WIOA 4ZS7H 2AJSH 5KOVC 4XAKE 3ARED 1JNNL 4WNQB 4GBXB 5J3HC 3F65A 1RJZB 1WT5A 4LLWA 4PUBL 4Y16D 1B2WL 1I4FA 5HGDB 3ZT7A 1FRGL 4LLMA 3GI9H 4OM1H 1F6FB 3RX7A 4MDIA 2BMKB 3VMPA 4GSDH 3JUZA 4PLOB 4YDKL 4JN2B 4PRBA 1CGSH 4LAQL 2YR3A 1NC4B 3M8OL 4OLVL 4MXQD 1AQDB 4GAYB 2AK4E 2DLIA 4PS4H 2EXYC 3IFPB 1DUYA 1FE8L 1FVEB 4LEOB 3QXWA 4XCCL 1DVFD 3QRGL 1AJ7L 4GXUM 1JWSA 3NZHL 2J7LA 3RVUC 1KYOK 5D2LA 3OJVC 1OT2A 2WIIB 3QIWB 4RIRB 2HLFC 2YHGA 5D70H 2QR0B 3NCJH 2O5ZH 1KUMA 3SDXA 1IVLA 4TRPH 1SY6H 1I1FB 4F58L 2XN9A 1E4KA 4RAVA 2AXHA 4WHYH 4ETYA 4BFGA 1NFIB 3CZFA 3QIUD 1M71A 3HNSH 3QISA 3S3JA 2OK0L 2NNAA 3UMTA 4KPHL 2I5YH 5L2KD 5T1DL 1MFCH 4U0QB 1JVKA 4G6KH 4GXVL 5ID0A 2FH8A 1BBJA 2ZCLL 3B9KA 1S7QA 3CH8A 3OHXA 3VGHA 3IRPX 5T5NG 4YHYB 4BSVA 4JFDB 2DRUA 1NFIA 2XTLA 2NY3D 3ZSSA 4IMKA 2A9MH 2ORBL 2UWEB 2AXGA 3BQUA 2NY0B 4DEPC 5L0QC 2BOBB 1U91B 2FIKA 4QRPB 5DJDB 1A7PL 1F2QA 5GPRA 5MEPB 1TNNA 4ERSL 4HQQL 4KROB 3BKJH 5K93A 1UXSA 1JGLH 3VGAB 2X4RB 2EE9A 5K59F 1WCQA 1MFBH 4Y7MA 5E8OB 3ZTNH 2NY1B 1XGQB 5TFSH 1AQDA 1JPSH 1X6LA 4CNIB 4NBZB 5F1IB 4XNUH 3R1GH 1MHHB 3SCMA 5DT1L 4FFYH 3IVKA 3T0EB 2BY0A 3OKKB 4NQEE 1J5OL 4NQXA 1BFOA 1Q9LA 3QNZB 3GMLB 4JFEE 4WRLA 3V8CA 5JOPD 2BZDA 4J4PD 2MWCA 1G7IB 2GITB 4S10A 5F7EH 5K33A 3G6JE 4MXQC 5DRNA 1QVOB 3EJZC 2HYMA 5F97E 3WUWG 5TE7H 4OFVA 1OSZB 3RWFB 2BVYA 4PB9H 3F58H 1MJUL 2YEZB 4HW6A 4M4PA 4X83A 5ALBL 4YBHA 3JV5A 2P5WB 4HLJA 4LCIH 3QRFM 2RBLA 2A6IB 2PTUA 3S4SG 1XIWA 5AUMA 3S98A 1Q94B 3AMKA 4PGCA 1U8NA 3EKCA 1IC1A 4RGNB 5CEXB 1DSFL 3I6KA 1QG3A 3G9VA 5F6HI 5DD1L 3HCVB 1E4XI 2YUWA 5EO9B 2X40A 4UUJA 5J6GA 4I77L 3PWNB 2FEDD 3K46A 1GZQA 4LIQE 