4UT7L

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'ASQSVLTQPVSVSGSPGQSITISCTGTSSNADTYNLVSWYQQRPGKAPKLMIYEGTKRPSGVSNRFSASKSATAASLTISGLQPEDEADYYCCSYATSRTLVFGGGTKLTVVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
molecule tags Immune system
source organism Homo sapiens
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7L00
3KPQA 4X6FB 4HPOH 4QTIH 3OKDB 2P46B 4IHOB 1JZ3A 2X4PA 3ZE1E 3DURA 3JV0A 3HNVH 5KN5A 5DD5L 4M4RA 4KMQA 5I8KL 1ZT7B 2NW2A 1KB9K 2RBLA 4KK6D 3S35H 3B4NA 3QCTL 2QADC 4BUHA 1XCQB 4AIZB 5HD8D 4HT1L 2HJFB 3R06A 3V5HB 5GRJH 4URTB 4YE4H 3FQNA 3TBWB 2AERT 1BQUA 1MIEH 3NA9H 1GIGL 4OLEA 4XCFL 5C08A 2NY1B 4RQQA 4XBGA 1IEAB 2NY2D 1G6RL 4MZ2A 2R69H 3G5ZB 4KKCD 5TDNB 3ZKMC 1I7ZA 5KAQG 5GSRB 5B38B 4KJWD 3ES6A 3SKJH 3CC5A 4K7PL 4WW1B 4PJ9B 2NZ9D 3OKOB 3D2UB 5T1LA 1XFPA 3L3IA 1MWAL 4KRPD 3C5ZB 1YEDA 4JDTL 1IGCH 3G5XB 1B2WH 4JG1H 3L5HA 4GRLB 1C16B 1FAIL 2A1WL 4HWUA 3EOBB 2Z31B 3WDIA 2BVOB 5I75C 1NCDL 4QRQB 4PB9H 1A6AB 2XXMB 2DKSA 1QFWL 3VJ6A 1FSKC 2XG4A 1T3FB 3OKEB 1NCAH 1ORQB 1QKZH 5EU6A 3D85B 4ZFGL 4F15C 3JWDL 1WK0A 1TQCB 1IKNA 3MRQA 2AV7B 2UZYB 2QADB 4BH8A 3RGVC 1N6QH 2YMXL 4RBPK 3TV3L 1OTTD 1ZGLB 3CUPA 4NRZA 5I0DA 2AK4D 3BP4A 5I74C 3OKOA 5T1LB 3D39A 1DVFC 1ZWIB 1OHQA 1RJYA 2XNAB 3B2VH 3EYFB 5IBLC 3RVTD 1MHPL 3T2PA 5B38A 3QHTC 5I73C 5TE4H 2Q7NA 4GKSB 5BS0A 1B0RA 4TN9A 5E6YA 4WW1A 1R5VB 3P4MA 1JGEA 2KZWA 3MLWL 4X8XA 4WTZA 3DTXA 5CSBA 5MEQB 4EOWH 2EECA 1RIVH 2BZDA 4Z7WE 4A2MA 5BO1L 5JUEL 4NZRH 1IGYB 1PX4A 5KSAD 2YK1L 1PDKA 3ULUH 5F9DC 1T3FA 1OP3K 2NX5E 5E5RB 2J5LC 4OCLC 3QXVA 4WJ5A 1REIA 3KPPB 5BRZB 2A9NH 2Y06L 4PGEB 3O6ML 4PJEF 4NQCA 2MCG1 3ALPA 5ELIA 1YECH 2PTTA 4QRPA 2C3HA 4M02A 4HJGB 2H2PD 4GO6B 1VACA 4HZLB 2C7UB 3T0VA 5J6HB 1H0DA 5DD6B 5TDOB 1A6ZB 3P9WB 2RQ8A 1KIQA 2BRRH 2XTJC 4JPKL 1JPSL 4WHTA 2I26N 4MD4B 1FO0A 5ENWB 4WI6A 1AQDB 4MAYD 3QULB 5D70H 4NQXA 3O3BB 1JHKH 4BSVA 4OLVL 3IDIB 4K3HA 1FYTE 2VC2L 1XEDA 2B1HL 5HD8C 3U0TA 5JHDA 4P2OA 5B3JE 3IETB 4M6ML 1D9KC 4K94L 1U2HA 2E6PA 1DLFH 4K9EL 4LDEB 3FN3A 3DUSA 5LWYH 3ARBD 1B0GA 3LKOA 3CSYB 3R4DA 4EJ1C 4OAWB 3ULUL 4OZGA 2NLJB 1UB6A 3KPSA 2MKLC 3NZ8A 1A1MB 5DZOA 1WV7T 2VAAB 3N1QC 4YXLL 5DFVD 4HG4J 4U3HA 5T3XL 1JGVH 1R3IL 3RZCD 1CDYA 4XNYH 5C6TL 1IQDB 5BV7L 5F7LB 1EO7A 5KVEL 1QVOB 3ARSA 4UUJA 5CMAA 5J3HC 5IB3A 1T04A 4RWYH 3LKNB 3VWJB 1QLFB 3MV9E 4FMKA 1FO0H 4W81A 4XAKD 3DVGB 4FQLH 5ALCH 5DJYB 3QUML 1AP2A 5GQBA 1F4HA 4I4WB 2BSSB 3UTTB 1Q0YH 1CLYH 4HAGA 3WKNA 3O8XA 4JZJB 1FE8L 2EKSA 5DMIH 3VD4A 4CRPA 1HSBA 4GFTB 2BCKB 2Q86A 4JKLA 2ZG1A 4RMRA 2V17H 1LD9B 3MO1B 3F5WA 1I1FA 1Q8MA 5EU6B 2VR9A 2ENYA 3QDMA 3WNPA 1K9TA 3LKQA 5CLWA 1HHHB 3RGVD 2IFGA 1GGIH 4NDMB 3IU3A 4U7MA 3K2UL 2NPLX 3N9GH 2UVEA 3FO1A 1U3YA 1DVFD 1VCAA 1XZ0B 3LCYA 3DBXA 1LQSR 2WP3O 1P1ZA 1KTLA 5I18L 3VE0B 5C0CB 1N59A 2X7LB 2OI9B 2V17L 3WD5H 1B2WL 2R0ZL 3OAYH 1ZK9A 2YUVA 2FJGA 1RU9H 1NUNB 2Q20A 43C9A 3OJ2C 4XP4H 1FDLH 2FJFA 2VNCA 5DURD 3M8OH 3OPZL 3IDYB 3T8XB 5I1AA 1INEL 5C0NC 1LO0L 1UCTA 4HH8A 3R8QA 4TUKL 4PY7A 3OX8A 5A40E 4KMTH 2APFA 4G5ZL 3ARVA 2CKBB 4N90E 3TWCH 2CKNA 5F9AC 4NSKB 2VLKE 3SKNB 5FM5M 5CJQL 1MIEL 3CVHA 5J6GA 3S5LB 1AGEB 1HHIB 3QEHB 1BZ9B 4OV5B 1YUHA 2CMRL 4ZS6D 2EXYC 4QRSA 3GB7B 4OCNC 1LE5A 3OKMA 4UV7H 5L0QB 1TTUA 3FL7A 5KS9B 1YPZF 1T5WB 3G6DH 2APWA 3CFDB 3R8BB 4QHLB 4NUGH 5EU3A 3DARA 3QIWB 3P4NA 4QTHA 5FM4A 4OLYL 4P2QE 5FOBB 5LWYL 4M9PA 5F1IB 4AL8H 1HKFA 4ZOBA 3OKDA 5F9OH 1E4WL 1INQB 3ARGD 1FBIH 4WUKH 1RZ8A 5IEHB 1UKSA 4Z0BL 2IFFH 3CXDH 5KS9F 4H1LB 3QCVH 1A3RH 4ZAKD 3L3DA 1P2CB 4KI5D 4YBLC 5F1SA 4AM0B 3P9MA 5ADOH 3GK8H 3ROOB 5I9QB 4NRYB 1I1YA 2PR4L 1ZLSH 4WO4A 4MAUL 2H6PB 3WEXB 5FUCC 3PIQB 1F4XH 4LLUB 2HWZL 4U2YA 5DFVC 4PJ7F 5TGBB 1NAKL 4NP4H 4GG8B 1YNLL 4I18B 4GMTH 3SGJC 3NCBB 3AU1A 5C08D 4PJIF 2B2XH 5A2KH 5C0FA 3ARDB 2BY1A 4U1JB 4PP2A 4WEUD 1N6UA 5CJ8A 5I17A 4K8RD 1ACYL 4Y4KC 3TA3B 3QIUB 4GW1A 1IARB 4XH2A 5EZLA 1UKQA 1F3DH 4NNPL 4UMGA 2WIIB 5F93C 5DJ6B 1FG9C 4GQ9L 1YYML 3DV4A 1UYWH 3G9AB 1I1AA 1LO3L 4NO0D 1IAIH 5I16A 5IBTL 1FYTB 4JEGB 4JDVB 3AXLB 1TVHA 1P7KA 4JJ5B 2ARWA 1F58L 2XA8L 1BD2E 5HI5C 5JDSA 2AVGA 4OCSL 2GJZB 2V2XA 4GW1B 4TVSa 5E6IA 3IS0X 5HPMA 1LP9F 1PW3A 3UPCA 5HYSA 4M3KB 3HE6D 2P8MA 4U1LA 2BFVH 4PP2B 5KANG 3MUHL 4PB9L 1I1AB 2P5ED 4DFHA 5GIRB 3ZYOA 5L9DL 3OR7A 3TIDB 1IGJB 1U58A 3TN0D 1AO7B 1HQ4B 4PJFE 4AG4L 4RGMB 5C8JA 4M7LT 3CFCL 3FB6A 1G7IA 1LHZA 1U6AH 5C9JA 1MHEA 3IAQA 2V2WA 2HLFD 2GJ6D 4NWUL 4TOYH 4APQC 1VENA 3B9DA 1KTRL 5KSUA 3RA7H 1RJZA 2C3XA 3HZKB 1F4YL 1R3LA 5B22A 2OZ4L 4ZFOA 3D6GA 4PJIB 1DVFB 3B9KD 5IJVA 4U3XA 1V3JA 1JRHH 2YRLA 3SPVB 1KIPA 2Y07L 3H3KA 1A7OL 4PJ7B 4QGYA 3JV4B 1K5NA 1G9MC 1QFHA 3FB7A 3T2OA 3MPCA 4LDLB 2JB6B 4YDJA 3ZKNC 2NR6C 2ATPB 3EHBD 2NY7H 1UKTA 2ADFH 3CFIC 3MMEB 3QQ3B 1TXKA 3STZB 4HK3N 5D1ZA 4Z0XA 2P8LB 1BX2A 4U6YA 1OQOA 2AKRB 4JKMA 1F45A 5DRNB 1FPTH 2HAZA 2ZUSA 3QH3B 3D2UD 5J6GB 2OZ4H 1FFNA 3TN0A 3DIFA 4LLMB 1F3JA 1V3MA 4DAGL 7FABH 3EOTL 4KI5C 3GEWB 3IDYC 2EDFA 4QRRA 5D6CB 2VXTH 4QLRA 1IFHH 5F3BB 1S9VB 1TCMA 3QJFA 4JO3H 1J18A 