4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
1OANA 4AM0Q 1RERA 5B1CA 3UC0A 4FFYA 3UZVA 3N40F 3UYPB 3J2PA 2HG0A 3UZQB 5IZ7A 5LBVA 1Z3RA 4AL8C 5JHLA 3WE1A 5JHMA 1PJWA 1UZGA 4ALAC 4UTCA 1TG8A 3N43F 2JQMA 3C5XA 2V33A 1URZA 4FG0A 4X42A 4UT6A 1SVBA 4BZ1A 5AAWC 2JV6A 4UTAA 2JSFA 2R29A 3G7TA 3N44F 4GSXA 5KVFE 2R69A 4BZ2A 3VTTA 5AAMC 1Z66A 5H37A 5LBSA 1OKEA 3P54A 3N42F 3IRCA 4UTBA 5IREA 1ZTXE 2ALAA 3C6EA 5KVGE 4L5FE 2I69A 2P5PA 3I50E 2H0PA 3N41F 4GT0A 3MUUA 5LCVA 2GG1A 5GZNA 1OK8A 5GZOA 3UZEC 1S6NA 3UAJA 4FFZA 4UT9A 3J27A 5KVDE 5KVEE
chains in the Genus database with same CATH superfamily
2YPVA 3FO2A 5E8OB 5TDNA 4CC4C 3L95B 5AOIA 2AJXL 2BHZA 3EH4B 1FYTD 3GTVA 1RVFH 5F1OB 1KLGB 4QRRE 5EA0H 1IVTA 3UZVA 2AMUA 3DJ9A 5D4HA 4KOCA 3ULVE 2HFGH 3AQYA 2F58L 2NDFA 3FL7A 3KPRD 1N19A 2NY3D 1QRNE 3MODH 3MRDB 3LZRA 3NSFA 1OGAA 3S34L 3WXWH 4PJAB 5SWQA 4F8TA 2K6WA 4LSSL 1OAXL 1UM5L 3QORB 3AZUA 2VTFA 2PPCA 1FNFA 1AQHA 1EGJH 2VC2H 3TEUA 4D8PB 3ATBA 3WEMA 5CFAA 4H8VA 1IC5L 3R1GL 1CBVL 2DH3A 3A3YB 1EZVY 3ISWA 5L88H 3V9EA 2A6JB 4ZXBA 4Y4KB 4RFEA 1JK9A 3N43F 1KJ2L 1JSYA 1P69B 2QPUA 3FRPA 5KYYA 3ULSB 3BUYA 3QRGH 4CSTA 4G6AD 4F3FA 5KOVC 3VXTA 4XBPA 5ALCL 3MRMB 3DC0A 3QR0A 3RPBA 2RTTA 5T1DL 3APCA 2PCXA 3MRLA 1BGXH 2DQGH 3LJ3A 2H8PB 5F7AA 3VSTA 5DCCA 3QXAA 4EQ3A 1I3RB 5L0QC 1S9KC 4MCZB 4O51A 1AY1H 2DPKA 3RWIB 3T1WA 1LWRA 2OMVA 1EFQA 1IM9D 4JAMB 3U46B 1Q9OB 4UAHA 3UDWC 5K9QG 5C08E 1XGPA 3DPDA 1KPVB 1GC1H 2Z7WA 3NFSL 1MWOA 3P9MA 4CNIA 3JUYA 4XNZB 4XZUB 3WLBB 3COOA 2ERJB 5IOKA 1CICD 4L1LA 3QNXB 4MNHA 3DX9B 3DV4A 3CPUA 4JO8A 1DVQA 4I3SL 4N8CH 3SBWC 3S9DB 1BBDH 1WLHA 1YUHA 2EDFA 4WFHE 1E4XH 2Y4SA 4N8VG 1BQUA 4M7KH 4B97A 3BLPX 2F8VA 1R46A 3JWNE 1BZ9A 4JRXA 3OKEA 3RBGA 4CVWA 5FW7A 3L3DA 5DZPA 2VLLA 4MMZA 1T0NB 3K5SA 1AYRA 1I3VA 3KS0J 1UWYA 3AY4C 4BFGA 4NP9A 2UXVA 2VH5H 2WPGA 3NDZE 4NBYB 4PRPD 3V0IA 4XX5A 1G9EA 1RULH 1WRFA 5BO1L 3D33A 1FJ1A 2BFGA 2KKQA 2DKMA 5TE6L 3D2UB 1HKFA 1BZ7B 4Y5VA 5AVXB 3OHXC 4XAWH 5JIMA 4GMTL 3BZ4A 3BH9B 2W0LA 3BQVA 3L9EA 3RB7A 3QUZD 1TJMA 3H56A 3FUEA 3P2DA 3DX8A 4R8WL 2C1PA 5JOPD 1JZ2A 5CUSL 1E5AA 3D07A 1EGJA 4KKQA 3GIZL 5EOQH 4E5XA 3FFCE 3FAXA 4A6YB 1ML0A 5BXFB 4M9PA 3EFOB 4HH9A 4KZEH 3QO1A 1MCOL 3B1UA 4PD4K 1IBYA 3S5LA 2XN9D 3FU9A 2HTKD 3F12B 3ROOB 2F74A 3GO1H 1A22B 4PJ5D 4F2FA 2AFNA 2CAKA 4H8HA 1XCQA 4JPSA 2ZD0A 3MRGB 1BA9A 1PY9A 4Z3TA 4JFVA 1QABA 1DEEB 3JT0A 4FI8A 1DQTA 3ZVVA 1KMGA 5MENE 1GSMA 3OR7A 3BUTA 3QARA 2PO6B 4B9YA 2Z7ZA 5I5MA 1QFPA 3QIUD 4YHNB 1AFVH 2YKKA 1MKFA 3U2HA 1U58B 1F42A 3TVMA 4XO5A 4R0LC 5DFAA 2DEWX 1KN2H 3JBG7 3MXWL 35C8L 4ZNEE 1M7DB 1YYCA 1IIKA 2I60H 1BWWA 1KXVC 5FM4A 4BH7B 4TULL 4JANB 5BZDA 2QV4A 2SEBB 3D4ZA 3MNVA 5D1ZD 2F7OA 5ILTH 5E6YA 3KYOA 1IBZA 4NJAL 4PJAE 2JH2A 4FOMA 4XXWC 4LU5H 3L4TA 2B2XH 3ZY7A 5FYJD 4KKLD 2V9UA 1E5CA 5IVOA 3AQDA 3NZHL 3OJMB 4OT1H 3KPSB 3AJ7A 3FU0A 1IGML 1QBLL 4NXSA 1JL8A 3S3DB 3MUGB 3NIGB 