4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
2GG1A 4AL8C 4UTCA 2P5PA 3C5XA 3J27A 1RERA 3N42F 2R29A 4GSXA 3J2PA 2I69A 1OK8A 2HG0A 5LCVA 5JHLA 2V33A 1PJWA 5H37A 3N41F 3P54A 3UZQB 4UT6A 4FFZA 3N43F 4BZ2A 5KVEE 5LBVA 3WE1A 2R69A 1S6NA 4UT9A 1TG8A 4FG0A 4UTBA 4AM0Q 3UAJA 5AAWC 5IREA 1UZGA 1OANA 2JSFA 3UC0A 3N40F 1Z3RA 3C6EA 3G7TA 1OKEA 1SVBA 2JV6A 3IRCA 5GZNA 5KVGE 4BZ1A 2ALAA 5IZ7A 3UZEC 4GT0A 5B1CA 3MUUA 5GZOA 1Z66A 1URZA 3UZVA 4L5FE 3N44F 4FFYA 2JQMA 5KVFE 5AAMC 5JHMA 4ALAC 4UTAA 1ZTXE 4X42A 3VTTA 5KVDE 2H0PA 5LBSA 3I50E 3UYPB
chains in the Genus database with same CATH superfamily
1EDQA 2NSQA 2Z7UA 3VXMB 1G9HA 3ASNB 4PJ9A 4OR1A 2JELL 3HCVA 4XPGH 1YCSA 4LP8A 3VFWA 2X4QB 4ZXBA 5AG9A 12E8L 3FO2A 5DC2A 5AOIA 1F0LA 3QS3A 4DPRA 5IVNA 2G2RA 2I7SA 3CBKB 2Q0ZX 4KRPC 4ZMZA 4OD1L 4F3FB 4Y16B 1C5BL 4X0KA 1TZ8A 1P7BA 2XXFA 4U7KA 3RIFK 4M9OA 4NO2B 5ADPH 2Q1EA 2ATKA 3QDME 2R0LL 3NABH 1UT2A 1KCWA 3AREC 4KTYA 3H42H 3ZDXE 3S8WA 4O2FB 3MLYL 4IU3B 3BLPX 4JL1A 1NICA 5BO1H 3QEQD 5A6LA 1ONQA 4L8CA 5C97A 2HT3C 3EJRA 3LKPA 4GW1B 4AQAA 1YMMB 4PLOB 2EE2A 5T1KA 5HDQL 1LK2A 4HDIA 3PIQB 2W91A 3GDBA 3LRSB 1IC7L 3WOVA 3QJRB 3E8UL 2XWXA 5SWSE 3HUJE 2Y2WA 3HHRB 5KVGE 1BOYA 4BYHA 4NERA 1FNFA 2ZX8A 3H85A 1SMAA 3KH4A 3MV01 4N1EA 1K4CB 3OAYH 1FG2A 5FECA 2CIKA 1L5GA 4KPHL 3FFCB 1BIIB 2X9WA 5DZ9A 3K7UA 3SZKC 2H0EA 3MV9E 5ETUA 4H26A 3EO9L 5K69A 5KYYA 3HE7A 1G5GA 3VXSA 4GMSH 1KJVB 1X9UA 2YEZB 4FXKA 4HKZA 4N2HA 4QRSA 1QSED 2MNJB 1NCJA 3PWVB 1PX3A 3GUTA 4Y9CA 5MEPA 4G9DA 1TZOA 3O4OC 4X9BA 2GSGA 3NIGB 4PS7A 3L5WA 2D8KA 1I7RB 4B95C 2C9SA 1NMBL 2X2HA 4NYLA 5L8JB 1TQSA 1C5CH 4HJJH 2IAAC 5D1QD 4QCIA 4PJEB 3NCCB 1ORSB 3RUGB 3B34A 5K5YA 5D6DA 3P2DA 1IEBA 2I07B 2VERN 5K1VA 2VXQA 5IUSA 2HRLA 5CR8A 2YQ3A 4M4RA 2HXAA 2EINB 2YRPA 1DE4B 4L1DA 1MRFL 1OCZB 1QEWA 2KL6A 4KKRA 3ZTEA 4LHUB 3CHQA 1ZS8A 4DKAA 1ZT1B 4ZUSB 4P3DA 1OAUL 3APDA 1F3JB 1Q1JH 4XBPB 2X10A 3AXHA 2OJZL 1MAKA 1PY4A 2D3LA 4MMZC 3S3JA 4QYAA 2NY2D 4WSKA 4IBLT 3U4EB 3VTTA 1UWXH 4DGYL 5C0RL 4HH8A 3KDPB 2UY6A 3Q8AA 3LB6C 4LGSB 4PWEA 5BUAA 5C2UB 2FATL 5L6YH 3FO1B 5IROA 1IM3B 5IWLA 3NCYS 1FO0A 1ZA3B 1BM3H 1OAKH 4PJHB 4WWNA 3UG4A 9CGTA 4NO0D 4AE1A 3RWIA 1X7SA 4ES8A 5I74B 2F54B 3VD3A 4AGMA 1E27B 4KWUA 1JWMB 3UERA 1SHWA 4DVBB 3HR5B 3Q9QA 4PJ8C 4WI0B 4FFYL 1LO3L 4KO9A 5JW3L 1A0QH 3C6LC 4FYSA 3EYOA 2ZX9A 2X2IA 3O6ML 4UDTB 5I8OL 5ID1B 2OW7A 4LLUA 1E4KA 4L4VE 1IZJA 4LIQH 1RUPL 4P2RA 3FN0H 1CS6A 2YBGA 1B3JA 4XCFH 1FN4B 3BH4A 5K1JA 4ZK8A 4LU5L 4XMLL 1FF5A 2X89A 3BEWA 1YZZA 5I6XB 3UO1L 2ZX7A 2B14A 4ZBJA 5C07E 4R26H 2WLIA 4JRXE 1AZZC 1U93A 5F9WB 1OWRM 5D1ZI 1RVFH 4JO5A 3NJLA 2VDPL 4WVRA 5B39A 5LDUA 5EHFA 1OF2A 1PZUB 1FVCA 3Q6GH 1PEZA 4GINA 4PJAA 5FAAA 4HEME 5CZXC 5I0XA 4ZO6A 2E4TA 3Q2CA 2E7DA 4GBXA 4XPTL 4JPIA 3CUPA 3GTNA 4PWIA 3C6SB 2EDNA 4Z7OB 1KCBA 3SODB 4GIAA 4I0KA 4PS3A 2XYBA 4EMZA 43CAB 1XCQA 3H3PL 4JKMA 3VQ2C 5KAQF 3CDGB 4RAVB 5C8JA 3AU0A 4JM2A 1JGVH 3EBHA 3HAEG 4NM8L 4PBVC 3ELAT 3ZQWA 3SDYH 4WUUD 3T3ME 3B2XA 4JJ5A 2HN7B 3FHEA 5L88L 5AWNH 1XD0A 1P53A 3WN5B 5IY5B 5DJDA 3ZMRA 2F58L 2BRRH 4NQDE 4G6JH 1SF3A 4OZ4A 1WEJL 4F2MB 1DR9A 5T5FA 2NZ1A 4HUCA 1GAFH 3V4PL 5HYSG 1LMKA 3VCLB 1HINH 4PRPD 4NPKA 2VW4A 2X3BA 2OYLA 1OT1A 4ZMTA 5DVMA 3R1GH 3D9AL 5FGCB 1B4JH 4J4PC 4UV4L 2RTTA 4OCRH 1AVAA 1PYWA 2OL3A 4K2UH 4YVUA 1K5NA 4U3SB 4WGWB 3SO3C 4ZMWA 5LUMA 4GQZA 1WZMA 4ES9A 1XGPA 5D72L 1H3VA 4H4NA 4EBQH 3KJ4C 3TS8A 2FE0A 5KSVA 2BNQE 5C08A 2P48B 2ZUQC 3TASA 3O8XB 3INUH 5F7AA 5KBPA 4X5WA 5D6CB 3RVXC 3G6AA 4PJ7E 5JHDE 3RVUC 3IMBA 4UT6A 5J6GB 4UT9H 2IWKA 3QFJD 4J6RL 1HSAB 4MYPA 1G6RB 35C8H 3UDWA 2QV4A 3OF6D 3LZOA 4JRFA 3TBVB 4XN2A 2WPGA 4OSUH 3UBXG 1KYFA 3HA0A 4Y2LA 4IJ3C 5E08H 3DPBA 5D93B 3DVIA 2O6CA 2K7PA 2V2WB 5PAZA 3ZTNH 4X0KB 5D1QA 1A1MB 1SEQL 3X3GL 3WHE0 2NCEA 1TTRA 3GSRA 3D4ZA 2OX5B 3BQUA 4NN5B 2F68X 2GITA 3C5ZA 1LEIB 5I1CL 5EN2A 3DARA 1RJZB 2IWFA 3L3HA 4ZMLA 3EGSB 1IEAA 3RTQD 1F42A 4HFWA 1HHGA 1P4IL 3EGXA 1AGDB 3FN3A 1VFBB 5KBNC 1TMQA 4BUQA 1ML0A 3RWHA 5ADPL 4DAGH 4GRLA 2X05A 3G5ZA 1F4YH 4IIQC 4EDXB 4WFFE 2E7LA 3QJFA 4M9PA 4A6YH 4P2QD 4JFXB 4F2FA 2Q8AH 5F1NA 1JCVA 3TCLB 4UWQB 3O2WL 4V1DE 4Y4KB 4QJ4B 4U7MA 5JDJA 1IMHC 5HGGS 4HKJB 4J27A 4YDJB 4I3GA 4O9HL 5JYLA 1EZSA 1B0GA 3ZLQC 5E4EB 1D7DA 2OW6A 4IKNA 4UILH 1U8PB 4XCYA 1TYRA 4HBQA 4WWKB 4OFKA 2ORBH 3NFSH 2CO3A 1DSFL 3OC8A 3OB8A 1NCDH 5JPNA 5JHMA 2FIKB 3HZYB 2NLJB 1JPTL 4E42A 4U3HA 1DCEA 3WXWL 5JOPD 4KKLD 4YFDB 3Q48A 2QKIC 3DX4A 1E9PB 1RSYA 4HF5L 1ZSHA 3D3VA 4ADGA 3RZCC 5EF0A 4BFFA 2UY7A 5M7QA 3ETBJ 2UZXA 4GW1A 5LXGL 4PRNA 5D1XE 1VADA 1KT2B 2XWBA 3WIFA 3MLZH 2XKNB 5JPMB 4NUJA 1F1DA 4LFHD 1E40A 3EH1A 2F1EA 5TE6H 2A6DB 4XNBA 1J5OH 2ZUWA 4RFEB 1E9QA 4YL4A 1MHEA 1IJNA 5FECB 1YUHB 1T0OA 4LHJB 4M6ML 4YIQA 4YFEA 1FYHB 2PWDA 3NFNB 3RY4A 2VR9A 1MI5A 8FABB 4FXTA 1IM9B 1J9TA 5GRZA 5T8IA 1N67A 1DFBL 3DROA 3CHRA 2J2ZB 4A39A 5TPWH 1U95B 2VDNH 3WI9A 2BWDA 4W68A 2Y36H 1WISA 4GFXA 1TPXB 3HMWH 3IJEB 3OKDA 1KIRB 2QQNH 4JG1L 2A1WH 4JO3L 1IAIM 