3MRKB 4O2FA 5D2NA 4OZ4A 3CGTA 2XN9A 5GRYA 3HLAB 4ISVB 2HT3C 5JHLL 1J86A 3BPOC 4FG6C 1CGSH 4ZNEE 4Y4FD 3S34L 5KSAB 4GBXA 3MZTA 2NY5C 3B5GA 2BHUA 1JWSB 2GTZB 2HJLA 5EUOB 2O5XH 3I3DA 4NN5B 2R4SH 3ARYA 5MENB 3X12B 1EGJA 1RURL 4MAYB 3MV9D 1CE1L 5FHBH 3GMRA 3HMWL 3LPWA 3VXRA 4XX1G 4WTWA 3VRIB 3TIEA 1ORQA 3B6SB 1HHHA 4UQ2B 1K8DB 4DZ8A 2OJEB 5T3ZH 3VFNB 4BZ1H 2NX5B 1RIUH 2O5ZL 3BP5A 3BE1L 4V1DE 5D1ZD 3TBSB 2GIYA 4IJ3B 2BCKA 1U8MA 1JPFB 2A6IB 3AC0A 1P1ZB 5DDHA 3FQTB 4KI5F 2QR0B 3KXFE 4NQSA 2X4NA 1OGAA 5E8OB 1VGEL 4WY7H 5MERB 2BC4A 3PHOA 5MI0C 1CQYA 3FZUC 5IWLC 1MJ8L 1CD8A 1MCQA 4XRCB 1I9IL 3L95A 1YYMH 1FZKB 4QHNA 1GAFL 5HJ3B 1J12A 5F89B 4OCRL 1CT8B 3PXHA 5BRZD 4JY5L 3HNSL 3ZHDA 4I5BB 1FGVH 4JM4H 4LP5A 3QA3B 3DWTA 4RMSA 1TJGH 1CIDA 5EOTB 4JHAL 2J1KA 1XF2A 1JGDB 1ZEAL 1O5DT 4I2XB 1A1OB 1MY7A 4I0PB 4WENB 3MYZA 1XF5A 5HDQH 3C5JB 1RFDH 2F8XC 1J0JA 5LXGH 3DROA 2DM2A 4PJ5A 5DUPL 1RK1B 2R2BB 4XP1L 4F7CA 2FGWL 3VGGA 3SJVE 5KN5B 5HYQA 4KKNA 2PR4H 4LLDA 3VW3L 2XZCH 4H0IA 1JVKA 1LO4L 4DW2H 1MVFA 2Y1VA 2YKLL 2PCPA 4OLWL 3CSYA 3IFLL 3G6JB 4XP5L 1AQDA 3ZDXE 4L1HA 4BQBA 1S78D 4Z0BH 4K8RL 3U1SH 3BP6B 5FK9A 1F42A 2IBZX 3K8KA 1H5BA 4MQXD 2HWZH 1LGVA 4HEPG 3U0TB 3A67L 4ELKA 3T0EA 2EDHA 4XGZA 4MJID 1T0NA 4FXGB 3WFDL 1MHHB 2VLLB 4F7MA 2FDBP 4Z78A 1ND0A 12E8H 5EU4B 3EO0B 3K4DA 1TETH 2ZJSH 1PG7X 4YDKL 1BLNB 5ADPL 4YHYC 2HRLA 4X0KA 2OL3L 3RY6C 2VMFA 4UTAL 5DI8A 3TWCL 4Y4FC 1JYVA 3HTLX 4G7VH 4OI8A 3OJDB 3U4AA 5DK2A 4PB0H 1BVLA 3O41A 5D7SL 4O58L 4F57H 1F02I 1MFDL 3IFLH 4X8JA 4F9LA 1F2QA 2HT2C 2PCPB 1T1WA 2PYED 1YJDL 2XNAA 3GSVB 5D2LE 1E28B 3SGEH 4ODTL 1CI5A 3TO4D 2QBWA 4Y16B 4XVSL 1FFOA 1IM9D 5JOFB 2VE6B 2FB4L 4XNQB 1QQDB 3LS4H 4XXCC 4P4KA 3FB8B 5I18H 4P59H 2ED9A 1RK0B 4IRSA 3UTQB 3MNWA 3QQNA 4G9DA 5TE4L 3QHFH 1BFSA 3MRNA 1AGFA 5F97E 5IVNA 5CBAA 1MJJA 3ZYJA 5AYQA 1MJUH 4ZFFB 1FNFA 5ESAB 5L6YL 1OGAB 4JHAH 5D2NC 4DKFH 3LEVL 1JNNL 4KKCC 3FT4A 5JHDE 2J88L 3QG6B 1A6PA 3SDDA 3SE4C 5JQHC 4HCRL 1NCTA 1NBQA 1MF2H 4MNGA 2GYSA 4HIXL 2VUYA 3WNOA 1XGTB 3Q0HA 3TBYB 4OJFL 2APBA 1KCRH 3WSQL 5DA0B 2BC4B 4F9PC 1JGUH 2VXVL 4PRHA 4OUUB 4FFVC 4LPCA 3QIWD 4OIIH 3ARQA 5JPNA 3QXAA 3WFEH 4LLYA 5E6IC 4BUGA 1I8MA 4LMQE 3LH2L 3UTSB 3BPOB 1YPZE 4YGVB 2AJXL 5DS8A 1RZ7L 4NQSB 2P5WB 3GMMA 2YD2A 4J1UA 5ICYA 1FORL 4GH7B 1CFTA 2XKNB 1CLOL 4ODHH 3SPVA 3FTGA 2Q76A 2NY0C 4G7VL 4F3FB 4MJ4A 1VFAB 4ETQA 5J11C 3KDMB 3ARTA 1OWRM 1XR9B 1NPUA 3SDAA 4KRMB 3HZVB 4D0CA 3U0PA 4TRPL 3B9KA 2FIRT 1MEXL 5FUCE 4X99B 1B6DA 2ZG3A 1YN7B 5KVFL 2EDOA 4CAGA 5ADPH 2ICWJ 5F7KC 4CADB 1L7IH 4OQTH 2ZNXA 4FTVE 4M1GH 1F97A 4XAWH 2FX8L 3CMOH 3SBWC 4DAGH 4IOFD 4HKXA 3S98A 4ZTPL 4JFQA 2AKRA 1VGKA 4O9HH 1VFOA 4X6DA 1FP5A 3FN0L 3FAWA 4YHLL 4WHYG 1OAUL 4PJHF 2FCBA 4ONGH 3VXOB 2YPLA 2IG2L 4CU8A 1GVIA 5DYOA 3ZE0F 3GO1H 4I2XE 2HRPL 3RX7A 35C8H 5DQ9B 4IEFB 4WO4C 4D0BB 4WTZG 1I3RB 1QOKA 2I9LA 1NMCB 5J57B 4U6YB 4WW2C 2C1OB 2VDML 4HK0B 4N0CC 4F37F 3GHEH 2VXQL 2R9HD 4JB9L 1KIPB 4NM8L 2D7NA 5F96H 1JFQH 5E8DL 4R4FH 2C3VA 2GTWA 4L3AA 4NM4H 4NQDD 4OFDA 4EUPH 3O3EA 3UYPA 2EXWC 1YPZA 4RFNC 3HG1A 3WIHH 2E9BA 3ZTNH 1HEZA 3N1PC 1N7ML 2V9QA 4G6AD 4P9MH 3PDOB 4OD2B 3UDWC 3IKKA 1AE6H 4Y5YA 3WJJC 1CDJA 5IW1A 4D8PB 1EEQA 2VXUL 3A0OA 2LU7A 3ZMRA 3NZHL 3FRPA 4GW5A 4FXKA 3BRDA 1TVHB 4JJ5A 3L6FB 1UQSB 2E27L 5E8EA 5EN2A 2GFBA 3TO2B 3WFHB 3MBEC 4A2LA 3HZYB 4K23H 1KELL 4MX7B 5IB5B 2R2EA 4HKBB 2IQ9H 5DJZA 1IZKA 2ZUWA 3P9LA 2VLME 4E5XB 4NN6B 3IXTA 2YD9A 3QIBC 3V0VA 5INDA 1SBBA 2XQYK 4ZOAA 1ZHBA 1UACL 1UCBL 3S4SB 1XAUA 3BWAB 3IDNA 2PO6C 2FEDC 1KG0B 1WAAE 5LQBL 1KJMB 2AJUH 5HHVH 3MRLB 1A4JB 1K6QH 1SHMA 1RHHA 4MCYB 3VFWA 3QIWC 1P84J 2FWOA 3WFHA 2WWKO 1H5BC 1T80A 4S1DD 5DQJA 3VDCA 4X9HA 1UYWL 2KZ1B 3MRFA 5KAQF 3GMNB 1DE4A 4GAGH 1AFVL 4PR5A 2W59A 2UUDH 2DICA 4GQPH 1ZLVH 4JGJA 4DGIH 2JCCE 4HLZH 4XPFL 1YMHB 4H8WC 5DEFA 4JY4B 4GG6A 3MNZB 3CFDA 3Q5YA 1H3GA 2YPVH 1H8OA 2RCSL 4MB4A 1G7MB 5ADOL 1I1YB 5FB8B 2GEEA 3U36B 5IV2A 1G6RH 4FQXD 4JFOA 4E42A 1U8NA 4HS6A 5EUKB 3LV3B 4YHML 3NIDE 4CMHC 3HR5B 3QDGA 3WE6A 5M94B 3C09C 2ZCLL 1NBVH 1NMAL 4XCFH 4Z77B 1IC1A 1T4KB 1XF4A 2OS7A 4H88L 5AZ2L 1MCNA 1NCWL 4JZNB 4MDJA 4PLNC 3OX8B 3GJEA 5J56B 3D39D 3CD4A 3SKMB 4RBPH 4U6VH 4U6HA 1UADC 5F44A 4PREB 2AV1B 5T1KA 3EIFA 5CD3B 4JFEB 2N7AA 1E6OL 4UV4L 2VN7A 1NGWB 3FQUB 4LU5L 2BOCA 2QKIA 4PRDA 1A1NB 1A7OH 5T5NF 3INUH 1NC2D 4PV8A 1JWMA 2C4FT 3QUKA 4KRPB 5FF6A 2VISA 4WUKL 1KTLB 3VWJC 4KI1A 4OZIB 1P4LB 1F13A 3JZ7A 2D4FA 3MBEA 5C92A 4C56B 4KKAD 4MVBC 3RA7L 1FZMB 4RFOH 3ARGC 1ES0A 4F7PA 4N0CD 3JVGC 1DBKL 2YD3A 4U0QB 2VJXA 3NN8B 3O3AA 4Z6AT 5IW6B 3QWRD 5E5UB 3QDAA 1WWBX 3HC0A 2VDOL 4H1LG 4UT7H 3RWGA 4P46D 1HKLL 2AJSL 3HAEB 5JIPA 3C6LD 3SKNA 4MHHI 4HKZB 1GSMA 2KKQA 2X7LA 2H32B 4HJ0D 3V7AE 3V6FB 4NZTH 5KJRL 2I9TA 4G9DB 5IHLB 1KGCD 5D72H 3ULSB 4FP8H 3NCJH 1H15B 3C60C 3OXRB 1FRGL 1NGXA 2VE6A 1F11A 2VLJD 1GPOL 4X6DF 2EYSB 3GRWA 4HCRH 4WHDA 3UDWA 4XBEL 1FDLL 1M6OA 5IESH 4KZDL 2CDFB 1GOHA 3L5IA 3RWDA 3BVNB 5A3ID 3WS6C 4KUCF 5JW3L 2EKSB 1T1WB 1OD9A 4LRIA 4E0RA 1ZKAA 4MXWH 1F3DJ 2PN5A 1D9KA 