3B3BA 4F9PA 4TUOB 3PF2A 4ACPA 1WFIA 4XN9A 2BNRA 2OYLA 4LHUA 4OI8A 1M6OA 3IJSB 1A1MB 1Z9LA 5FA4A 1JUFA 1RJCA 2YUXA 3EFDL 3FT4A 3I02A 3HG1A 3N1QC 4QHNA 5LAPA 1DVZA 1Z9SA 2GC4C 2VJ8A 4MZRA 3WFEL 3RZWA 4IJ3B 3E80A 5E5RB 3C6EA 5FO9B 2J4WH 3IMTA 5J89A 2CBQA 4PRIA 4XXDB 5CBEB 2KI6A 5AW9B 5T3XD 3X1FA 5IHWA 3O9WD 1U2HA 2JKTM 5I15L 5FGCE 2DQJL 4JFZL 2FX9L 1CIUA 2COVD 5I1KL 1HHHA 2FHCA 3MV8B 2DYPA 4NSKB 2NTSP 1KTBA 3KWXA 2VZUA 1X9RA 3ECQA 1A7OL 1RZJC 2ADFL 2AJUL 3H9YA 1G9MH 4N2LA 4P9HC 4AMWA 4X6CB 4YS4A 1NUNB 4Z8FH 4X80L 1XGUA 2VKXA 3SKNB 5K39B 2V7HA 4GKLA 3MYJA 3V0DA 3GS0A 2J20A 4Z7UE 1H6EA 5I16A 4IOSD 1I1FB 1WBZA 1HIMH 1UM6L 3IWUA 1WS8A 4HKJB 5C9JB 3QR2A 4HXBH 3DBXB 2XFGB 2VXUH 3EUDA 1XTLA 4JREB 4J7RA 4N2GA 2Q86B 3MFGB 4CDGC 4TTDC 4PGEA 1QBAA 1TOXA 5HHOD 3TP4A 3L4VA 1CLOH 2VLKA 2XWTA 3RHWK 3F05A 4HCIA 5KSVB 1ORSA 4G43A 3O4LD 1Q8MA 3LIZL 2H2PD 3IDMA 2ADGB 5EWIL 2DM7A 3DPBA 3HZKB 4LCYB 5LBGA 3QUYB 4FRWA 5JDSB 1JN6A 3BN3B 4NQSA 5LVEA 3TIEA 4WCYH 4U6XA 1FZJB 1AZUA 4XVTL 1ZPLA 3KLDA 3VXPA 2APXA 5C0AD 4PJCF 4EDXB 5M94B 2PW1A 1E67A 4GS7C 3GI9H 1KBPA 5IJKA 5C0CB 3QUZC 3UBXB 3FH7A 1J0KA 5FDWB 4NZ8A 5IMKB 5ISZE 1YO4A 1TKWA 4OQ1A 5K9JL 1MWAL 3OPZL 3VXMB 3W0WA 4G82A 4JO4L 5D2NC 4NZRH 4LASH 2A0LC 1UWEH 2WVSA 4ZZKA 3L7FB 3US1A 4XZ4A 2PCFA 1JHKH 2BSRA 2WCPA 3FH5A 3RVVD 5KZCD 3HI1B 1OIOA 2HTKC 3AM8C 4MAYC 5CZRA 5CHNA 2A5UA 4KVCH 3B3IB 1QI4A 4HIJB 4LIQE 1F11B 1IKNC 4QJ3B 4XHJC 4BKLB 1NGZB 1OAKL 2OXHA 4QHMA 4TSAH 3TEXA 4CBZA 2UZYA 1RAMA 4JLRA 1Q1PA 4OFYA 2LU5A 5BUGA 3B9EA 2D4FA 5DI8A 2EIJB 2Y07H 5TE4H 2Z3FA 4I7ZC 2Z92B 1MCSA 4K2UH 3MMEB 2FZ3A 5DJCA 3O45A 4ALAH 3CFKA 5LNDA 3FU7B 3RGVB 2F7QA 4ABUA 1FVEB 2L04A 1BMWA 2XN2A 2JKSA 4S1SH 4Y19E 5FHAL 3WS3A 3F7KA 1O6VA 4BGDA 3LRSB 1DJHA 1YNKL 2OTUA 3FFDA 4NC1E 3WIIL 4F33A 3EJPA 2QDWA 4XN1A 3BP7B 4HD9A 3B9DA 4U6VL 1JYVA 5C8JB 1GVIA 4YZFF 1NFDF 4XMPL 5B38G 3NPSB 3GMOA 4IBTA 3ULVD 3T0DA 4LVOC 3ZL4L 4HC1H 2MRYA 3VI4E 1HYSC 3QXVA 5ICYA 5JPNA 1I7TB 5ANMB 5J11B 1ZT7A 1DFBH 1N0XH 4JO3L 3VFWA 3JWOH 4D2NA 1T7WA 1JERA 4PVMA 2PCPB 1J9QA 3H0TA 3DK2A 4BM7A 2WAQA 4BJLA 3OAZH 4KK5C 4X5XB 4DKFL 5GJSH 3FCTB 1MCEA 3VXRB 4OGXL 4ZTPL 3DDGA 4ORZC 4AITA 3VG9C 1DJIA 2UWEA 4K15A 4L18A 1MLCA 3AACA 3L3OC 2XDHA 3HS0C 2UYLA 4Z7QB 1HT6A 4Y4FD 5ESQB 4YHYB 4YBLC 1H3TA 3OD3A 2ICWA 3MRJB 4PREA 1N5AB 4MMXB 3A0OA 3MBXH 3L9RA 2NY5L 4QXGH 1NGWA 3B9KA 2H1PL 4HSAC 4YDLC 1IKOP 3JVGC 1YG9A 3KH4A 4BE5A 1UCTA 2B1OA 1Z32X 2FGWH 5C08D 4EDWL 4KH9A 1R0AL 1WAAA 1PZDA 1FC1A 1ND0A 4NO0D 3IK2A 5AKTA 4UM9D 5GGTH 4JFSA 2WB1A 3GRWL 2Y6SD 3MLSH 4RRPA 4WW2B 6PCYA 2XI9A 3ROLA 2YSSB 4ELKB 2QLYA 3WAKA 3GBNL 4FXKB 3VRJA 4WFHD 4KKCC 5ETUB 1U8KB 3HS9A 1B3JA 4Q58C 4MXQD 1JGLH 1J10A 2KDYA 5HYSA 3IVKA 3LVEA 2VJXA 1D7DA 5C07E 3K72A 1AXTL 4AL8H 2DIEA 1FWXA 3AREB 3RWJA 3G5YA 5IK3B 4NX0A 1CFNB 3MI6A 3O11B 3H4HA 3ELAT 4OZIE 1NFDA 3P2BA 2H32B 4A1RA 4BWWA 4R9HA 4TXVB 4ZFOB 3VGBA 1NKOA 3WNNA 