4XPFH 3WL9B 4KJWC 3QK0A 1INQA 2H3NB 3AQDA 3GXMA 1MAJA 4AK2A 1IFHH 3F3HA 3QZPA 3CLFH 3H53A 3FQRB 1ZTXE 4R5TA 2ZQKA 3BZFB 4GPVA 3MJ7A 4UQDA 2P24B 4EXPX 2X9YA 1OM9A 3S7GA 3SJVD 4MMZB 3BRGC 1IEBB 2YKKA 1B2WL 2IDUA 4KDVA 1XTLA 4P23B 3F5WA 4X6CE 3ILQD 4P2RB 5E6ZA 3KEDA 5CZRA 4YDKH 1SN5A 15C8L 1D5BA 1IB5A 5EU7E 5ICXA 1F3JA 4G1MA 2OTWB 5FX3A 4A2LA 2ADFH 3PP4H 4IOFD 5EA0H 4OGAC 4G3YH 1QZNA 1WP6A 4FTDA 1XDTT 4GAAA 1JZ7A 4I18C 1ECZA 1H5BA 2Y7QA 4PEEA 2YD8A 4KQ3H 4R90L 2K3HA 5ISZB 2IH1B 2F19L 2FVNA 1CVRA 5C9JB 4OCYL 5MEQA 1BWMA 5K93A 3U1QA 5JHAA 1WTLA 3HJEA 4P2AA 3I85A 1WZKA 3SE9H 3CK0H 4H0HB 1WD9A 1MCFA 2DJ4A 2B15A 1V7NH 2EYTB 1ZHLA 5I1JL 3IE9A 5MENB 4M00A 3BAEH 2YBRB 4LOVA 1GOGA 3SYCA 43CAA 3QUXA 2OAAA 4AVIA 2HT4D 4KMQA 2GI0A 1E65A 3PGFH 5EF2A 5ABZA 1OAYH 4I1NB 5J11C 2C9RA 3NCWA 1L0YA 1QSFE 1JN6A 4DO5A 4JFFD 2DWDA 3WN5A 3GKWH 1ETB1 3D07A 5CMAB 4ZFOA 3VFGL 4XP5L 4KXZH 3EFFA 4JGJA 1T4WA 4NJAH 3UBXA 1KZQA 1Z9SA 2VXQH 3CFIC 4LNRB 2X9ZA 4I9XA 4F93B 2FT8A 4FQ2L 1ZWIB 2D7OA 4HWUA 2HMID 4NKOA 2NXYB 1WFJA 3K8LA 2ZG1A 4KDTC 4EI6B 1EHXA 2ZKWA 3JUZA 3FQYA 5FO2A 3BIKA 2WZ0A 3W81A 4OLYH 3F12A 3VU1A 1KPVB 5JTWA 3RZWA 3MOAH 4OF3A 4JFWA 1T0NA 3HVNA 2J44A 4A2FA 5DSCB 4ZXBD 1NKRA 5TE4H 1PDKA 1S7XA 2WUBL 2H32H 3QC6X 3RB5A 2LLNA 4WHCA 1TETH 3T77B 1DQLL 3RNKA 1RK7A 1YAZA 5J1AB 1W0WB 2P5WB 4NFDA 5F8RC 3OAZK 5AALA 2AGJH 2F53A 2H6PA 3EFDL 3QJQB 2LU3A 1MPAL 1PFOA 4Y5VC 3NK4A 1Z3GH 2NSMA 3AS1A 2Z92A 4L8DB 3LS4H 5KG9A 3ZQXA 4NQDB 3ATAA 1OP5H 5DJDB 5DUJA 3B9KB 4F57L 4FMVA 1BW8A 4OLVH 1BFOB 4EJ1C 5F89B 4PJ8B 3X1GA 4PRDB 3L1OH 2LU4A 3GSOA 1HOCB 5AW4B 2GITB 1RPQA 4LSSH 1CN4A 1UACH 3LIZL 4NGHL 2FECI 3L3HB 2VL5A 3E38A 2ZCKL 3LCYA 3M46A 2M26A 3B7TA 1E3FA 4XTRC 3PJLA 3U7WL 5CEXB 3U2HA 1AXSB 3AC0A 2QLVB 4NO3A 4UTAL 3VSUA 5I1KL 3TPUA 3HI1A 5BCAA 1LL1A 1SOQA 3SD2A 3PDDA 1CLYL 2XWZA 4GUOA 3QJFB 1EPFA 3PS6A 4GAJL 2CJSA 3C5JB 2NXZC 3DI2B 4Z3FA 1OB1B 3ZTCC 3WFHA 2AEQL 4NWUL 1YUKB 3VFNB 1E5ZA 1VEMA 3RKDC 1AIZA 5L9DL 2F5AL 5DLLA 4GY4A 4HKJA 4MA7H 2ZTBA 4GUPA 4IYKA 1XL4A 4PCSA 2TSBA 2VZTA 2GABA 2V2WA 3H7BB 4XCYB 4M5YL 2PCFB 1FZMB 2WYIA 3AB0B 5KSAD 3C60C 1YEGL 3QDJE 1P84K 1S7SA 1CFSA 2NW2B 5EN2B 2XACC 2JIXA 2NY6C 3PAUA 1XMEB 2NNAB 5DFWH 2Q7AA 4ZG1A 2EXYD 2MCMA 3GZPA 1M4KA 4YHNA 3TO4B 4OM1L 5DJ2A 3S5YA 1MSPA 1U4FA 2QFRA 5I1LA 1QLEH 3VXPB 4P0DA 2G3NA 3AY4C 3QQ9C 4N28A 4FG4A 2XRAL 3CVDA 4RX4A 5IM7B 3B1UA 2N7BA 4R9HA 1BAGA 2ISDA 4QHKI 1BYOA 3SE3C 2XT1B 4KNUA 3V0DA 4QTIL 4P04A 3REVA 1OE1A 3QIBA 4U6HA 2DLEA 5JW4Q 4KVNH 5DEJA 2AJUL 3H3PH 2R29L 3K0YA 4F37F 5IHWA 2RR3A 3SYPA 3TBSB 1NGYA 1WFIA 2B4CL 1GHFL 3NK3A 4MMYA 2FQDA 4K5OA 5CD3B 4Z7QE 3HRZB 4NN6B 3VA6A 4M5TA 5E8EA 3V5DB 5EA0L 3B2MA 5I1KH 1NMAL 3QDMA 4L1LA 4XMPL 2GJZB 3CC1A 3VJ6A 3FQUA 5FIEA 4P4KC 1E42A 1XBRA 1G7IA 4LCWE 4XNZB 4Z7OF 1QKZH 3O3BA 4QIRA 1HEJC 3IJHB 4OFYD 3GXIA 3MNDA 1E9PA 1UD3A 3MRNB 2FEJA 3U46B 5F0JB 2NXYC 4DQAA 4YHOL 4PU2A 4UOW1 2H32A 4ERSH 4TKWA 2J88H 4K8RD 2X89D 4ALAH 4J5VA 3ILQC 2YOCA 4Y4FA 4L3CA 1AXTL 2DTML 2XKNA 3GZOA 5JPMA 1KJMA 1QATA 2CLVB 3ME0B 3L9YA 5HJ3A 1UZ8B 4L0YA 5I75C 5I0YA 2Z64C 3LS4L 5JIPA 3WMPA 4P46C 1B0RB 2R0KL 1E9QB 4WK4B 1ODAA 1Z3GL 3O2DA 3OX8B 3GPEA 4G1MB 3FB8A 4U31A 3VD2A 1FORL 2VE6A 3F8UB 2X88A 3Q06A 2FJHB 4BIKA 4MDRA 4I48A 4XPHL 1HHHA 4PRPE 1H5BB 2ZXQA 4RGOL 3JV4B 3QZNA 4LVNB 1JI2A 3BLKA 1A9VA 5C2BL 4FG6D 5AB2A 3Q5YA 3CZFB 4P5MA 2EC9U 4KOCA 5IESH 4GAFB 4UOW0 1S7WA 2DLHA 1QP1A 1BVLB 2ICES 4AGLA 1A7QH 1J1PH 4GO9A 4EN3A 1ZK9A 4LCIH 4L8BA 1Q94A 4GSXA 3SPGA 1YEDB 2D73A 4CA4A 1KB5B 2YD5A 4M1GH 3VG9C 3QVAA 2A77H 2K70A 3L8QA 1XGYL 3CVHL 4LL4A 4AXWA 2YAHA 1PW3A 3OKKB 5F6IC 1DVZA 4QNPE 1AE6H 3MBEB 1JGUH 3IKKA 3FT2A 4MJ6B 1N6QL 4FMKA 4PJBA 4XHJC 4PGCA 3VVVA 2XPZA 1YMHA 1KBVA 2FLBT 3EOYG 4O58L 4EVNB 3NJNA 1L6ZA 4G80B 3WAJA 2NR6A 4FLHA 3UYPB 3MBXL 3RVWC 2QQKL 2VDRL 3AVEA 3VI4B 3FTXA 2OLDA 3TCXA 1UGKA 1V7NL 1FWXA 1I7UB 2IADB 2F7OA 5KWYC 1EFXB 1JHLH 3U7YH 2IH1A 4M62H 5KS9A 4Q89A 1LWJA 4NKOB 2BS71 2QTVA 2D03L 5DJCB 4PJBF 4LEXL 3KJ6L 3LMJL 2RA1A 2BP0A 2R0KH 2BOBB 4LSVH 1J18A 3EDDA 1YEJH 2JI1A 3VXUD 3GBDA 3IMUA 4POYA 4LCUA 1DDTA 5D96C 1CK0H 1KY7A 3LNIA 2X1PA 3SPCA 2R4SL 2ZZUT 1CLVA 3ZW3A 4Z95L 2F1AA 3QA3A 3VI3E 2EDEA 4F1SA 2HT3D 4Q97A 2OJEA 5E1AA 3QWNA 2QKIA 2BMKB 4R7DA 5I1CH 1MIML 1S3RA 2PETA 1CQKA 1R3KB 3QISA 4N2EA 3J07A 1A6VL 4FRWA 5HHVH 5JLZB 4YSUA 2KUTA 4FQCH 3H56A 3DRQA 2EVHA 1G1CA 5TK2A 4Y16C 2Z35A 4LASH 4H1LA 1UOLA 5F3BA 4LCWD 1EAQA 3S34L 4G6FD 1FHGA 2CDFA 3RGVB 2XPGA 5I24A 1IGFL 4GRLD 3HRZC 1YJDH 4HJEA 4CVXA 3TBYA 4E41D 2WB7A 1YJDC 4YX2L 3WFDH 2WO2B 4WIQA 2MRYA 2VZSA 4HJGA 2O26U 5T1KD 1ASQA 1U3HA 4NN7B 3AWGA 3UIZA 3BIKB 1DEDA 1RZ8B 3SDCC 1DVTA 4Q9QH 4N0RA 5JQ6H 4HJ0C 5DZJA 3HI1B 3CD4A 2RQEA 3CFCH 3UEZA 5J13B 2V3DA 1PDKB 2D7TL 1UH2A 5IZ7A 4ILDA 2XN1A 5FDYA 1CF8L 3T77A 3PE9A 4PJCA 4N9OB 4ZOCA 5LGKA 1PIGA 3B2VL 3MRQB 4B9PA 5FYJE 25C8L 2NY5L 4NQDA 4ZNEE 2JTDA 1QBAA 1P4LA 3HAEA 5GJTL 2XOTA 4PWGA 4KROD 1FL3A 2H2SD 5DJYA 3OJDB 3I9IA 4K3GA 5DZNA 