4K8RC 1DQTA 1YC8A 2NYYD 3QUMH 1F3RB 2D0FA 3GBNL 4Z7UA 3UTSA 1MELA 3GMLB 4QRRE 4AYFA 3DVGA 3DMMB 3MJ7A 4L8BA 5T5FL 4Y5XB 1IGTB 5EZIH 1KCUH 5DD1L 3V4UH 3PE9A 4KU1A 5BV7H 1TCRA 3U6RB 4UINH 3M1BA 3BPLB 4ELMA 1FVEA 2PO6D 4MD5B 4KXZH 1AE6L 2QQKL 3QEQE 4BFBD 5EFIB 3L5WA 4X5XB 2X1XR 4KZEL 2VIRB 1LD9A 1CF8L 3BUYB 3DXAD 2ZUYA 2VZ3A 1BIIA 3U7YH 5ALCL 2R1XA 5D7SH 2ZP0T 5DR5L 3T77B 4ZUVA 1Q94B 2CLRB 4KROD 3BJ91 4LLQA 3MV8B 4XHJC 1R3KA 2B5IB 1DQDL 2ZOKA 4PGEA 1WFOA 4LVNC 4MNHA 3WS6A 1YNKH 3MLRL 1Z6JT 4WUUE 4ESKA 5CINH 2ZSWB 5JNYA 3QUZA 1X5FA 3B5TA 1AHWB 4S10A 2Z8RA 1NEUA 1PEWA 35C8L 4YDVA 2X9XA 4GAYB 5BMFH 5EU4A 1X5LA 2FSEA 5HGHA 3DXAE 1INDL 1RUPL 2OLDA 2MQCA 2EIEA 5T3XE 1CGVA 2VLRE 3W39A 4PJAF 4JRYA 5IMKB 2NQCA 1A6VL 2DQEH 5ALBH 4PJBF 1CXKA 1KB5L 3WLBB 1MHCA 4TTDC 3HG1E 1L7IL 1R5WB 2CDGA 1S3KL 1TZIA 1RJLB 3H9ZA 4R2GC 4XNUL 3REVB 1OAQH 1BZQK 1CVRA 4RRPA 3DJ9A 3RTQA 5CINL 4NN6C 4TUOB 2XFXB 2CRYA 5ESQA 2NY3B 1BQSA 3ULVF 1CT8A 1QSEE 3ZKSD 3HB3C 1JN6A 1X5GA 1FZKA 2ITDA 4YHIB 5TE6L 3OXSA 1DQLH 1YQVH 5CBEB 2BERA 1X6LA 2DWEA 1YECL 4P5TC 5MHSE 3DX7B 4HUNB 3ARFB 3HG1D 2PNDA 1MAJA 2VZVA 1J87A 1C5CH 1DQML 3U2SB 2V7HA 4Q9RH 3VG0H 1R3HB 3WXWH 2Q6WB 5E8NA 3PL6B 1U92B 2VDKH 3HUJA 3TBVB 3NCCB 3QO1B 2GY5A 4MJIE 3RIAK 1BVKA 2XTLA 4PJ5B 1NGXB 5KG9B 2PTUA 25C8H 3C6LA 1PVHA 2XRAL 3BKJL 3N9GL 4U0RC 4UDUB 3BZ4A 5HGGS 1RJYB 4EIZC 1QSZA 4NC1C 5JO5B 5I9QC 2X41A 3EBAA 1I85C 1FAIH 2A1WH 4G42A 3ZYZA 4WWID 3HAEA 3FN9A 4LKCA 1WBYB 5T1DH 3ARRA 5BS0D 3O3AB 3RWCB 1R0AL 4UQ2A 4RA0C 1NCAL 3VXNB 4WFGD 1UEMA 2XPGA 4DGVL 3PL6A 2NY1C 1NANH 4IRZL 4XXDA 4P59L 3F8UB 1L6XA 3LS4L 4U2ZA 5CD5C 2X5PA 4JG1L 3ESUF 1IGCL 1UWEL 4OD3H 2OQJB 5ESVA 5KSAA 3HMXL 2O61A 4XPGL 4EN3C 3NPSC 4FA8A 3OR6A 1WBXB 1WC7A 5F7YC 4OLUL 2VLJE 4NHCL 1G7LB 4K55A 2O93L 4JQIL 5E56A 3WN5C 1CGWA 2W0FB 4S1QH 2R0LL 4K9EH 4V1DD 2Y23A 3BI9X 3VRIA 1Q9KB 3TBWA 1ADQH 1A3LH 1A9BA 5I66B 3NA9L 2EDLA 2FD6L 1NC4D 1MFNA 4HK3J 4OZ4B 4YBQD 3ZE2F 5BXFA 1YC7A 4PP1D 43CAB 1MI5E 3JBG7 5GS1A 2XI9A 4Y19E 3MLUH 1XCQA 1X5XA 3TPUB 1PD6A 3TT3L 3C60B 5FUZH 1OGAE 3HPJB 3PV7A 4NQCE 1PKQA 1MY5A 3LIZL 2JB6A 3Q48A 4YDJB 5FYLD 1YDPB 1J88A 1AO7A 4Q0XH 4C4KT 4ZFOL 4GLRI 2QQNL 3GSQA 3RRQA 2WBJA 3ULVH 1MJ7H 1UG9A 4H88H 1RVFL 5I8OH 3GNMH 1NGPL 1FZOB 5HYJA 3CVHL 4MNHB 4XHQA 4NO0B 4QO1A 4FS0A 2EDWA 1FFNB 4HKJB 3TN0B 1J8HB 3MFFB 2X4SB 4LCWE 2YKLH 2LU4A 2XIDA 1U8PB 4C4KO 5BO1H 1T7YA 5GS0D 4HIHB 5D71H 2ZNWA 4NT6B 4UOJA 5D1XD 2XN9D 3EKCA 3MYJB 1PYWA 1I85A 4DGYL 1CFVH 1P4BL 4JFEA 4PGDA 3PXJA 1I3GL 1NH6A 1MUJB 1NUFA 1T7WA 5I1CL 3VXUA 4J8RA 4QXUH 4WVRA 4YO0A 1Z3GL 3B2VL 5HGAB 4U6TA 4DUWA 3S96A 4X80L 3DXAB 3VI4F 1NCBL 4HW6A 4XVTH 2WSKA 2KL6A 4PPTA 3IU4L 4MJ6A 4M5YH 3GIVA 1SY6A 3T1FA 4OT1H 4A6YH 4JG0H 4FFWD 1CR9H 1OPGH 4H0HB 1QLEL 2BVUA 1D6VH 5INDB 1OAZH 1S7TA 4HFUL 3RWDB 4ZAKB 4TVPL 1D5MB 1KCUL 3BH9A 3V4UL 3D3VE 5DEFB 2R2EB 1KG0A 1Z0NA 2FBJL 3VFRB 2VOTA 1OARH 4Q6IC 1IC4L 2NY0B 1CGUA 1QSEB 5DQJB 4RNRB 2DQJL 2ZUTA 1C5DB 1UWGH 2J6EA 4GQ9H 1SBSL 3S35X 3BDBA 5F7UA 4GRMB 4KZDH 3ULUD 5FYJL 1DR9A 1MLCB 4LLVA 3BZFB 3PWJA 1EGJH 4N0UE 4PIRF 5D1QC 3BQUD 4M5YL 5ETUB 2ADJB 3IJHA 4P9ML 5L0QC 3MLXL 3NCJL 5FKAB 4UT6H 3ZKND 3HAEH 5BVJA 2YWZA 1CE1H 1G6VK 2R8SH 1EZVX 4IMLB 5F7EH 3CFEA 5BOZG 3FFCA 3FOLA 5I1IH 3T1FB 3VD9A 2MOVA 5IMMB 4MJ6B 2EYRB 2F15A 1T20B 3HPLA 1EX0A 5E95B 4KQ3L 4V2BA 1D5MA 3BH9B 3QUZC 3TYFA 2QL1A 1RD6A 4M6OH 4KKLD 4WWKD 3H9YA 4JO1L 4JHWL 4RFOL 1LDSA 2YD6A 1P2CA 4MA8L 1EIBA 4KH2A 5HTSA 4I48A 1NGPH 3RVWC 1KLFA 1NDGB 1MCPH 4K3JL 5HBBA 2D31A 3L3JB 3OGOE 5GSVA 1UC6A 4P4RB 2D7TH 1WWCA 4G6KH 1Q72L 3ZDXF 4OLYH 1G84A 4I18A 1I9RH 3BIBX 3E8UH 4HAFA 2C3WA 2VDLL 4ZOEA 2DLGA 3QWOA 1CLZL 1MFCH 5D5ME 3V4PH 2OQJA 1AHWC 5ESVB 4EUPB 4ZS7H 3BMWA 3OAYK 1YN7A 2ICCA 2PW2B 3EAKA 3DBXB 3BGAA 3CZJA 1WT5C 4HWEL 1WTGT 2CKBL 3CLEH 3P2TA 4LCIL 1YY8B 1G9MH 1JTTA 1S5HA 3AUVA 1MCKA 5C70A 1B6UA 2CUMA 4OF8A 3O6LL 3MODL 1TFHA 1FJ1A 3O11B 1WAAA 1X5IA 4PTUB 4L4VE 5K33A 3W2DL 1LDPL 2EZ0D 3QDGE 2X89D 3RJDA 4XP4L 1I1AD 2R23B 3L3JA 1KJ2L 2D31B 3C60A 5SWSE 2PYFB 4Y2DC 3WFEL 4XVJL 4CNIB 3CH1A 4QOKE 4OV5A 2VLJA 3TVMB 1OTSC 4Q2ZA 1II4E 2DWDA 3HS0A 2AABH 4QXWA 4P5MB 4I77H 4MWFB 2DQCH 1OP5H 2G9HB 4D9RE 3QUYD 3LKQB 4QHUA 5TFSH 4P5KB 1PLGL 3IFOA 1JPTL 2LVCA 5E0QA 4FQQB 1FNEB 1UJ3C 2IANE 5FKPB 3ROLB 3S37H 3ZE0E 3QT2A 5HYJD 5KVMC 5CEYB 3KHQA 3ARGA 3LN5A 2VL5B 1I8LA 4GSDH 3MV7D 3H7BB 2NY6C 4DFIA 1MJJB 5GPRA 3TPKA 2HVJA 2C26A 3MOBH 1AGFB 3ARXA 4HBQA 4QCIA 4RZCA 5EORH 3VWJA 1ZXQA 4M6AA 1CXFA 1RULL 1OPGL 2CLVB 2JIXA 3EYQC 3ZT5A 3QXUA 4N0RA 4HIIA 1RMFL 3WIHA 2Y36H 3O8XB 2IMMA 3RU8L 1P9MA 1EFXA 2C3VB 2GTWB 1MCBA 4G8GB 1A64A 2F74B 5HI4C 1E28A 4G6MH 5JXEA 1I4FA 4M61B 1P6AB 2E3VA 3OG4B 4RMTA 1FFOB 3KPMB 1NBZA 2Q8AH 1DANU 2BSRA 5L7XH 5DQ9A 4K7FB 1YQVL 3AREB 3HPJA 4K94H 2XXCB 1A9EA 3QUYA 1DLHB 7CGTA 3PWVA 4CDHA 1J8HD 1ZLSL 5D71L 5CJXA 5I2IB 4W68A 2VDMH 5T3ZE 2VZUA 1BGXH 3CLFL 3IJYB 4ZXBC 1Q9KA 3O0RH 3FOMB 2H1PH 4YUEH 2P24B 1FFRA 2BRRL 4JPKH 2EDDA 4R7DB 4P23A 1KCKA 1QP1A 1MVUA 1R5VA 2N56A 3KHOA 5IK3B 5F9OL 