4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
b'MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
5IREA 4FFYA 2HG0A 3I50E 3N41F 3J27A 1Z66A 5IZ7A 1Z3RA 5KVEE 3P54A 1ZTXE 2R29A 2H0PA 4UTCA 3UC0A 3G7TA 4BZ1A 2JV6A 1OK8A 3C5XA 3VTTA 3UZVA 3UZQB 5B1CA 2P5PA 1OKEA 2R69A 4X42A 4GSXA 3J2PA 4UTAA 3IRCA 1PJWA 3N44F 5LBVA 1UZGA 4AL8C 5LCVA 2I69A 5AAWC 5JHLA 5JHMA 1TG8A 3WE1A 3UYPB 3N43F 3UAJA 5KVFE 5KVDE 4BZ2A 5LBSA 1SVBA 3UZEC 4FG0A 5AAMC 3MUUA 4AM0Q 3N42F 4L5FE 4ALAC 1URZA 2V33A 2GG1A 4FFZA 4GT0A 5GZOA 4UT9A 3C6EA 1S6NA 5H37A 2ALAA 5KVGE 4UT6A 4UTBA 3N40F 1OANA 2JQMA 5GZNA 1RERA 2JSFA
chains in the Genus database with same CATH superfamily
4HOWA 5JHBA 2XQ0A 1QWHA 2HB0A 3AS1A 2ERJC 3MREB 4IOFD 4B9JA 4F7TB 3DRTB 1AG6A 3NIGF 5IBLC 3W5MA 1IV8A 3BZFB 2YPLE 3AJ7A 1BW8A 4MRCA 4JCLA 5L2KE 4UBDD 1MW2A 4NM8L 2BNUA 4X9YA 2YXFA 1MCSA 1XV8A 4GKNA 3QG7L 4XI5D 3MRCB 3K5RA 2X2HA 2BSSA 5D70H 4F7KA 1OHZA 5ID1B 3FT3B 5B1KA 5FW8A 3FFCB 1OGTA 4WTQA 1I9IH 3GB7A 2R0ZH 2O26U 4LOVA 3DIFB 5F0JB 1CZ8L 1RZJC 2F53B 2NOYA 3TIDB 4IS6B 4P9HH 2BVQB 2UWEA 5DEFA 4CBZA 2XZCH 3WIIL 2XPYA 1NFKA 3D30A 2NY3D 2ICWI 5KVEH 3QDJB 1C16A 5FHAL 5I76B 4PS3A 5I1AB 1I8KA 4UDTB 1AOZA 5ETUA 5IMLB 2JCCE 2XWBA 4P2QD 3O3BB 1LDSA 1T5XB 1Q9LB 2HZHA 3LDBC 4GAFB 4R4BB 2FYYB 1ZHBA 3B2XA 2DQHH 1PU0A 2VDKB 1XCQB 4K23L 2LABA 4HISA 2MOQA 5D7EA 1H0DA 4I77H 3REWB 3QZBA 4F2EA 2EVJA 4L05A 3UTTB 3N0AA 3ASNB 5CKGA 3K8KA 2FO4A 4YHLL 3KPNA 4L2YA 2AQSA 1AHWB 3AG4B 2G5RA 3RGVA 5D70L 1TF4A 4XBPB 1HVXA 3W0WE 4J1UB 4AZ8A 4NC0B 4NSKB 1RURH 3JTSA 2LW5A 2WXKA 5E6UB 3MV8D 1MJJB 3MCLH 2CJTA 2CO6B 4P9HL 5I0YA 4JM2F 2Q10A 3E7JA 5ABDE 1PYWB 3BQUC 4Y2OA 4Y4FA 3TO2B 1IBGL 1HN1A 2FGWH 1UM5L 1P84K 4PWIA 2RA1A 1KELH 3SOBL 5CP3A 3D3VB 2PR4H 4W9KC 5T1MB 5LNEA 1I3UA 3L5XL 3X3GH 2DQHL 3OJDA 4TF4A 1BD2B 3T65A 2X6AA 3BGMA 5IB5A 1JDAA 5FOBB 4JRLA 5FDWA 1YEFH 2D03L 2JQMA 5E1IA 4HEMA 3N41B 1RLBA 4NQDB 3FB8A 3QUYA 3ZMNA 2W65B 2WSPA 4S0HA 1C5CH 2AV7A 3DXAA 1CXEA 2BMKA 6PAZA 3U1SL 4AYFB 2EXWC 4XPTH 3BE1H 1KG0B 3MCLL 3HPJA 4HUVA 2VMDA 2YD8A 3DYPA 4QGYA 4CU6A 4AC2A 4DZBB 1HKLH 3IPEA 4U1JB 3B37A 2O5ZL 2NQDA 4I2XB 1S2EA 4WRLA 3PJNA 2QQNL 4BRVA 4YIQB 2BW4A 2CBTA 1CK0H 1BQUA 2FGWL 2XFXA 4Y2NA 4J8RA 5J57B 5J11C 1ULVA 4BZ2H 1FVDB 4GW4A 4PWGA 3VD2A 5BS0D 4IGBA 1BZ9A 3NIDB 2BP3A 2YAOA 1PEWA 1L5GA 5DHMC 1FAIH 2ESVA 2BNRE 4LCYA 5ENWA 5HHXL 3US0A 4QRTA 3ESNA 4Q8BA 2VXUH 1LL1A 1J5OL 1YEFL 1ITBB 1M3JA 1W72H 1BFOA 1D7DA 3BDYL 2MTAA 4PJ8B 4Y5XC 4R7DA 1M1SA 1V7MH 3B7SA 3IMWA 3J2PA 1C5CL 1U0QA 1L0XA 2QMKA 1NAMH 3KCWA 4MD5B 4AKPA 3P0YH 2C9SA 4IRJD 4B9IA 4ACPA 3ULSA 5BO0D 1I85C 4OCMC 1N6QL 4GP5B 4D9RD 3TTYA 2VWEC 3S3BB 4A37A 1JZIA 3TA3D 4Y19D 1VA9A 3L4ZA 1B4JH 3OKNA 2A83A 1W0YT 4AYMC 5GSVB 2E86A 4ICXA 1IC1A 5EU5B 4O02B 4G5ZH 4I88A 5I1HL 3KCPA 3NJLA 4LKCB 5T1LB 3TBSA 4BZ2L 1Z9LA 3G08B 3NFPB 3WNPA 3TPKA 4A55A 5C0CD 2YJLA 5TE6H 3LVTA 3M88A 1ZLUH 1UVQA 4LKXA 4U1HB 3TFKC 1KXTA 5MP6H 4OFPA 3X2QB 4YHPB 3ZHFA 4A68A 3NEOA 4A63A 4ERSL 1XB8A 1IGJB 3BGFC 4MMYA 1U8QA 1A4KA 2TRHA 2ZPKH 3MA9H 1MZZA 2VJXA 3SDAC 3KHQA 1RZIB 4TVPD 4NYLA 5JIDA 4AVJA 3HN3A 3D4CA 5I1KL 4MAYA 2J1KA 2WZ5A 5D4IA 2WYHA 2EUZA 1KPVA 4YVNA 3HNSL 4FI6A 5J06A 5F93C 4WKZB 2IH3B 3VWKA 4J4PA 3IXTA 1B4JL 3QZOA 3SDCD 1O7DC 2NYKA 1BOGB 3T6VA 4LE8A 4TS6A 1S9XB 4HKXB 4ZFOL 1HXMA 5C0JA 4YDKH 1I3GL 2FH8A 3F83A 5CJ8A 4HOZA 3KEHA 2Y0SA 1DQMH 3PWLA 3WLWC 1CE6A 2ZF9A 4NJAH 4X9IA 3B8SA 1RI8A 1VGKB 3CFDA 2WQVA 2P43B 1CVSC 4WNQA 4X5XB 3QDGA 4HJEA 4JVWA 2AXWA 2JQZA 4NNYB 4OLXL 4XXWA 4Y1AB 3PXJA 2EE6A 5I1GL 3LRSA 2ZPKL 4N25A 3ARFB 2WB1A 1SLWA 4EBQL 5ESQB 5HDWA 4XAWL 3QO0B 2VLRE 4LLAA 4X98B 3ATFA 1WCBB 3U83A 5IJDC 5MERB 5FW6A 2YUXA 4RMRA 5F9WB 2DM4A 3GWJA 1FZKA 4HIJA 5HXMA 1U42A 1BM3L 1JPGA 3V0HA 3VFSB 1PGRB 1K3ZA 1Q9WB 3MRMA 1WWAX 1QI3A 1DVSA 5HYJB 1DN0A 3NPSC 4GG8A 2H0EA 4GO9A 4FAAB 3V5KA 3TEUA 1HAUA 3WSQL 3M1OA 3AROA 4PBVC 4RFEA 4D9LL 4UOW0 4GSXA 3FQUB 4PIBA 2WQSA 1LP9A 4IRSA 4L29A 3WHE1 3UMNA 4NJAL 5F9AC 2UVEA 1LILA 3RZCA 4ZX5A 1T0PB 1I1AA 1U30A 3QJQB 4FMFA 5DJZB 4ZMLA 2PWHA 4WLCA 4YNYB 2WMPB 3V9FA 4ETYA 2WIIB 3OMAB 4NQCE 5JYMA 2MEJB 3DV4A 3VI4F 3MJ7A 1FC1A 4CSZA 5EIIG 3OPZH 4ZTPL 3RQ3A 1NMCC 4MWFA 1J0KA 4R5TA 3H7BB 5HHOA 3KLLA 1BQKA 3QEQD 4WENB 4G6KL 1MRFH 4FG0A 3EOBA 3QIBA 3WS6A 2QKIB 1OP5K 4LCWD 3CC5A 2QGEA 1Z5HA 3UBXI 4OZ4A 3R18A 1S7WB 4WW2A 3Q2NA 3BC9A 1AS7A 3US1A 3MGTB 5KYXA 5CN1A 4OJEH 4I18B 1HQRA 3LPWA 3QDMB 2XA3A 3EKCA 4A66A 4MMXA 4ODSL 3VWJB 5IM7A 5J6GA 5AVYB 5I5IA 2G2RB 5DMIH 5DQDL 4FYRA 4ZX3A 3T6WA 4WEEA 4PGDA 3MJWA 4NC2B 4NIYE 4EO5A 4IJ3C 3FB7A 5DMGD 3Q0HA 2NW3A 5SWQB 2V9RA 3KLAA 2CRZA 1AS6A 4LLVA 3BDBA 1UWGH 2OXGB 4WI4A 1VADA 4HG4K 4GRMA 4PJCB 1LK2A 2D9CA 1LDPH 1WO2A 3OPZL 1HSBA 1ML0A 4IYKA 5FO2A 2HJLA 5G2NA 1XGUA 3PP3H 4JKPL 3HS0B 3WCYA 4PS4H 2QZQA 4C58B 3ZYJA 1ZA3A 3I50E 1XDTT 1MFEH 2NZIA 4FQJL 3KWWA 2BVOA 3F7VA 5IT2H 3PAYA 3PWJA 4TUOA 1G7JA 3S96B 5AVZB 3EADA 5JXAL 5LAPA 4OZFB 4J6IA 1G7PA 1PEZA 3EIFA 2DH3A 1Z7JA 2CDEA 3T77B 