4AW7A 3QDGE 2NCEA 4OIAA 1L6ZA 5DMKA 5IJVA 4JKLA 1ZLSH 3RUGF 3SGJC 4P4KC 1TVDA 5DJDA 2MTAA 2FWSA 4LPVA 1SDDB 4HC1A 1TJIH 3Q5YA 3WJLC 3H7LA 3QUXB 1MCLA 1NGQL 2CUMA 4WRLA 2VL5A 3K2UH 2HRLA 2H7WA 1DSFL 1T66D 4KY2A 4IU3B 3SOBH 3G6DL 4NRXA 2JNZA 1MCQA 3FFCD 3FO2B 4XXCC 5TDNB 4PJDB 3E1ZA 5F9WB 3SE6A 4J3OC 4PJGF 3VGAC 4W6YB 3RVWC 3NCEB 1Z6JT 4Q6KA 3T6WA 3SE9H 4GW1A 3UG5A 1HC1A 4YHIA 1QPKA 2E7LC 2M26A 3B7YA 2HFTA 3MTXA 4RISL 4AEEA 1THAA 5SWQB 5MEND 5E0FA 1URLA 2V9TA 4GSQA 2F5AL 1JTTA 1U93A 2CXKA 3RTLA 2BIQA 1MCJA 2ZUWA 2ADIA 3SBRA 3RIFK 2OYPA 2XKUA 1NOFA 3AS0A 3M88A 4OLZL 5AENA 1U30A 2EE6A 5E8DH 1N18A 2E7MA 4NO2A 4PUBL 2EH7L 1JK9B 4FLRA 3KGTA 4XWOC 1AQKH 3KLKA 1LDPL 2B7DT 3BYTA 2H0FA 4O4YL 3GS7A 4XBPB 1PYWA 2IXQB 3POHA 4HCGA 5GGTA 1E27A 1V27A 5H2BB 1IGJB 3OMAB 3BJ91 3DJTA 3VXNA 5I1GH 3MRLB 2WYTA 3QPXH 2VDOH 4R4BA 5GISL 5TK4A 4QR7A 1XQ4A 2B59B 2O30A 3C5ZC 3QXAB 1JF1A 3TC9A 5BRZA 4KJWC 3MZGB 4LCVA 1D5IL 1ZSHA 1K72A 2GFBA 4MJ6A 4PW4A 4XC3L 2X2HA 5CNHA 3X13A 1BXUA 1NOAA 4NPYA 1ZLEA 4Y4KD 4NNYA 5EZOL 1LEIA 4UV7L 4HV8B 1XGPB 3ZT5A 4PJ8B 2CR3A 2DJUA 3AMKA 3P9MB 4CNIB 1HE7A 1TQBC 5I9QB 1M1SA 3SY0B 3ZMRA 5D7LE 4P46C 3CFEA 2C4FU 4NAMA 5L4FA 3PL6B 3K6IA 1DTUA 1RLWA 3R7QA 1I85C 4X7SH 1GGCL 4NQEA 4ODVL 5D1ZI 4TOYH 1DZBA 4OBSA 3GKWL 2X6AA 1M9SA 2OSLA 4ACTA 4JRXB 1KFAH 25C8H 4R4ND 1E40A 1U3HB 2FJHA 5GSVA 3U1SL 3SGKA 3CFQA 4O58H 2VLLB 1WIPA 2EIBA 4HKZB 1U91A 1ZCRA 1PSKL 1ZVYA 3MOBL 4PJGA 1OTSD 3BWUC 4R83A 5AAWA 2ICES 1NMAH 1JZHA 3DSFL 3ZE2E 4P5TD 2ICEA 3IU4L 5CGBA 4AE0A 2BOBA 2EYRB 2J8OA 4N86A 1FJ1B 1MFVA 2AJZA 1KEML 4JY6A 2ATPB 3QJHA 2DWDA 4Y5VB 2Q9OA 3IETB 4LP8A 3T3MF 1COBA 1WCQA 3K1KC 3BZ4B 5KN5A 2QADC 3EYSL 4X9BA 1HINH 3TFKC 3D0LB 1OXYA 2ZUTA 1UB5A 5KYUB 3DX8B 3RKPA 2C1PB 3NCBB 5TQ0L 2XPZA 2X7LA 2ESVE 4KRMB 2J56A 1BMGA 1TCMA 3GIVA 4CUCA 2VC2B 3IFLL 4HWUA 4E5XB 4NM4L 1NAML 1ZE3H 4HH9B 3SDCB 4Y1AA 3WUZA 2VAAA 3FSOA 3LCYA 1SOKA 1JE6A 4JFDB 1L3NA 3FF7A 4U1NB 3NOIA 1PD6A 5F3HA 2GUYA 5IESL 2F74B 5CR8A 5SV4A 4A2HA 5I23A 1B4LA 2JIXA 1XCQB 2XT1B 1QUNB 2VT0A 3Q2CA 3GS4A 3IGAA 1LXMA 3UCRA 3BEWA 4Y2LA 3WJJC 5J13C 2B20A 1JNLH 3Q8FA 2GSGB 2J8UA 4G9DA 1YC8A 3P30H 4P06A 3TBYA 3TVMB 2HXAA 5HDBB 5DGQA 3ZIMA 1W8EA 4OJFH 3K5RA 1Q1JH 1LWJA 5F1SA 3VB9A 4AGOA 3TYFA 3DRQB 1NGXB 1RU9H 3WGUB 5DRXA 3WENA 3M1CA 4PJEA 3MNVB 5JORB 4ZMQA 2P5WA 3KYOB 1OGAE 3RWFB 3WFHA 4QHLA 5HVGB 4WK0B 5LN4A 1AD0A 5CSGA 2WLJA 1KIQA 4IEFA 3SDYH 2JB5L 5G5DA 3TJHD 1YDPA 3HC2A 3VRIA 5DF0A 4LT7A 3FK3A 4BZ1H 2A9MH 4G6FD 5D1XE 3TWCH 2BNRB 3G6JF 1LHZA 5EC1B 1M6OB 2R0LH 4IM8A 4UTBL 2W9EL 5JHLH 3I02B 3FT4B 4QHNB 1UYWH 3HG1B 4BCZA 4YSEA 4N6QA 4BELD 4K7PL 2BLFA 4UQ9A 1J0JA 5L8KB 3ECVA 5A2AA 2EINB 1REIA 2BY3A 5C2BL 3QORC 4ZBJA 2ZWNA 2Z0BA 4PRIB 2LFGA 4KI1A 1PZ5A 1KNOA 4LGPB 2BW4A 3D05A 5KJ4A 2DL9A 2C3XA 5I6OA 1BYPA 4H40A 4HF5L 1R3KA 1JDAA 1R33A 2DYPB 4JG9A 3T9WA 1DVFA 1UASA 5FHBL 3KBEA 1IL1B 5GRUL 4LXFA 4FQCL 3KPOA 