5F8QC 5DRZB 4C56E 4X6CA 4WEMB 1R5WA 3B9KB 4LEOA 4HJGA 1UT9A 4HUKB 1V3LA 1CD1B 3X14B 3RVUD 4XX1E 2CXKA 4AEFA 4UV7L 3UAJC 1I7UB 1Y6NR 2VZTA 2EH7L 3EFDH 2YPKB 4X5WB 5J6HA 5BW7A 5MEQA 4PJGF 3GMMB 1HE7A 1V7NH 2P5WA 3QQ9C 2QADD 3T08A 2OP4L 1EJOH 1L9NA 4OF7A 3TYGH 1WT5A 5LXGL 1I7RB 1FQ9C 1FVDA 4MA3A 3RUGE 5FUOL 5BS0B 1V3KA 5C2UB 1ULVA 4OIAA 1YDPA 2RB8A 4ELME 3C8HA 4M93B 1UB5A 4NNYB 3I02B 4GRLA 1NJ9B 2YEZA 3GSWA 4LVNB 3JWOL 1T22A 4QRPB 4H20H 1JGDA 4NJ9H 3MA9L 4YHKH 3BDYL 2NX5A 4RAUB 5GISL 4PRPE 2DL2A 3HNSH 5GGUA 2H3NB 3KR3H 3RZCA 4JY5H 4I5BA 5IMOA 3WIFB 1I4FB 1WVZA 5BZWA 1BOYA 3F7YA 5EWIL 4OB5H 4JRYE 3RI5F 3RFZC 4HFWA 2YPLD 3BUYA 3DETC 1XH3B 3C6LC 5T1KD 3KPNB 4JO4H 3P11L 4HPYL 3CFJB 2NMSA 3O6KL 4OKVA 4NJAL 3G5YA 3NTCH 3G6AB 5ICXA 5C0IA 1T2JA 3CU7A 4OFYA 3MRCA 4JDTH 3CPLA 2WLYA 4Y16D 3UTQA 3D39E 3VXMB 4XBPB 3FHAA 2DDQH 2ZKHH 3GSRB 5ISZD 4DN3H 5K9KA 4I77L 5CEYA 3VJ6B 1UVQB 2BVPB 4FN0A 5KJRH 3RBSA 1IKFL 2FX7L 3ZTJH 4Z9KB 5A16A 3RTQB 3BEWA 3DLQR 1C5BL 1C16A 1AXTL 5A3IC 3REVA 4MB5A 3E2HC 2PXYD 4RAUA 3VWKA 2HVKB 4WU5A 3RAJH 1KJ2H 3S3SA 3AS1A 1LNUA 3PP3K 2X4RB 1X5YA 2VDKL 1FLRH 3GSNA 4L4JA 1TJHL 5DGRA 2ZCKH 3OXSB 3ALXA 1SVCP 4G80A 3EFFB 3GHBL 4YDLC 4LFHG 2BVQB 5JOPE 1U42A 2GK2A 3NCYS 2B7DT 4LASH 1GOGA 1L7TL 1C12A 1M7DA 4IOSD 1AGBB 5D5MA 1RQ5A 4ZXBD 5EU5B 2OK0H 3WFCH 4UIKH 4LPYA 4M6MH 2XV6B 3DIFB 4LLMA 2AJ3B 3TJEL 2COQA 3WE6B 4JFHD 4ZPVA 2YS4A 4KDTC 5KOVC 4FXGA 4ERSH 2A77H 5D7IB 4QHKJ 2DQHH 1S9VA 1YEFL 3PWVB 5DZNA 4Z0XB 3DX9A 1YN6A 5IK3A 1I7TB 4H26A 3FQNB 1R5IA 1R3KB 5E4EB 2OMNA 1QPXA 4LEOB 1JZ5A 4JDZA 4YZFE 5IJKA 2Y07H 4ODSL 2GJJA 2EIZA 1NCWH 5E5MA 4PD4K 1RZKH 1H3WM 1CD0A 2YWYA 4KWUA 3JUYA 5KBNC 5D1QB 5TF0A 5IHUH 5T33L 2ZCLH 1MAMH 1NEZG 3QZWB 4HC1L 4JAMA 4QHMB 4X5WA 2R0KL 4XP5H 2H1PL 5ID0A 4GRWF 5DC0A 3OB0H 3ZKXC 5F9WB 5D7LB 1OVZA 3D25B 3P77B 3U4BL 3C09B 4ODBD 1NGYA 4AG4H 4RA3A 3MMEA 3QQ3A 4ONFL 3EYSL 5IVXB 1DN0B 5EOTA 3PDGA 4G8EB 1MSPA 2PETA 2DQIH 3HI6H 5DURB 2VXSH 1AXIB 3RWIB 4WUUA 5DSCA 5L2KE 5M7QA 5LGJB 1AR2A 5IBUG 1WWAX 1P7HL 5I15H 1OP3H 5FA3A 4P5MA 2ED8A 5FCSH 1T1YB 3D9AH 1CDCA 4HV8A 4LF3A 2X1QA 3BT2H 5LBSL 4NQVB 3CH1B 2AGJL 2EZ0C 2F53B 1HZHL 4F58H 1MQKL 4LL9A 4NBXB 4YHZL 3MCG1 1J05A 2GI7A 5IP4A 3LN5B 1U95A 4PR5B 1N4XH 3LMJL 1NCDH 3RWGB 3SE8H 5EDXA 1H15A 3OXRA 1BEYH 3ROLA 3DO3A 1QFWM 3GMRB 2F74A 3E6FB 2HKFH 4CMMA 1ED3B 1ZAGA 1HINL 4QRUB 4PJBB 1KACB 1DBBL 4LHJB 4AY0A 5T3ZL 1DBAL 5CILL 4LCWB 2XN9E 5CSGA 2JJSA 1T03L 2AABL 1XF3A 1T21B 2YPLB 5HHOE 4E5XA 5DEGB 4G8IA 2PXYC 2BXZA 4JFDD 3W11C 4E41A 1L9MA 2R39A 3UBXG 4LSTH 1CFSA 1J0YA 4RCAA 5CD3A 5GRJL 1NAMA 3MV7A 2R56L 1X9QA 3U4BH 1UM5H 2VXQH 5D5MF 3MODH 3SDYH 4PV8B 1DSFH 1T5XB 2DD8H 2G5RA 4Y5YC 2HRPH 2EDRA 5FXCH 3T04D 5INCA 1FCGA 1UM6H 1CLCA 1ZANH 2DAVA 4LIQL 5IHUL 1VEMA 5LVEA 2VDNH 5J13B 4MAYC 1KN2L 3A6OA 4EN3D 5C0DB 2XWTA 3ULVD 3OF6D 2AQ1A 5HY9B 3QO0A 5IFJA 5IB1A 3QXDA 5L88L 2OI9C 5DYOB 4FG6D 4NUGL 1ZSDA 5LGHH 3P4NB 2A74A 3G6DL 3QG7H 3QI9A 5BV7C 1RJZB 3W81A 1Q72H 2R9HC 5SWSD 1U41A 1JRHL 1U8LB 5F1IA 1MEXH 1JP5A 1YY8A 4JVWA 1Z0MA 1MIML 1FSKB 3NOIA 2H32H 5T1MA 5E9DD 1UM6L 5IM7B 1PQZB 5GGRY 3ALWA 1JV5B 4MA8H 2R0WH 3LD8B 1T5XA 1J1PL 5CLTA 1U58B 2DD8L 1L7TH 1K3ZA 1FL6A 5I1DB 1I1FB 2PYEE 3WN5B 3CFEB 5C3TA 3RDTB 4DEPB 4XP6H 4JHZA 4PJDA 3ET9F 4PY8J 2W0FA 4CUCA 3D0VB 2LFGA 3IJHB 1UWEH 4LSUH 2R0ZH 5L9DH 2Z0BA 2PO6B 4I3SL 1WFTA 1JHTA 3MQIA 4OIIL 3U48A 3UZEA 3O8XD 1IL1B 3GBMH 1S7SA 5E2VL 3SDAC 1BIHA 5DD0H 4L3EE 3EDJA 5DJZB 5DJ0A 2B39A 4ORZC 4KHXH 2XY2A 3P4OB 4KJQC 4Y5VB 3U36A 5IV2B 2M8XA 4RGNC 5MEOB 4OSUH 1AIFA 4ZUSA 1BD2B 4Z7OE 2ZUXA 1CFNA 2HKFL 5E9DE 1FE8H 4Y0GA 1OARL 2JJTA 1WICA 5LGJA 4FQLL 1KPUA 4N8VG 3ME0A 3BGMA 3ILQD 5EOQL 5J12C 3FO9B 1UZ6E 1WAAF 2HN7B 4KY1L 4JFFB 3K0WA 4HFUH 2YRZA 2DMCA 3TH2T 3OJVC 3NZHH 2QQQA 2AGJH 3OQ3B 1OW0A 3C9NB 4A6YL 4LIQE 2Y5TB 4JKPH 4WW2F 4EBQH 2A6KB 5DHYA 2RGSA 2F54D 4AMKH 4HUXA 4I18C 1IC5L 4WHTB 2FR4B 2E6QA 2JJVA 4Q9RL 4J8RB 2ADGB 3KLSA 3CDCA 1U95B 3QO1A 2DJ4A 3FRUB 4Y16A 5I1CH 3QJHB 1NAKH 4NP4L 4FQJL 1J8HA 3MFFA 4ZFFA 4R4FL 3RL2B 5GRZA 5DJYA 1QFPA 3UBXI 2O5YH 4KVCH 1RZ8B 4P4KC 1CD9B 3EFDL 3QHZH 2ICES 3RZCC 3VD5A 1IQWH 1SJHA 1CDGA 5E5MB 3HE7C 2CSPA 2DQGL 2YD7A 4K07A 4KROC 4Y4KB 3IETA 4YQXL 1PKQB 3D69B 4LRNH 2EICA 3M17A 2XQBL 3RWFA 4LPWA 4JCLA 4MDIB 3IAGC 1OAYL 1BQLH 2X10A 2Y25A 4M7LL 1S9KC 2R29L 4CU7A 1WFUA 2WLZA 4PRIB 3SGDH 5IFAH 3JWDC 3D39B 3RY6A 3VXME 3L7EB 4LOUD 5GRVK 32C2A 3G5VB 4IRJB 3ZYIA 4CVXB 2HT2D 3VFVB 2XKSA 2X4SA 2HFGH 1B90A 2A77L 2Y72A 3OB0K 3FO2A 3FMGH 2IBZY 1IGIL 4N8CL 3QZWA 3TFKD 4GG6F 4C57C 2JK5B 5ERWB 1RUMH 1A7PH 1SJEB 1YEIH 3QYCA 4CL7A 4KVNL 3O9WC 1G7QA 3NABH 5JA8B 3K74B 4LSQL 3CZFA 1LO0H 5BCAA 2ZUUA 4QXTA 3GHBH 1XZ0A 5FO8A 1XGRA 3G5YB 5HVHB 3GIZH 3HUJE 4CADA 1T1XA 1G6RA 3KPPA 5I6XC 4L8CB 3CUPB 4NRZB 3V6ZB 2LE9A 3BX7C 3KS0J 1FGVL 1F4WL 1F4AA 4PJCB 4X99A 3EDFA 3MRCB 3QAZC 5GSRA 3ZLQC 3EYFA 3KXFB 5JIHA 5EC1B 1MRCH 1QKZL 1EXUB 2HYMA 4ZS6C 4MAYA 3SE3C 4MS8D 4DGVH 3F58L 3W82A 2WAHA 2VITB 1JL8A 3X17A 4M7KH 2YRPA 3TESA 3FT2A 5SWZB 