3O6FC 1CURA 1SXNA 4GBXC 4WU7A 1G1KA 2G4GA 4ZDHA 2I32A 2V2TA 4KHXL 2XWEA 5C8JB 4EUPH 1GYVA 1DQJB 1Y1UA 3RX8A 2F74A 1G6RB 3FO9A 2LLLA 5DMIL 4V1DB 2WXRA 3KL0A 4JUSA 5AW5B 5CZKA 4MA1C 2UXVA 4PG9B 1G7HA 4DQOH 2QPUA 4QHKJ 3X3FH 1CYXA 1V54B 2X9WA 2NXYC 3QZWB 4KGLA 3AT8A 1QSED 4PS4L 5SWZA 3FN3A 1NOFA 3DX9A 2GFBB 2APVA 2A9NL 3RILA 4BFIA 4AMXA 6TAAA 4PJGE 1T66C 5TGBA 1VCAA 1WJ3A 1DE4B 3T1WA 1FBIH 1HSAA 4XNMA 3WKYA 5C7XH 4NCC2 5F3BB 4F8OA 3KMDA 4HHWA 15C8H 4FZEH 4PRPE 4TSCH 3V4PH 1P7QB 3X13A 3BAIA 1ZWIA 4K3HA 1W15A 5K9QI 3VH8A 5IHBA 2EECA 1EXUB 2A6JB 2AAAA 2Y3NA 3GMOA 3DK2A 3IAGC 1SHWA 1WZMA 2DKMA 5T5FL 5EZIL 1XSKA 3B9DA 1NH6A 3H42H 4J27A 3ROOB 1F58H 3SBPA 3B56A 1O7SA 1OXYA 5BQ7A 1U58B 3BYYA 4RA0C 4P23A 2DQJH 1HHJB 4X7SL 5MEQA 3X14B 2VH5H 4LP5A 3AG3B 2XTJD 3X3FL 4RIRA 1T7VA 1XB3A 4EDXA 4HAGA 1BJMA 5D7LE 5I17B 2YAMA 3D4GA 4AL8L 3L5HA 2G2NA 1TZOA 1PFCA 1Z5LB 3DC0A 4Q2ZA 5E8PB 3QJZA 3WJMB 1R3LB 1QG3A 1DZBA 2OL3B 4PJEA 5EZJB 3BPOC 4N0RA 4OBRA 3UZEA 3X12B 3S36H 1DFBH 5JIPA 4P59L 1IAIL 1YAZA 2ZNWA 4WV1C 4J3XA 1KBBA 3MACH 4TSCL 5GRZA 3OAUH 4JFOB 5L6YH 4PREB 2I9TB 4H5SB 4UT6L 2FD6L 3H2WA 1WGVA 4NP9A 1TJIH 5HHNB 2K45A 2XG5A 4Y5VB 4YQXH 4XODA 1B3IA 1M3IA 3QEUB 1H3PL 1DQTA 2W0PA 3MRFA 3TJHD 4M8QA 4BQCA 1NFDB 3HCVB 3DNKA 4HS6B 5T1KB 1C7TA 3N06B 2IDQA 2GKIA 3QRLA 2VLJE 2VH5L 4PJDE 3CSYB 4WO4D 1JWSB 1F90L 4KNQA 4G7YH 5DR5L 1TLKA 4JZOA 5IBLD 4LCIL 2XNAA 4OLEA 4JRWA 3MV9E 2W95A 1A4BA 3LAFA 2DYSB 2YMTA 1TMCB 2GB2A 3OHXC 4BRJA 2EKSB 3PPEA 3ZE0E 4G9FD 4CMHC 3S36L 3NA4A 1RFDL 1DFBL 2WVSA 2P7TA 5D2LE 4F2ME 5TDNA 4S11A 4ONOA 1UJ3C 3DO3A 3NCEB 3OAUL 4LSQL 5AYUL 3F84A 4TV3A 2YA2A 3SDXF 1BOYA 3RAJH 2OMZB 1D6EB 2ED7A 5DJCB 4BYHA 1NCDH 1KJ3H 4YQXL 1OGAD 1FNLA 4BFKA 4QRUA 3SODB 1M1XB 3ULVD 3MO1A 1D2OA 3NFSH 4NQED 4PJ9B 4QWWC 4LLUA 4F15B 5ESAA 3ZKMD 1D5BB 2YMXL 3MXVL 1XB6A 3K4ZA 1M4KA 3FAXA 2E0PA 1RK0B 1JN6B 2UX6A 3BMVA 3S3DB 2CMRH 1PLAA 4IBSA 1TEYA 3Q13A 3QIWB 4ZPTA 3G5VA 4OD2B 2J6EH 1SBSL 1WDAA 2KZWA 3V95A 4WI7A 4YK4B 5E9DA 1IQDA 4ZFQA 4YDLC 3B7YA 3BZDA 3T2PA 4NP4H 1EFXD 4HD9A 3BUYA 5CJQL 3GLDA 3V6OE 2YIHA 4IU3A 1Z3GH 3KPPA 3DROB 1ANUA 2NZ9D 3W2DH 5AALA 4CRPA 2OMYB 2O61B 3WNMA 3QCUH 4P2OB 3PHQA 5AKSA 1NCDL 3L3GA 4DO5A 5LVEA 4BZ1H 2ADFL 1GTFA 2X4TA 5SX4I 3SDDB 3ZYZA 5T3ZD 3UMTA 1T3FA 1XD1A 2XN9A 3NFSL 4BK5C 1NIDA 1N68A 2B2XH 1WC7A 2IGTA 2DDQH 1IBDA 1A7NL 4U0RB 4IKJA 5EO9A 1IM3A 5E00B 4C56D 1N10A 5D7KE 1KN4L 3UGEA 3U6XS 2OMVA 3RDTA 2IFFH 4N0YL 3D39E 3IMUA 2GJZA 2ZOLA 3UPCA 1KWGA 4PLOB 1D9KC 2EVGA 3SYCA 4E9LA 5TDOA 3S5LA 2E8YA 3IJSB 1MI5E 3QEHB 1UXMA 2EICA 2P8PA 4ZOBA 3GXPA 4U6VH 3BWSA 2HTKC 5DURD 1MG3C 1NBYB 4QXGL 5JO5B 3S35X 3QXTA 4YJZL 1JZHA 3BO8A 3TNNB 4N2HA 3MR9A 1XSIA 2VAJA 4JDZB 5IJVB 2H1XA 1IE5A 3P3RA 1QPPA 2IQAA 4N20A 4P5TB 4KMTL 1HL8A 5EOCJ 4IKKA 4AYGA 5KANG 3E3QC 4BZ1L 1QFPA 1NBVH 4IK7A 1JNHB 2XZAH 2XWZA 2ZOKA 1FN4A 3GRWL 1ZSDB 4E9TA 3HS9A 4OFKA 4JQXA 2DQFA 3KYOA 2B2XL 2DDQL 2B8OT 1KJVA 1T4KA 1YECH 5B39G 3QYNA 3OLEA 1CT8A 1DQIA 3QZLA 4JVUA 4XPHH 4XXCA 3T3PF 1TO5A 4QRSA 4ZXBA 4ADJA 5FLUA 1JZ4A 2DL2A 2ZOUA 3HMWH 5DRNB 4R8WL 4NGHH 1NZRA 3BT0A 5TF0A 5F0MB 3HZYA 3UCRA 1V05A 2CIKB 3UTSD 4E41A 5JPMC 2CK0H 2Y36H 1VIWA 3MRLB 3MUHL 2NW2B 1IFRA 2EEBA 1USQA 3SYAA 3W38A 1THAA 5FGCE 1T5WB 1HINH 3STLB 3EJSA 3ZT5A 4NPJA 2Q8BH 2EVHA 2LU3A 1DBBL 4KQ0A 4I87A 3G9VA 1V8HA 5BV7H 1EV2E 2ZUQB 2KLSA 3NPZB 1QD0A 4N1HB 4HCRA 4AQ1A 1BXUA 1FO0A 4E9QA 4W9FC 2VDRL 4JGUA 2JKTM 3VFUA 5CILL 3LKPA 4AITA 5T33L 5C0FB 4RX4D 4AIOA 3QYCA 1OTUD 2NYZA 5FV1L 3IRPX 4WFHE 1VJSA 2EXYC 1YEEH 2J88H 1G4MA 2VN5A 4Q0XL 4QHLB 3HVDA 4AKOA 3PHOA 3ETBJ 3QXWA 3R06A 1QFUL 1J48A 4YFEA 4GG6B 3HR5A 1P4IL 2KYIA 4YGAB 1BEYH 3UTPE 4YSSA 1S7QB 4QXTB 2VUKA 5DMYA 2WWOA 1A7PH 4Z18A 3T0EB 4OZHF 1BMGA 5GGVL 2CALA 1E4KC 4EN3A 2X12A 3IGUA 4P46A 4WUKH 3HB3B 2CK0L 1MHEA 3ZRCC 1B88A 4WI5A 3IDUA 4MX7A 1P5VA 1BBDH 3ENEA 2LLNA 2Y69B 1S9WB 2AAVA 4MJHA 1GS6X 5TE4L 3ULUL 1HINL 1XWVA 5DGQA 1MFDL 4J2QA 4DVBB 2L8AA 3EJCA 4DSYA 3PDGA 4PRAB 1LK3H 2CQVA 4QT5A 4EMZA 2F7QA 3LIZA 1ORQB 3ZR6A 3D2TA 5EDXA 4XNQB 2ICWJ 3O45A 2JKIS 3D69B 1BMZA 2Y1VA 3D8MA 1HFUA 2HWZH 2Z31C 3GRGA 4IDJH 4Z0BH 1A8JH 4PGBB 2J88L 4HIHB 5F0LB 3VW3H 2ZYSA 3WFBL 1G0DA 4NT6A 6FABH 4LHUA 1N64H 2C9UA 2K3TA 5DLMH 3V5DA 1E50A 1XXFC 1IEBA 4UT7H 1U8LA 2GK0A 4PD4J 5KVGH 1HZHL 3D0VB 1MFNA 2E56A 5ITBL 5GS1B 1QBBA 4X80L 4PJEE 5JDJA 3OXRA 4WUKL 2DIEA 4YPGA 2DS4A 3GSUB 5MI0B 4PVBA 5EMYA 5DJDB 3OF6D 1K8DA 1FNSL 3PWPD 4KZCA 2ARJA 1WBXB 2JH2A 1I8KB 2NY0C 3WKQA 3WTTA 5ETUB 3DDFA 1PY0A 4GINA 3JBG7 1PZAA 1BQLH 4JPWH 5DJYB 1UZ6F 1TJHL 4B53A 1AQKH 1LK3L 2EH7L 4XP5L 3T6XA 4HWBA 1U93B 5HJDA 3SOTA 1F18A 4QF1A 5DVMA 1NWPA 5BQDA 4Z3EA 3VI4B 2WZPD 5DHYA 4Z0BL 4UUJA 3U30B 5C9JB 3VW3L 1DUYB 1OTSC 3GXFA 4HUXA 2QGBA 5E6IB 4ODXB 1FA4A 4KU1A 4UT7L 3SSGA 4ELDA 3EYVA 4JFEB 1USZA 2OZ4H 3CCHB 3U9PL 1IGTA 3VXMA 3PL6A 2QV2A 4HPYH 1Y7VA 1E4WL 5IB4A 4C55A 2A74A 2GBTA 5AW3B 4AKQA 1UOKA 1DSWA 1R4XA 1E3XA 2MIZA 4V2CB 1R0AL 1E6OL 2OTPA 2NY2C 2OQJA 3LMJL 2FNWA 