2JLPA 4RMVA 2OR7A 5HYQB 3N41F 5DJ8A 1XGUB 3UTSA 2D7NA 2V7HB 3MYJB 4OVUA 5JO5A 4OD3H 3QIBA 4L1SA 5KEZA 1T2QL 1X4YA 1WBZB 3CDFA 3VFGL 2Y72A 4G6KL 1HH6A 2YUVA 1TYRA 2XVGA 4MA8H 3TJPA 2WQAA 1IGIH 2V2XA 5KSBF 3UC0L 2EDRA 4NWUH 5H94B 3MV8D 4JGNA 2YGPA 4NCC2 4NNXB 4JRXE 1QPPA 5LCVL 1N26A 3ULVL 4Z3HA 3GYRA 1T0PB 1MI5A 3MGOB 4BCXA 4RDQF 2FEDC 3O6FC 2XPYA 4FYSA 3W39A 2ZG2A 2WAHA 2XWTB 4IRJD 2WBJD 4ONHA 1JFQH 4XNZC 1P5UA 5IJBC 2ERJC 4KVPA 4FFZL 5E2WL 3U1PA 3S35X 1A4KA 1CGSH 2YAFA 3IJEA 1QATA 1UXMA 3RFZA 1JN6B 1W91A 1XF4A 5FKAA 2OM5A 4NQSB 4Q14A 2ZOLA 4M5YL 4P9ML 1FNGA 4U6XB 5HD8C 3L4YA 4QXVA 4WEEA 2V5SA 3U4KA 4WHTA 3PREA 2K6YA 2NW3A 2G3MA 4NLAA 1MFDL 3EHBD 4I85A 4FZEL 2HLAA 4TNWF 2SODB 2F54B 3BWZA 3ZKQD 2AK4B 4PAZA 3ZK0A 4EI5C 1A6AA 2ITFA 2E27H 3W0WB 4NRZA 4G6ML 1OLZA 3O2WL 3M6DA 4AYDC 4HU2A 2R4RL 1PW3A 2VGLM 1T6VN 2PCFB 3B2UD 4BZ1A 2BSRB 1BVOA 1QMUA 4KV5E 1MHHB 1KGIA 4E2OA 4JFEB 2Y3AA 4GI6A 5FLUA 5C07D 2Z31B 4D0CB 1PX4A 2A7BA 5IW3A 3B2XA 2F7PA 5DQDH 3S8WA 2WMPB 4P2QA 1JCKA 4OLYL 4QHMB 2UZYB 1WEJH 3QDGD 3NJMA 4MD5B 3VXSA 4MBOA 2ZXDA 3BKYH 2QFRA 4WTZG 3VXMD 3FT3B 3ECUA 5IUCA 3P3YA 2VQ1A 4FNLL 1K5WA 1BAGA 5DJCB 3LNDA 3H42H 5F7HA 3O45B 4L29B 3CFKB 1RZQA 1OO2A 4M7LT 5DT1L 3GSWB 4PGCA 5EBLA 1FZKA 4M1DH 4OJEH 1KY7A 2PWDA 1JS4A 2DQUL 5A16A 5BJTA 5G4NA 4NT6A 4FHJA 1NLDH 5DEJA 2VNCA 3DARA 1PEWA 2ZWYA 1VFAA 2A74A 3NDYE 2J5LB 4F33B 4BFFA 3NTCL 5TE7H 2FLRT 5SWSB 2PO6C 1I9RL 1M56B 5GGQH 4AYFA 1G4RA 1NCGA 2APFA 1OE2A 1GA2A 2GIMA 1ASOA 3GJFH 4L23A 3QQ9D 1Z9MA 4JZNA 3TV3L 1N4XH 5I73C 3RGVD 5KAQG 1LP9F 1XSOA 5F3BA 3FOLA 3CHRA 4ZFGL 5JPNB 1QFWL 2WIIA 2Y06H 3JWDH 2EDEA 3AXLA 1ZT7B 3DUUA 4MX7B 3KDPB 1FVCA 3X1EA 5F2FA 3VD5A 1GKEA 2OJEA 1BFVH 1LK3L 2ATKA 3H0TB 4YHKH 1YNLL 2DH2A 1ODUA 4PRIE 3M8OH 4U7SA 5I1HL 4JPKH 3TZVA 4FLHA 2H45A 3RZCD 4UV4H 1LQBC 3D39A 2UWEB 3RL2A 1MLCB 5LGKA 3MAWA 1BOGA 4GUPA 1AGEB 3IJ8A 5AZEH 1XL4A 2HG5B 2UYLB 4FP8L 2E8ZA 4D9RE 4F7EB 4FCHA 2WO3B 3UO1L 1KZYA 4PRAA 1XGRA 1VEOA 2ICWB 4PREB 4HS3A 1RJZA 1IM3A 2V37A 3BKJL 5LGHH 1GZHA 1NGWB 3RPIA 2HMIC 3HMXH 3OV6A 4Z0BL 1QZNA 4GKZA 2BSCA 5CEYA 1IC7H 1FNHA 3DMMA 3ZTCC 5J06A 1TSRA 4RBPK 4GW5B 1OHZA 3MR9A 2APWA 5BZZA 1I1YA 5TFSH 2G9HA 4DN4L 1XAKA 1ND0B 1RPKA 4PBDA 2C3GA 3ABZA 3MUHL 2G3XA 3V4UH 1E8XA 3IDYB 2HT4C 2PP7A 3OXSA 4X0NA 1MH5A 3GZQA 1WD9A 4WHYH 5D7LD 4M6NH 3EGSB 2VLKE 3ROLB 3ARFA 4H1LG 5AZUA 5IVXA 3T77A 3VRJB 4FFWC 5A6MA 4XN2A 5JQHC 1SLXA 4KO7A 1FFOA 4DP2X 4JB9L 3EYUH 3IVKB 1YRKA 1A9EB 4QTHB 1NANH 3NZUA 3BGMA 2X4NA 4JREC 1FYHB 3RWGA 4DP0X 3BKMH 3K72B 4WV1B 3OZLA 4JY4A 3SBQA 1E65A 3RWJB 1YEIH 2YGVA 1ZDSA 4ODTL 3ZDXB 5DWUL 1RZFL 1QP1A 4FNSA 3L1OH 1IV8A 3H9HB 4UINL 2QTVA 5EIIB 4YPJA 1CFTA 2DQDH 1W8OA 1L0PA 4FFTA 1JGDB 5DO8A 5F7DA 5FYKE 2FQEA 1LP9A 2ZKHL 4GRLC 4DIXA 5IJVB 7TAAA 4JW3A 3FTVA 3QUYC 5IREA 3W57A 3GJFA 1AG0A 1B2WL 4AJWA 1WHOA 2E0PA 2OK0H 3MGTA 2VXQL 5IF0B 4HEPA 4BFBD 5B1JA 4UQ3A 2DQ6A 3ARED 