3V52L 2B1AL 5J13C 5TF1L 5I0ZA 5F3HA 2BVOA 3GJFA 3WHXA 1MFAL 4PTTB 1G7JA 4I2XA 2J88H 5BJTB 1RK0A 2X4RA 3EJYC 4K7PH 1TNMA 1F00I 3GIZL 5GGVH 3NTCL 2R1WB 1RI8A 1HIMH 3QCUL 3MROB 5F1NA 1FRGH 4TQEH 2H26A 3EOBA 4HDIA 5HSFA 5FO7B 1RIHL 5DJXB 1CZ8H 2MNUA 1U8MB 5E00B 3TZVB 3DOSA 4BFGA 3GBML 5HJ3A 4OZGB 5E1AA 5DTFA 3L95B 1NBYA 5IOPA 3GI9H 4Y1AA 3WO4B 3RGHA 5CP3A 4RX4D 5E7FA 3U9UA 1CGXA 5CUSL 3V6ZA 3HR6A 4YX2H 1BJMA 2HMIC 1WZ1L 4XB8A 2AXGA 4BJLA 4RFEB 3L3KA 2R15A 1MPAH 3VFVA 1JI2A 2YA2A 1WGOA 2IF7A 3IYLW 3QCTH 4LLAA 3DX7A 4PJ9A 4W6WB 4IM8A 2OMBA 2NY3C 3ZKMD 3KYNB 1AH1A 4UTAH 1V7NL 1JUFB 3DO7B 1CD1A 3X14A 2UZXB 3O2DL 5KVGL 4GRWE 4PJ9C 2GK0A 5KSUB 2GW5A 2D0HA 2IADA 5J11B 1ES0B 3DHJA 4R26L 1F6FB 4QRRB 4OFYD 5KSBA 4G7YL 2VWEC 2GTZA 3PWPB 5B8CA 4LHUG 1E6OH 4UV4H 2QSCL 4NRXB 4P48A 3MGTB 5C0EB 2LTQB 5IMLB 2CLZA 3LHPH 2NY4B 4L9DA 1KYOK 2QLVB 3CX2A 4N0UA 5CWSB 1FVDB 4MA3B 5SX4I 5CIPB 5CP3H 1VERA 1BBDH 1CU4L 5CBEA 4NO3B 4GAJL 4Z7NE 5EULV 5DFWH 4CDGC 4P5TD 1JNHB 3ARPA 4YQXH 2EXWD 1JIBA 4KUCD 5D2LA 2EO1A 2DQGH 3ZDYF 2OXGA 3OSKA 5D7JB 3BISA 3CLFH 5DF0A 1IJ9A 3VRJB 4GXVH 1CCZA 1RZIB 5GS0L 3U6RA 2KQMA 2AK4B 5DT1H 5EB9A 4GOSA 5KVDH 1QBLL 2CK2A 3CFCH 1Z5LA 2PUQT 1YEJL 4JFYA 3BKCL 3MV9A 2FRGP 4EI5C 1C8PA 4D3CH 4WI3A 1F90H 3QEUB 2Q8AL 4XWGL 4PGCA 1BIIB 1PGRB 2JIXB 1P53A 4M1CC 3RPIA 2BOBB 1SYVB 4I0PC 1VKXB 1UJ3A 4QF1B 4HJJH 1KN4H 1IGFH 4Y8AA 4W6XB 3IJYA 4IOFC 3PQYE 5BQ7A 1AHWA 3TV3H 3QNXA 3RP1A 1RMFH 2VLRB 1AR1C 3CDYA 3T0EE 4PJEA 5I2IA 3KLHC 1XGUA 4NZJA 4X4YA 5D2NE 1E27A 3ARBA 3BFOA 3B9KC 2Q8BH 1QNZL 4P99A 2EIBA 4JVUA 3I6LE 4K7FA 1I9IH 5SX4H 2PYFA 2Q7YA 1KN4L 4W70A 3F7RA 2PF6A 5E2VH 1JI1A 4YAQA 3KPSD 4PJDB 1IAIL 1K4CA 4XWGH 3CDGB 1KV3A 1HZHH 3TP4A 3P0GB 4ZSOA 3T3MF 1BAFH 1OAZL 5J1SC 4X6BA 3UTSE 1QLEH 1BQHG 2X6MA 4Q6IB 3RX5A 5LBSH 4PJAB 4QHUB 5F9WC 4EXPX 4XBEH 2P5WE 2B0SH 3D3VD 4NUJB 2I60H 4TSAH 3WFBL 4KV5E 4NFBA 3IDUA 4D9QD 5L2KD 3K7UA 2ZSVB 1FJ1B 2KQNA 4WHYH 1R6VA 1TZGL 4OD1L 4PLJC 4V1DA 2AJYL 5CZXD 3TN0C 4WI2A 1IM9B 4YH6A 3LEYH 2IGFL 4JRXD 3JTTB 4PJGB 3CFKB 4Z7VB 3TJHC 2QJDA 4GMTL 2H8PA 5D1ZB 3H7BA 4EXKA 3E6HB 4CJ0A 3UTZA 4J3UA 5KSBE 3BOVA 3KNBB 4Y2DB 1CGSL 1ZA3A 4PV9B 4UT7L 5C0FB 1M7IB 3SDDC 3SE4A 4EUPA 1IVLA 2D0GA 5C0JA 3QUXA 1FVCA 5SWZE 5JXAL 1QACA 3SY0B 4C58B 3VA2C 2D3VA 2R0WL 4NFCA 2BSTA 5CSZA 2R0KH 1PZ5A 1EUUA 1T2QH 4J12A 4RMWA 4O5LL 1KJ3H 4NYLB 4OZFG 3MLTB 3PJSA 4KQ4L 1UXSB 3ECBA 4LEXH 2PW1A 3OKNB 5SWZD 4XI5C 2X4TB 3SCMA 5D9SA 2FHCA 3HPLB 3SDYL 3RX8A 1QO3B 1XGQB 4R8WL 3E8UL 3OKKA 4ZDHB 3HR5A 3TBTA 1VADB 2UVFA 5B21A 3ZSTA 4HMCA 5C0AB 4QEGA 1EPFA 3LSOB 2NR6D 5EBLA 5IGXL 3S3PA 1A7QL 5GJSL 4LCWA 2XACC 1U8NB 2K1MA 5EUKA 1CZ8L 1DBMH 1J1OH 3OR7B 1OAXL 1ADQA 1MRDH 2BOCB 4ORGB 5TQ2H 4TSAL 3WFBH 4FTVB 2B0SL 2Z8WC 3OAZK 4U1HB 2Q87A 2YHGA 2AJXH 4WU7A 5HPMB 1W0VA 4X4XB 3C60D 1EEYA 5EO9B 4IOIA 3LPFA 3O2WL 4QWWD 4ZAKA 1H3UA 3BZFA 3MJ9L 3QDME 2W65B 4Z77A 1QLFA 1NMBL 6FABL 2FX7H 1MCDA 2IPUK 3AVEA 1KJVB 4FQXB 3VFRA 4BFEA 4DOHB 4M00A 4MQ7A 1N0XL 5K9QG 4UT6L 2GSGA 4IIQB 5LQBH 1GGCL 1EA9C 2JB5L 4Z7NF 3QXAB 1C1EH 1SMAA 3BAEH 1QFWI 3I75A 3LS5L 4L8DB 5DJCA 4QXGH 2DQTL 4UNVA 3SGEI 3ULUC 5E2TH 1U8IA 5CJOH 2FYYA 2VAJA 3HRZB 5E8EB 4NQDE 3BQUC 4MA1C 3SGKA 4N0YH 2EYTA 1IGFL 1QSFA 5GZND 4HJJL 1T66D 1MLBA 2YPLE 5HHOB 1MJUL 2E9IA 3FO0H 1A22B 1FIGH 3UJTH 3RPIB 1JF5A 2FATH 4OCWL 2EDEA 1UQSA 4WI4A 4QYOA 5J89A 2E27H 4RX4A 4P57B 1N8ZB 4AQOA 1GCFA 3VXTB 5IQ7H 2FBOJ 2OL3B 2VLRA 1ZHLA 4HWBA 1IAKB 5ID0B 4BK4A 3GBLA 3WHE1 4G6FB 4WNQB 5H37G 4XMLL 4ODTH 5DLMH 5J9PB 3QQ4B 4XVUD 2CGRL 3E6FA 4TUJB 1VGKB 4WV1A 5IT2L 1RZKC 1JWUB 4UNTA 4F57L 2BNRA 3DX8B 4OM0H 4Q6YA 1A02N 4K7PY 4G8EA 2DQIL 1X7QA 3TA3D 3MYJA 4JREB 2XY1A 2YD1A 3P77A 1TPXC 1NFDF 5CZVH 2NYYC 4LVHC 5HDOA 1Y18B 2HFGL 4XCCH 3PGCA 3DHMA 4D0BA 2HFEA 4KAQL 3QDJB 2JIXD 3WNLA 1QSED 1YN6B 2CKBA 1FZOA 3I2CL 5HYJB 1ZT1B 3MUJA 5F72S 4QHLA 5EU3B 5H2BA 1EEZB 2GK0B 1M7DB 3WFDH 4XPTL 1UB6B 3KPSB 1MUJA 4N0UB 2AJ3A 3LDBB 2GUOB 3GB7A 3TO4A 4LQFL 2DLHA 4K8RH 3U1SL 3V5KB 4NGHH 3DRTA 2YXFA 3I9GH 3J8F7 4OZHE 3QBTB 5KSAC 4OLWH 3VH8A 1A6ZA 4Y4HB 4UB0L 3P9MB 4P2OB 2HA1A 4BZYA 1WJ3A 2DRUA 3QIBA 4PJHE 5C1MB 1A6WL 2F8OA 2G5BA 5B4MC 4JRXB 3VXSE 5C0RH 1AD0B 2OTWA 3QUXB 5IB4B 2HTKD 1RFDL 5L8KB 4WWKC 4ZMAT 4U1GB 3D3VB 4IS6A 5SX5H 2YN5A 1FL3B 3FO0L 4J1UB 1ZEAH 1YEHL 3QCUH 2X05A 3S7GA 1HILA 4X6EB 5IUSA 4G6JH 3L3IB 5AZEH 1EHAA 1ONQA 1TJGL 5IJKC 3RU8H 4TULH 1HDMA 4JRWA 3F7QA 3SCMC 3WJJA 1I8MB 1LK3L 4GMSH 3NCEB 3DSNA 4Y1AB 3RAJL 2ZUQB 3LS5H 5E6ZA 4LVEA 3U0PB 5BZDA 3NFPA 3LZFL 2VZOA 1PEZA 4IRZH 4JPVL 5GGTL 5DMKA 1R3JA 1NKRA 3H42H 3FT2B 4M5ZH 5SWZA 1IKFH 3MZGB 4I9WD 2VQUA 3IRZA 4XC3H 4PJAA 5CIPH 4MD0B 4BKLB 1Q1JL 2AXFA 3Q6FA 4R4BB 1L0XA 3L3OA 1PG7W 3I6KB 3KR3L 4RMUA 1GZQA 1F8TH 4G80B 4X8JB 4Q9CA 1ZHKA 1N3NB 3VGAC 5DMIL 1EVTC 2YC1B 4C54A 2MPAH 2NY1D 4MNGE 3ARFA 4G6JL 2APVA 3SOBL 1ONQB 3QRGL 4IBLT 3LKPA 2AK1L 4AIOA 1KJ2B 1DUZA 1HXYA 1G7HB 1FL3A 5IVXF 4PJEB 5FHAL 3VWKC 1CG9B 2HH0H 2YUWA 4BFIB 3BWUC 4UDTA 4Y16C 5C0GA 1X6NA 1MCOH 5DRXA 2DWEB 1NLBL 2VERN 4XT1C 