3CZUB 1ID2A 4JHBA 2OXHA 2WAQA 3DSNB 3NABL 4NENA 3OKKA 1UUNA 1U9KA 1UATA 2UZYB 4M5SA 2AJVL 1KENH 1SFHA 3BEVB 4FCAA 4RZCB 2ADIB 1KTLA 4H8QA 3MJ8B 4UV4L 2K8MA 2UY7B 4IHOA 3UACA 1AQKL 1KFAH 1E7VA 3FT2B 2NUPA 5DC0A 5EF0A 1S6NA 3JUYA 4YDZA 4QOKB 1DCEA 4X4XA 2J1WA 3PQYD 3FCGA 1L6XA 1U8PA 1BVNT 4JKMA 4KRMB 2R2HA 2ROYA 1IT9L 1CTOA 3COOA 5L8JB 4K8RC 2YBGA 1JNLH 1QNZL 5ADOH 2JQAA 3CFEA 4HFUH 2EIZB 2R0WL 2WLMA 3DXAB 4LP8A 2OZ4L 5L7XL 1KMGA 1SYVB 1J5DA 3QUZA 4OLUH 4ZAKB 3MLTA 3V79C 1AFVH 1HHKA 1ZKAA 3HPJB 1E9PA 4YC2B 5E2TH 3NRQA 3UTQA 3CFKB 1FHGA 2LAAA 2VN7A 1TR7A 2B4CC 1ZTXE 3QSKB 5HHVL 1MFVA 2F0CA 2FUTA 4HW6A 3W11D 4QRRB 5DC9B 4ORGA 3FFCE 4LEOB 3FU5A 2O6FA 1ZV5A 1URIA 1ZXQA 5I1EL 2NT1A 3U7YH 1PG7H 3II3A 4UM8A 1MIMH 1N8ZB 3D9AL 3NCMA 4ZYKB 1QX1A 5AVUB 4N8PA 4EZLA 1HHGA 1I7RB 1R75A 1AHMA 1XD0A 2BNQA 5IFJB 5E99L 3QDJE 5J12B 5JHLL 3K91A 5D5MA 3CFNA 2KPNA 4PAZA 5FF6A 3GZQA 1QLFA 1TQBB 3CHRA 9PCYA 4AGLA 2WBWB 1J0JA 2HLFD 5CLTA 3KG5A 3BHBA 3OJ2C 1JNLL 4QDGA 3QR1A 1RHHB 1DVFC 4HFUL 4JCMA 4JFUA 2X6MA 3RBSA 3P4MA 3QDAA 2BY3A 4LPVA 4OLUL 3ARVA 2BS71 1L9PA 5L9DH 4GXUN 2D0GA 3JV4B 3UTTE 1CDGA 3B9AA 3GJEA 2CM5A 4UM9A 4FNPA 3HZKA 2AJUH 2IVFC 5C0GB 1ZGLP 4HJGA 4JFFE 2CK2A 4Y0GA 4PP2B 1OWWA 4JFHD 3N1GC 2WXNA 2Y07L 4M3HA 4X6BB 2J1ZA 3E8UH 3UJTL 4JHZA 1H5BC 3V0WH 4HG4J 3LZNA 4P4KD 3GBLA 3CK0L 3U7YL 1PG7L 2E9GA 1WAAA 1SY6H 1G43A 1IGYA 2VC2B 2WJ5A 2JMRA 3CVIL 4H25B 4LKXB 4NHCH 2VLKA 2VN6A 4ELKB 1U95A 4QRAA 1PZ5B 3HC3H 3MRPB 3DX0A 3MCKA 1XH1A 4HUUB 1T89A 1CXKA 1XR8A 2AXHA 2WSKA 1FUNA 4LLWA 4ZFZA 4NAJA 1U8QB 2QSCL 3NUKA 4OJDH 1UOVA 1DBAH 5DZAA 2NX5D 3IWVA 3CSTA 2JLLA 4OSUL 1H6EA 2EYSB 5DD5H 1R24A 5F7EH 1QRNA 3D0AA 4BQ6A 4N22A 4KDVA 1BD2E 2WHVA 1AXTL 3MLRH 1MREL 4OUUB 3U4BH 4O4YH 2G0LA 3BJLA 2C9XA 1N0XL 1BJ1H 3UIZA 2JJTC 3ARSA 4NQDE 2IAMB 5E6SB 2ALAA 5F9OH 3FU6A 3WFCH 3UAFA 2ZUXA 1T22B 3TCLB 5EF2A 5TF1H 4I0CC 1DP0A 5C0JB 3E8UL 5JHDD 1KLFA 3PWLB 4HHAB 1ZS8B 3H9YA 3KLHD 4AENA 2FATH 4MBOA 1NC2D 2F08A 2IV8A 1FCCA 2MQ0A 3EYQC 3MROA 4NHCL 1U91B 4A7GA 2W91A 2XV2A 1Z66A 2GW5A 3KPOB 4I2XE 3HC3L 4P48A 4AYBA 3ABZA 4LCUB 4MZRA 3T1FA 5JTWA 4YLQT 5I2IA 2PPFA 3NBNA 3S88H 1ZJBA 2OYPA 3SPGA 5A7EA 3KS0J 3NIDE 5DD5L 2UZXB 1T1XA 2B16A 4KHTH 3O6KH 3QQ9C 3UAJD 4R97C 1KEGL 3SPJA 4KAQH 1OP3K 3KWXA 2UXFA 2X40A 4UMSA 3VD7A 2IWGA 4Z7OF 2XX0A 3KJ6L 4O4YL 1KTJA 1ZT1A 4CUCA 3TZVD 3CFUA 1GMIA 3SDXB 1A6PA 1QSFA 3V5KB 1EEUA 4XMVA 4YN3A 3WLBB 4Y16C 4DP7X 1FG2A 2OJZL 3PGCA 1LP9B 3AWFA 5GS0C 2NRDA 1IVLA 3MFFA 4KDTA 2ZKMX 4PRHA 2ADGA 3U7WH 5I1JH 3IFPA 3HG5A 4TQHA 5ISZA 4Z23A 1FZOB 2VRQA 4J3UA 1P4BH 1MCQA 3MYZA 4PTTA 1UB5B 1RUKL 1MHPL 3S88L 5KYYB 1T7YA 4BZ2A 4XGZB 2Y23A 4JHAH 3CC5B 1Q72H 1QUNA 4KKNA 1LO5B 4JB9L 1M05B 3ZY7A 4DKAA 4JL1A 4OAWA 1N3NA 1TSHA 3FDWA 2KBGA 2JELH 1PZUB 4G43B 1OB1A 1EHLL 1E5CA 3B1TA 3MOBL 5CR1A 5E94B 1NTDA 1W72A 3JT2A 5A6IA 3IJYB 1U21A 4FXKB 4YGVB 2BOBA 4U2YA 5E4OA 3WUWA 2PXYA 4JFXA 4GIOA 2FECI 2YR3A 3BZ5A 2YPVL 1NAMA 3CDZA 1I4FB 1LO3H 5FKPB 5IB2B 2X4UB 4LMQE 3IS0X 5D9SA 1I9RL 1ORSA 5EWIH 2VDNH 3OMIB 4ZX6A 3QI9C 1OALA 5F1NA 2DQCH 3FB7B 2BWDA 2HYMA 4QRPD 3I2CL 5F1KC 5GGRY 5JIIA 2FLMA 2DLIA 5BZWA 2BWIA 4PRNB 3VXME 4QY8B 3G5ZA 2PABA 3IU3A 5SX5K 4CSPA 5KS9F 1UCBH 3IDJA 3NVQA 4Y2LA 1WPCA 1KBGL 3KWWB 3VXUA 2ZXEB 5AB9A 3QIUD 4OCSH 5DS8B 1S9KC 1Q72L 3L4VA 3ARDD 4TMPA 3SBWC 3HC2A 1J8RA 1BLNB 2Z34A 4WFFD 4WWKC 1TNNA 1IC5H 2V3FA 3EJTA 3TVMB 3FYIB 2PO6D 4PJ5A 4ZDHB 4JM2A 1KSRA 4XB8A 1UD3A 1LO3L 2UZPA 3RDJA 4APQA 1KXVC 1P4LA 4KROD 5KWYC 3CLEL 1FE8H 4JRXB 1BQHB 2I85A 4LCCA 4WGWB 1U36A 5HHQB 3T3PB 2BLFA 1CU4H 1KIQB 2ATAA 2CUAA 4A7VA 3NFNA 4DK3A 3Q6FA 4XP1H 1E3ZA 1FNEB 4PV1C 4N2OA 2LAGB 3QNZB 5TDPA 2A38A 3N85L 1KNOA 2HT2D 4HUNB 1UCBL 1X9LA 3L1EA 2PKDA 2C9PA 4YBQD 3G6DL 1AC0A 5IW3A 3DURB 3HE7B 4OD1H 4ZO7A 3TF4A 1MDTA 2I5YH 3E1F1 5ANME 3WN5A 3L81A 3O3DA 1KGWA 5FUOL 1QSVA 1QFWI 4X8JA 1JZFA 1EK3A 3B9KC 3D3VD 4G8GD 4GQPH 4YXLH 5HPOA 1E9QB 1RZJL 5LQBH 1EAQA 1R5WA 5KG9B 3VMPA 4EAEA 5KBDA 3ULVL 5IJKA 3LKRA 1X6LA 4PLKC 4IBLT 3GSXB 4XBEH 4PJXF 5LUMA 1TTFA 2A0LC 4OTXL 5DYOA 2BVYA 2J2ZB 1U3YA 2C7FA 2G5BB 1OK0A 1AZUA 3VD1A 1BYPA 1TQCB 5IWLC 1BZEA 1TPXB 1QEWB 3BWUF 4OZHB 4Q9RL 1AYRA 3HE6A 3QAQA 5F96H 3VA6A 5H37H 4CN1A 2E7LC 2A1WH 1A21A 2K70A 2O5YL 2JKRM 3T2OA 2RALA 1AGCA 2QR0B 4YFLI 2WTOA 3CPLA 3BJ91 3BSZL 4MQXC 5GIRA 5ESVB 3BH9B 3EJUA 1HX0A 2VW7A 1WYJA 3GF8A 1BSIA 5L4IA 3T0XA 4AIZB 2IBGA 4P0DA 5K9QG 1AO7A 3WDJA 1CBVL 4RISL 4K7FB 4YH6A 2P80A 4XC1L 2AANA 2B0SL 4HIIA 2VL4A 4PGCA 3BH8B 3J8F7 5E6ZA 3TH4T 2OSLA 3IU4H 3ZE2E 5EUKB 1DJIA 2XKSA 3ZBMA 2FHBA 2P5EA 3FO1A 3OKMA 1MJ7H 3RX5A 4YAQA 4FERA 1UHVA 3KR3H 1LE5B 1YJDC 5KVEE 5EU6A 1AMXA 3FQ1A 1R19A 4M43H 3VXSA 3T4YA 3QHFL 1E7UA 1LMKA 1MVUB 1HNGA 2HP4A 4KKAD 2VNCA 2A1WL 2XNAB 1H3GA 3W9DB 4ODUA 4XVSH 5JXEA 4N0CC 4NO3B 4CC4A 4IU2A 1ZV2A 1UQSB 1EMTL 3KPQA 4YSRA 4AJ0A 3UJIH 4ELMB 4CJ1A 1JK9B 4V1DE 3TO4A 2DD8H 2VMCA 5EC2B 1JV2A 1QBLH 5LKNA 3EFFB 4ODTL 5C0BD 4P07A 1LO2L 1XL4A 4PYHA 4UIKH 1NEPA 4XCNB 2EDEA 