5G4MA 4QAWA 1OSEA 1J1PL 1QSZA 1R33A 4XN1A 1U41A 4Z7QF 1FC2D 1YECL 2IG2H 2DYPB 1TO5A 5DD5L 3UTZA 2WY3B 1V05A 5C08E 1XXFC 3E0GA 1M7UA 1QRNA 3FOMA 1Z32X 3GS4A 1CFTA 2DH3A 2H41A 3SPVB 3KLQA 1EXHA 4MFHA 3NPZB 5PCYA 1YQVH 3LNEA 5I82A 1R5IA 4MJJA 2FJGA 2ZF9A 4LSPH 4IRSA 3PWPD 1E9OA 2E7MA 1XH3B 1ID2A 3QIBB 3KD4A 4U6HB 4GG8A 5CILL 2WZAA 2X7LB 4HHAB 5CIPB 5DHVH 5A7EA 4F8LA 2BH0A 1NGYB 2DYRB 3ES6B 4S1SH 4ETQA 1IM3D 3BSGA 1CGSL 1O9WA 3T2QA 3QGVA 5E8EB 4JFPA 4YR6A 4OLVL 1FZMA 1UG9A 3U9UB 4NJ9H 1FYTB 3QDMB 2ZAIA 1LVEA 2YPLB 1K8IA 1QTYT 3VXTA 4XO8A 3P4NB 4GW4B 3VG0H 3U46A 1CICB 3CLEL 4HUUA 5CEYA 2W94A 3TO4A 4YZWA 1OPGH 4YHNB 5LQBL 4NQSA 5FYJU 4IS6B 4Y5VB 3S35X 1A6AB 2CGZA 2KH2B 1EJ6A 1MWAL 4Z0BH 2WLYA 4PJXB 1RUKH 2PCPB 3EYVB 4FEIA 3B3BA 1KJMB 1TLMA 2ESVA 2KLRA 5KUMA 4OFPA 5IQMA 1WFTA 1J88A 5ERWB 2HH0L 3MLPA 4PG2A 4JQVC 4G42B 1A3RL 2XHNA 3L3KB 4KZCA 2V0AA 3DUUB 3FFCE 2GK2A 1ZHKB 1RZKL 2UZIH 3S2AA 4B9IA 1IBBA 2CHDA 2O5XH 1CDYA 3VRLE 5CZVL 2E3VA 1XF5A 2JKJA 1ZGLA 5ESQB 5CD3A 1NCBL 3QHFH 1KLUB 1MFCL 2FYYB 4PGEB 4R3SA 1RURL 2EKSA 2OULB 3UBHA 5AKTA 4IKIA 1AI1L 3NIFB 5D5MA 1NAML 5KJ4A 3FU6A 3BN3B 4GXVL 1KNOA 1OZUA 3HG1A 1IC4H 1USQA 3HCVB 1G7PB 3D3VE 1ES0B 1J05B 1R9FA 4PJIA 2PTVA 4F3FA 2CH8A 1WFMA 4ORZC 5I18H 1HIML 2XWJB 3H9HB 3QHTC 5CIPH 3CVBA 2NYYC 4WUUB 5KN5A 4PJHF 4Y9EA 2P5EE 3SDAB 5CCJA 3HBQA 2A7BA 1CGTA 2VZUA 1SOXA 2VQ1B 3L3IA 1FGVL 2WAQA 2JB5H 4MJ6A 5DJ0A 2RFXA 1I3GH 2PXYA 3DK2A 4K3EL 4YS4A 3EBIA 3AY2A 5HD8C 3QUYA 4XX1E 5F7FA 2BK8A 1Z0MA 2H0FA 4PRPB 3ZR5A 4G6KH 5AQ0A 5JXEA 4G80A 2CDGB 1AMXA 1CI3M 4YSRA 3KDMA 3EDKA 4OI8A 3DJTA 2CHNA 5EEZA 4L1BA 4Z7UB 5HY9B 1AKJB 4KK6C 3RGVC 1EFXA 3BVDB 3FB7A 2B9AA 3E2HB 5C0CB 5AVTB 3L4WA 1O9ZA 2ZYHA 3VXRD 5KVDH 4HIEB 3CFQA 5KVFE 3OLIA 1JZ2A 1ZSDA 4OLEA 3SDDA 2F53D 3SO3B 5C08D 1H3XA 3VRJB 4Y1AD 1WZ1H 1JF1B 3TNMB 4EIZC 3ARBD 2MNUA 2OZ4A 3EJUA 1DBJL 4UANA 5FOBA 4PHZA 1TVBA 4K5PA 4KTDH 3I6KB 2VMEA 1RUAL 3RTQC 3PWPE 3UO1H 5MEPB 1ACZA 4X9GA 3HC3L 3TVMA 3D2UB 3DVGB 5GGSA 3TA3D 2AZUA 2GTZA 4Q14A 2ZXGA 1EZUA 4EUPH 4Z76A 1T89C 3SCMB 1ZGLM 3MLWH 2N0MA 3JV5A 4X6CF 1MXDA 4K71B 5EO1B 3VWJA 3ZYZA 4PJBB 1NFDE 5ECJE 4JGMA 3WDHA 2X6VA 2ICWA 5FM4A 5C07B 5KVFL 2AV7A 2VZVA 4FP8H 2G9HB 4UM9B 2FH6A 3F04A 2WNWA 4G1EB 2ZPKL 2OMNA 1EUUA 1SYVB 4JMXA 2VRAA 4PB0H 1OGSA 3LEVL 4YBQC 2FTAA 5DJXB 3ZR6A 2YFNA 3KNBA 2WANA 3KWVA 3ILDA 4GBXC 4KKAC 5F7DA 3DHJA 5EU6D 1OAZH 4G83A 4A7VA 1HWGB 2C9XA 1BQRA 2ARJB 2XUWA 3DHUA 4FQHB 4JVPA 4X4XA 3G6DL 5EG6C 2E86A 1BM3L 1OAKL 5ESVA 4WGKA 3C8HA 1I3UA 4Z7OE 2JQMA 5MP6H 3BP6A 1M1XA 1JGUL 5A1AA 1S7QA 5T5NF 4M7LT 2V7HA 4NQEA 4OU3A 1A4AA 3QULA 3UTTA 3KLDA 4M7LL 1JNNH 2F54A 3T3MB 4BKTC 2J6EA 3MRQA 4KHTH 2WZPD 2V4LA 4BKLB 5I73B 1MRFH 4OZGF 3HB3C 4PJ5E 3Q43A 4FZEH 4F2ME 5IIEA 4ABQA 3E7JA 3IDNA 3NG5A 1MCHA 3AWEA 4IGBB 4L5FE 2APSA 3BDYH 4OD3L 1QI4A 3UACA 4KQ4H 4X80L 4GNKB 1PZ3A 4GIOA 3APMA 2XA8H 1BAWA 2BIIA 3B2UC 5AG8A 1OGTB 5FA4A 3EFOB 4OGYH 5DHVA 2YWZA 3P9WB 3GBNH 3MAWA 1BJ8A 1R0AH 5IP4A 1IC5L 2X0UA 1U93B 4KJWD 1NBYB 3AQZA 4M5SA 4L8SC 1UKTA 3QUMH 2RD0A 2AJVH 5B21A 2YA2A 3O6KH 1WT5A 4CU8A 4UUJA 3WLBA 4MHHI 1KELH 2VDNB 2WTOA 2F6AA 1EXUB 3MXVL 4P2QE 3UTPD 4TQEH 1S7UB 5HHOD 4PJCB 2QVKA 1XH3A 4RISH 3VWKC 1GJUA 3QCUL 4G3YL 1GGIL 4F7CB 3MA9L 1CE6B 4GBXB 3R8BB 4U4BA 1KTLA 4G9FD 4XBMA 2CO4A 5AZUA 4BXVA 3T0EE 5I5MA 3ZRFC 2IWGA 3W9DB 3GMQB 2N1KA 5C0FA 2WVUA 3TX4A 4OH2A 2I5YL 1GZQA 1H6UA 3KPSB 3DBXB 4EI5C 3OSKA 3NN8B 3PFUA 4YO0A 3SQOH 1FYTA 3MU3A 3QPQC 3KCPA 3WO4C 3DX7A 5EF1A 4ZX6A 4RFOL 3ARDD 3F7VA 3N1MC 2JVUA 2X1XR 4QTFA 5FOJA 1MVUB 3STBA 2WKGA 2FK9A 3ZMEA 3QCTL 4X4YB 3B9AA 4WEBH 3U9PL 4HVBA 1X5AA 3CPUA 3BUBA 3TJPA 1XR9A 5IHBA 4YWGH 1WIUA 4M8QA 2XZCH 3OAYK 4WNJA 3WHE1 4RQQA 1BOGB 4OCXL 3DPDA 5I6XC 1NGWB 5GGRY 1AZUA 3QIWA 2X12A 1MFEH 4IBVA 1BVKA 2FJGB 1T5XB 5ICZB 4MJID 4HPYH 1XIWB 1OLLA 3K74B 2COVD 3F7LA 2FUQA 3HEIB 4HC1L 3LXCA 4JY5H 3FH7A 2ED7A 3ES6A 1NFIA 3LN5B 2QR0A 3PHAA 3N2JA 4TQ8A 4X6DE 1NSNH 3ULUL 3LQAL 2X6UA 4P9MH 5B8CA 4LRNL 1TIUA 4JFPB 3SDCB 1U3NA 4OJYA 2DBLL 3N40P 3AADB 4G6JL 1V54B 1KNOB 5KZCD 3MLZL 2KC0A 1P5VB 2G3MA 2VMFA 4OLUL 3RYMA 4D9QE 3TVMD 3P3SA 4OQ1A 3UAJD 2XN2A 4LNVA 5T1MA 4GW4A 2OI9C 3OGCB 1AQKH 2NYYD 5IF0B 1UUNA 1OD9A 3OZ9H 1KFAH 4PAZA 4GKOA 1X5JA 4DJMA 3FNKA 1OB0A 3JTSB 3MYJB 4FX5A 4JRYE 3FMGL 3GLAA 5D7JC 2IIJA 2NR6D 3MUGA 4L3AA 2VLRA 4TLTA 2OMYB 3V2AR 3STZB 1UA6H 5ERWA 4XX5A 4YXLL 4PY7A 1IEAB 4UNIA 4ZXBC 5AB0A 2O6PA 1SMDA 4IBYA 2IV8A 2PW2A 2J1XA 1AP2B 4ZQKA 1JPFA 5F1IB 2ZNXA 1J8HB 1EAPA 1NFAA 4AYFA 4OJFL 5TGBA 1ZLUH 3RWHB 5GGSY 5BRZB 2DLTA 4M1DL 4M7JL 4NGHH 3Q2WA 3CLEH 1QWNA 2HJLB 5ANME 4LPYA 4MB4A 4HA1A 2BSRA 4QNPF 3TCLA 2R1XB 1SVCP 3A21A 3HG1B 4P5TA 1AO7A 3DOHA 4YBLC 5F21B 3SDDB 3TZVD 4A66A 4YDJA 3MGTB 1TZHB 3VG0L 4QHMB 1P4IH 2A6JA 3FQNA 4N0UA 1DVFB 4JFZH 2H8PB 3GMLA 1T7ZA 1HAWA 2AVFA 1DN0B 5HGBB 3I6KA 3E1F1 3MV7E 4N90E 4M6AA 5IB1A 1JK9A 2DMCA 1GPOL 2YK1L 3AM8A 2B1HL 4WCYL 5I19H 4XTRD 3IVKA 1FV1B 1I1AC 1UKQA 2WJ5A 4YBHA 1AGEA 5FYJD 