1YEDB 4NAJA 4ONGL 2ESVD 5DMJB 3VD4A 3FUFA 3L1FA 4W9EC 4KNUA 4XCCL 3ESUF 3X3FH 4LCWA 4PW3A 1BQHA 1FSKB 1IAMA 2FSEB 4GYBA 5I8KL 4I13B 4LLQA 3TEWA 1CDUA 3U7YH 4W6XB 3FO1A 1UOKA 1R9FA 3BISA 4L4JA 3ESNA 5I0VA 1LO4L 1I8IA 3KYNA 4QTFA 5FUOH 3QI9B 4CSPA 3QUXD 2X4RA 1JYXA 3QIWD 2NY1D 2BP5M 1KIUA 1QFOA 2WKOF 4C83A 2NNXA 1BXXA 4HDIA 4YLCA 2A4CA 1U93B 4KTDL 3UIYA 4EBQL 4RVBA 1YN7A 1Q90A 1T4WA 3CSYA 3F04A 3FULA 3QWRA 2IQAA 1C1EH 3CFCH 3L13A 1T5KA 3HMXA 3VH8A 5F6IB 3QXUA 5INDA 3GPEA 1LYQA 4JEGB 2GSIB 1BEXA 5ESVB 2JCWA 4U1JB 2CRYA 2VXTH 1E5BA 1KYAA 1KCBA 1NUGA 2D8KA 1OGAD 4HCRL 3RGVC 1JHTA 5PCYA 3T2OA 2X0UA 3V6BR 5GRVK 4Z5RB 3VXNB 2JK5A 1S7TA 4PTUA 4MJIB 4I1PA 2HYMA 3EYVA 1L9TA 1V7ML 4DGIH 5BRZB 2A6KB 3KVQA 3QJXA 3NSJA 3Q7JA 4KC3B 2GFBB 3IKCA 1S9WB 1UXSA 2D3LA 4KAQH 4PJCE 5BOPA 5I0XA 4ZXBD 1C5DA 3X13B 1JNJA 1KYOJ 2HH0H 4GKNA 4Q8BA 4NNYB 1JZ6A 3Q48A 1AANA 1P6FA 1JWSA 3HBPA 2AJVL 3EJSA 4LSVL 3NPSC 3RAJH 4NYLB 4ANVA 4IBQA 5C0RL 1QTSA 5KAQF 3GSNA 1TNNA 4TL5A 3TN0C 3U2IA 5PAZA 1EA9C 1OAQH 3EGXB 5CEZE 3C08L 3B9VA 3CFEB 1VGKB 2X70A 5HGBA 1S78D 1MFBL 1A64A 4XHQA 3V9FA 5AAMC 1ZGLA 5GRYA 2A6IA 2WNWA 4N90E 3HAEH 2OSLB 5GSVB 1EH9A 2FJHB 3SIKA 1YHPA 2BNUA 4QNPE 5L6YL 8CGTA 2YAQA 4OGAD 4W9FC 4UYPA 1ZXQA 2IWEA 4YVUA 2ZCZA 1GGUA 4KGLA 3A6CL 4YHYC 1ZT1A 4M93B 4MMXC 1OSYA 2BOBB 2P5EE 1F4WL 4LSUL 4X7DC 3V4VL 2EO9A 3WKYA 1JRHI 3U0WL 4JY6B 4F1SA 4F7PB 1E0OB 1CK0H 1MOEA 2O5ZH 4FNTA 4XMLH 4N2DA 1QNZH 2NY0C 4JRXD 3S6CA 1TENA 4WI0A 4HISA 4U05A 5KN5B 1MDTA 4PP1D 4YL4A 1JVKA 1UB5B 2BM3A 4PQXA 1CLZH 4GJTB 4A66A 1UFUA 5IHBA 5IFAL 3HC4H 1NFDE 4P2RA 5EF0A 4WW2C 3QCVH 1FDLL 3FC8A 2A73A 3MKGA 3SGEH 5E51A 2MIZA 4FXKC 3ATEA 4Y1AB 2VAAB 4MRBA 4W9JC 4X8GA 4NUJA 1DVTA 5CM1A 1JNHA 1QFHA 4ZUTB 2C9SA 1OL0A 1AHMA 2VJ0A 2GUOA 4LSRH 2ED7A 2JIXB 3BAXA 3AG1B 2ADYA 5INCA 1T03L 3VFTB 1U42A 2Z1KA 2UY6B 1FIGH 2BX5A 2J43A 1G7QA 1BYOA 2YAPA 2QPEB 2VDOB 2X12A 2IWGA 1S9YA 2J8UB 4G9DB 2DQIH 4EIUA 1AGFA 1WIOA 3EJYD 1JD9A 3ARDA 3GBML 1KJ3L 3S0PA 1KGYE 2VDNH 5DYOA 3QBTB 5JOFB 3MLYL 2ITDA 3QUML 4MJ5A 3QNFA 1INDH 3N06B 3T5WA 1UUSA 4NCDA 2IDFA 5DRXB 3S37H 1VA9A 2NNAB 4PJEB 4PH8A 4RFOL 2UVEA 3T4AA 1TVHA 1W6WA 2N01B 5IOPA 1I8LA 3PP4H 1X5GA 3QUXC 4ONOA 1PG7X 1KTRL 2DBLL 3B4NA 4ODHH 4XRCA 3SPGA 3BCFA 4IEFB 2EO7A 5IMLB 1OZTG 2JJVA 3SD2A 3P9LA 4ZFZA 3T6VA 3ZE0F 1YDPB 4WO4A 1DYZA 3KR3H 4JFFB 3W11C 3TVMD 5F9WC 3MFFA 3TO2A 1K9TA 3R0NA 3TF4A 4AK1A 1IQDA 3HAEA 1FHNA 2MEJB 3HBQA 4B9JA 4UDUA 4HUVA 2FJFA 4HJJH 4G5AA 4LAQH 4TVPH 4X5QA 2QKSA 5ABDE 1RFDL 2XZAL 2ICWJ 4KVNL 3VQ1C 2WVVA 1OAYH 1HCYA 4ZMWA 4PY7A 1MJ7H 4YUEL 1ZHBA 3EFFA 1GJWA 1UD6A 3C6LA 1KNOB 2F53B 4Z7VF 3HKZA 4DFHA 4G6JL 3DJSA 2BERA 1PZSA 1R3KB 2XTSA 4F58L 1OB0A 2FO4A 3VGDA 5CU9A 3UBXI 4DVRL 2BNRD 4LHUD 1DVFB 1TTCA 1VGEL 3FQ2A 3LVTA 3EF7A 2R59A 3KPOB 2VSMB 3KVPA 4RGNE 3HG1D 5D6DC 2XWBA 4GO6B 2FT6A 2RQ8A 4KZCA 2VN4A 3UTSB 3GSVA 4DP7X 5CGYD 2NY2B 3BW9B 3QIBB 4XNUL 