6FABH 2Q76B 4NYLB 5FM5M 1HXYB 1KJ2B 3ARZA 3HCVA 3QDMB 5FEBA 4YEEA 4RGNE 1ACZA 4TVPD 5C0BD 3WFBH 1MRFL 2UV3A 4OGYL 1U8HA 3DV4A 4G8IA 1ZANH 5IQ9A 1NMCB 3HE7B 3KWWA 1VFAA 4HCRA 4WO4C 1A4JB 4D0DA 1C5CL 1D5ZB 4KJWD 3PDOA 1S7UB 1A6ZA 2MQCA 3W39A 1ZMYA 5KAQG 1GCFA 2F53E 2V2WB 2ZKHL 3OXRA 2VE6B 4WGVB 35C8H 5FYLE 3UJTL 4UTBL 3PWUB 5JR1L 2R2CA 3F7YA 4PJ5A 1UG9A 4MNGA 1UEYA 4RGOL 4LCWD 2MNUA 1RZIB 2Y6SD 3QFJA 2P45B 4OAWA 4XTRC 3GSOA 1SMAA 1SEBA 3OG4B 1VFUA 4RGMB 1KB5A 5EO9A 5HGHA 3ZZ1A 4WFFE 4DEPB 5GZOC 3EOTH 1SMOA 1KPRA 3PDGA 1ULVA 4UAOC 5C08B 3MJ9A 1YQVL 1FSKC 2V5RA 2VJXA 3PL6A 1WWCA 4O9HH 5DHVB 4LMQI 1ROWA 1FBIL 3FRPG 3MRQA 2ADIB 2OBGA 3DUSA 3L7EA 5DC4B 3RWFA 4L4VE 4PYGA 4BKLB 4UIMA 3GHBL 1HHKA 5FYJE 1ES0A 2PW1B 1I9EA 2PYEB 4YO0B 2NLJA 1JPTL 3QZWB 4JFXA 1L7TH 3WN5C 5IJKC 3MRPB 5DSCA 3MRMA 1QFWI 2FH6A 2HRPL 4J3UA 5BOZG 1MCNA 2HFFA 1G0DA 4LNVA 2YWZA 3W9DA 1JL8A 1DANU 1RQ5A 3F7QA 3SDAC 4MA8L 1BFOB 5DQ9A 3S88L 4RGND 5ANMA 1ZWIA 3S34H 2VXVH 4JPWL 4LNRA 5D2NE 4ZUSB 4PGZA 1NGPH 3ZTJH 4JFOA 2P8MB 2ILLA 3WEXB 3DGGA 5EC1A 4NUGL 5F1IA 1PD6A 3F6LA 3OAZH 3F8UB 4Q6IC 3OKOB 1AGCB 4JFPA 2NY1D 3QJFB 1IFHH 1LNUB 2ZKHH 4D0CA 5JW4R 2FBOJ 3UTSB 3FTGA 1P4BH 1KB9J 5ACMA 1I85A 3D6GA 4DUXA 3H9SE 4G9FE 3UZEA 5IT2H 1A1MA 3CCHB 4NQEB 1MHCB 1T3FB 2IGFL 4OM0L 4UT7H 1AGBA 2Z31A 3RL1B 1R3IL 4FABH 1GOHA 1IRAY 5HTSA 1D5BA 3IXAA 3QUZA 3QH3A 5IG7B 1CLZL 4Z7WA 3S37L 1LD9A 1ERNA 3CSPA 2DQUL 3IJHA 2WZPD 1FL6A 4FZ8L 4Y4HB 2VZ1A 3NGBC 3GNML 1DCLA 4JVUA 3WNMA 5IR1B 1FJ1B 3V4PL 1J0ZA 5GSRB 5HHOE 1FCCA 1OARL 4P5TB 1DN0A 5E08L 4CMMB 1H9VA 4S11A 4YDKH 1EVTC 2DL9A 4PJDF 2ZOLA 2R0KH 2XZQL 5IK3B 