3VFNA 5GGSB 4YXHH 1T6VN 2ZSVA 3E8VA 4CN4A 1GIGH 2AXFB 2WXIA 5BRPA 1YYLH 3D05A 4U7KA 1A1NB 2WYZA 3EH4B 4OM0H 4AEHH 3FONB 3P02A 2R1XB 3MO1B 4PJBF 3IU4L 3VUAA 3LQZB 3IK2A 5DJAB 5G4OA 5B38B 2AMUA 1MJ7L 2OBGA 3B1UA 4OW6A 2BOLA 1AI1L 4WWID 4YHOL 4Z3TA 3GUTA 3CQFA 5K9OA 1EZLA 2ZYRA 1BVZA 4RFNC 2W9DL 3L45A 2B59A 3P2TA 4LSSH 5IUCA 3Q2CA 1CWVA 4HKBA 5DI8A 1OAKH 3SQRA 3P4OB 5A6LA 2K8QA 4XVSL 3S0PA 5T5FA 4GMSH 5AW6B 3P2DA 1YHPA 2AEWA 1RUAL 1G5GA 2OMUA 3QHZL 1G9EA 2VR8A 1D6VH 2MCMA 3PHAA 1QSFE 3WFZA 1QBLL 2WLLB 3L9RA 3BUYB 1V10A 4W4OA 1AR1D 2EYTA 4UB0L 1NMAL 5DD6A 4EI6B 4IU3B 5FOJA 4M1DH 1NBZA 2R7EA 2BZDA 1J0IA 3F7YA 4KMQA 2LFEA 4RMWA 5H35A 2VDPB 3SO3B 3DGGA 2NYYD 4OZGF 3LOWA 2A4CA 1CD0A 2GCYA 2AEOA 3WL9A 1XF2A 2YJQA 3A0OA 5DK2A 5FYKH 3VXPA 5ISZE 1HDMA 2IDCA 5HYSA 3NCXA 3GDBA 3NIGE 3ZMEA 2V2WB 1FCGA 1GS7A 4NQUA 3V4PA 5JOPD 1I82A 1YEHL 2XTLA 1NCWH 2CKBH 3MRIA 3NYKA 5DSCB 3AXLA 4UT6A 3ZTDC 4GXUM 1CYGA 2FHCA 3RNKB 4AYID 3D48R 2G0KA 2UV3A 3II2A 4GMSL 4UZSA 3F64A 5CJ5A 1CGTA 5HYJD 5DQ9A 1DBJL 2P8PB 4Z77A 4G6AC 3CH1A 1U8NB 3APMA 1CTMA 3GEWB 5F3HB 4FADA 3GMRA 2VDQB 5IHZB 2EE0A 4JHUA 3HG1A 4MS6A 1OCWL 2R8SL 1NCBL 3D18B 5KN5A 1JI2A 2Q2LA 4GRWF 5IGXH 1K9TA 1U3NA 3MR9B 1LYQA 4M1DL 2ZNXA 2EUXA 3DDGA 5EU3A 3MMEA 4L8DA 1QTSA 2VL5B 3EYOA 4AG4L 4MYPA 2ZOKB 5HDOA 4DW2H 6PCYA 2ZSWB 4ZO9A 4JY4A 4IIQB 3LH9A 4K5MA 1KJVB 2WVUA 1UFGA 3SCMB 1YMMD 3L4CA 1CT8B 4GSUA 4H26A 4N87A 2CKBL 4LDEB 1F1AA 3ZX1A 4O2CA 2QHRL 3HAEB 2WXGA 5ICYA 3F05A 2XV3A 4W9IC 5EORH 3HZYB 1A3RH 4RRPG 5E2JA 4F24A 4Z7NF 3WXVH 4FXGB 5JLZB 3IF1A 4JUTA 3O8XA 4N0FB 3NOIA 5K9KA 2BZCA 1IKNA 1HTYA 1GJUA 2ZXGA 3PGDA 2BSRA 5T1DH 4G6FD 2EUWA 4ZMXA 5CIPB 1TEGA 2P46B 4G6ML 4Q6KA 1QLRB 3HN5A 3ESOA 4PJ5E 1TZGH 2NR6C 5F7LB 3S98A 3Q9PA 1FIGH 5TQ2L 4MB1A 3IPBA 4UT9L 4EI5D 4W9DC 2X6UA 4WI8A 2ED9A 1VDGA 4PUBL 1JTOA 3PWUB 2HG5B 1JXKA 2P8MA 4DEPC 5FYLL 4DW2L 2O5NA 2VDNB 1XGRA 3SGDI 5BRZE 3MLUH 4NO0B 4PEEA 4RWHA 3QR2A 3LEYH 3OJMB 4AUYA 1JZEA 4PWFA 5JZ7C 4YSUA 3IFOB 4IGBC 4UINL 5CD5D 3IJEB 3MSPA 3U4EB 5K39B 4BFEA 1NLBH 5EORL 1KCSH 5FUZH 4P46B 3T5WA 4UTBH 4XVUC 4XNZB 3WXVL 4MX7B 4E42B 2FJHB 4LLMA 3ZQ9A 5CO1A 1XSJA 3D0LB 4JZJC 3F8UB 2JB6B 3NGBC 4U1LA 4LNRB 5E2VH 4ZW6A 2FT7A 4D8PB 1HJCA 1JMXA 1EZVY 2P1YA 3ZO0A 5E7FA 1IQWH 3MJ9L 2BCMA 5C08A 5GZNA 4YHML 2EIBA 2HT3D 2EDWA 5FV2A 1MFCH 5I1DA 5HBBA 3GMQB 4LVHB 1DVTA 2C3VA 4I8DA 4Q9QL 4I0PD 2VIRA 5FA3B 5FM8A 4G72B 1AXSB 1VZIA 3LEVH 1CVRA 3R1GL 4NT6B 3WHE0 3L3OB 1MCIA 2J12B 3G5XA 3LEYL 3R4DA 1IEBB 1J12A 1EH9A 4G80B 3FH7A 4K2UH 1DDHB 4JRYE 4Z7OB 4M5ZH 4OU3A 4BZ1A 2AJSH 5IK3A 1HH6B 4NN7C 4Y1SA 4RGMB 2BSTB 1P7QD 1R17A 5IB1B 5IW1B 3EDDA 4QR7A 4GRWH 1V3JA 2D7NA 2D2OA 3K1DA 4MNQB 3ZYIA 1QR1A 4GUQA 1UYWH 3G04A 4RDQF 2XTSA 4DPBX 1K72A 2CO2A 4YDJB 4OCRH 3VI3F 3G5WA 2XOTA 3M8OH 1U8JB 4MAYC 3EFDL 1NGQH 2XBDA 1A9EB 3RVXD 4X6FB 5CSZA 5L2KD 1IQWL 4HGMA 5J6HA 5GRUH 1N6VA 2WBJA 4KK9D 3W57A 1MELA 4ANKA 3L1FA 1MFCL 4J4PC 1ACCA 2P5EE 4QYOA 1NOLA 4L9LA 4MQTB 3BZEA 1DFXA 2VDMH 4A2EA 3LEVL 3VXSE 3RFZC 2RACA 4HKJB 2ZG2A 2BINA 1XGTB 3MCYA 3Q1SL 4K5PA 2HMID 1T7ZA 4BUHA 4G2AA 4TNWK 1JVLA 2NLJA 3FQTA 5J89A 4PJAA 3MRNA 4M5ZL 2CBMA 5T5NG 5JW4Q 1C12A 1FL3A 2FUQA 1R3JB 3BYTA 5DC2A 3T3MF 5DFTA 3TYGH 1ILUA 3RTQC 1CICB 4ZFGL 3KDMA 4FFZH 3JV0A 3CUPB 5EO0B 4Y4KB 3VG9C 4GG6E 3RHWF 4FFWD 3FOMB 4Z7UF 4YMPA 3MRQB 3M8OL 1A22B 3T0EE 4ZMWA 5FO9B 1KXQE 3TYFA 3N1QC 1X7SA 4TUJB 4HS8H 1ADQH 3K0YA 3UC2A 1QVOA 3K2KA 1EXGA 5GRUL 5AAWA 3WJLA 4KKQA 4KXZH 3ZDWA 1SOXA 4ZOAA 2UYLB 1N5YH 2QELA 2FIKA 5HGDB 3V6OC 5EA0H 2HVKB 4MJIA 1NOAA 2Y7NA 2VDML 4H13C 2J4WH 4OFYD 5KS9B 3ARGC 4GI8A 4N90D 1T1ZA 4LARH 4HF5L 5ADPH 3T4AC 3VQ2C 2DF3A 3OX8A 5MEPB 3ECWA 3AQYA 3HZ3A 3MLTB 3C5SA 3TASA 4WO0A 3MYJB 2ATKA 3CZNA 4WK0B 2GBVA 3SBRA 2NCEA 1A1MB 2IG2H 2BS8A 5CP7A 3BWAA 4WNSA 5HDQL 3NCCB 2OFQA 2Z1PA 1G7IB 2MWCA 3KGSA 3MV7B 4L4TB 1NMBL 3S48A 3GM0A 4H8HA 4TUKH 5KTEL 5B8CA 3TLRA 3C6SA 4I5BB 2VB5A 4HS8L 4M6AA 4UM8B 2UY6A 3QWRA 4PP1D 3Q8AA 2J1XA 1HHGB 3GLZA 5J13C 3WFDL 2BNQB 1G9MC 3P9WB 3GSRA 3V0FA 1IILE 3L9YA 2VXTH 1O9VA 2AERT 3NAAL 4L4VA 3L08A 4XNXH 5D5MB 4DIXA 3QIWD 4HDIB 4M5YL 2FJFA 2J4WL 4MMXC 5ADPL 5KBMA 3BAEH 1T4WA 1UWXH 2BCKA 3T2LA 4U49A 4U33A 1KEML 5FYJH 3VAEA 4HU8A 4DUXA 5D7JD 3FFDA 3VI4E 4K07A 2RFXB 4JFDA 4KV5F 3GJFB 3O3AB 4A39A 12E8H 2IG2L 3DA0A 5HHPA 2FBJH 2JCWA 4QXUL 5ICXA 4ECNA 4JO4L 4JFEE 1KCRH 1L0YA 2PWFA 3BP4B 4UAOB 3H54A 1S9YA 4LRIA 5KYNA 4M7JL 4NAMA 4Y4HC 4F8TA 5BUGA 4KC3B 4TUKL 2EO1A 2X4QA 4G42A 3PXLA 3V5HA 2FGZA 3H6JA 3IJHB 2GY7B 2H26A 3PNRB 5DMKB 2XUWA 5SWSD 4WUUB 2WQUA 1V3LA 3SY0B 3AT9A 2QT6A 2XQYG 3VH8G 4HUKB 2DYPB 4LLQA 4ZFZB 2VXTL 4LLWB 4XNXL 3QORC 1N59A 3SKUD 3P11L 3L3JA 2VRKA 4C4UA 2H9GA 4JM4H 1UM6H 4M7LH 1X4ZA 3BAEL 4A7TA 3H4FA 4S2SA 1QRNB 1A9BB 1EX0A 2EO7A 3AM8A 1KGCE 3WXWL 2DLEA 5DJ8B 3GI8L 4GXVL 3T8MA 3HEIB 3A6OA 2R83A 12E8L 3O81A 2XBTA 1DQQB 2CGYA 3FTSA 3FF8A 3H3PL 3MPCA 4Y9BA 2EEFA 3STZA 2VSCA 4I9WE 3M1BA 5B22A 3DVIA 1XIWA 3C5JB 1G9HA 1HYSD 2PCYA 4MAUH 2B77A 2CJUL 