5D7LE 3VXSE 2FGWL 3HKZA 2XSKA 4FFWD 5GSRB 2AV7B 2P52A 4KKAD 4KY1L 5CSBA 5DS1A 3MODH 5IQ9A 2Y7SA 3QWOB 3G5YA 3LAFA 1RU9L 2YPVL 3KNBB 4XPBL 2WIIA 3STLA 4DN4H 2YZ1A 4U6VL 3FB7B 3LH2L 4OJDH 2ARJA 3MLVH 3U2IA 4DKEL 4FFYA 2EVIA 3LXBA 2E9JA 2P28B 3HC0A 3Q5OA 2OR7A 3RWCB 4RX4D 3REWB 4X6CB 5KSAC 3SDXE 5FV2A 1DQDH 2DI8A 3DROB 2IAMB 3ECBA 5FOBB 1TJGL 2EEAA 1IT9H 1XSKA 4NFCA 2FYVA 3VXMD 1I85C 2P26A 4DGVL 4ZFGL 4QHKJ 3WL9A 2ATPA 4OW6A 4YMPA 1CDJA 3DOSA 1MF2L 4AVHA 3QQ9D 4U0QB 2Y22A 4I8DA 5E99L 2E6PA 4XXCC 5EO1A 2O4EA 3TJEL 1VGKA 2A73A 1CFQB 1FAIL 4X2UA 5E7BA 4C4BA 3FTSA 3Q5TA 3V52H 1FFQA 3CK0L 4RAHA 5BS0E 5IIEB 4NO5A 1P5UA 2W0PA 5I9QB 4OKDA 4V33A 4IGBA 1NCBH 3QHFL 4AI7A 2WCGA 3C09C 4R84A 4A7GA 1UB5B 1HZLA 2P80A 1QRND 1XD1A 1HEZB 2AJZB 2ROXA 3QEQB 5DHVB 1KYOK 2CRMA 3Q2NA 1H0DA 4X6FB 3KGTA 1HKLL 3Q8EA 4KH9A 4X7CC 4WZ9A 5HHXL 1JZ5A 4DP4X 2BP3A 4CMHB 3TBTB 2J72A 5HYFA 3PDGA 4BFKA 5B3JF 2VB5A 3SQOL 2QQLL 3U9PH 4P2OB 4PRHD 4XMWA 2ZAGA 4K8RH 5CINL 5CSZB 5FHBH 4IU2B 3VD1A 5HYJE 2HAZA 1UJ3A 2ZCKH 3IGUA 2F61A 1XGQA 2V7HB 5EULV 5TQ0H 3U6RA 3ZKMD 2EDYA 4GKLA 3KR3H 3FCTB 3WJJA 4XCNB 1HNFA 1T5WA 4WWKC 1LO4L 4XMVA 1BBJB 4BK8A 4NI3A 1VFAB 1MEXH 3GSXA 5JIQA 5AUMA 1ZEAL 3BGFB 3KPSA 3N9GH 3CQFA 3W1ZA 2J1WA 3CVIL 5F1SA 4YO0B 2RQ8A 2FJSA 3PJSA 4AQ8C 1MUJA 3WMQA 3RJQB 2WXJA 2DIAA 1N5AB 2NY6B 1INDL 2MKLC 1JBJA 2VDPB 1CXLA 3NFPB 1JGLH 2NY3D 3SGKC 3DTXB 3ATBA 3S88H 4FI6A 3VMPA 1KEMH 1YNTB 2IPUG 4JM0A 2ZE0A 3ZDYE 5IFJA 2PR9A 4XB8A 5A6MA 3EO0A 2X41A 5ACMA 5HVFB 4X4KA 1GIGH 2ITFA 4HAGA 1JWSB 1LLAA 4LHUD 4Z7VB 2Y07H 5CEZL 3ZE2B 4O02A 2HLAB 1PU0A 4CSZA 2Q76A 2G0LA 3ZBMA 3W37A 1JZ8A 2WB1A 4R7NA 4GRWH 4NLAA 8PAZA 4DN3L 2A99A 5DLML 3ISYA 2DQGL 1Z5LA 5K9JL 1AZNA 3QIUC 4AQOA 3F12B 4N8VG 4F7CA 2PW1A 5CKGA 3FU0A 5IGXL 4AM0A 3SO5A 5E1GA 4K07A 4HUXB 4KITB 2YRBA 4UT9A 4LGRB 5AAWA 3UPCA 2YAPA 1XAKA 4NN7C 4FA6A 4NO0B 3RX5A 2JV6A 3NCJL 4DFHA 4N2IA 2OBGA 3BUPA 3MV8B 3QYMA 3SQRA 3F7VB 4P9ML 1E28A 1MVUA 4JPKH 1A5FL 4PJ7A 2P49B 5JHDA 3EH3B 4JJHA 4HCIA 5HYSB 1NAKL 4HUWA 1TJIH 2BRQA 3KE0A 3SGDH 3VXME 1CL7I 5I66B 2GK0A 4J7RA 3TF7C 4QRTB 1S9YA 2DEYX 2VITA 2Y25A 3GBEA 3G6DH 5F89A 3MRKA 5BV7B 3I3EA 3KS0J 2ED8A 2JKXA 2P8LA 4P9HL 2ADYA 3VACA 4IIZA 1FCCA 1P7HL 4ZZKA 3STZA 3ARXA 4U1KA 2X6AA 1EUTA 3QO0B 4PP2A 4NKQB 5ICZA 5LKNA 1JZGA 4Z6AT 1AP2A 4ZQKB 4GG6F 4TSBH 4OGXL 2H3KA 2J25A 4MQSB 1RHFA 4Q74A 5IHUL 3Q05A 4ZS7H 1PKQB 1C7SA 1NFIB 3LN5A 5BRZA 1WBYA 3S34H 2TRYA 4NRXA 1BZ9B 1J9RA 3PWLB 3HPJA 1FIGH 3QDGD 3AG3B 4BD4A 4X98B 5B8CB 5AVZB 1C5DA 3D0LB 3EYSL 3ZJAA 5J89A 4XC1L 2EUZA 1BD2A 1U8CA 3VFTA 3VXNB 1KMGA 3VFNA 2XIBA 3IJ7A 3HC3H 1X7TA 3GI8L 4U2YA 1QBLH 3DRTB 1NIFA 4YHOH 2YMXH 4ZPVA 4X6BB 4GS7C 3WO3B 2J7LA 3H4FA 1TZHA 3MBWA 1HXYB 3RVTC 4R2GD 4U6TA 4P99A 2DI7A 1UT1A 4K8RL 2H8PA 3GMLB 5FHBL 2VT0A 5L2KD 4Y5YB 1X5GA 4DP1X 2G2RB 2Z31C 3IGKA 1RFDH 1IL1A 5F7KC 2AK4E 1WBZA 3NACH 1CD0A 2NW2A 4ZOBA 5GHWH 4D8OA 1KLFB 1T0PB 1W8NA 2AJUH 2VLRB 3AABA 3QXVA 3QUML 2XQYK 2NNAA 4PP1C 3UMNA 4P2OC 3TEWA 4HJ1A 4KRPD 1BZOA 4QTIH 2EUVA 1QLFB 4PVMA 1NIEA 4ZW3A 4MA8L 3OD3A 2D9QB 3OB0H 3U2SA 4LCWB 2VXTL 3HUJA 4D0DA 1A02N 3O11A 1R3JA 4FI7A 5IQ9B 3LRSA 3APNA 2ZICA 4NRZA 5FW6A 5T1KB 2IV9A 4GG6A 5BVPH 1A7PH 1LQSR 2QTEA 4W81A 4YNYB 5E00B 4DP6X 2AKRA 1NL0H 2O61B 1BIIA 3TBSA 1MFAH 4FYTA 1KJ2L 5AL8A 4UTBA 1YEGH 1IGCH 4QHMA 4KHTL 3ECBB 3ESVF 5GGQL 1F2XK 1DN0A 5HGBA 2HX8A 2F74A 1M1SA 1X5YA 4U0RC 1OM3H 5AKVA 5GS0L 3WY4A 1JDCA 5T1LB 1DQDL 3IVKB 1TEGA 2BO0A 3CSBA 2ZWSA 4YN3A 5EH1A 1DBML 3VXSB 4FQQB 5DFAA 3H9SA 2PYEA 2GT9B 3G08A 2YPVH 4G9FE 3IJHA 2DM3A 1G0XA 1KGIA 1DVSA 2FLRT 4P23C 3GLEA 5I15H 3T4AC 2BZDA 2JB6B 2R15A 4LAQH 4NM4H 4I77L 3K4ZA 1I7RA 1A3LH 2WLLB 4I3RL 4B0MB 5D9SA 1HYSD 4QCIB 3QHZL 4AQEA 5SX4H 3DSFL 4GAJH 1MJJB 4MAYB 4X6EA 1SEBB 3DXAD 3RTQB 4PBWD 4TVPE 3K5SA 2ICWJ 2XTJD 1QR1B 5EC1B 1RJYB 1B0RA 3DJRA 5DRWB 1AKPA 3F7QA 4D0BA 3KPMB 5BPPA 4X6FA 1DE4A 3AREA 5F44A 1BLNB 5CP3A 5INCB 1I31A 2H9GA 4U1LB 4P3DB 1P2CB 2AJYH 2ROYA 1GPOH 4XI5C 3K46A 4AMXA 3QRLA 3FUJA 3UJJH 5DMJB 4ODVH 2GY7B 4ALAL 4WHYH 4DT2A 4L23A 1O5DT 1F4AA 4QOKE 4XPAH 3NT0A 3IPEA 3VI3B 3HLKA 3I6GA 3BVWA 4PJHA 4WI3A 3O6MH 3FQ1A 2EDTA 2LLLA 2BP8A 2EP6A 4JRXB 4KI5C 4MB1A 4QRUB 4R0LC 3VFVB 3HNSH 6FABH 2J1ZA 2AS5M 5H94A 1SQ2N 2PN5A 3UZEA 3MRGA 2G3ZA 4ZT1A 5AUMB 3VU2A 1RIHL 2JQZA 2YPLD 1F2QA 5DA4A 4DVBA 4M1DH 2WBJB 3BPOB 1JAEA 2OL3L 2XNAB 3KGUA 3K72B 3MRIB 4XH2A 5CEZE 5K59F 3OKKA 1XB8A 2XV0A 4J2QA 3RHWF 3RFZC 4MQXD 4WW1B 5C0RH 3QJHA 3VSQA 5I75B 4WY7L 3C6LD 3D87B 1E5AA 2ZCHL 2O5ZH 1RZIB 2VMDA 1PZCA 4PRBB 1VEPA 1XB3A 3VMNA 4DP7X 1YEKL 2XU9A 3RL1B 1JNJA 1FAIH 1E6JL 1WA1X 4O02B 4PHXA 4HS3A 1CC3A 4M8UA 5HYJB 3EADA 4C56D 4Y4KC 4NQEE 1UVQA 1NZRA 3P73B 4JDZB 4AKOA 3GBML 1GS6X 2X4TA 3BP4B 4RGNC 4J1UA 1ZT4B 3VB8A 4QHUA 5EU5A 4NUGL 4KZDH 1A14H 3KBPA 5I23A 4U6YB 3IMTA 1FLRL 2YAEA 1BX2B 1JCKA 3PY9A 2QSTA 1BBJA 4ICWA 1A21A 4P46A 3RAJH 3PQYE 1M71B 1YNTF 1C5CL 1PLBA 4HJJL 4W4OC 1NC2B 2MWCA 2F58H 3L4TA 4D7BA 2JXMA 4L2LA 5GRVL 5M95B 