2Q7YB 4H26B 3S88H 3WFDH 3O3UN 3QSKB 5ALCL 1CGWA 2J8UE 3RDTA 5JIKA 1QSFA 2X1WL 2PO6A 1RJCA 2NR6C 4R7NA 1S7SB 4KJYA 4HULB 2QEJA 2Z0BA 4R90H 5JDJA 3FB8B 5CEZE 1MCBA 2M2DA 3OBAA 5IWLA 2ZUVA 1AQKL 1OGAB 1LEKB 5J4MA 3O4OC 4YHOL 3EDFA 4HZAA 3U7WH 3VH8B 4L5FH 1M05A 4GKSB 1CK0L 3A6CL 1ACYL 3WKMH 3WKML 4EQ2A 4GKNB 5JMRA 4ODTH 1TJIH 2H2PD 1DEDA 4AL8L 2YPVL 4XHJD 4K3DH 3C6SA 3JV4A 4RMTA 4E5XA 1SJVA 1FL5A 4MDIB 4PRHD 4S2SA 3NCYP 5CJOH 3DSFL 3MRKB 4PRAA 4TUOB 3TBYB 3BYYA 4ELMB 4X6CB 2UVEA 5I1HH 4UT6H 3U0PB 4PP2B 3MRDA 1FFOB 4QRQB 1FLRL 3FN0H 5TFSL 4OD1L 4GQ9L 2BERA 6CGTA 1RZJL 5IQ7H 2DQHL 1WC7B 4RGMC 2VLJB 4WVRA 4F37K 4OZGA 1HZHH 4JN1L 4YHPA 3UTZB 5GZOD 2OJZL 2CLZA 5ID1A 3C5SB 4U1HA 3KYNB 4D94A 1YN7B 3WFDL 4AEHL 4JQVA 1YNTB 3INUL 1BWWA 4BA8A 2NQCA 3C5SA 4U1HB 3D9AL 4RBPH 5IW1A 5E08H 1OAKH 3O81A 3GJFB 1KB5L 4GBXC 2XFXA 1TVHB 3NFNA 4FQHA 2D0GA 3MV9A 3FFCA 4MAYA 4KXZH 4UV7L 2C4FU 5CKAA 4HJGA 2AABL 5IW3A 3UTPE 1CE1L 1A9EB 1EEQA 1PSKH 3GSVB 4J6RL 1SVZA 4GO6B 1ZE3C 3DVNA 5DJAA 3IDNA 2XV6B 4B7LA 5EH1A 5GS1A 4PV9B 5LG1A 5BO1H 1FFPB 1X7QB 4KMTL 5J1AA 4JFFA 2XNAA 4TUKL 1C7TA 1NMCC 3HE7C 3MRGB 4QXTA 5C0NC 1YEFH 3BESR 3QIUA 4L4JA 1YEEL 4XP6H 4UINL 3RVUD 2QSTA 3LEXB 3GRWL 1C08A 4LLVB 3OJDB 4HIEA 1ZVSB 3RWJA 4FQCH 1KJMB 2W9LA 3HRZA 2XXMB 4PBWD 1T22A 5C0FA 3IJYB 5I18L 1H3UA 2BNRB 1MCCA 4Z7VA 1BOGA 3ZLQC 3H9HA 1Q0XL 3PIQB 5JTWA 5FA4B 3FB8A 3HMWH 4K7PX 5GHWH 3HFMH 4KVCL 5I9QC 5HHXL 5IBTL 1CCZA 2CRIA 1R5VA 3QFDB 1HQRB 4LBEB 2L0DA 4XNMB 3FO0L 2XA3A 1L0QA 1RIVL 1CVSC 1EXUA 4OZGF 2IBGA 3U46B 2NY4C 2H26B 4M62L 2YA1A 1HKLL 1TJGH 1FAIH 5DHXB 1P7HL 1NPUA 1P5UA 2F5BH 1CFQA 4LCYA 1E4XL