5IOPA 1F3JA 2OZ4A 2CLRA 3UOAB 3AREC 4B9GA 1V7NL 5D7SH 4DKFL 1SMOA 4HP5A 2X4RB 3DUSB 4M62L 4DP2X 1KJ2B 4NNPH 4QO1A 3RUGF 1ZVYA 4HX1A 2DW5A 2N7SA 5KZCB 3P9LA 1PY4A 4IBUA 3T1FB 3BSHA 4CVXB 3QXDB 1NCJA 4ZBJA 1UM6L 2EH8H 1PSKH 4M7LL 3TFBA 4EVNA 2EDHA 2FJUB 4BUQA 3RKDC 2HLEB 5FA4B 4BCZA 3BKJL 2XDHA 2V7HB 4NNXB 1YDPB 2QQLL 2Z7YA 3RA7L 1MHHA 1QWUA 2QL1A 2Q86B 1UM4H 2H0JA 3P40A 2LVCA 4OCLC 3T04D 2ZTBA 4UQ3B 5D1QB 2E7BA 4KRPD 3RNQA 4U1MB 1L0PA 3VTMA 5I75B 1KLUA 4PWHA 2ZJSH 3IDIA 4AI7A 1BFTA 1Q0XH 3VJ6A 1RZFL 4E2OA 3C60C 4UQ2B 5HP5A 4KX8A 5DRZA 1MLBA 3BKYL 5DO2C 3DPBB 5AQ0A 1AGBA 3BD4A 4MB4A 4PRBA 1HEZA 5FGBA 4KXAA 4NJ9L 3QXAB 4NN5B 5D4QA 5GISH 1QW9A 3NCJH 4AEIH 3DMMB 2AQPA 4R7LA 3L3DA 4WGKA 1I7TB 3HMXH 3HRZB 1ZLWH 4LOEA 2X7LB 1BIIB 3N50A 1B0GB 1UKQA 2BIOA 4NC1E 2I60H 3ETBF 1LGVA 4LVNB 2EH8L 3HB3D 3SYOA 1AC6A 1URLA 2O6PA 1JPTH 1BPVA 5I24A 4FQPA 1H3TA 4XN4A 1MCBA 3FO2A 2BP8A 3U0PB 2YO3A 3C6LA 1O6SA 2X4OA 4ZMOA 4IW4C 4J3OG 1XZ0A 32C2A 3WAJA 1WFMA 1UM4L 2ZZUT 5DHDA 1P5UC 3Q2LA 2NY5C 3AABA 5BXFB 1WHPA 4BHUA 5CCKH 4FQXC 4OZGB 4B6ZA 5IEHA 3HS8A 2H8PB 2D8KA 3A47A 2DKSA 3OM3B 1MW1A 1T04B 2FT6A 4U6TA 2H45A 1Q0XL 1KB9K 2E9IA 3A6CH 4RQQB 3R19A 4RGNB 1N6UA 2AQTA 5DD0H 1IFHH 4TSBH 4RWYH 1SVCP 4AC4A 3OAYK 3PHSA 1AY1L 4X99B 5IEKB 5HGHA 5DRWB 1YMHB 3NCJL 3D2UB 3L3KB 2XX1A 3HMXL 5BZWB 5FHBH 3WYRA 2Q20A 1OP9A 5DUBB 4QCIB 4U6XB 4ZFOB 3SJVA 3QUKB 2I60L 3OVUB 4G7SB 4JR9L 4MB5A 3GSWA 4XO3A 3CSFA 3K4DA 3OR6B 5J9PA 1CL7I 2E9WA 2W59A 1AJ7H 1B4LA 1SY6A 5F9JA 2W81C 4O9HH 1UD2A 4RZKA 2XXFA 3RPKA 5KSAB 2GYSA 4J3OC 4DGYH 1UWYA 3S36X 1F00I 5IF0B 4XHQA 1Y1DA 4PS7A 3ZT7A 2F1EA 3TWCH 4DOHE 3SPIA 1ZVSB 3DX6A 2DQMA 3SE3C 3UGUA 5IQ9A 1F4HA 2WXQA 3NZSA 4TRPH 3HHSB 3NG5A 4HJJH 1A6AB 4L1TA 4P4RA 5EOCH 5BZXA 1IAKB 1F02I 3D85A 1TCRB 2WLIB 3OSVA 1IFHL 1A02N 3SDXE 3M6DA 1CD1B 4MJIE 1YEGL 3LIUA 3RGVD 3B3BA 2AVFA 2EDLA 5CD3B 3NFNB 4Z7AA 4GQ9H 5DRXA 4S1SH 5LCVL 5FHBL 4POYA 4NWUL 4Z7NB 4NZUL 1KNOB 3AY4C 2V7NA 2P8LA 1WBYB 2UZIL 5CEYA 5J5EA 2E9JA 4M93C 5TE7H 2DWDA 2J73A 2VGLM 1S8DB 1AJ7L 4OLWH 3RFRA 1P0SE 4Y4FD 4YEEA 4ZOCA 4UQCA 4WHYG 2Z93A 3ZE1F 3BPLB 5HY9B 5F6HI 2DTSA 3PABB 1G7LB 2OMXB 4BH7B 1D5ZB 4ODVL 3CDCA 1TTRA 1EVTC 1H3WM 1T0NB 3F58L 4LHQB 1TQVA 3L48A 3O3EB 1DEDA 5DUJA 5AOKA 1OSPH 3UYPA 2F54E 4Y2DA 4JAMA 2BY2A 3TBTB 1AHWC 1QFWM 3QUYD 2AV1B 4F33B 3PWVA 1MLCA 4PR5A 3CQQA 4MXQC 3LZFL 2WW8A 3DXAD 3TOPA 4C83B 4EZKA 2CR0A 3KWTA 4S1SL 2AJ3B 3QUXB 4QXWA 1LE9B 5MENA 2HJFB 3VNYA 2ZX8A 3ARBA 1YZZA 2GITB 5E9NA 1FLRH 2QFRA 5TE7L 3A23A 4H1LA 3MRGB 5FK9B 1P7HL 4JG9A 4OT1L 1J10A 2XZQL 4OLWL 1EA9C 3D08A 3VXQA 5H2BB 4ZXBC 4CL7A 2DMGA 4MLSA 2BC4B 2DQUL 4Y9EA 4X4ME 1FLTX 1U8KB 4FA8A 1FL5B 4GAYA 2C26A 4IGBD 1U4FA 3THMH 5KVGE 1RJYA 1CDYA 2QSQA 2Z0BA 4DN4H 3BFQG 2KS0A 2ESVD 1UXSB 3ATDA 4Q7DA 4K3JH 4BZYA 1M2OA 2B4CH 1MHCA 1EGJL 1OSPL 4R3SB 3V6ZA 4BSWB 5KJ7E 5C92A 4LPCA 1OF0A 4NI6A 4ZPVA 4X6EA 4PTUA 3O4LB 3QRGL 1OW0A 5C07A 1GTNA 4AQ1C 3IDGA 2Q6WB 4DO6A 4G1EB 5HGBA 2CD0A 1FFNA 3IE4A 5ACZA 2QJDA 1UH2A 2ZX6A 3MBWA 2H5UA 4E0RA 4ODUB 5G55A 1LWJA 5AAMA 1TU2A 4GUCA 4JRXE 3KPQB 1FLRL 3RGHA 4CVZA 3P73A 4JLRB 3T3PE 3GS7A 4LHUG 5BZDB 2NMSA 4K8RL 3O9WA 4MHHI 2C9VA 1N7MH 1F97A 5I6KA 3QAZB 5J56B 4OLYL 2HLAA 5BMFH 3SQOL 4JE0A 2FX9H 4KVNH 1NGPL 2VLMD 5TK4A 3THML 3OG4B 2IOMA 4YX2L 2C4FU 3I3EA 3T08A 3KPRB 4M7LT 3MX0B 3LV3A 4K3JL 5HI5C 2R2CA 3I6KA 2B4CL 3E2HB 1A64A 1OT1A 5LDSA 3BN9D 4PJ8C 4ZUUB 4XX5A 5FUCE 2JI1A 3MRJB 2PR9A 4R90H 4F57L 3INUL 4MAYD 4AW7A 3NJIA 3FTVA 2W8CA 5FM5O 5F88A 2WNKA 3N2JA 1UD8A 1ADWA 3BAWA 3T3MB 3RU8H 3L5WA 4KGJA 4R4FH 1AVAA 2NXZC 1MAJA 4OR1A 3VWKD 4J4PD 4I4WA 4GO8A 5I8CA 1KN2L 1B6DA 5E6RB 1TMQA 2A7BA 1N12A 1OD9A 5DZ9A 4XVTH 2APXA 3KXFB 4OZHE 4WQOA 1JGDB 1MZYA 1ZY9A 2PP9A 3F7YB 5AWNL 1N19A 1X5IA 4KVNL 4R2GC 1CD8A 4ALAC 5TQ0L 1BZ7A 1X5MA 4XP4H 5JMOC 4AIXA 4D0CB 4KMLB 4F8LA 5LGHL 2MQCA 1FFOA 1FWXA 3QDGD 3V7AG 5F7HA 1WZ1L 2WNWA 5DK2B 3VXPB 4J6RL 4JO3H 2KDGA 4AM0A 5L4FA 4PGEA 3TN0B 2ZUSA 1JFHA 4KZEH 2CO3A 4HZLB 5EEWA 1WFJA 5CBAA 1PTZA 4MRBA 1CB4A 3GDCA 2CJ3A 3L1OH 4ONHA 3M07A 4MVBC 2FO8A 3ISYA 5AAPA 1JGIA 4XXDB 4S10A 1ETB1 5EBWA 1QLEB 2Z8WC 4NPYA 2BX5A 4GKSA 3QULA 4K3EH 1KT2A 1TO4A 3WKML 5KJRL 4MJ2A 3CH1B 5FECB 3BQUA 3GMRB 1DSFH 2M8XA 1KXHA 3CZKA 3GNMH 2OMBA 4TVPH 1FC2D 3QZNA 4LOUD 5GS3A 4A67A 3EBIA 4IRSD 3DK0A 3OAWA 3MNZB 3P54A 2A74C 5CEZD 2YEZB 3NACH 1E30A 4ACTA 1KB5L 3MLVL 3RZCD 3X11A 2WUBH 1K2DB 1KIRA 3AQDA 7PAZA 1I1AD 1P7KB 2F8IA 2IO5A 3GSVB 4BM7A 3WEMA 4RAUA 4A2FA 4BQ9A 3RJOA 5LN4A 1K5WA 1JYWA 3DBXB 1CG9B 3NT0A 4NWTH 5F0PB 4XRCA 1OP5H 1UZ6E 2W5PA 3ARFC 1SJEB 3NJGA 4Z7WF 4Z5RB 3EYFB 5EHFA 3QWNA 5HHOD 2IJ0C 4HHGA 1H6UA 4OCXL 3QIBD 2XPZA 5CLXA 3EJYC 4L3CA 3DV6B 3L3HA 4CU8A 2K0RA 1IL1B 2RR3A 3HC0A 3W37A 2V8MA 4L1DA 2VITB 3FQXA 3FTUA 5D1ZB 5C6TH 1FGNH 2W60B 2P24B 3TEWA 2BIQA 3OKOA 3KM2A 1CLOL 4ZK8A 4AW4A 1DSFL 3HZMA 5DEZA 3CN1A 4NZTL 4LLDB 4XPAH 2KKQA 3LPFA 1OAYL 2QADB 4URTB 1MFBH 3H8NA 4U6YA 5E8DH 2PTTA 4PRDA 1VEOA 5JQHC 4HJSA 5B21A 4TLKA 