4XMKL 3RPIB 3PUUA 5CCKH 2YAOA 4A68A 4GQQA 3MV8A 2PCYA 4PB9L 5IVXF 3CDGA 2XQBL 3OHXB 1ZTMA 3BFWA 5DR5L 4XN7A 4YHYB 2FECL 2HT2D 3MREB 2B3RA 4PJ7B 1RZFL 4CUCA 5JHDB 5IJKC 1KBGL 3IJYA 4B9FA 3SE9L 1YNTA 2IC2A 3F84A 5I66A 3VMOA 3DRQB 3G5XB 3PYCA 2BVTA 2VITB 4ZD3L 5I17B 5ACLA 5EOQL 5E94A 4JREC 4Z7VA 4TQIA 4KRNA 1AR1C 2VDMH 2CHZA 1NBVH 2F8IA 3CVIH 3X1FA 2QL1A 3MLWL 4R7NB 3IDMB 2FR4B 2OJ1A 1I8AA 4DZ8B 2YMXL 5KJRL 4XWGH 4HIHA 5F6HJ 4MMXC 4MBOA 4PWJA 4Q9RL 2CIIA 3OGOE 3ZK0A 3S98A 1H3PL 3IN2A 4WUKL 4LVOC 3UCRA 3QIBC 4EKJA 4ZSOA 1S7RA 3CH8A 1PYWB 1ITBB 3EOAB 1K5NB 4U3SA 4YVNA 3F6JA 3HS8A 3I2CL 3ARFC 1ZJBA 4HX1A 4ZS7L 1EMTL 2KBGA 5TQ2L 1BD2B 3VXNA 4XVSH 4IDLA 3E3QE 5EEYA 3LPFA 5J5EA 1ND0B 3N44F 4JB9H 5D7EA 3RVTD 1K5WA 1BVNP 3ZHFA 2DWEB 3ARBA 5C0BB 1AHKA 4I18A 4KI1A 1G6RA 2EYSA 4YBQD 4AQ1C 3U2JA 4CC0A 4HJUA 5FO8A 4N2FA 3B2DC 2LU5A 1P4LB 2EDOA 4L0PB 4YSDA 1FNGB 3OLDA 4ZTOL 1IQWH 1EEZA 5DUPL 4Q9BA 3GNMH 1FPTH 1QI5A 3QUZA 4OJEH 4Y19E 2WUBH 3WNOA 1XEDA 1SJHB 2PWHA 3ZT6A 5DJYB 3V9EA 5IJKA 1DSWA 1E0OB 2IANE 2WZPA 1KLFA 3FCGA 4V2BA 3QCVL 4QRRE 1ANUA 3QUGA 4GO8A 5TDNA 2WHVA 4NQCA 3IRPX 1DJIA 4A7UA 4ANXA 1QLFA 3GSRB 3GXFA 3I75A 4RA0C 4HFWB 4UM9D 2P7TB 3U2SB 2XBTA 4DGYH 1VFBA 4JPKL 2X44D 1W6LA 2YARA 3O11B 4P3WA 1CFTB 1XH0A 2BNUB 1H6TA 1JYNA 4NRXB 4Z8FH 4JFEE 3IFPA 4KNTA 3Q8CA 2DMHA 3P77B 5C0AD 5JNYA 1FO0L 2OMUB 2NY0B 4IRSB 1VGEL 3BVNA 2BIHA 4GAYA 3V5KA 2OMTA 4JZJA 5G5DA 2CCVA 4HHAA 4KBPA 4N0FB 5CBAB 4OQTL 4Q6YA 4XNZC 4PBDA 3LRHA 1JHTA 4ETQB 1BLIA 3QBTB 3UTOA 2HFFA 5C0IA 5C6TL 5ELIA 3WXWH 1GIGL 2XXGA 3A67L 4U1GC 5E8NB 1SBBA 4YR6B 2F74B 4KKCD 1DJXA 4NAJA 4XBGA 4F15B 1E7VA 2GSMB 3VM7A 2RB8A 3DYPA 2YPLA 3I9GH 1U8PA 4DSYA 4PW3A 3H9SB 4K15A 1RHHB 2E6QA 2GT9A 3G08B 3P4LA 4M03A 4JL2A 4PTUB 2Q8AL 4WDIA 1KLGB 4CBZA 1X3DA 4ZZFA 1HYSC 4PY8J 3GZKA 1RJCA 3L7FB 1OSYA 1D9KA 1EZLA 5EEWA 4LCWA 1N19A 5MERA 5DMKA 2FBRA 3D3VB 1GOHA 1KT2A 2HJFB 2XWBB 2PCPA 2X28A 5LBGA 4UT7L 5DO2D 1MY5A 5BRPA 5E9DD 1BG9A 4RRPG 1I53A 2R51A 1T2QL 3NTCH 4MD5A 3P3TA 3U9WA 3VH8G 3WIFB 4F58H 3BQUC 5F7UA 1ZIBA 5IK3B 3K5RA 3S37X 3D0VB 5SWZD 5B1BB 4XWOC 3KPRD 3LJ3A 2O61A 2P5EB 1MREH 2A74C 3CXDL 5LAXB 5E23A 4WK2B 1P2CA 2FEEI 1B2WH 1HHIB 2C5DC 2HZHA 5J13C 4Q2ZB 1E43A 5HJBA 1T1ZB 2WQSA 5JZ7C 2E8ZA 4UZUA 1FDLL 5DA0B 4YXKL 2CXKA 2W60A 4G9FB 4JQIL 3DSFH 2VTFA 1G7PA 4TULL 1CR9L 5JXEC 4Y8AA 1OGPA 3IJEA 2Z7ZA 4I3RH 3L45A 3KH3A 4G6AC 3KS0H 4UMGA 3ZGIA 3PRZA 1INQB 2H3NA 2P24A 5CGMA 3LV3A 5L0QB 4RMVA 4JG9A 3VW3H 1AS8A 3ARDB 2DOCA 5JQHC 3K72A 3MRIA 4HMEA 4BRJA 4MGXA 4ABWA 5JIIA 1NCAH 1Y7VA 4FS0A 3OKNA 4XNUL 4AY0A 2I7OA 1JERA 2XWEA 3R18A 2VQ1A 3L3IB 4YSPA 4WV1A 2AEOA 3D9AH 4QHNB 4LQFH 5DJ0B 4U1HB 1WZAA 4X99A 1RD6A 1UA3A 1Y1UA 4Y5YC 1AOHA 2CSPA 4BE6A 5DCCA 3GM0A 1JF5A 1CL7H 2H9GB 3PL6D 2XDHA 1L7IL 3BN9D 3UP6A 3ZDZF 3U48A 3V6ZB 5KANG 3EHBD 2F2HA 3B7YA 4PJBE 4Z7UA 5GZNC 4IBWA 1QO3A 1ZAGA 2G2PA 3SE4C 2MFNA 1XIWD 2DB8A 5C0CA 3FUNA 4UQ2B 3I6GB 1KB5L 4KJYA 2X4TB 4F1ZA 4YLQT 4TUJA 3TIDA 3V0WH 1EBAA 4HGMA 4IHOA 3VRJA 5ITBL 1NCTA 4JG0H 3NSFA 1CFMA 2W65B 4PJ5B 5GGUB 3V6BR 3W5MA 3BCDA 3JVGA 5KZCB 2XQYG 2J73A 3VQLA 3BZ5A 3V0HA 3L13A 4BZ2A 5T3XD 3RWDB 3BX7C 1QSFA 3TZVA 2QVFB 1SLVA 1NUNB 3IBEA 4Z76B 3QUZD 4CC1A 3WDIA 3NZ8B 4JK0D 4MRCA 2CBQA 4RA3A 3LKSA 1WD8A 3HFML 1Z9OA 4CDHA 2DWXA 4ONOA 2P5WE 2EO1A 1WT5C 4WFGE 3U6XA 1CLOH 5C70A 5C07A 5LXVA 4IEFB 2PWGA 3L3DA 2Y06L 2FBJL 2GC4C 4IMLB 5LBSA 2HVKB 4X9YA 4Y89A 2MOGA 1SXAA 1T1YA 2HUHA 4POZC 4CW1A 2FQGA 3O3DB 4H20H 5BMFH 2YK1H 3EBGA 1KB3A 3K6NA 4WCYH 5HYJA 1E4HA 2X53A 1HU8A 1L9TA 3KPLA 3P73A 1CD8A 1X5MA 4JDZA 4FQHA 5D7SL 1S3KL 2WOYA 2WYZA 1O5PA 4H2CA 3UCQA 1CGSH 2Y7OA 4HXAH 1MCPL 2VZ1A 4Y0GA 5IKCB 2N3JA 5DSCA 3R0MA 2IAND 2FSEB 3QORC 2EXWD 4FQXB 1A8JH 1KPVA 1SFDA 3DV6B 1BMGA 3HG1D 4KVCH 3MLRL 5J1AA 2AXJA 5IUCA 5DRZA 5G55A 3U1PA 5DD0L 4FNLL 4X50A 1JI1A 1RL1A 1SZNA 3PAVA 5C0BA 1W0WA 4FABL 3WYRA 4PVNA 2ADIB 3B7RL 4NQXA 4RGMC 2XA8L 1AGCA 4I5BB 2FWSA 3D39D 3PAZA 4KVNL 2VW7A 4L8DA 4I0CC 3RKPA 5FYKD 3AMKA 5K1NA 1D9KD 3MBED 4PRDA 3GSOB 2ICEB 1DJYA 2BOCB 1I1AB 5ITFA 5CCKL 1RUML 1FL5B 5E5LA 2KPWA 2BVPA 4Z5RA 3TJEH 1OP9A 2MKWA 1ZLVK 2X4SB 4MJ2A 5IB3B 1VPOH 1F13A 4DCQA 1KCSH 1SLWA 4ZUWA 1MAML 1FLRH 2Y5EA 4OLUH 4G5ZH 3L3OB 2QSCH 3LRKA 4JZOA 4BUGA 3UJTH 4YSQA 2IWEA 4FNQA 2P8PB 1ZLSH 5E9NA 5FF6B 2MIZA 3ULSB 4L4VD 2IAMD 1YDPB 3OLEA 1ND0A 3P0YL 3TNNA 4M5YH 4G82A 1F58H 1KTLB 1XFPA 2WWOA 4Q0XL 5CHNB 3WBDA 5BOPA 5IW1A 5J1SC 2DM2A 4KUZH 1UD4A 4M7ZC 2XZQH 1DO6A 3BT2L 4FJZA 3QDJA 2EABA 3U4BH 2VR5A 4Y19B 3Q8BA 1EEZB 2C4XA 4PB0L 4TN9A 3TA3A 5HI5C 3II2A 5JXAL 3POCA 1A7OL 2AITA 3PWUB 4EOWL 4HCGA 1NCGA 1SJHA 3H9ZA 4Y16A 4P4RB 5F71A 4DTGL 1DBBH 4LGPB 2VABA 1MCDA 2DQJH 2W9LA 5ADOH 3WS6A 2R23A 3V4VH 2EH7H 3HNTL 3K91A 4GQRA 4M61A 2JNZA 3I75B 5EEVA 1CFSB 2A4ZA 1NUDA 4LVHC 3OHXC 5E2UH 2YO3A 5CS7A 4G6FB 1MLCA 4HLEA 3KLAA 1DUZB 1U2HA 4G7RB 4JFEB 2X70B 4MA1C 4MD4A 5I19L 3MRHA 1F1GA 2BW4A 1Q0EA 2VISB 2YGOA 1ZMYA 3IFPB 4V11A 5K9QI 4AIOA 1LK2B 5KSBE 3EGDA 