3NJVA 1IIIA 3LHPH 4PRID 4GT0A 4I0KA 3GGWA 4KHXL 3RUGE 4JQXC 1HH6B 1L7TL 4L4TA 3T0EB 1CL7L 1NCWH 2V2XB 4NQEE 3US0A 3D0VA 3X3GL 2DYPD 3QHZH 4JPWL 4X6DA 4TQEH 2ISDA 3L1EA 3OF6A 5GRJL 4P07A 3GK8H 4AQ8A 1OCCB 1MI5B 4PJ8C 2IBZY 3RL1B 4D9RD 1XZWA 2RALA 4LHQB 4YDNA 2OR8A 4PJGE 5CINL 3WBDA 2ZWKA 4YSQA 2H0JA 3NEXA 5EZJA 2NYZA 1OSPL 1A4KB 5H37G 3PL6C 1NCBL 4HIHB 1AE6H 4AH2A 4Q9RL 1VJSA 1XF4B 5FKAB 3DBSA 1I9JH 4K5NA 3PDDA 2ZOLB 4XPHL 2VDRL 5DSCA 5J3HC 1FNGB 3KYKL 4PJXF 2EIKB 1LO2L 2XWEA 4FNPA 3PAUA 1L7IH 3RA7H 4D9LL 1S9XA 3M1BA 4OFKA 3U4EB 3AT9A 4E9RA 1DN2A 1U3HC 2CH8A 4PS3A 2OX5A 4O00A 5LJYH 2VLKD 3WE1A 4DP5X 2DD8L 2HLAB 1G7LA 5EN3A 1KTJA 5DRNA 1MVYA 5F88A 5BS0B 3OLDA 4XNDA 1HNGA 4H88L 4NRZB 5D7JB 4J1UA 4LF3A 2HX9A 3R4DA 4Y1AE 2BIOA 4MD4A 3U6XS 3SDAB 3QPQC 1H9DA 3P4MA 3U6XA 3FB5B 1AXSA 2KQMA 2X1QA 3MX0A 4PGBA 2X9YA 5CMAA 3BKCH 4L3EA 2W65B 2JKIS 2BW5A 4M48L 4KJPC 3WJMA 4BZ2L 5AW3B 3V4PL 5L2KE 3PJSB 2VZ3A 4PLKD 4Q2ZA 4AXWA 4AK2A 3VXSB 1A6WH 1NMBH 2GABA 5FYKD 2J8UE 3W0WD 1KBBA 4BFNA 1WVZA 1KB5B 3D85A 2EE0A 5AW8B 2Q8AH 1XB8A 4N3UA 5GQBA 3VFMB 3WXVH 3B7TA 3SDCC 4CVUA 1ETJA 1DQJB 2AQNA 2VQTA 1RK7A 2FQGA 2CSPA 1WHPA 2Y7LA 5EG6C 3GEFA 3JTTA 1FZKB 5EBLB 5GGSY 3V0HA 3FRUA 4HIXL 2VLJB 1DQKA 4OZGF 4L8SA 4PJEE 5A16B 3R8QA 3VWJA 2P5WE 4NT6B 1KCRL 5EFIA 5T33H 4YHMH 2ORBL 2NT1A 5AQ0A 3O6LL 3IMUA 1VFAB 4CMHB 2NMSA 4OFYD 3A4AA 4DO6A 4FNUA 4LQFH 1C16A 4FQXA 2ZAHA 3TVMC 5FW8A 3S5YA 5BVJA 1L0YA 2DJMA 2N4IA 3UTOA 4ELMA 5F3BB 3FOLB 1K3ZA 2OKMA 1GC1C 2WIIB 4GQRA 4Q6IB 1PD1A 2XRAH 3AXLB 3GI8H 4XN5A 1RUQH 2Y1YA 1FVCB 3RX5A 2G0LA 3HNSL 1NDTA 1T83C 3EH5B 4Y2NA 2BVOA 3TZVB 4TTGA 2P52A 1HZHL 1IARB 4WI7A 4DP8X 3GHPA 4S1DC 2VN3A 3D39B 3QVAA 3VYOA 1KTLA 3NT0A 4HJ1A 4GUPB 1BOGB 2R83A 2MJWA 1B0RB 3WIHH 2WZ6A 2KYIA 4Y9BA 2XG4B 4BKTC 3HI5H 4PRAB 4WUKH 1AKJA 4HS3B 1RJZB 1IM3B 2P28B 1Z9NA 3BH8B 1JZDC 2KS0A 3RPIB 2CUHA 3KLLA 3M7OA 5FEBA 2M2DA 1OPOA 2YPVL 5CEYB 3PIQB 2G60H 1FG9C 2XQYK 3MR9B 2ZPKH 3D4YA 1I31A 5BUPA 4LCCA 5DD1H 4G1EA 4V2CB 4ZMNA 3OXSB 1F3DJ 1MH5B 1SF5A 4IK7A 1J8KA 1XBDA 4ZO9A 3D08A 2Z64C 1QYGL 4FX5A 5IVXB 3WY2A 1RIUL 1TEGA 3AS3A 3GMNA 3T77B 4KJQC 1CMOA 3B9KD 3QCTL 3ZYZA 3MV7A 4APQA 3OKNA 4KXCA 4OZGA 2H6OA 4ZS7H 5I1JL 4N25A 5I1LB 4N90D 1K8IA 4XOAA 4GRWF 2D0HA 2X4NB 3RWGB 3CMOH 1KEGH 4QRSB 4JY4B 1CGXA 2ODIA 3DIDA 2DQTH 2V8MA 4M7JL 2DLFL 4BA0A 3MDJA 2MCAA 4Z1PA 4LZKA 3MOAL 3NESA 3VJ6A 3NQIA 1FL3A 2P5ED 3PXHA 1NIFA 4JHZA 2NYKA 3OMIB 4GAYB 4FHBD 5F7DB 2AQTA 1FNSH 2IALB 2UVFA 4GBXB 4XMZA 1TZGH 3KAAA 4OSUL 3GJFB 5IB5A 5IMMB 3V6OA 2YMTA 2PNDA 2VDLH 2WTOA 1HILB 1QFUH 1DSWA 1UXWA 1YNTF 4OQTL 5FGBC 4XCFH 1J5OH 1CR9H 4P2QE 3KPPA 1GIGH 4Z95H 1BAFL 1DQLL 2FWLB 5IFHL 4LCWB 5L4IA 1BQHB 1CD9B 5AWNH 1JBJA 3HIZA 3DI2B 1ITBB 1N6UA 2BHYA 1NC4B 2WZPA 3ZKXB 3G6AB 2KLTA 3MLWH 3S98A 2VR5A 4F2MB 2AK1H 3FO1B 1CU4H 4BUQA 1ZGLP 3D12B 2WANA 3CD4A 1I8IB 3AAZA 4HUWA 2Z31C 3T2QA 4B9FA 5D2LA 3T65B 1NLBL 