3LS5H 3VXRA 4HIXL 5D72H 4GRLB 4EZMA 1JHTB 4A7SA 3BXNB 4XP9L 1XF4B 1MVFA 3W82A 1AGFB 5EOQL 2D31B 2XI9A 4KKBC 3QYMA 4Y5XA 1LO4L 1TKWA 1AD0A 4N6RB 5D1XB 3RWDA 1FYTB 2X1QA 2R4SL 1F3RB 5GS0L 1I85A 4TTDC 2FWOA 1E28A 2JNZA 2QKIC 3QXVA 3QE5A 1YSOA 5CXPA 4FQ1H 1V3KA 2RMNA 4JPKH 1KCVH 1RK1A 4NDMA 5F44A 1KIUA 5C0AB 1FGNL 1U92A 2I7OA 4NUJB 1MPAH 1NGXB 3GKZA 2IPUG 4I18C 2W07B 5DK0B 4P57A 5FYJU 1GGYA 3CV5A 4MD4A 2GHWB 5GGQH 3VWJC 2GJ6B 3AACA 1H8NA 4CW1A 4CJ0A 2KQNA 3ZUNC 1ZV9A 4F9LC 1FJ1A 1OCCB 3EO1B 4XMZA 3WE6A 1RUPL 1BVOA 4PV8A 3LKOB 3HW7A 3P4NA 2AK4B 2HX8A 4M3KB 1OAQH 1NBQA 3E6HA 3AY2A 3GTVA 3NK4A 5A16B 1QFOA 2P5WA 3QZWG 4R26L 4P3DA 3SDAA 1Z2KA 5F21B 3UTPD 1F8TL 1G1OA 4XTRD 5SWZD 1B9ZA 3GS4A 4MNGA 5AUMB 3QJFA 4PJXA 4F7PB 2F6AA 2LU5A 3KS0H 1AQMA 3ZRFC 1E8XA 5CJXC 2EDQA 2BHUA 5F6IB 5F89B 3CVHL 2DQ6A 1ZANL 2DJUA 4UTCA 4FQ1L 4BEIA 2GIMA 1IGMH 2BJML 1KCVL 2AGJL 1MNUH 3FCTB 1OLZA 1GC1H 2JV6A 1GGTA 2K4AA 1GXEA 1UC6A 3BESR 3Q3GA 2IGFH 4YBLB 3S5ZA 3WG7B 4C4KT 1B9KA 2CKBA 4GLRI 3SKOB 3OWRA 1RIUH 2GAZB 3MXWL 5IESH 2VXVL 4FHKA 5T3XE 4NRYB 4HFWB 4P23D 4YDVB 1WZKA 3V4VB 3VXOB 1JDCA 4PLJC 1PG7X 4QKXB 2TRYA 3QUMB 4GS7B 4JDEA 1AQDB 1OOWA 1OAQL 2NY3B 3CMGA 3KPSA 3P3SA 5D6CB 3VGGA 3DUUB 1S7RA 3X17A 4EQ3A 3BUPA 1DUZA 3BZEB 1DL7H 1OZTG 2VISA 4OD3H 1HL4A 4H20L 1GHFH 4P2QB 3TBVB 3ZDXB 3HC4H 1W0WB 2VRAA 5F7KC 1CGWA 2PWDA 2TSBA 2WVVA 2YK1H 4YE0A 5CCJA 1RJLB 4P49A 1INDL 4F92B 5LXGH 2E4TA 3WD5L 3FHAA 1LD9A 1J9CT 1JF6A 3QO1A 3BVXA 4X6CF 1R5VA 3NCFB 1PQZB 4WK2B 1WP6A 4XPBL 3CSBA 4DFIA 4XMWA 1TJMA 3WMSA 4HALA 5CUSL 1QAWA 1X9QA 2HRPH 4HJUA 2IGFL 2SEBA 3QWOB 1BVKA 1NUGA 4AQEB 1S9VB 3BPCB 5EC1A 1HCFX 3MV8B 2K9UA 5IESL 3BH4A 3UTZA 1IM9A 4QRQA 2ENYA 3WO4C 2FSDA 3SPVB 4NFBA 2WPGA 4MKTA 1K4DA 3POHA 2R2BA 2E7MA 4M6NH 4X4KA 2DLTA 1X5XA 2ZXAA 3SZKC 2DM7A 4I89A 1MKFA 2KZBA 3AB0B 4TPRH 4ESKA 5ICUA 1DL7L 5AW0B 4EE2A 1T1ZB 5GGTH 2YK1L 4PWEA 4PJBA 4YHNA 8FABB 1YC8A 4PJHA 3RY5A 1ZA6B 1FRGL 4ETQB 4AH2A 3Q2WA 4HLEA 1BP3B 1HH9B 1MCOL 3O41B 1DEEB 4DT2A 1ZHLB 2NDFA 5DWUL 4FJYA 3APCA 1IAMA 4AQZA 4G8IA 4Y5VC 2HRPL 2L3BA 2XG4B 1NWOA 1XT5A 2HH0H 5AVVB 3AMLA 4Z7OE 1I7ZB 5IB3B 3C6SB 1ZAGA 2FSEA 1N0LA 3L13A 3ZW3A 5CS7A 3CDGA 2EIEA 5KJ4A 5J4MA 3D25A 4MNQE 3CLFH 5F7DB 4PW4A 2N3JA 2DWXA 2GTWB 5EIIA 4L4VB 4TPRL 4MCZA 2J56A 4Y9CA 3V10A 2X1WL 3H9SA 1GYWA 1ICTA 1MWAL 5BS0B 3F12A 1TCMA 2XXGA 3GMLA 5CM1A 4L37B 4FTVA 3CMOH 5E9DD 2V5TA 4LSVH 2X2JA 3KHOA 1QHOA 4HC1H 3RY6C 2J8UF 3CFMA 5FB8A 1CFQA 1NDGB 4HMEA 4AXWB 1YJDL 1RUMH 1KB9J 1H15A 2Z92A 3PV6A 3O6FA 4MSWB 2D7MA 4GBXA 4K94C 4NUMA 4NQSB 5CGYC 1BQ5A 3K46A 1OCZB 4IRJB 1FDLH 4QTIL 4EJ1C 4X8GA 1E4XL 4GQRA 2XN9D 4PJ9C 5JHMA 1FORH 4F15C 3BAJA 3N40P 3TA3B 2J5WA 4ZTOL 4N3TA 4Y19B 2D0HA 5TFSH 3CDFA 3CLFL 1F1DA 3MGOB 1I9JH 3BEWA 3D5OF 5E2UL 3RDTD 3BAXA 1QW8A 4AGQA 2H9GB 4KJPD 3K6DA 2AFNA 4JQVC 1VSCA 1N8OE 3LN4A 4FXTA 4M61A 5C0CB 4E68A 1CI5A 3EGXB 4S2SB 1OPGL 4HBCL 4LCCC 4LZKA 4XX1G 5DUML 3RWJB 5I0XA 2E74C 1JZDC 4OV5A 4P2RA 3REVB 4HC1L 2V0AA 3DBSA 3NMEA 1RUML 4HT1L 4URKA 3PNWB 5KS9E 3VX1A 4HQQL 3NN8A 1OL0A 5L0QB 5BVJB 1EJOH 4P2OC 2R15A 5IOPB 1FDLL 3SDDC 1F3JB 2HFEB 2Q1EA 4JREB 2Z4QA 3OAZH 4OVVA 3VXTA 3AMKA 4U0RC 3HG0A 1RERA 2AJZA 4YE4L 5TFSL 2IDSA 4OJYA 3SDCB 4QO1B 1I9JL 2R69H 1OT2A 2NY1C 3MV7E 3HI5L 4WI0A 1F4WH 5AW1B 1IBZA 3LY6A 4NZRL 5E2WL 1F3DJ 4AVHA 5IJKC 1ZTMA 3U2IA 1I7UB 4E41D 1KCKA 1GZHA 2X53A 5T3ZH 1CDCA 3VGFA 4R7NB 3HRPA 3X1BA 3RL2A 4JJHA 2EILB 4WV1A 5DJ2A 4O2EB 4XCYB 2J8HA 1TETH 1DQKA 1A14L 1FNGB 1A7RL 3KVDD 3LXAA 5D4HA 2PW1B 4N0UB 4G5AA 4P5TC 5GRWA 4DHLA 1OZUA 1JK8B 3UZVA 1KLUB 1JYVA 3JWOH 3CGTA 1SXAA 4H44C 5DRZB 4M7ZC 4F7MA 2JI3A 1TXKA 3NCWA 5FCUH 5F7YC 2BIMA 2B14A 2P5WE 4NQXB 5DD3L 1YUHB 5IVXA 4KK8D 3RVTC 2JKSA 4Z8FH 4PJFA 3L3DB 2H2PD 2R69L 1MW3A 2ICEB 2FZ3A 3I50L 4LASH 4ZUTB 3S97C 2G9HB 1F4WL 4PJXE 5E8NB 3NP3A 4EN3D 5SX4H 4P46D 1WG3A 2B3RA 3OHXA 5IFAH 1NGZA 1S7TB 1E4HA 4OV6F 2DIBA 2NY4D 5FYKE 4IM8A 3FT9A 3RWEB 2BRRL 3C6LB 2HFFA 2X4OB 3L7EA 4FQHB 1UJ3A 3LKNB 1XZ0B 1TETL 1SRDA 3VD5A 1RVFH 3BPNB 1MEXH 4ADGA 1UKSA 2D3LA 3RVWD 3QEQB 5JIMA 5BJTA 3GMNB 2PTVA 4MBRA 4KJYB 4YVUA 4EUPG 5MEOA 1MCLA 1UA3A 3GHEH 3BVNA 4O5LL 3ESMA 3MQIA 4WJ5B 5E5MB 2CLZB 3D4YA 4HXBH 2E6PA 2F5BL 4LLYB 1I1CA 1UB6A 4GT0A 4CMMA 1GCYA 1DBML 1E2VA 4KKCC 5HYQB 2V17L 1DQVA 3MRHB 3VI3A 4RA3A 1EHXA 5I28A 1TIUA 5I30H 4K5LA 3KPLB 1JRHL 3T0EC 2ID5A 4Z8FL 4LASL 1HJBC 4OZIF 4IHBA 4FF9A 1INEL 4NQTA 1F2XK 3MRBA 2DB8A 4KXBA 1PX8A 4DJMA 3GXDA 3QA3A 4UOQA 3L3IB 4BKLB 5J9PB 1WE5A 5IFAL 5DQJA 3A67H 1ACYL 3QQ3A 5F9JB 4OBSA 4QTFA 4FN0A 4ABWA 5INCA 4P5MA 1W9XA 4ANUA 4XOBA 2GK2A 4HLZG 1C9SA 4OF6A 4X8CA 3C8KB 1MEXL 3HI1A 1RIHH 1GYAA 2GTZB 3OLGA 3KYKH 3IDNA 3GSQA 3KJ4B 1FZMB 4MVBD 4V33A 2GSIB 5C0DA 1Q1JH 2IDFA 2DBLL 1YQVH 3RG1C 4BK5A 5I66A 3MRDB 4J7RA 3FCSB 1MCFA 4H7VA 3UPRA 5E03A 4NX0A 4JNXA 1DLHA 1JFQL 1JP5A 2DQGH 5F6HJ 1BV8A 1S5IL 4Z7UA 4L8SB 5D1QE 2J57A 4KY1L 3VXMD 2XN2A 3PL6D 4PHZA 4LB8A 1OD7A 2JKJA 3I75B 3K71B 3PIQA 3EO0B 5GS1C 3DO7A 3GSNB 