5JMOC 4FQHA 4GXUM 4NQXB 3BUTA 3O81A 3U46B 4YWGH 1J0IA 2LVEA 2J6EH 2JK5A 5CAYB 5IHBA 5I1KH 5JHLH 2Q6WA 4PP1C 3WXVH 4I9WE 1GGTA 4LNVA 3CZFB 3O6LH 5AEAA 2DLTA 3U0WL 3UYOD 2MQ0A 4M93C 2CR3A 1VSCA 1PKQE 3KJ6H 2F5AH 5D7KD 5MEND 3TZVD 1CTNA 1G9ML 2MQ3A 5AWNH 4LQFH 4O2CB 1KCVL 3MNWB 4OZFA 2HLFC 3PQYB 4AIZA 2AQ2A 3QRFM 4J7RA 2HP4A 4TUOA 4XBGB 5GS0C 1A7NH 3TNMB 3STLA 1JNHA 3VI3F 3MRIB 2NZIA 4OF0A 3MV8A 5EH1A 4KHTH 3VGAB 4JM2F 2W9EL 1S8DB 4L9LB 4P46B 3RHWF 1PZUB 2J5LB 5HGBA 4I0PA 4G6KL 3MRHA 5CFHA 3JVGA 3OGCA 5JNYB 4TTDD 5AZ2H 1D5ZA 3BP6A 5FK9B 2VLRD 4X4ZA 4KC3B 4PJIE 4JFXB 2VDQL 2P5EB 2BRQA 3WDJA 3H9SD 1F4YH 3X3FH 3C8KB 5T3ZD 1S9WB 2HG5B 3B3IA 2YK1H 5DD3L 4O00A 5E4IA 1CXEA 5I1JH 3NH7L 4MJIA 4EOWL 5BRZE 1CBVH 4G6FD 3H2WA 1RZGB 3RVXD 1UH2A 1FV1A 4QY8B 4JREC 2WV3A 3B9EA 3SCMD 1AXSB 3RKPA 4ZUTB 1N4XL 3LMJH 3SE8L 4DUVA 2BVEA 4FQQA 3FJTA 3T3ME 1S7UB 3WYRA 1I75A 1SJEA 5F6HJ 1MCIA 2CIKB 2YUZA 1OTTC 5HHNA 4J3OC 1FNAA 4I13B 2FZ3A 5K9OB 5GS3A 1AC6A 1GC1C 1HXMB 3EYUH 3RVTC 4MCZB 3PWPE 4L5FH 4O2EA 1KXTB 3DX6A 4YEEA 4HF5H 3UJIL 4HSQA 4NKIH 2UYLA 3O2VH 4OTXL 4QWWC 5K9JL 1K8DA 1NBZB 5IBTH 1E4KC 3B6SA 2OTUB 5E4EC 1S7SB 1KB5A 2BNRE 4MMXC 3S36H 4I3SH 5C08E 3O2WH 4Y4KD 1JPFA 1F90L 4APQD 5ECJE 4D3CL 3TBSA 4YHYB 1QYGH 4L8SA 2J4WH 5HI3D 3U79A 2BY3A 1S9YB 3V9FA 1DL7L 4HQQH 2G9HA 4PJ5E 5GGSA 3HC0B 4CU6A 1U8HB 5KZCD 3WJLA 3NGBB 5DMKB 3MBEB 2BY0A 3IKCB 5ANMA 5DJ0B 3DVNB 3MJ9A 3KYKH 4PRAB 4DZBB 1KULA 4OCXL 5BOPA 2HFTA 3NFSH 3HE6A 1RURH 5GZNC 1A2YA 3G6JE 3MLZL 1WBZB 5IW6A 2DYPD 3STZA 3MA7B 5IGXH 5JW4M 5FO8B 5ACLA 1B4JH 4NM4L 2MWCA 4Y4FB 5T1KB 5FF6B 1VA9A 2AJSH 3G5XA 2PXYB 5TJWK 4C56A 3NBNA 1ZA6A 5IVZA 2IC2A 1JWUA 3QH3A 5DA4A 1MNUL 5EU6E 3RIFF 3F6IA 2QKIB 3HMXA 1UH3A 3B2UD 4FQXC 1CXIA 5IKCB 4M8QB 4POZD 4XVUC 1RZJC 2GAZB 4AQ1B 8FABA 3QEQA 2GITA 3BPNC 4OFKA 4W6YB 4LCIH 3V7AG 4DOHE 4JFDB 1LWRA 3CNKA 1Y0LB 2N7BA 3W0WE 4P3DA 2V6HA 5JIIA 4Y4HA 2F58L 5F7DA 2W0KA 4HKZA 5JPMA 2OK0L 3VMNA 4I48B 4GBXB 1AGCB 1ZVHA 1U91B 4HUUB 2E9JA 1LEGB 1TDQA 3KJ6L 3MRRA 4Y19D 5B3NA 2CXGA 2DQUH 3UCRA 1A21A 4NQEE 2Z92A 2R2HA 3VU2A 1MCCA 1CDIA 2R56H 4EVNA 2D03L 4WW2A 2D7TL 4DKEL 4LBEB 1J11A 1B4JL 4LHUB 4N5ED 2X4PB 4RGOL 4JY4A 3OAUH 3GUTB 1N5AB 5HHQB 3GJFH 3BRGC 1MCSA 1BFTA 2FWOB 4Z7VE 2VL4A 4P57A 4DTGH 2WK2A 3CSBA 4QRSB 3FCTA 4CMHB 4JZJC 3FB6B 2WINB 5C07A 1INEH 3AGVA 2RCSH 2NXZB 3HAEG 5CILH 5EOCH 2WZPD 3BWAA 2C1PB 2WQRA 1BZ7A 4U6XA 5HYEA 2J4WL 4GUPA 5JW5A 2I5YH 4LVOC 2VKWA 1U8IB 1QG3A 2WANA 4AEHL 1CE6B 2IBBA 3S36L 5I1DA 5JIKA 5FFLA 1K4CB 5D1XA 3MV01 2EYTB 4OZGF 1LILA 5IW1B 2DLEA 2ORBH 3EDDA 1EH9A 4NKIL 5CGTA 1C7SA 3NIFE 1S9XB 1VPOL 2CUIA 3L1OH 4OB5L 4LBEA 3FCTB 5C09D 4PJBA 2XA8H 5HYJE 4OT1L 1WTLA 2P5WD 2XZAH 2VLKB 5HHQA 2A83B 4QNPF 2GJ6A 4GW5B 3O3EB 2UUDK 4U4BA 3DGGA 2X4TA 3SCMB 4M1DH 1T6VN 3HE7D 4NHUA 2N1KA 4NKOB 4RIRB 1HEZB 4U7KA 4FQCL 4NYLA 1IBGL 3QWQB 3ARDA 1HHGA 3FQXB 2NY4D 3IDMB 3IF1A 4FZEL 1LEKA 4HWZA 4X7TA 4Y8DC 3H7LA 1N5YH 5SWQB 2VDRH 1AGDA 3IU4H 3K8MA 4MZ3A 5DT1L 3SEPA 2F54A 1T04B 4U1JA 3MOAL 1CE6A 3CCHA 5E08L 5ISZE 2AK4A 1FYTD 1C5DA 1AY1H 2AXJA 2Y9RT 3MCLL 1DTUA 3ULVC 3EYVA 3RJQB 3WFZA 4NO2A 4CVUA 1FHGA 1BVZA 5EBLB 1HH9A 3LSOA 3LKSA 1U8OB 2OJZH 4XC1H 1DLFL 2R29H 4FTVA 4U7SA 1EJOL 2FO4A 1UXSA 4GS7B 1JFQL 2F53E 2WBJB 2H45A 3CH8A 4YR6B 1CK0H 2EC9T 5F6IC 3LHPL 4ZO7A 3QEGL 2W9EH 5AG9A 4MA7L 1HHIA 3QEHA 3MUGB 1FZJB 4HKJA 1NUDA 5F7NC 4PRPD 1IQWL 4PUBL 3QCVL 4HWNA 4CVWA 4M9OA 1OP5K 5CZVL 3AU1B 2O5YL 4KVCL 4PY7B 5IIEA 1YJDC 3QFDB 5ICYB 1ZA6B 4TYUA 1A5FL 4Q0XL 3C08H 5EU5A 4JFFD 2Q76B 4FQ2L 4LASL 1GJIA 2FEDD 3V0WH 3MREA 3FFCE 1A6UL 2X89A 1NCCL 3VI4E 1LE5B 1U8KB 4JN2A 4BK5A 1YZZA 2O61B 3OWEA 1ZV5A 2YBRB 2ADIA 1L0YA 1CFQB 3IDGB 1WISA 3GKZA 3VXOA 5D8JL 3FONB 2FGZA 1AXTH 3U4EA 3SO3C 2CRIA 4G5ZH 4S1QL 4KY1H 3RL1A 1M7IA 4ODHL 1G0XA 2VKXA 5FOBA 4P3CL 4LKCB 4R2GB 2B5IC 4H0GA 1XGTA 5CGYD 3TBYA 4N9GB 5ITBL 4NKQB 1FV1B 3ARZA 4QY8A 3SE9L 4HEME 1MREH 5ESAA 5T5NG 4H5SB 1AP2B 1CXLA 3F12A 1P7QA 3D0LB 1D7FA 1HCVA 4OGXL 3H9SA 1XIWD 3CVIH 3RUGF 1P6FA 2FZ3B 3PGDB 5ACMA 3KVQA 1XGUB 3TH4T 1RZFL 2XWJB 3KDMA 3MJ8A 2LABA 3MGOA 3RVVD 4OZHA 1H3XA 3F58H 1G7LA 5FDYA 1BQHA 3DSFH 5GGRA 4QF1A 3X13A 5EC2B 2BOBA 5EWIH 15C8L 1HSAA 4R3SA 2I5YL 4LSUL 1K2DA 3U2SA 5BQ7B 4GMSL 1LK3H 3QEUA 1QEWA 2X9WA 1KLGA 3RDTC 4DEPC 3G6AA 1MREL 2EEAA 4ZODA 1T1XB 5TPWL 2FJGB 3PWLB 3VGDA 1HQRA 1PG7L 4MXQD 3VXSA 3TH3T 5K9QI 3MXWL 4NC0B 5MENE 4P3CH 1NJ9A 3GSWB 5FV2A 3I6LD 4UILL 4Z7UF 1W2KT 4CN4A 4YDIH 2EO9A 3TCLB 2Q3AA 3MC0A 4KPHL 1GGBH 5GJSH 1HK6A 4JZOA 3CLEL 1K85A 2OP4H 2ITCB 4PLKC 3DX6B 5TE6H 5DUBA 1MIMH 4YK4B 1A6WH 3S34H 4LNRA 4N68A 2IANB 4OLXH 3DETD 3K4ZA 3RWIA 1O7SA 2CPCA 3ZT6A 4HT1H 1BLNA 1NDMB 4NKDB 1BP3B 1GC1H 2VABA 1L0QA 3V0WL 3HNTH 5D96C 4O2CA 3PUCA 2KPNA 4HJ0C 2R4RH 1OAKH 3JSSA 5BRZA 5M95B 3PWPA 3O4LB 5B8CB 5A2LH 4CGTA 1K4DA 4ZUTA 2QSQA 4NQTA 5IG7B 5E6ID 2W0LA 2IADB 3DPBA 1MCEA 3UEZA 3SJVD 4LAJH 4XNQA 3ZSSA 4OZIE 4HXAH 4YHOH 4JFHE 3N85L 1CGTA 1X44A 2P5EA 1CLZH 1MFCL 4X7EC 3UYRL 3KPRB 4JO1H 3T0AA 3V4PL 3MXVH 5DO2C 3OGCB 