1KIUB 2D7QA 1U6AH 4MLIA 5EU6A 3PWNA 4HDIB 4FABH 3FU5A 5KVDE 4QOKA 5AOJA 2BIHA 5HDQL 5JOEA 4YSTA 4BDVA 1J1PH 1YN7B 2OP4L 3PUUA 4OLWH 4IRSB 2IQAB 3PWLA 1E3XA 4JQIH 4GMSH 2EDWA 2JQZA 2NY5C 4ODSL 1T4KA 5HI5C 5DR5H 2YAEA 1UZ6E 4ZX5A 4LCIH 2XKNA 2FX7H 1USQA 3WTWA 5B8CC 1HXYA 5JA9A 2CE6A 2W59A 5JNYA 2BSDA 2OMTB 3BDYL 4PRDA 1K5NA 1S7QA 5KVFL 4YXHH 3IDUA 4PJIB 4PTUB 2A77L 3LRLA 4XPGH 5J9PB 3DHJA 1NBCA 2J5LC 1ZLUH 1R5VA 1OP9A 1C5DB 1KN4L 2WZ0A 9CGTA 5EOTA 3QWOA 1JWSB 2QVTA 3D39E 2MCMA 3ZTJG 4JN2A 5DD0L 3FB8A 2J72A 4NHCH 1RD6A 3CZUB 5ANHA 4KMTL 2N56A 1BPLB 2NQ3A 1Z2KA 3O0LA 4KTYA 4J6RH 2QHRH 2Y24A 3FCBA 4OAWB 2ZUUA 3QDAA 1N7MH 3LRGA 1M6UA 2HKFL 1A4JA 1MQKH 2HJKA 4ZSOA 5FM8A 5KUKA 1YNTA 3DTUB 4JM2F 3DX6B 2EACA 3PFUA 2A6IB 2C9PA 2YBRA 1KCSL 1YEHH 3HE6A 3LH9A 4PP2A 5C86A 4JG5A 1H3VA 2BNUB 4RGND 4N6RB 2ZWSA 4JPIA 4JFWA 1MY7A 2XIIA 3AUWB 1BD2A 5HHXL 5ITFB 1S9VB 5I74B 2EZ0C 4KKRA 2DIAA 5DD5L 1JXGA 4NWTL 3UL4A 3W1ZA 1ZV5A 4Z7OB 1Q38A 4KITB 3BZFA 4YX2H 1IFRA 3ZXAC 3WNIA 4MB4A 1UQSB 4CA4A 1WZAA 4NQED 5D5MA 2YD3A 5F7LB 3UAAA 1S7WA 4NQVB 3B6SA 4X0KA 3WO4B 3OQ3B 1Z0NA 3CFIC 3M17A 4KI5E 5KSAC 3SQOH 3T8MA 4MJ4A 3T2NL 1RZKH 4BK5A 1MFAL 1DANU 1E4XI 1CB4A 4NKMA 4OGYH 1F2XK 4MWFB 1A0QH 2A73B 3GMLA 2XQBL 1PZ3A 5CAYB 5GZNA 2OA9A 3OR6A 1U3ZA 4MFHA 4DZBA 4JQIA 1LP9E 2BCKA 4WJG3 3WMQA 1RULL 3QULA 5EO0A 4QXWA 1A9BB 5D96C 4PS4H 2GUOB 3VX0A 5J6GA 2MNUA 1KBGH 2OR9L 3BVNA 2EXWD 3OX8B 5INCB 4D3CH 4WV1C 4U7KA 3VSVA 2VISB 1DVXA 1G7QB 5D8JL 4HHWA 3SHSA 1KB3A 4S1RL 4M02A 1VFUA 4LCWE 4NPKA 2A3TA 2FRGP 3ARDB 1TJHH 4JGMA 5DYOB 3M45A 2YR3A 4Y1AD 2J1WA 5CEXA 2V5MA 2ITDB 1ZJAA 2P8LB 4FHKA 3UO8B 4MJ5B 3UZQB 4PJFB 5K1VA 3KPTA 1OEZW 3QNZB 3I6GA 1NGYA 3T4AB 1Z5LA 3DRTA 3LPGA 1TVHB 1IX2A 1UWXK 1WZ1L 4MAUL 3EDEA 1AR2A 3NCYS 4HIEA 4JM2A 3GO1L 1GGIH 3SE8H 2EADA 4ZQKA 3BPLB 2XQ0A 3CFTA 1XO8A 4N87A 2XSKA 4ZFZB 3WS6A 1S7XB 3ZTNH 1EO7A 1H6FA 4JNXA 1FSKC 3I3DA 1F41A 4E41A 3TO2B 1B90A 3AU0A 5HTSA 4X5PA 1R3HA 1IQDB 2VDRB 3ECWA 4UDUB 2B15A 4JGUA 4X6BA 4HUVB 2V4LA 2FJFB 2DYSB 3ESPA 3HPJB 3TBWB 2P5WD 3QI9C 2WXFA 3EO1B 3QDHA 2VKWA 5E24E 3E8UL 2V5RA 3P3TA 3ZE1F 5I1DA 4PY7B 1Z9PA 5ILTL 3CCHA 1GAFH 3D51A 3V6ZA 2YS4A 4A7GA 1GW6A 1XF3A 3Q05A 3ZDZF 1HDMA 4PWEA 5FYKL 5CD3A 1II4E 1BJ8A 1URIA 2C7FA 4V1DA 1TTGA 1ZK9A 4WGKA 4NQDA 2XWBB 4W93A 4K3DH 4M3JA 2AITA 3GSVB 1AHWA 5I8CA 4GRMA 1TTFA 4TPRH 4MS6A 1YYMH 5GGRA 1F4YH 3P1VA 4HJTA 3GGWB 2DI7A 3APMA 3STLA 3CQQA 3ILDA 3NIFF 1G6RB 4M1GL 5DHMC 3IDGB 1Q9LA 1IZKA 2H6PA 4X6DB 2Q6WA 5J8OA 5MERA 1DVFD 1F3JA 2R0WH 5H4YA 3TCXA 5EEZA 4IU2A 4OJAA 2G3ZA 4HSQA 1V3LA 3F6JA 3HG2A 3IBEA 4PFEA 4HVBA 2L3BA 2O61A 3VGGA 1QA9A 5EUKB 3UTSD 1UUNA 2NXYB 3QIBD 5A3ID 2LW3A 5F96L 3MRRB 5EZJB 1A6ZB 3AG2B 4QUOA 2CBOA 1HL4A 3NZSA 1RZIA 2AV7A 3V7AG 1YYLH 4M3KB 1J9CT 4Q56A 2VDNB 2B0SL 3EYOB 4YLBA 5DSCB 3GZKA 1ETZA 2XVBA 5L9DL 3DV6A 3QRLA 1NZRA 2IGLA 1MI5D 3SGKC 2OX5B 3NSXA 4N1HB 2JLLA 3Q8CA 3LKOA 