3HUJA 1RSYA 1OE2A 4PJBE 1D9KA 3BKCL 5IBTH 5IMOA 3N9GH 4U2ZA 2XQBL 3MLSH 4M8RA 3TIEB 5MI0C 3BD5A 4XWOC 1ZHKB 2J21A 4MA7L 1VGEL 1J8HA 1A6VH 4MJ4A 4NKDB 4ZO6A 4JFQA 1KCUL 4PJ7F 1OTTD 3PU7A 3OR7B 2YAEA 3IKCA 1KLGA 2NT0A 2EDJA 1D5XB 1KIPA 2PYEE 4ZNCD 1CXIA 1KV3A 3LRHA 3EOAA 5C09A 2NCMA 3LZLA 5KBKA 3U6RB 2VDOH 4YHIA 2A5UA 1UXWA 1QSEB 2EIMB 1RIHL 3IDMB 2Q76A 4KNTA 5J1AB 3KYKL 1UA6H 1SN2A 1E0OB 3AGWA 3MU3A 3SGKA 4X5WA 5ERWA 2PTUA 3FT4A 2I69A 3BZ4A 3U30C 3UYPB 4H88H 1N2RB 1WLGA 1TZHA 5E6IC 1GZQA 4LF3B 4N5ED 3V6BR 3PWVB 1R5IA 2DQTL 2FH6A 3C87A 4ZSOB 1BBJA 3ZTNL 3KWUA 2BO0A 4OZGE 3BP7B 3H9SE 4RBPK 3IXAA 1SOSA 4PU2A 4G8EB 3QUZD 1ZT7A 4OH2A 5DJ6B 2YWZA 1UWEH 1IZKA 2ITCA 1S7UB 1LEGA 1XHHA 2VSMB 3L17A 1NUNB 3LYRA 3NRFA 5GGRA 4KITB 4LL1A 1A65A 3N9GL 4N2MA 1X5GA 3MLSL 1DVYA 2Q5BA 4WEBH 4H1LB 4S1RL 4FLHA 3BP5A 5F7MC 3CH8A 2WYTA 2B7DT 2XTJB 5J3HC 3TPUA 2C3XA 1Q0YH 5AOLA 3IBOA 3K6FA 4N8UA 4F20A 4FG6C 3HMXA 3MI6A 3VU2A 1ZPLA 2O6DA 4G1MA 3GBNL 4YR6B 1RJYB 5CLWA 1OARH 1UA6L 2Z1KA 2BNQD 2R9HD 2L0DA 3H9HA 3VMOA 5GRYA 3SKJL 3VSTA 2H3NA 3FRPB 4GRWE 1N5AB 4H88L 4IQHA 5B39A 2E9BA 5C2BH 5JORA 4XCEB 3NTCL 3AT0A 1BVNP 1T1WA 3ME0A 1J5HA 3DJRA 1HILB 5JOFA 2GJPA 1KBWA 4UTAH 4ZAKC 5F1IB 3HG3A 3WV0A 2O5XH 1J8SA 1E4KA 2IH8A 1UWEL 2FQEA 5EZLB 1KYUA 1A6TA 4YC2C 3U4KA 1L7TL 1NCOA 1JNJA 5C3IA 1G9MH 4UM9D 4M48H 2V2XA 3P73B 2OI9B 4P8QA 2A77H 1UT9A 4WO4B 1A1OA 3HLAB 4UILL 2EC8A 2BOCA 1XTMA 4A1RA 3FTGA 4OGAC 2HLAB 4OCYH 4ZD3L 4XCFH 4Z7NE 2IDUA 1X7QA 3WFHA 3RPIB 2EZ0C 2VLKD 3VGEA 1JPFA 5FO7A 2Z31A 4FMVA 1B3JA 4G9FB 3BMWA 4I1NB 5AW4B 4WWOA 1J18A 1C5DA 1HQ4A 2NPLX 3IB4A 3IJ9A 5EUOF 5I16B 1MUJB 1VPOL 4X4YA 2B1HH 4U1NB 2FQGA 1QKZH 5AZEL 2J44A 1QRND 4UTAL 5GZNC 3EYUH 5F7WC 4TULH 1VESA 1ES0A 1OGAB 3JYBA 1DJSA 4DZ8A 5B7MA 1EDHA 2O6CA 4NQEB 3RRQA 1KYOJ 1G9ML 4Z7VF 3RUGA 4NKMB 2X89A 2Y7QA 5JDSA 2F58H 3IWUA 2Y5TA 1QTPA 3MC0A 1ZDSA 1SDDB 2AEPH 1CFVL 3JTTB 4HJ1A 2JKNA 4NC1C 1EIBA 1OE3A 3JQOB 3H53A 4XCFL 4JPVH 3V4UH 2MPAL 2JXMA 2Q3XA 4KK6C 3SPHA 4TN9A 2YHGA 3RVUC 3H0TA 3VE0A 3VX0A 2BXZA 2R29H 3PAUA 1ZEAL 2QFPA 5F3FA 4H8WL 5HI3D 2EDXA 1S46A 1MJ8H 4L0ZA 3RGBA 1OP3H 1MCCA 2WM0A 1GSMA 1D7CA 2JKWA 2B1HL 1OQOA 2WP3T 2QVKA 1KPRB 4TULL 3RWHA 1F4YL 4N2BA 4OGQC 4XWGH 5HTSA 2CO7A 2VABA 3QQ4A 1JF1A 3VFOA 2IAMC 4BXSV 1QSFD 1U2YA 3FQWA 1EGJA 1I8IA 2R39A 3O4LE 4JFPB 4OLZH 2I07B 4C56B 4KI5D 3HR6A 4UQEA 3OC8A 3FUNA 1FHNA 1CGSH 3V4UL 4PRHD 3E6FB 4TXVB 3P4LA 5FYJE 5AG9A 1B2WH 1QEXA 3VRIA 5ISZD 2FX8H 2CDFA 3CZFA 4Q14A 1UEMA 3QW9A 4PSRA 3VI3E 5DURB 1KTDA 4WCYL 1OHQA 2E3VA 2DOCA 2F19L 1LQBC 2I24N 1MJ8L 3S4SB 4WSKA 4R96B 4L4JA 2F5AH 3MRKB 1EJ8A 1TJGL 3J7HA 1I1FB 3QGVA 2R56L 2X41A 3FU9A 2J8UB 3L3HB 1RKRA 5ICZA 3GMPA 3ZHKA 2PWEA 3KYNB 2IANA 1Y18A 3UYRL 4KJQD 1JGLH 2I9LA 3IYLW 3K72A 4S1DC 2ICWA 5DHVB 3JZYA 3H4HA 1A3LH 8PAZA 4GXFA 2RHEA 4AYSA 5BV7C 1JXFA 2O72A 3I84A 4ZTEA 2BERA 2PXYD 4R0LB 4KTDL 1CLYH 3LNHA 5BW7C 4OJCA 1PL3A 3T3ME 4RGND 1TFHA 1IGIH 3N1MC 4W68A 3UTSB 1J05B 4YHZL 1OSZA 1ROCA 1BIHA 4L0PB 1MH5A 5SX5H 1CFSB 5H94B 3D2UD 4Z7UE 5I71B 1DCLA 5EN3A 4ANWA 3M17B 5E8OB 3UZQA 4W9CC 1H9DA 3DVNA 3BI9X 5D55A 3MDJA 4Y5XB 1DVFA 2XWTB 3ATEA 1WD9A 3O3UN 3QJUB 3VXUD 1KZQA 3C9NA 1GGUA 3SKNA 1J8HE 1RK1B 4U4IA 4X7DC 1ETZB 4RAHA 1U92B 3LRLA 5C09E 3TT1L 3SQBB 4CNIB 1QR4A 2ZCHH 3EUUA 2OK0H 4FXKC 1GY1A 3EGSA 1JWUB 4MD4B 5BCAA 5KSVA 4JY6B 5E08H 5IFHH 2FBOJ 2FAUA 1YPZB 1H5BA 4JM2D 4YO0B 4APQD 4QNPF 3Q44A 5LG6A 2QPEB 2EIKB 1BQHG 1IGIL 1PKQB 1VZGA 2IIJA 2MCAA 3I85A 4PBXA 4XMPH 1U8MB 2AXJA 3WE6B 1L7IL 4J3OH 5FS5A 1GKEA 5G5DB 4JEGB 3DVGA 1OAUH 2NY5L 4NRZB 2OLDA 3PUUA 2YKLL 4LSRH 4P3DB 2CUMA 3SDAB 5A3IC 2LQRA 3WIHH 1UACH 2DMHA 2DV6A 3VSQA 5C3LD 5DCCA 3MNVA 5JR1H 5IIEB 4M00A 2P9RA 2OSXA 2X0WA 3ILPA 1OM9A 2LR4A 4DTGH 2D0FA 1KB5A 1XX9C 3ABGA 1OT4A 3LKSB 2XPGA 2QTEA 1ZTXH 2DAVA 4YZFF 4EIBA 2JJTA 4M9PA 1PLGL 4PMFA 3W9EB 1W0VB 4FNSA 2OV0A 5KSUB 3CHPA 5AD0A 4KPHH 3LCYA 3AU1B 3TVMC 3DRQB 3SO5A 4YSEA 5E08L 5LBSH 1TVHA 3RLSA 1PDKB 2VDOB 5FWRA 4F7CB 2DM3A 1M2VA 2IALA 3EBHA 4KV5E 5I1IH 1JV5A 3PRZA 3RX9A 4NCC1 3TP4A 1J9RA 4YFLF 4K3DH 1QQDA 2RGSA 1ILSA 4XMPL 4U1IA 1XF5A 4HJ0C 5DJXA 3KGUA 5DA0B 2ATPB 3PWPB 5DJ0A 2ITDB 4EIUA 1S7RB 3HE6D 4OGXL 1J1OH 2Q8AL 2YPLA 4ZUWA 1WUNT 4HWNA 4K9JA 5LGYA 3P30H 4RNRA 3GHBH 1R1CA 3QNYA 2E7DA 1DTUA 3HE7C 4HJTA 4JO1L 4XAKD 1ZTXL 4MA8H 4FQ2L 2X70A 5IR1B 3RWGB 2A6IA 3RWCA 1AO7D 4R4NC 4YXKH 3PYCA 3OKDA 2GTQA 5DVPA 3Q8BA 3AQXA 3G6JB 5D1XE 2P80D 5EZOH 2BFGA 4Y16A 4UNUA 4Y88A 4PMEA 1VLXA 3HZVA 4XC3H 5LBSL 2ZWYA 1U3ZA 1EWHA 3LXCA 3MNWB 4HSCX 2VT0A 3LQAH 4ODWA 4QAMB 4QHNA 4FLQA 5I1IL 3FQNB 5GXBB 2W1NA 1RZQA 3CX5K 3UTZB 1IM9B 4XMLH 2Y2YA 3DX7B 3S7GA 4MQ7A 5C0AE 3CN4A 4UNVA 2OTWB 1TQCC 1RZ8A 5EBMA 4B50A 5EU6D 1J5CA 2YD9A 1TYJA 3VXSD 4TSAH 4OZIB 2JCCA 2COVD 3WEXA 3QPXL 3D7PA 3FT0A 2VDKL 4I3SL 2VR3A 5IOKA 2GJ6E 5LGJB 3EG9B 5JXED 5E1AB 1M7DA 3LSOA 4L8BB 2NUTA 1IARB 3BP6B 3TO4D 1HHIA 2MTPA 2YAPA 3RUGE 2APTA 2PUQT 3MBEC 2AK4E 4G82A 2Y72A 3D52A 3PQYB 3QQDA 1KDIA 4JW3A 1A6WH 