1IEBB 3IDXH 3O9WD 4IDJL 5CWSA 5KZCB 4N5UA 5AAMA 3GSXA 4HZAA 2XWBA 3RBGA 3BPNB 1UWXH 3TFKC 5FAAA 3W0WD 3K1KC 5CEZL 4LLQB 2OJZL 1W72L 3ZE2E 1X5KA 3RUGB 1RUAL 3BYTA 3J7HA 4P2RE 2P24A 1G9EA 2HKHH 3K46A 2B4CH 3VXMD 4BH8B 5DZLA 5AAWA 5DMGD 4NWUH 4TOYL 3C5JA 5D1ZC 5JUEH 1I8IB 1T03H 4AEIL 2I60L 5FO7A 1EGJL 3FZUD 5JHDD 1KEGL 4F7CB 1QRNE 4XPFH 4Z78B 1DBBH 3AM8A 4MQTB 4M4PA 1NFDE 4JRYB 4GKSA 5IWLA 2NY2C 1VFBA 4FQCH 4KRPC 4QHNB 3VFOA 5DD1H 4XPBH 1AC0A 4P49A 1KFAL 3BGMB 3LY6A 3L3OB 3D2UA 1QR4A 4XPAH 1UWXK 3SQOH 5HHXL 3QI9D 5FYLH 1F11B 3A6CH 4XZUA 5E1AB 5DHVH 2N4IA 2AV7A 1YQ2A 5E00A 4XMPH 5LJYH 4L3EA 1KIUA 4LLDB 1K8IB 5HGDB 3I85A 3V6FA 1KJ2A 1U8KA 3U4EB 2OTWB 3CSGA 4KHXL 4MNQB 2F54E 4KTDH 1HDMB 4MXVE 4UDTB 2D7MA 4PFEA 4X80H 3DRTB 1D9KB 2E9WA 4N9GA 3X12A 2HTLD 1W0WA 3VXRB 4XPBL 3VGBA 2DLIA 1G9NL 2AEWA 4R2GD 2ATKB 5JW3H 3B43A 5EC2A 3OMZA 2J12B 3QUXC 1S78C 2NXZD 3DVFA 3VD7A 2AI0L 1GH7A 4HXBL 4P9HL 1NFIA 1U0QA 5BZDB 2VTFA 3VCLB 1NCBH 3HMWH 5C0CE 5D7LD 1P7QB 3D1MC 3NIGE 2B4CL 2NTSP 3DYOA 4HWEH 4WRLA 2WBKA 4X6EA 1YA5A 2DIAA 2NW2B 4S2SA 2IPKB 5DDHB 3EW3B 4DGYH 5I8EA 4LSVL 1I1AC 3QUKB 2XKUA 4DKEH 1IAIM 4XWOD 1ZOXA 5F9JA 4PRIE 1LP9A 1MFEL 4W4OA 5IIEB 3M17B 3N0PB 4B7IA 4WFEE 1MOEA 3TT3H 1FZMA 3F6LA 2EDTA 3NACL 3MLUL 2AV1A 3THMH 3UYRH 5L88H 3FO2B 1A0QH 4MLIA 3HNVL 4J3WA 1N0LA 5E2WH 3S37X 3D3VA 2GJ6E 4IS6B 3UZQA 1W8NA 3GJEB 1Q0XL 3FN0H 1SY6L 5IJVB 4QTIL 3SGJA 1MAKA 1MJ7L 2P5EE 4KK9C 1T2QL 4RZCB 4WNQA 4X7FC 4PJXA 3CMOL 5AWNL 2D7OA 2ICWI 2DKMA 5DVLA 2F5AL 3RL2A 1EBPA 1T83C 2ADIB 1OF2B 3M45A 4D0DB 1UH4A 4M6OL 3LKSB 1QUNA 1ZLWH 3OAZH 3V95A 3DX8A 3BW9A 3KYMA 3MREB 3AS0A 3SKMA 1QZ1A 3FAXA 4YNYB 1RUKH 4OD3L 3MRBA 4FNLL 4PJCE 4XPHH 2XQYG 2EH8L 5C6WH 1FZJA 2Y5TA 1GXEA 3HZKA 4IIQA 5GGSY 3PGCB 3HI5L 2FR4A 3SDCD 1HHKB 1J0KA 3Q6GL 5DJCB 4QRTB 2BX5A 4XTRC 4G8FB 1QRNA 4X7TB 1RHHB 2BXYA 4U1SB 4TSBL 3OF6A 3UTOA 4DKDC 3BGFC 5TPWH 3UBXA 3QJHA 4X4XA 2WBJD 1DL7H 1OM3L 3GMNA 4QT5B 1H8SA 2QSTA 2MJWA 2DKUA 2IAND 4LKXB 3BZDA 4MX7A 5IB5A 3KPTA 4MMZC 5C7XL 3ESVF 4AT6A 3ARUA 2APXA 2ZOLA 3IT8D 4KTDL 5E6IB 1K3IA 3LV3A 1WCBB 3FKUS 1D5XA 4WHCA 4F58L 3F65A 5F7MC 4E42B 2W9DL 3SO5A 1T1ZB 2V2WB 1D6VL 4JFPB 4OCSH 3RKDC 5GRWA 2DJSA 3P4OA 4P2RB 4WGWB 4HWZB 5D7JD 1YMHA 3TJHD 4DKFL 5AZEL 4FQXA 1UZ8A 3SQOL 2IH1A 4QRPD 3EUUA 4P9HC 1KPVA 3VFGL 4PLJD 1MFBH 3NFNB 2CO7B 2OXHA 2KUTA 4EVNB 2ZUVA 3QPXH 3GMOA 3TC9A 3QUXD 5C6TH 2Y7QA 5LAXA 1P4BH 3OV6A 4BELD 4ONFH 4D0DA 3MRRB 4Y5YB 3FMGL 4HUUA 5FECA 5F7HA 1IAII 1IL1A 2GKIA 4YXLH 3MLTA 3NH7H 4PJDF 3QIUC 3WJLC 3P9LB 4KJYB 4U1NB 5H94A 4AM0A 5I1LB 2HJKA 3LQMA 1CS6A 3UJJH 3RWEA 1L6ZA 4PJFB 4DVBB 3BESR 5C0AA 5I1GH 1ZS8B 1T5WA 5EN2B 4PJBE 3BQUA 3SGKC 3EOYG 3PJSB 1CICA 2FX8H 3A6BL 1X5AA 2D7QA 4PLKD 4KXZI 4YC2B 3P0YH 3IDXL 4IDJH 3SDCB 4YUEL 5KANI 3UBXB 3QB7C 1LMKA 4ONHB 3PDOA 3CIQA 3HC3H 1QR1A 4YBQC 3AROA 4LVHB 5EOCJ 2E7BA 1MLCA 4LLVB 1CDHA 2DQEL 1Z9LA 2WBWB 4RGNE 3TJEH 4S1SL 1ITBB 4ZAKC 1BPVA 1AQKH 2AEQL 1OTUC 5F88B 4LCCA 5CZXC 1YYLL 1FNHA 2DQDL 3QXDB 4YAQB 4YNYA 3VRLF 3IGAA 1KPRB 4FQ1L 4KJYA 4H8WL 4XPGH 1BFOA 5F7DB 2WW8A 1FG2B 3QUMA 4O2EB 3VE0A 1RZ7H 5IVOA 1S5IH 2JF1A 3Q2CA 5FM8A 4TRPH 43C9B 4HV8B 2H8PB 2AEIT 3H9HB 4XP1H 5IROC 2BK8A 3O45B 3ZHKA 1RHFA 4WI7A 4H1LH 4XXDB 5FHAH 4YFEA 1HI6A 1KYOJ 4L3EB 1MHPH 3FFDA 4Q74A 3O4LD 3QUZD 1MFBL 5B39A 1TZHB 5L8LB 1CICD 4O51B 1P84K 4LSRH 3PV6A 4XAKE 5ID1A 1TMCB 3E6HA 1XMWA 4CMMB 3GSRA 2CIIA 2AP2A 4XP9H 2P1YA 4NBZB 3LEVH 4S1DC 3ZDZF 4PRID 3SKOA 1GPOH 2DIBA 1K8IA 2BP3A 2FJHB 4ZOCA 4ZFGH 1TIUA 3MA7A 4C59B 2JCCB 4OM1H 1S9WA 2HG5A 2AAVA 3MBXL 1LK2B 5CBAB 4ELMF 3ZO0A 1UXWB 4MJIB 5CMAB 1JPST 3NZ8B 3P0VH 4PS4H 5CIPA 1KBGH 1QQDA 4OGAC 4P2QB 2UWEE 3GI8L 1U3HD 3SKJL 5B39G 4FTVD 5ITBH 1JF6A 4YPJA 1ZLVK 1VEPA 4OUUA 5D72L 2MCPL 3HN3A 4K3DL 4EI6B 4Q9BA 1RZIA 5FUOH 4MQXC 4N9OB 5D7LA 5A43C 4P2OC 1JNJA 2F19H 1SYSB 1YEIL 2K9UA 3DUSB 2EDKA 3P4LA 1A7PL 1BMGA 1JHLH 4Z7WA 4MCZA 4JQVC 4F9PA 2CDEB 5HHPA 1TLKA 3MO1A 2DJUA 4JY6B 5D1QA 3RWHB 5GGVY 4O02H 1XR8B 4PGCB 5GXBB 3BIAX 4ELKB 4JAMB 3V5DB 1BM3H 3VGFA 3DUUA 4O58H 4PJ9D 1XIWA 4OI9A 3RQ3A 3OJDA 1IEBA 2ZPKH 1KIQB 4JGMA 3HC4L 3KGRA 3U9UB 1P69B 1NKOA 5DVNA 4UTBH 1MCPL 3RVXC 5FGCE 2HFFB 1HCFX 5D1XC 4NO5A 5A16B 3MCKB 3IDIA 1NBVL 3ILPB 4Y2OA 2AXGB 5FEBA 4R7DA 4JN1L 1TZIB 3NGBC 4GRLD 1OSZA 1ND0B 4WI9A 1DBJH 1FO0B 5ENWA 3EDKA 3GSUB 3UTTD 1MNUH 2ARJA 4U6VL 2FGWH 4ZQKA 4MHHG 5B4MD 2DQFB 2H26B 4NRXA 4HBCH 5DK3A 4G42B 1KC5H 4RFEA 5AYUL 4DN4H 3GSNB 4KKBC 3T3PE 3GM8A 2H9GB 1PSKL 4M43L 1YEEL 1KLGB 4MSWA 1P7QD 5E8PB 4YHMH 3ABZA 1CF8H 2HT3D 4JO2L 4F80A 1LO4H 3MLXH 1PY4A 3KYNA 1T6WA 2AXFB 2VDRL 2YPVL 3Q6FB 4JKPL 3MRIA 5DJDB 3ZE1F 1UCBH 5D5MB 3VA6A 1AR1D 1F6LL 4MB3A 4NO5B 1J8HE 3WLWC 4WFHE 5J3HD 1ROWA 2X4NB 1CFBA 3AREC 3BSZH 3JUZA 4NQDA 2Z31A 4YXKH 5KW9H 1TCRB 3MOBL 1G7JB 2P8PB 3T65A 4XRCA 4LSDA 1OTSD 4LCCC 3BP5B 4GLRH 1QEWB 1BFVL 3MR9B 3S37L 1TJIL 4PJ8C 5I1EH 5FM5O 3SDXB 1GZQB 5C0GB 3BPCA 1H3VA 4PRPA 1N6QL 3VRLE 5EIIA 1CR9L 1BWWA 2X4OB 5JZ7C 5HYQB 4BZ1L 2V2TA 1I3VA 2V7NA 3LKPB 1GHFH 2CDGB 3NIGF 