3A4FA 1J9QA 1WZ1L 3L4ZA 4U7SA 5EZIL 5LB1A 5G5DB 3BIAX 3CJJA 3TO2B 4P49A 2R2EA 3X14B 5IVZA 3NRFA 4YDLB 3MLYH 4LKCB 3QUKB 4HUVB 4NAQA 2EQDA 4BH7A 3HRZA 4J6IA 3FFCA 4UNTA 4Q2ZA 2OQJA 2R0LH 2WLMA 5HGAB 3W9EB 5E9AA 4UQAA 4ZO9A 2DQUL 2HP4A 2XA3A 5ETUB 3T8XB 3UG5A 4JVWA 4KAQL 2E0PA 3SE3A 4G6AD 3FQUB 1C5BH 1P69B 3TJHC 4JAMB 1MCKA 5DD1L 2E74C 4ZUUA 3S35H 1QSFD 1HESA 4AYMC 4WWOA 4FN0A 1LNUA 1G7IB 2Z0UA 4YDLC 1NLBH 3L7FA 1HILB 4RMUA 3LV3B 5D1XA 3PV7A 3MYJA 2QSQA 3WIIH 1E4KC 2BM3A 1CICC 2YD7A 2Z65C 1RK0A 2I60H 3MR9B 4X9FA 2DPKA 3QORB 3NH7H 5C3LD 1S4IA 2KLSA 2XXMB 3F2LA 4J8RB 3NA9L 4L3CB 4WV1B 7FABH 1OAXH 1QFWI 4HWBH 2EE3A 2V37A 3ET9F 4JCLA 1JUFA 3ABZA 4AYFB 4XT1C 1A7QL 2P5EA 4BCYA 2I9TB 5C0DB 1NCUA 3QJXA 4M3HA 3IRCA 1HL8A 3JWOC 5DC0A 4LT7A 4XBPA 4A7QA 2H3XC 5FUCC 1EANA 1P7QA 4P46D 4CU7A 3FT3A 2LABA 1TU2A 1OSPL 1S9VB 4PD4K 3A5VA 1XR8B 3WD5H 5AOZA 1J7VR 5CWSA 2R1XA 5D93C 3RBGA 4L29B 1NEPA 1EJFA 1T21B 5CNHA 1NMBH 3MGTA 4H7VA 3WELA 1SQMA 2EEDA 4IKJA 2NZ9D 1FNSL 1VAHA 1SJVA 3LZQA 4LBEA 1U3YA 4QGYA 2F5BL 1BGXH 5AAWC 3OAWA 1YEDA 2FGWH 4TVSa 1VKXB 2WLZA 3OVUB 3ZDZB 1BQHG 1THCA 2X0VA 3HR5A 4JBSA 3EH5B 3ULVC 3WV0A 1Q94B 1CF1A 4HFUH 1XF3B 3IU3A 1HDMA 3H55A 4NI6A 3MRPB 1LO4H 4OLXL 3V6OC 3WNKA 3T6XA 3ZRSA 4WAFA 3FHAA 5A2JH 3L3DB 1G9ML 4EN3C 5KS9E 3I2CH 2W0FA 2WUCL 1TPXC 5TQ0L 4AE0A 1CDCA 3AXLB 1VZGA 5F8QC 1DUYB 2ZWKA 2Z93B 1U6AH 3QFJE 1I7UA 4W6WB 2WBXA 2WIIB 4ORGB 2FBJH 5F97E 3EYQD 1D7FA 1IAMA 2XX0A 2UWEB 3OKOA 4CKVX 3GTVA 3MROB 1IAOB 3RWCA 2QHRL 4B0MM 3WJMA 5B39B 5CJ8A 2EIZB 3QRGL 3RIAF 2IAMA 1R34A 1YMMD 1X44A 2XQ0A 5I6PA 4PH8A 2FSEA 1E4XI 5HHXH 4BFGA 3NP4A 3ERXA 1EGJA 3BKCH 2ATPB 3OTTA 3NZHH 4H5SA 2WO4A 4MHHG 2V2TA 1TQCC 5D4JA 4PS4L 4R2GB 1PIFA 4OAWB 4BK5A 2BMKA 4KJQD 1ZE3C 4PJAE 3HG4A 1NGPH 5IFAH 3UYOD 3RA7H 1D9KC 4ZMQA 4PREA 5FCUH 2BSED 1WFUA 2IH8A 3QNYB 2IBZY 3DGGA 3DMMC 4ANUA 2CKBA 2FX8H 2P5PA 2XRAH 5DZOA 5JLZA 1QSEB 1PVHA 5T1DL 2Z31B 4ESKA 4IRJC 3WFBH 1KTCA 5EIVA 4OV6F 4A37A 3SDXF 5SX5H 4BV1A 5E6IA 1I7ZA 4F2MA 3WXVH 5H2BA 1G7MB 4YHLH 1OVZA 3TH2T 1BZ7A 3ULUH 1ZLWH 3S48A 5CGYD 4KDWA 3DX2A 4ZDHA 3QUMA 2YD4A 3Q3GA 3QWQB 3P40A 3T2NL 3GEFA 1IFGA 4H13C 2FX9H 4BSVB 1TQVA 3QDGE 2CK0L 2CWRA 3A6OA 3O0LA 1UOWA 2F53E 4Z3HA 1V3LA 2AQ2A 5F9JB 5C08B 3O8XA 3ETSA 3C60B 3WEXB 2QSVA 1Q0XH 1O6TA 2H47C 1C9SA 1WAEA 1HL9A 4JY6B 2QLYA 3LD8B 1WGVA 4GP8B 1EVTC 4QO1A 1EJOH 1E90A 1UM4H 3LXUX 4C59B 5LJYH 3LZRA 3HNVH 2CHWA 1DBKH 1MFUA 4DPAX 3AQXA 2GJPA 2OCJA 4X7FC 1JGLL 2V8LA 3TA3B 3FUKA 5T33L 4LASL 4P2CG 3DPBB 1UYWL 4BXSV 4OF7A 3SCMD 1HK6A 5C09B 1E5UI 3C9NA 4HXAL 3DLQR 2J71A 4R26L 3OJDA 4F33A 3TEXA 4DK6A 3U1SL 2H2PD 3DTXA 4H8QA 5I5RA 4AQ8A 2F54D 4TQPA 3KAAA 4XC1H 5CU9A 3DVNA 1VESA 4K3DH 5MHSE 2J4WH 4MXVF 5IEKB 3AACA 3BAYA 2CUMA 4HGKC 3BKJH 5LBSH 3SPVA 4E9YA 2HLAA 2OMWA 5D1QE 4OJCA 1IIKA 3PWJA 3WLWC 5E4EC 3EJCA 4U1JA 1OHZA 2XYCA 1WLGA 4P5TC 1QQDB 4KH2A 1NLDL 1DSYA 3QP3A 1GZHC 4ATWA 1GMIA 1Y0LB 1QYGH 4DW2H 1A3LL 3DWTA 5IROD 4PRAB 2X1OA 4AIZA 1DCLA 4JM4H 5D1ZB 1TTFA 5LGHL 3ULVL 4HUVA 2OI9B 2WN2A 3O81A 4Y19A 2DIEA 2AQNA 5HHPA 3L4XA 4HH9A 3W5NA 4Z7WE 5T5FL 2HFGH 4M6OH 2VCOA 2ZOWA 4K3EH 4ZUUB 4N20A 1AS7A 3IMVA 1I1CA 3SYOA 2GBVA 3BVTA 5IQ7L 4MKMA 1T04B 2BNRD 2WBJD 1F86A 3DMMA 4HUWB 1KTKE 4IGBD 3P30L 3NIDB 2V9TA 4Y5VA 2X87A 2DDQL 4QRTA 2KZKA 1ZLWK 4HV8A 5T3XE 4IRJA 5ICYA 3E9UA 1NCWH 4HUUB 4QT5B 2P8LB 2C3VA 4L4TE 1F02I 1FFOB 3HG5A 3MRHB 3BRFA 4X6DF 1RK0B 5GGQH 1A6AA 5E2JA 3FUHA 2UZXB 4O4YH 5AFAA 3KPNB 3WIHA 2UZYA 3N42B 4HUMB 1LDPH 4KNSA 2MJWA 3V7MA 2E6JA 1NCDL 1IC4L 1GS7A 3CU7A 2ORBL 3IS1X 1DZ0A 3NFSL 4RFEA 5D7JA 5FCUL 1PS3A 4N5ED 2BVQB 1U91A 5GS0D 4MNGA 5HHOB 1RERA 2VLKB 1MI5B 1QAWA 3TWCL 4QRPA 1PG7L 2ZCLH 4UINL 4J28A 4GBXD 1NM9A 3OSVA 4F9LA 1U95A 1DQKA 1K9TA 1NC2D 3KPSD 3LN4B 2EDBA 3V6FB 3UEQA 2GC7C 3ZYJA 4DKFH 3LY6A 2A74B 3EJYD 4N0YL 1OAQH 1CTMA 5AAPA 4O02L 1EZVY 3ULVD 4DWHA 4UTAH 1CD1A 1VF5C 4RAUA 4MNHA 4YDKL 3D30A 5JHDD 4DOHE 4AMWA 2VDPH 3MR9A 1XF3A 2XWJA 5GJSL 4JLRA 4YE4H 4J8RA 3QG6B 4LQ1A 2RFXB 3C2SA 3O45A 1DBJH 1CLZL 2HB0A 3B6SB 4NHCH 5FYKE 3DJ9A 2VDQH 1TKWA 5FGSA 4AV0A 2W0FB 1U8IA 1D5BB 2CALA 3KDMB 4LRIA 2F7PA 4AMKH 1P7KA 1LJMA 1UA7A 1KB9J 1A2YA 2Z93A 4JHAL 4MJIB 1AKJA 1P0SE 3FT3B 4ZAKC 2IMMA 4QRQA 2BVEA 4OSUL 2IO5A 4YNYA 2VNCA 1INEH 1OSZB 3GMNA 1T1XA 3MNMA 5DJ6A 2KDGA 5LO7A 5ABAA 2APWA 3SE6A 5DQDL 3NIFF 3CPLA 5KYWB 4GFTB 4J3VA 1BD2D 4OGYL 4O51B 5GGRA 5IR1A 1TVBB 3DTUB 1X9LA 3KPOA 1B6DA 3NGBB 3A23A 3D39A 3QQDA 3TVMB 2R0WL 3D2UA 3HS9A 4U1GB 2GAZA 4FXGA 1TOXA 4FHJA 5FR3A 5CFAA 3SCMA 1HDMB 4HWZB 4QOKB 2FB4L 5DXWA 3VB9A 1GAFL 5B7FA 2UWEF 5TE6L 4JEGB 4JFYA 1HSBA 4XNAA 3FQTA 3M7FB 4P57B 5E51A 5DURD 5C0NC 1JN6B 2DWYA 2CBTA 3T9WA 2K4WA 5DJXA 4ZFOB 3IGLA 4E0RB 3MYZA 1JNNL 3UZEC 2G9HA 1J8HD 4YZFE 2DICA 5CJBA 4HZAA 1RQ5A 4PQXA 4R5XA 3HLAA 4PJ7F 1T89A 1KIQA 3G9AB 1QR4A 1MCSA 1MW2A 2CUIA 3QAQA 5BRZD 4KKCC 2BSCA 2DQFA 1V3KA 4UILL 1ZLDA 5B7EA 4CSSA 5ESVB 2JCCB 2N01B 3T6ZA 2QADC 2UUDH 4FYQA 5DFTA 4BFRA 2J8UF 1KF9B 3PNWB 