2DN7A 4ZUSA 1HHHB 3LPGA 2WWMC 1II4E 2EE9A 4UQBA 2ZXCA 2KMWA 4L5FH 3SDYH 3W0WA 1J0ZA 3FOLA 1YN6A 3NJHA 1MJUH 3VRJB 2VW6A 1UH3A 3WBDA 3B6SB 3KPRD 2A9BA 5JUEH 3HLKA 1HXYA 4GFTB 2AQ1A 5ITFB 4B9FA 4BDVA 4MS8C 4D0DA 2FSEB 5HD8D 3LN5B 5AB0A 1NJ9A 3CVHA 5B38G 5F7NC 3QI9A 4IJ3B 5JIHA 2AF2A 4BELD 1QFWH 1IAII 1L6PA 4TOYH 3F6JA 1TYEB 5BO1L 4HWEH 4FULA 4DPAX 1PIGA 4MNHB 1PZ3A 4AJYV 3ASOB 1MCKA 4X7EC 3WUZA 4DGVH 4YSAA 5INDA 4AJVA 2AQ2A 3GK8L 3F12B 1EEQA 3ZHDA 4HV8A 4PJ7B 4GNKB 2L7UA 1MCDA 3LRMA 1MAKA 2YD6A 2BFVH 3SBWA 4DN3L 2OX5B 2QQKL 2X1OA 1FO0L 1TVBA 4WWKA 2RTTA 3SDYL 2C3GA 3ZKND 5EEUA 3B5GA 3VFWB 1C8PA 1MFUA 4IEFA 2AI0H 3PJSA 3MGAA 4GBXB 4JN2B 5IHUH 4C8XA 3VFVB 4CA4A 3QH3A 5EO1B 3CXDH 5IVZA 3ZGIA 1KXVA 3IJ7A 2F8XC 4JPQA 5JW3L 1JI1A 2HT4D 4XWOD 2HFGH 1J9SA 2BDNH 1YRKA 1P9MA 3EFOB 1NGYB 3EJRA 3MNDA 4MA1B 4O02H 4XE5B 4HOXA 5JNYA 1A2YB 4XNUH 1QFWL 1MOEA 3DGCR 3BW9B 1NANI 4TOYL 1SN0A 2Y1AA 4PJIF 1IX2A 2WTRA 4RMSA 2GT9B 5F8RC 4B7IA 2DQEH 3MV8E 4DGVL 1R3KB 4HIEB 1P1VA 4HUWA 4KO5A 3DOSB 1ZIBA 3FB5B 3LKQA 3TH2T 2BNRA 1WV7T 2YN3A 3PP3K 3TV8A 3UBXA 2CRIA 1WBZB 5D8JH 1YNTA 3TA4D 1OAZH 3GZKA 4XHJD 1ETA1 1EEYB 2VW4A 2XXMB 3HG1D 5E8EB 1E5UI 3VXNA 5C0EB 4PJCF 4YHKL 1T03L 2NX5B 2VQUA 4H8PA 3U2SA 3FTYA 1QBML 3SO3C 4MA3B 3RL1B 1UURA 4YDIH 3OKLB 1ITCA 3AFLA 3CXDL 2F7IA 2PETA 2C1OA 5BVPH 2HFGL 2E47A 1YC7A 4JDTL 3ZL4H 1DN2A 1ET7A 2AJZB 3VFGH 5IWLA 3CHQA 4L3EA 4XNUL 1XQ4A 3L4XA 3VRLF 4IMKC 3ILQC 4OUOA 4FEMA 5AZ2L 1RIVL 3HAEG 5E0QA 2E7LA 4TNWF 4ALAL 1JNNH 5CHNB 3VG0H 1TZIA 5K59F 1JYXA 2DQEL 1A4JB 2X4NB 4OQ1A 1F6AA 3HI6L 2WINB 4PI0A 2DZEA 4Y2DC 3O8XD 1NC2B 1XH2A 1BVLB 1GGCL 4DAGH 3SB3A 1GR7A 1XH3B 4APXA 5CCHE 3I02B 1Z9OA 4U1SB 1A7OH 3PREA 1SLVA 4XOEA 4LRNH 5M94B 1UJTA 3WN6A 3DX8B 5I9QC 4JPIB 3ROLB 4XNYH 4LQFL 4L2LA 1G1YA 2ZG3A 4A04A 4ZI8A 1BG9A 3U0TA 2EYRA 5F9DC 4A7UA 1WCQA 3OJVC 4KTEH 5JQ6L 2G3MA 5GHWL 5KSBF 1O75A 4IIQC 5EUOB 5BVPL 2E8ZA 3TJEH 2I25N 3TZVB 3VFGL 3A4EA 2KZ1B 3TCXA 4G83A 2FJSA 3O2DH 4NKIH 1FYTD 4LCVA 2FZ3B 5E0FA 1AKJA 1MWOA 1SXSA 3RWFB 1JNNL 2CGRH 1EO8H 1F11A 1KPUB 4IOIA 3P0VH 3U46A 2E27H 4Z7VB 5D7IB 2VQ1A 4D9RE 3O6LH 4FXGC 3OZ9H 1UT1A 1FVCB 4Y19E 2DIAA 3WY1A 3B7RL 3FZUC 4OCWH 4XNDA 4DAGL 4L23A 3T0WA 3BKML 2HFFB 2Y22A 4HXAH 1WHOA 2QPDB 4FQLH 3I6GB 2Z8RA 5LWYH 1A7OL 3VFMB 4NKOA 1M6OA 2JIXA 5C08D 4H2CA 4JN1L 1QO3B 1S7VB 2CU9A 5AAMC 3MUUA 1MAML 3U9UB 3MZGB 2IPTL 4O51B 3G6AA 1U8CB 1G7QA 4HC1A 3HKZA 1A47A 1T2QL 1UWFA 3KYMB 2HVJB 3EOTL 3TJEL 5IMKA 4WHTA 2P52A 1SYSA 4XPFH 2EE2A 4MAZA 4TVPE 2CHZA 5KOVC 1WA1X 3A6BH 1E67A 3I9AA 2HTLC 2WXLA 4CN6A 4DP8X 1B0RB 3UJJL 5B3NA 1EO8L 4X6DF 3QFDA 5CGMA 4ZFFA 3P0VL 1S5HB 3FHQA 4I48A 2G2PA 1P1ZB 1SUHA 2WC7A 1NFDF 3RI5K 1YY8B 1K5NB 4M7KH 3QCTH 3L2LA 4NQCA 2JWYA 4QRPB 3VDBA 4H40A 4KK5C 2JK5B 1KZYA 1K8IB 3GSOA 2NNXA 4P5MB 4HXAL 1IBFA 4FQLL 4GH7B 1MFAH 3UGXA 3EH1A 1MY7A 3TBYA 4P5KB 1BM7A 4WTWA 4Z76A 2NY6C 4FKEA 1LEIB 1NEZB 2WBJD 3GSQB 4YSCA 2KQMA 2WQ8A 1WTGT 2EDTA 4OZFH 2R2EB 5LAXA 3CSGA 3UC0H 3QIUB 4LFHG 7PCYA 5FR3A 2ZCZA 1SJHB 5KUMA 3ARDB 1O5PA 1M71B 4NN6B 5DA4A 1XAKA 4NRXB 3K5SA 3L3OC 3Q48A 3B3IA 1GL4B 4IRZH 4XPFL 2Z91A 3FPXA 4N0UE 4MD0B 2IBBA 5H37G 1B0IA 3UCQA 1G6RH 3A6BL 3DO7B 3PIQB 2PO6B 1NPJA 3B2UC 2OMWA 4HCFA 5IMOB 3VVWA 1AXIB 3B9EA 2ZX7A 3GC3A 4KROB 5JA8B 1OF2A 3P3UA 3SGDH 2CDGB 1EFXA 5KAQF 2LT9A 5EU4A 1JF5A 3CXHK 4DETA 4NB7A 3OSKA 3V6FA 5DFVD 3MLXH 1GOFA 3EOAB 1Y0LA 2GI0A 3CZJA 1I9IL 2R0ZL 2C1PA 4XH2B 1LJMA 2R69A 4UZGA 1BMWA 2CKNA 4M1CC 1PY9A 3QUHA 4O2FA 5D2NA 1DR9A 2VZUA 4FC3E 4L8CA 1FV1A 1Z0MA 3WTXA 2XZCL 4MKMA 4F27A 3ALXA 4X5WB 1JGUH 3CFJB 1Z9SA 2H1LM 5ALCH 3ULUD 5KVEL 4D7PA 4U1KB 2VDLH 2W0FB 3MUY1 4MJID 3P1VA 2YPKB 1UD6A 1I8MB 3K7UA 4ZW8A 3SHSA 5FKAA 2W92A 4G8FB 4IRZL 4G8GB 3WMQA 1DANU 3QEQE 1R34A 3IXAB 4M4RA 1G6RL 5EU7E 1AGEA 3GLEA 2BXYA 3DSFH 3GYRA 2GSMB 4KO6A 5GGUA 2FWLB 4LCWE 5B3JF 1DJZA 4XMUA 5JPMB 4I77L 4WW1B 4H0HB 1CICC 4CGUB 3EXJA 1FZJB 2PN5A 4Y4KC 5HI4C 2PPDA 4AK1A 3OMNB 4HU2A 4A6YH 4NO5A 4XO9A 3TPUB 4ZW7A 4RMUA 1XSOA 3LPOA 2CLVB 1RURL 1PZSA 2NR6A 2OL3H 1JWMA 4GKZA 4JJOA 3TNMA 1I3RA 3H3BC 5C0IB 3ECBB 4PJGA 3QWRD 3U7AA 4JANB 1JPEA 4PRIA 1QMUA 1RULH 2VE6B 3IVKA 4L1LA 4PRPA 4X0KA 5ALCL 4CGTA 3KPMA 4OI7A 4L4VD 4OF3A 1MRCH 4KWUA 3KLKA 1AP2B 1KELL 4LDCA 3V0VB 1ZT4A 2BSDA 5LG1A 2PR4L 1OCOB 4HK0A 1R3IH 2VZVA 1OSYA 2EEAA 3X3GL 1Q9KB 2MHAB 4XN1A 2KI6A 4JO8A 5C0ND 1V5JA 3FQRA 4JFDD 4RRPA 1IEHA 4NHUB 4YHYB 3DECA 2DWEA 4Z7WE 2V2XB 1MXDA 2Q9OA 2XU9A 2CSPA 4F58H 2IXQA 4JZJA 3O11A 4PIRF 2PW2B 1S7SB 5D7LA 2E76C 1I1YA 4OJFH 2XKNA 1N4XH 4QTHA 3MLYH 4XPTL 2X38A 3BE1L 4PFEA 4LVOB 1JIBA 3L4TA 5ID0A 4IBZA 1JZ8A 3IS1X 4OB5H 2YD4A 1HKLL 2BHFA 3DTDA 3V0DA 5C0RH 3ZPDA 2YGOA 4ONFH 4UNIA 4N8VB 4WU5B 4L3EE 2B9AA 3BUTA 5C0BB 3T0AA 1CK0L 1F13A 2F15A 4K94H 1E5ZA 2NNAB 1C5DB 2IPKB 1KY6A 2WB7A 4UZUA 2BRQA 2VLLB 4Y5YA 1QSEE 1JVKA 1VFAA 4TVUA 3WEBA 2DTMH 3FF7A 1HCZA 1INQB 4HUCA 2XWDA 2X2YA 3TU6A 1FAIL 3CVCA 1L3NA 2Y6SC 4GO6B 4QJ4B 3FU7A 5HSFA 2N1KA 4MMZB 4OF0A 2VXUL 4ZQKB </