3FONA 4OCYL 3KXFD 1G6RB 4L8CA 1QFWH 5DD0L 1KELH 3CC5B 1NMBH 6FABH 2EDYA 4XHJD 2DMBA 4Q9QL 2MKWA 1UB5B 3WHXB 1KIRA 3VH8B 3BP4B 1S7XA 3S4SG 5E8DH 2A38A 2EDQA 3CMGA 2VITA 2EYSA 4AH2B 1JZ8A 4U1IA 4XP6L 4JB9H 4PYGA 4PJXF 1RUQH 5ITFA 2VB5A 3QDJA 1HSAB 4JO3L 5DO2D 5FYJE 2NNAB 3MRKA 1SJHB 3C87A 3O3DB 3QDJE 3IAPA 5CKAA 2R4SL 3EO1B 2VLMD 1U8JA 3C5ZD 3G5VA 3T0BA 3CU1A 4POUB 3LN9A 8CGTA 3LEXB 4AIXA 1IGML 4M1GL 2EDJA 1CICB 3GGWA 3L7EA 1G1YA 3BKMH 3TVMC 5J4MA 4M48L 3O8XC 2Z35A 2YZ1A 1AO7E 3ARDD 4ETYA 4PGBB 3BXNA 3TO4B 5TE7L 4PJCF 2VXTL 2G5BB 5H35A 2FECL 1A3QA 1FVEB 3MRMA 3EYVB 4ERSL 2DN7A 1OAUH 4JZNA 1FBIL 2OTPA 2F54B 3DECA 5LCVL 4LIQH 3KJ4B 4ZTPH 3W5MA 1E4XH 1AGDB 4HX1B 3WNMA 5E7BA 4NOFA 4ZNCD 1SVZA 1DQQA 3C9NA 1MLBB 5ILTH 2HJFA 4PJEE 3V5DA 2XTJD 4MDIA 1EAJA 4L4TB 4FFYH 3BKML 3WXVL 1J1XH 1U93B 4WV1B 4JANB 3PABA 3FQRB 3B9AA 1JNLH 5DRWB 5HHOA 3HZMA 4PJIA 4LFHD 4CW1B 2ITCA 3VFSB 3O9WA 4ZYKB 4DJMA 3QFDA 4YHPB 5SX5K 3QEQD 3MTRA 1GGBL 3AMKA 3D18B 2A6KA 5DHVB 3NFSL 3OJMB 4X7SL 3V79C 5MEOA 4CNIA 1E4XI 3BH8A 4NN7C 3RTQC 5I76A 4L3CA 4HIIB 4TQEL 4X5LA 4GG6E 1QLRB 5C8JB 3QRGH 2R23A 2DDQL 2P43B 2SEBB 4R97B 2J7LA 4F8TA 1QBML 2A6JA 4JPWH 1QYGL 3V6OC 5SV4A 1RZJL 1YMME 1TVBB 1WIUA 4J4PC 2FX9H 4XNMA 2JJUA 4KDTA 4ZFOB 1LK2A 2V5RA 3D48R 4JO4L 2GJ6B 1XCTA 4YHZH 2XWJA 3QHFL 4J3SA 1ITCA 2V2XB 3JXAA 5LKNA 3RNKB 2GFBB 3GDBA 5DEZA 3VXQA 1JK8A 1RY7B 2EDXA 4Y5XA 3I3EA 4JFED 4PJAE 1U8LA 3BP7A 1HWHB 2VSDA 1GZPA 2DMKA 3CAFA 4XVSH 3D9AL 3MRJA 4IOIB 1VADA 4GKZB 4G3YH 5HHXH 3C2AL 4O51A 4H20L 4ZUWA 4ZO9A 3VG0L 1NSNL 1A7RH 5FKPA 5I16B 3AFLA 4DUXA 1NL0L 4M3JA 1LO3H 3NABL 3I75B 3MV7E 1DN2A 5GJTH 3R1GL 4J3VA 2R2HB 1S7WB 5D93B 5F96L 5MP6L 3T0DA 3KPOB 4XNZB 3V6BR 4EI5B 1WITA 3GHEL 1LEIB 5EUOF 1ACYH 3TA3C 4JFOB 1OAQL 1JHTB 1FAKT 5EO0B 1INQA 1YJDH 4BZ2H 2BNUB 3VXUE 4POZC 1FFPB 4ONHA 3SDXE 2P7TA 3LQZB 5DGQA 3LB6C 4U1MB 3SDDD 4F2MB 3GNML 4QTHB 4PTUA 1W72H 3ULUF 1D3CA 3H6JA 3EYQD 4LRIC 4AL8L 1RUPH 5C9KA 5EO1B 1S5HB 3KPLA 2X4UB 2DTSA 3MRPA 4YK4C 2I9LB 3GK8L 4ZUWB 4OZIA 2J8UB 4RWHA 4KAQH 3KYOA 2XWTB 3F7VA 4HGWB 2LQRA 4K7PX 5JOEA 3DI3B 2XG5A 2XOTA 1G9NC 4HMDA 4YR6A 4F33A 4XI5D 4F9LC 3O2DH 5KVGH 4RAHA 3GUTA 1WWWX 3PP4H 1E0OB 4NBYB 2WUBH 2IWGA 5FA4B 4ETQB 1T20A 5CEXA 1LE9B 4PYHA 3HZYA 4MA1B 2BNUA 2H6PA 1URLA 1HH6A 4GXUN 5EO0A 4YPGB 2ATKA 3BD3A 1QO3A 1SEBB 4BYHA 3C2AH 3MOAH 4F2MA 1ZHNA 1IZJA 4KZEH 3H0TA 3VW3H 3RTQD 3ECBB 2Y36L 5I1KL 1FNSH 4YGVA 5KSVB 4UINL 3MLWH 3P0VL 4PS4L 1C5BH 3QDMB 3R1GH 2DM7A 1JTPA 3JTSA 5ACZB 3DVNA 1D5XB 5F1KC 4K3DH 5INCB 1IRAY 3NFNA 1FIGL 3N1FC 3UJTL 2QHRL 3GBNH 1GGIL 5BW7C 4NDMA 5EBGA 1IC7L 5HHMB 4JFDE 4BQ9A 4UBDD 1MF2L 4X6DE 5EIVA 4OGYL 5DS8B 1DN0A 4G3YL 1LO5B 4JLRA 2WUCL 2Q3ZA 3F5WB 3SJVB 4JANA 2NY3D 4PG9A 2Z8SA 3ZKXB 1TENA 2A6JB 2OTUA 3S5LA 1GAFH 4FP8L 3HI1A 1GZPB 3JTTA 3I3BA 3L9RA 3N1GC 5EPMB 3QNYB 1A8JH 4M6NH 5KG9A 2NCMA 1RZJH 4MXVF 5SV3A 5D7IF 4HULB 4PGDB 2UV3A 4NCC2 3WKMH 5SWSB 3WDHA 5CJXC 1QLRA 4J6RL 4YO0B 4FABH 2DI8A 4QGTA 3GMPA 4P0DA 1DBKH 2R69L 4NPYA 4OAWA 2P47B 3QDHA 5JHDB 4PB0L 5C0EA 1O7VA 1OF2A 1EHLH 2RFXA 5FGBC 3NCMA 1QBAA 4LHUA 4ODXA 3C8KA 4S1SH 3KPRA 1UJ3B 1V5JA 4YIQA 1TNNA 4S1RH 1JHKL 2D03H 3MRMB 2VQTA 4ZPVB 4N1CA 4YDKH 2VZ1A 4M62L 4OFPA 1Z2KA 4NQEB 3FT3B 1SEQH 1K4DB 4M1CD 1SYVA 1FL5A 4QHKI 4JM2C 3QIUD 2DQDH 4ENEC 4PJFF 4LLYB 3F62A 3D25A 3B83A 3W39B 4K3JH 4JCMA 4RMQA 1MH5B 43CAA 3C5ZC 5D7JA 4K71B 1WZKA 4GKNA 3UJJL 2YSSB 3WL9A 4Z7QF 1NFKA 4HX1A 4PUBH 2VR5A 2D9QB 5BMFL 1Z5LB 3BGFB 4HDIB 3HC3L 4E9LA 5IFHL 3NACH 2VAAA 5HDBF 4YHNB 2ADFL 5JXAH 4ZTOL 3V8OA 2IALB 4M48H 4MA7H 2NX5D 5DRXB 4QOKB 2EIZB 3UXFA 2W0PA 2XZCL 4LK4A 4HS8L 4LCWD 3QSKB 4R9HA 1CK0L 1JPGB 4CVZA 2PYEA 5MP6H 2IPKA 4PRBB 2CK0L 3RUGA 4G43A 5I1GL 3VI3E 1YEKL 3K1DA 1S7VA 2XT1B 3E2HB 5I1IL 3VXMA 4U1KA 3MLZH 3U7YL 3LQAL 5EZJA 2J2ZA 4P46A 4PTTA 1TZGH 4OD1H 1EUTA 3VDAA 5DJAA 4OKVB 5E08H 1HOCB 3NCFB 3QULA 1UVQA 1KLUA 5GGRB 2YD5A 5GGUB 1UACH 3RVVC 4JKWA 1AGBA 1NLDH 3BEWB 4XBPA 3MSPA 5EIIB 4UIMA 2ICEB 3DO7A 4RISL 5FYKL 5HVWA 4G9FA 2M2DA 3L5XL 3MACH 4K23L 1IAOA 2BFVL 1MI5A 3WUWA 5D6DC 5HI4D 1MQKH 3EJZD 2PYEB 1I7ZB 2EE3A 1A4KA 1OM3H 1QBMH 4E41D 5GRVL 4N1EA 3NFPB 3JWDH 4XMPL 2QQLL 4TSBH 1HYRC 5DUBB 1DP0A 3EOAB 4LGPB 4KJPD 2XTJB 3TIEB 4R96A 1SJVA 4WFGE 1OSZB 1R3JB 5DMJB 4OKDA 3TCLA 1IE5A 4QRQA 2YPKA 3DV6A 2YD4A 2H3NA 4IRJC 4LLWB 4QXUL 3VFOB 2C3GA 5A2IH 5F1NB 1YEDB 2EE2A 2DB8A 3BSZL 2Z4QB 5CKGA 2C4FU 5I19L 3ZTJG 2YC1A 2DBJA 5BJTA 3ILQC 2XWBB 1YEJH 3G5ZA 5TDNA 2AW2A 5EC1A 4AEEA 2CR6A 4FQPA 4GXVL 2E7LA 5IFHH 1DBML 2I24N 1RJLA 1ZT1A 5H2BB 3X3FL 2Z31D 4Z8FL 2V5MA 2HKHL 2ENSA 1S7VB 3DURB 1WIOA 1RUAH 2WQ8A 5ESQB 3ILPA 4YHLH 2G75B 3UZVB 4JJHA 3ULVL 4I8DA 1VEOA 2E7LC 4HWBL 1RUKL 3GSXB 4EI6A 3KPQB 3INUL 4X6FA 4MSWB 1A1OA 4MNQD 4GT7A 1DLHA 3GMPB 3PNWB 3REWB 3QJFB 4OQTL 5DI8B 3WIIL 4G7YH 1I9RL 3FRUA 4Y4KA 1JMXA 1T89A 2VWEE 4KJWC 1YEFH 4HWBH 4OZFB 2IH3B 5JA9A 1M7XA 3BJLA 5IB4A 1Q0XH 3IVKA 3HC4H 4UT9L 4Z7UB 4YDLB 1EFQA 3EO9H 2R4RL 1V05A 2JE8A 3SKOB 5E2UL 1EERB 3GRWL 1H5BB 4M7ZB 3MGAA 4P9HH 3L7FA