1S7QB 3HI6H 1DDHB 1YY8A 2WWKT 1I4FA 1L9OA 4D3CL 3D4YA 4XVJL 2ZWLT 5E8DL 1KDIA 3N40F 5I6KA 3M1CA 3ZDWA 1SMOA 2WC7A 4PWKA 1DVFD 3BYYA 1A7BA 2ZOKB 4WFFD 4GI9A 4R7XA 3V4PB 5C6PB 4NQEB 3VUAA 2P5WA 4A2HA 1PZ5A 4OCWH 4PPTA 4HXBH 4QLWA 2EIKB 4OJAA 3BQUD 3H9SD 4JKPH 2C8NA 3IDNB 4ZMXA 2Z92B 2XNAA 2DM4A 3LTVA 2ADFL 4AWJC 5KYNA 3WTTA 1UJ3C 4MZ2A 1VFUA 4TMPA 1H8LA 1I1YA 2E59A 3PREA 4QLRA 2EEFA 3EFOA 4JHUA 1I7ZB 1C08B 2ZKXA 5AVQB 4C55A 2ZKYA 5I1AA 3M86A 1FHNA 3FUEA 1GGBL 3IB4A 3O4OB 4LRIC 1CIDA 2BX5A 5T33H 2AV1B 3WTVA 4P8QA 2FGZA 4JFTA 4HPOL 1T1WB 4XBEL 4I0PC 4GQ9H 1FC1A 2E7LC 3F05A 2LAGB 1H6EA 3NAAH 1KBGH 3ATFA 3L4YA 4NO3B 4TL5A 5DVNA 4L5FL 4YDIH 1TZGH 5IROC 4QHUB 2I27N 3L9RA 4YBLB 2WQ8A 5C0BE 5I15L 4OD1H 4JY6A 2E27H 1EXUA 1BX2A 1MG3C 3VYOA 1RZFH 3H9YA 3FMGH 4N4YB 5LHDA 3OMZA 3DJSA 5ID0B 4LSUL 5C0FB 2LOEA 5I30L 3LSOB 4NQVA 2FQEA 2GBTA 1IC0A 1KB5H 1W8EA 3M6DA 4R4BA 3FDWA 1A4CA 3DX7B 4X80H 3BGFC 1OAUH 4WW2C 1TZIA 2L7EA 4JQVA 3IJYB 1N59A 2R8SH 4NRYB 1HKFA 3VTMA 4UM8A 3HTLX 3QPQD 2WOBA 3BVVA 2GKIA 3GHEH 3GBMH 1MDAA 3GJFK 3GYRA 1XR9B 2VJ0A 3EIFA 3FXIC 4HALA 5EC2A 3UGXA 2PO6C 2X4RA 1EV2E 1RCYA 4KQ0A 1U58B 5DJAB 3VXRE 4GKSB 4KUCF 3KLSA 2IPTH 4Y2DC 3GSNA 4JFFB 1MG2C 4ZSOB 1KPRB 3IPFA 4A2DA 1WA2X 2HTKD 1QASA 3KLKA 3N1QC 1A6ZA 1D5IL 4LB8A 4M29A 3MKKA 1J8HE 3SDCA 5CLWA 4UIKL 3VH8A 5SWQA 4WEBL 3KZ8A 1TQWA 3PHQB 4GH7B 2NX5E 1W8OA 3V5DA 3ZL4H 2BC4A 2WV3A 3QXDA 1WC7B 2CDEA 4GXUM 1BCIA 1P1ZA 4IK6A 5KVFH 5T1MB 3IYLW 3E8UH 4YJZL 1BJMA 1CXEA 5IF0A 1YPZA 1MOEA 1P5VA 2QDWA 4S0TD 4RIRB 2ERJB 4LL1A 3FAWA 3QUZB 4GQPH 3RL2B 3L9BA 4WI9A 3VTAA 1MZZA 2CBMA 1LP9E 1H8NA 2UX7A 4OLWL 2B3IA 1F3RB 1PNCA 3MV7B 4AEHH 3AG2B 3KPTA 3CU1A 2WYTA 1KELL 4M7JH 2VZOA 1YEJL 1CTNA 3CZSA 4GRWF 5HYQA 3D25A 2RAMA 4X83A 4NENB 4PRIB 5E2TL 2GTQA 3B9KD 3JV0A 2BNUA 1GA2A 1O0VA 2CLRB 2GB2A 2AF2A 3P4OA 3FOLB 4PJAF 4R8WH 5D5ME 4A2MA 1LO3H 2VIRB 3LZLA 5DQ9A 3VXQA 1DBKL 4U0RB 4NC0B 3KYMB 4AGNA 2HA1A 3A47A 2CO2A 1VFOA 2Y9RT 3MRMA 4JR9L 4L1TA 4N0FA 2FO4A 2ZX6A 4B60A 3VSVA 5AAMA 3QR2A 3GJEB 4FQXD 4H25A 1OARH 1J10A 1EK3A 1BREA 3GXNA 5DD5H 4OB5H 4S1DD 1KXVA 1F4WL 3A4EA 2CKBL 4NCC2 4XBGB 5EFIA 4XRCA 2FIRT 3GMRA 3CQQA 2CQVA 4H26B 3O6LL 5KYYB 2DM7A 4DOHB 1BVLA 1RIUL 5G4NA 1QLEL 2NPLX 2B4CC 3PWVA 4PJEF 4RWYL 4XP4H 2YGNA 3ARFA 4F15C 4LEOA 4ENEC 2LT9A 3QG6A 4RESB 4I87A 3WXVL 1YNLL 1A7RH 1L3WA 2JK5A 3G5WA 5KYUA 3UBXI 5IESL 4P57A 1I1AD 3V8OA 2XLLA 4LRNH 4KKPA 1U8IB 4JM2C 3K0WA 3RPBA 5JIKA 3L5XH 1GSMA 5AYUH 1NSNL 4LDOB 4MMXB 3T0VA 5C2BH 3ZHDA 4AL8C 2IDFA 4WI6A 4YAQB 3W0WE 1JGVL 3QWOA 3BH8A 1OALA 4BFBD 4HIXL 1TTGA 4N1CA 1BQKA 1G43A 5I5IA 1MJ7L 4PJFF 5EWIL 4CKQA 1G6VK 2BSDA 3C87A 3OPZH 3EYUL 3TT3H 2VQTA 2FD6H 2D7NA 3CSFA 3BAJA 4MXWH 1B90A 5AB1A 1SLUA 3AU1A 1ED3A 1YY8B 4JQXA 3SPIA 2W60B 1I4FB 4WU7B 1M7XA 3T6VA 4J8QA 4N24A 1PTZA 4LCUB 4GQ9L 4EEEA 4HPOH 1VCBC 1ZA3A 4Y4HA 5BS0A 2HT4C 5L2KB 1ZTXL 3FFCD 3S5LG 4QOKA 3NJKA 2YRLA 4GEJA 5HDQH 1O9VA 2A73B 2OJEB 3BWZA 1CFQA 1HC1A 1NPJA 3CFKA 4HS6B 4LVNC 2FWOB 4UQIM 3UTSE 4TVPL 4OF5A 2WCPA 1M6UA 1OQOA 1NFKA 1O7VA 3HUJF 2FHBA 4OF6A 3VFOB 4KFZC 5FYKU 1CK0L 1U8HB 4UT6L 1I75A 4N2NA 1L0QA 3GIZH 1YN7A 2DQEL 4RVBA 2DJSA 5I26A 2MCG1 32C2A 1IBFA 5SX5K 4H1LB 2R27A 3QEQA 1D5XA 5TDPB 5C71A 4HOXA 3K2UH 3O0RL 3TBTA 3U4BL 1E67A 1H0DB 4FJYA 1S5IL 4HEMA 3BPNB 1HWHB 3WSQH 4DESA 3UC0H 5AW7B 3M88A 4OFIA 1ECYA 4I3SH 3ZZ1A 1UJ3B 4OT1L 2D0GA 2HYMA 4LOUD 5J11B 4W9FC 3TIDB 3S36H 4XOEA 2X40A 4DERA 5E7FA 4AQZA 1XGTB 3T08A 2C9PA 1QW9A 1B4JL 2IG2L 1PJ9A 3IETB 4UV4H 5HPMA 4A1RA 4PJ5A 3LQAC 4GSDH 3DV4B 4A55A 4CSPA 4ZX3A 3OKYA 5DVLA 5E6YA 3WENA 1W9XA 1T5WB 3ARGB 1L0PA 3LKQB 4FOMA 1TTCA 4OZFB 2IFFL 3KLLA 4FG0A 1AR1B 5EORL 3LPWA 3ECVA 1QFUH 4YDZA 4XE5B 4ZW8A 4ELKB 1TZIB 3TH4T 4MKTA 4CN6A 1M7IB 1CB4A 2OSXA 3UXFA 3O3AB 1P9MC 2HN7A 3DXAB 2HVKA 2DLFH 2ZUXA 2Z4QB 1RJLA 2VXSL 4K5MA 4P59H 1UURA 3AT0A 4CW1B 5I1JH 2A9DA 3KG5A 2MMXA 4OZ4B 3EO0B 2VXVH 3BWUF 3UTZB 3WFEH 4HK3J 5K9OA 2DYSB 5KBDA 4FZ8H 3VQMA 1BHGA 3CHSA 3ULVF 1V5JA 3L6FB 2NXZD 2PW1B 2P8MB 3MLRH 3F83A 1KPRA 1A9EB 2N4IA 4YC2C 3BAWA 3B9VA 3GF8A 1XGPB 2JCWA 4WGVB 3DI3B 3WJLC 4MJ5A 2FNWA 4AJVA 3KXFB 5EDSA 3LSOA 3FU7A 4TRPL 5ALCH 3VH8B 1AG0A 1NMCC 3MJ9L 3AZUA 1RZGB 2L0DA 5DHMC 2Z3FA 2I26N 1E28B 1OEZW 5J12C 5AOMA 5DMIL 2CU9A 3CHXA 5DRNA 3FN0L 3KMDA 1JNLH 3NRQA 3T09A 3CZLA 3E80A 1DVQA 3F58H 5CJ5A 1NWOA 3DGCR 1OF0A 3CMOL 3CWGA 3P4NA 2HWZH 1JV2B 4ATTA 4CN4A 1A4KB 2V5TA 3BVUA 2ICEA 4K9JA 4LF3B 4X8CA 5FUOH 5FXCH 1RAMA 2K45A 4S2SB 3VWJD 4PYHA 3FB6A 2LTQB 1ID5I 2QQLH 3HG3A 3I6LE 5AW0B 1I8KA 3C6LB 3QO0A 4KTGA 2X4SA 2DJMA 1QMUA 3QI9B 1EDHA 1IZKA 3C5ZB 1LEIA 1N10A 4GEIA 2KKQA 4Z7NB 5FS5A 4DTGH 1CGUA 5DS2A 1IAIL 5E08L 4JFFA 4X6DA 3D25B 1JS4A 4G42A 1N3NB 3HMWL 5D2LE 5EU6A 4M93C 3OL2A 1ZHKA 3LH9A 1JNHB 2IBBA 3NEXA 4R0LB 3MNVB 1MW3A 4YZFF 2O5YH 4JKKA 5SWQB 3VE0B 1LO2H 2ESVE 5F0MB 2LTQC 3HPJB 4N8UA 4NQQA 3Q2LA 1DBAH 3B9DA 2EKSB 2BHFA 4AGOA 4YHZL 1U36A 4OGQC 4WK0B 3B1TA 1WC7A 2CDEB 5F1NB 3VFGH 3IN0A 1NGZB 4AX3A 5HDBE 4ZX5A 5I6NA 1HHJB 2AK4A 4Y4KA 4X6BA 4HQQL 4P05A 5DUMH 2EE0A 3O8XD 2QSCL 4FQJH 1M9SA 2YD6A 7PCYA 3CXHK 5I5JA 2VLJA 2IPUK 4KZEH 1J8KA 4QY8A 4AKQA 5DZVA 5BQDA 2CGRL 5I0WA 1IBGH 3H9HA 1RZPA 3GIVA 4XCEB 4HIJB 3SOTA 2Q3AA 4UOJA 1UOKA 2A5UA 1Q38A 4IRZL 1UATA 4PRIE 2CKBH 1PEWA 2Z31D 5JDSA 5CZVH 1CMOA 1UFUA 1BXXA 1AI1H 4PS4H 4ZYKB 1Q0YH 1RZKH 3OM3B 1OD7A 1JZFA 1UM5H 2CLRA 3P4OB 4Z3JA 3H4HA 1CQYA 2JLPA 3S2CA 4GG6B 3PCYA 3TOPA 3TN0A 2HPTA 1HWWA 3HE6C 4LPCA 2NDGA 4U1NA 5C3TA 3ULUD 2B77A 5HY9A 3GB7B 4FKKA 5IVZB 5F88A 2R0ZL 3BPLC 4FG6C 4U33A 5HDLA 3BD3A 5E00A 4ONGH 1FRGH 4UAHA 1UWFA 4MSWA 2OSWA 1JFHA 1ZD6A 1VACB 1IM9A 3C60D 3HC2A 1IKFH 1JF1A 4XCCL 2WNGA 1X9QA 5KSUB 5AYTA 1JVLA 2C9UA 4FQQA 3UPAA 3FC8A 2WQWA 4JAMA 2GCYA 5J57B 4PJCF 2EXYC 1WSST 3FT4B 3AFLA 1RUPH 4UI2A 5AW1B 1ZS2A 1OGAD 3FRUA 4E9LA 3HR6A 1LNUB 1IE5A 3CZNA 4LU5H 3FQXA 1OT4A 4YGVB 3TIEB 4H20L 5BMFL 4WENB 4N8CL 3VGEA 1HCFX 3O6KL 4JFUA 2R4RL 4GKNA 1JRHL 5CF3A 1TETL 5AL0A 1CGWA 4WFHD 1KPUB 4TRPH 1UUSA 3G5VA 2ICWB 3M8OH 5ALCL 2WLLA 4JG1H 2L7QA 3Q1SH 4GIPD 2BSTA 4G1EA 1CDBA 4GT7A 4MAYA 2EDWA 2IOOA 1KN4L 3JWNG 4P23A 3GQFA 4PW9A 4J23A 4KFMA 5HVGB 3BRDA 3BZ4A 4UT9L 4PJHE 4XXDA 4IRSD 1BLNA 5INCA 3IPBA 4FKHA 1IKOP 1S9VA 5FM5M 3MRRB 4WU7A 1UZ6F 3RGBA 5HYIA 4EUPG 4R97C 3BDXA 3GKWL 2XPYA 2XCMC 4HC1A 1YVLA 4KHXH 3SZ6A 4MVBD 1WWWX 4LLVB 3IETA 2LU7A 5FHAH 3TWYA 4HS6A 4OCLC 5IBUB 4K8RC 1WS7A 4N87A 2WWMC 5F1OB 1QSEE 3LKQA 4M5ZL 3VFOA 4JY5L 3RDTD 1ZVNA 5CLXA 2DQ6A 1U4EA 1TEYA 1SDDA 3K8MA 3QFGA 4XH2B 5TF1H 4YXHL 5ICUA 4YHZH 2F54E 2WN3A 1M7IA 1ZK5A 1ERNA 1D5RA 4APQD 2NY1B 2BFVL 4F7KA 1CXIA 1KGUA 1OGTA 4HSAC 3GI9L 4GAGH 4DP8X 4X5RA 5DYOB 3V4LA 3AXLA 4AOFA 5CXPA 3G6JF 3C75A 4MDIB 3V79C 3N5AA 1RZIA 4PRBA 4ORGA 5IG7B 4K73A 4HJ0D 3L08A 3KPRB 1NAMA 5SWZB 3EJYC 5JA8B 1NBYA 2BS8A 3TT1H 1OV8A 4NZUH 1IAOA 3F65A 2NSXA 2EIZA 5HHNA 3C09B 1XGTA 2V9UA 4UQBA 2CR3A 4HJTA 5HPMB 2J88L 2MHAB 3IFNL 4ZFZA 3GIZL 2K4AA 2XKSA 1H6FA 3GLZA 4H5SB 3GMQA 3Q1EA 1NC2A 5C0CD 2P42B 1R3IH 1XV8A 2GPZA 4I1RA 2VC2H 3NN8A 4H8PA 1RIVL 5LGYA 4ELKA 4XHJD 2F53B 2H6PB 2X6MA 4JFDD 2WK2A 3KCPB 2K0RA 2V9QA 1MHHA 2VDML 4I9WE 2A9NH 2FT7A 2EIBA 2DWTA 1LK3H 3QNYA 4LSVL 3V9CA 4BQ9A 4ELMF 5H37G 4X4YA 4OVUA 2V5SA 1SDYA 2OSYA 1GHFH 2ZOUA 5MEND 3ZYOA 1MJ7H 3B9KA 5DVKA 1IKNC 2R29H 5CZKA 4YDVA 3PG2A 3QUHA 3FT1A 2CMRL 4PMEA 3CFDB 2JELH 3EDJA 5E94B 3QXAA 1TT6A 5K9OB 1HOCA 3OKMB 1NDMA 2DD8H 2XWDA 1SYSB 2EADA 4DHLA 4X8XA 3CFNA 5E4IA 4HU2A 3UO8B 5DZAA 3BFOA 3QFDB 4XMKH 4JPSA 1MHPL 3LKOA 2GJRA 3CFBA 3O4LA 5C07D 4B7IA 4BSVA 4F8TA 4UNVA 4N90D 1EO7A 1WO2A 2BFVH 1SY6A 3ISWA 5TE7H 3P11H 3MNVA 2H5UA 2A9AA 4NPYA 3MCKA 2W0LA 2XIIA 3TPUB 3EOBA 1SY6L 2WVVA 4Z7WB 1QRNE 5E5UB 3CQPA 2EUXA 3C5JA 4IDJH 4XP5H 1UEMA 2LW3A 3NIDE 3ARFD 4E9XA 3S8FB 1UWXK 2BY0A 1FO0H 3ULVE 2IANA 2X4QA 4ZXBB 1TQBC 1MQ8A 5EOCJ 4QUOA 2AEPH 5IVXA 4Z77A 5JQIB 1F56A 4D9RD 1YEFH 2VR7A 4OVVA 1M2VA 1T83A 1G6RL 2PCFA 2XFXA 1CU4L 2ZUVA 1LO5A 1JZDC 4W9KC 4XNXH 4LEBA 1ACYH 1IILE 4CN1A 1AHMA 5JXED 4PV9B 5KW9L 1AYOA 1DVXA 2J1KA 5IB5A 3ULVH 4NPJA 2FJFA 4XPTH 5HJDA 5IEKA 4NQDD 5TDNB 5TFSL 2JKLA 4K71C 3B5GA 1XCTB 5GIRA 4IU3A 2QPFA 3JZYA 3OXRB 4Y88A 4L8CB 3RX9A 1OIOA 1EDYA 4PJ8D 3W2DH 4N8CH 6FABL 4U1JB 4OBSA 3TN0B 5F7WC 5JR1L 1KTDB 1QQDA 3DNKA 4D7PA 3D5OF 3L3GB 5B39G 2RHEA 3P77A 5JNYB 1EQWA 2G60L 3UAFA 5F88B 2XV6B 1JHTB 2B39A 3B3IA 4PRAA 1U8KA 5FWQA 5SX4I 4U6XA 4PLKC 1NGZA 3K2KA 2RH0A 1L5GB 4PVLA 4P5TB 4XCFL 4QF1B 5FKPB 4KMLB 1JXKA 4POUB 1IC7H 5A2AA 3V95A 4OTXH 3MSPA 5GZOC 4R7VA 4N3TA 5E8OB 2VLKE 4NKDA 4Q9RH 1MCCA 4I0PD 3DMMB 1KCRL 1J12A 4Z3GA 3AS0A 3MV11 4W9IC 1D9KB 4OJFH 1QBML 4YGVA 1RMFL 1WUNT 4HHWA 5E2VH 4TOYH 3V7AG 1KEGH 1KCLA 4A7SA 3AW5A 2YSSB 4HWBA 4TF4A 1XH2A 3VFMA 5L6YL 2OS7A 4MA1B 5JIMA 2BXZA 3G5YB 4EE2A 1HE8A 2H6OA 1OOAA 4PLJC 2Z0BA 4WI4A 2Y1VA 1X6LA 2HRPL 5HVHB 2BDNL 5KYXA 1MCWM 1MCBA 4UOZA 3RFRA 1BXUA 3PQYD 3Q2VA 5FYLL 2BVQA 2Z9TA 5C86A 1TMCB 1U2CA 1FNLA 5TTRA 3REWA 1FH2A 1HCZA 3EUUA 1HHIA 1BEYL 4C54A 2PYEE 4G9FA 3R1GL 2UY6B 2VJXA 1T1ZA 3TU6A 1BYPA 1NA8A 4FNUA 4QPEA 2X42A 1FJ1B 1HINL 2BINA 4LARL 3O2VL 3QNXA 5EBMB 2VM9A 3HBPA 1KBBA 4LLVA 4Y19D 2A74A 3TA3C 2CO6B 3BXNB 3I3DA 4LCYB 4UZSA 4BQ8A 1KGCD 4AEIH 4F8PA 1OK0A 2ZONA 4RAUB 4BFIA 5I1GL 1VSCA 3BOVA 4LPTA 2EH8L 1NKGA 3CIAA 1BZEA 2AQPA 2DLGA 4Q56A 2VOTA 3R06A 4JO8A 5KVDE 3OV6A 3C08H 1B88A 3N0PB 3EKCA 3HN8A 1J1XH 3FTGB 3G5VB 4L3FA 1P5UB 4U6VH 2HTKC 3EYOB 1BVOA 4UDTA 5M94B 4R97B 4AGPA 3RWGB 4HAKA 1MLBB 4O9HH 4FJ6A 1VIWA 4P07A 3FT2B 3PGDA 5EO0B 3R4DA 5C0CE 2C3GA 1AZBA 1F6LL 2JF1A 4LOFA 3ZHNA 4XXDB 1BBDH 4MJIA 4MDIA 4FNSA 4Z7NF 5HVWA 2YMOA 3L81A 5LQBH 3JVGC 4I9WD 3B4NA 3KM2A 2YD1A 3S3SA 3EH2A 3MUZ1 3TBWA 3BN9C 2FEDC 1JPGB 4TTGA 3V0EA 1ZA6A 1G0DA 3LRLA 2GSIB 5KYWA 1CTOA 1J48A 3ELQA 4Q9CA 1YQ2A 1BJ1H 1XIWC 3SKOA 4CRPA 1MELA 2BP0B 4XOCA 5EO9A 1MZYA 2R1WB 3QE5A 4JPIB 4YHKL 2OMVB 5LNEA 3MNWB 2D3NA 1QSFB 4WW2F 3A4DA 4QRBA 1NFDB 5MI0C 1UEYA 4QEGA 5IHHA 3WY1A 4BINA 1KJ2B 3PAYA 4XVJH 3TZVB 3NJHA 4EI5B