3MACL 1D6VL 1OGPA 2AQ3A 3BPNB 2YD9A 3NUKA 1G7LB 5DRNB 5F88B 4TUKL 3EOTH 3U1QA 1MUJA 4P2RE 5D9SA 3CXDL 1N59A 1D5BA 1UOLA 2JWYA 3G5VA 3IDIB 4GQZA 4NQCA 5D7IB 4M93C 4J1UB 4PIRF 5JHMA 1XIWD 2LU7A 4MD4B 3WFBL 2F8XC 1MRDH 4UIMA 2VW6A 1Z3GL 1TG8A 2JMRA 3AW5A 1PQZB 3MX0B 4PGBB 3WJMB 4HPHA 3ZKMD 1WGVA 4R2GB 4Q2ZB 1MAMH 5CEZL 3B83A 1YEEL 3IAPA 1U3NA 4LDLB 1NPNA 4MXVF 2VZSA 1SXZA 4XCEA 4Z78B 3DO3A 1BP3B 2IEPA 1EXGA 1NEPA 4K8RH 1A4BA 4YZWA 15C8L 2ICWI 1UWEL 2BPBA 3K2KA 1QLRA 3FRUB 1J5CA 2E6JA 3VWJB 3RIFF 1EAPB 4P2QD 5DEGB 5FFGA 4WWKA 2J1ZA 1FAIL 4FYQA 4U2YA 5E6IA 5JIDA 3E38A 3VXSD 3C5SB 3CH8A 1KPRA 4KK8D 1RIHL 3AWEA 1GL4B 3MVSA 4OJDH 4QRAA 4A2LA 5IP4A 4CMMA 1DUZB 3NJNA 3AMLA 4BFKA 1EV2E 3FQXA 5TE4L 4MXWH 4NN7C 3DHMA 2NPLX 4QRQB 4ELMB 3BVVA 4Z18A 2WTPA 3MLXL 3QPKA 1BLNB 4X7CC 1JXDA 2YBGA 2H0PA 2XA8L 1OK0A 1E2ZA 3GSXA 1BZ8A 5B7MA 5KTEL 1BF2A 4WHDA 4I77L 1E7VA 1Q72L 5AOMA 3E2HB 2DY2A 3MNWA 2L8AA 3NCJL 2E9GA 3Q2WA 1WCBB 4ZOAA 4P23A 2COQA 3CFDA 4AEHL 5AW6B 3ESMA 1YC7A 2HTLD 4ABQA 3KDMA 1JK8B 3ARWA 3OLEA 4UQ2B 4WWNA 4YAQB 5E2TH 4L4TE 5H35A 4X8XA 1QLFA 2Q87A 3ARTA 3OAUH 2BSTA 2GCYB 1NCIA 3D39D 4N0YL 4A7UA 1MQ8A 2VDQH 4X6DE 2B77A 1Z3RA 4LCCB 3EBGA 4N4YB 4G1EB 5I6PA 4LFHD 2IGFL 2G9KA 3N85H 1V5JA 4NUPA 3EOYG 2K8QA 2J6WA 4H0GA 1IM3D 1MXGA 3LXAA 2NY2C 3OWRA 2X44D 2ZJSH 1BIIA 3AT8A 1YEKH 1RL1A 3MV7B 1ACYL 3OKNB 3FHAA 4LOFA 1ZLWH 2NYYD 3T0EC 1M3JA 5F70A 1W0VB 2DQEH 3DMMD 4HIQA 3DKHA 4PR5B 5C0JA 3TNNB 5FW6A 4NGHL 3RI5F 4J5VA 2FE0A 2X3BA 3C8KA 2EJ1A 5T5FH 5DZLA 1QQDA 2GPZA 3K2MC 5EBMA 5B1AB 3ZE0E 4B3VA 2NZ9D 4HIPA 1K4DA 2J57A 4KMLB 1OM3L 1N2RA 5E2VH 1NL0H 4KQ3L 4C4BA 3ARFD 1FL3B 1FI8C 1FO0H 5LWYH 4HSCX 2DDQL 2EDYA 4PGZA 4LKXA 5T1KA 4ISVA 2ZP8A 3IE4A 1A3QA 5D71H 1OPGH 1TCRB 2BVQA 4ZMLA 1NCAL 2N7AA 5IB5B 1QPXA 4YDVA 4KI5D 2WCGA 3F7LA 3MA9L 3PP3K 1EERB 5IB2A 5FLVA 4IKKA 1NJ9A 3LKSA 3P4LA 4L3EE 4Z7VE 3GLAA 5F7WC 4QTIH 4TQIA 4YFEA 3RG1C 2V9RA 3Q2NA 4JM4L 1LO5A 2DMGA 4KXBA 1I1AA 2P1YA 1HH9B 4K73A 1R17A 1XD0A 2XN1A 1XB3A 1HEZB 1XMEB 2BNQE 4ZYKB 4O02B 5D7JC 2DI8A 1FQ9C 4XI5C 1E43A 3ULUF 2GITA 2YOAA 5HY9A 3SDAC 1GZQA 4JRLA 3J7HA 3QAZB 2D0FA 1ZLSL 3LPWA 4ZUWA 3SCMA 4NZDA 1I7ZA 2CJ3A 4LRIC 5LXGH 3SJVA 4QRBA 3PWNB 3MRNA 4QOKB 4MSWA 4RMQA 1LE9A 3N2JA 3QS2A 4LCWD 4YEFA 1G7MB 2KHAA 4BDVB 1P4LA 3ZZ1A 1C12A 3ARBB 4UMSA 3JVFC 5EOCH 4TQHA 2BRQA 4BZYA 5BVPH 1T4KB 1AGDA 1SJVA 2XZQH 5IWLC 5JHDA 5C0ND 4ZUUB 5JNYB 4JDEB 4EN2A 3EJTA 1OCWH 2ARJA 2Q3AA 3ARQA 4JG1H 2LQRA 1K5NB 3L3GA 1S7QB 1UD4A 1ZRUA 3UJTL 2DQCH 3AG3B 2VXSH 3FS9A 4UNIA 3W38A 1A5FH 1SF3A 3S48A 1F3RB 1F13A 1EMTL 3D48R 4CMHC 2Z35B 3QWRD 3KBPA 1QVOA 1KLFB 1R5VB 3VD0A 4AQEA 3W56A 1OF2B 5EOTB 1WE5A 3QWOB 3U2GA 3VXOA 5GGVY 1HHJB 1OCRB 3WOVA 3WNMA 3HNVL 5F8QC 5LG6A 1EZSA 1L9RA 4WDIA 4JN2B 2QSCH 3BH4A 1N12A 3FO0H 5C6WH 2HVKA 3WDIA 1KXQA 1JTPA 4KDVA 5HYFA 5IEHB 3WFCH 3DETC 4J4PA 4Q6IC 1LLAA 1M2VA 4X5RA 3H6AA 2HPTA 5KBDA 4JHWL 1FO0A 1J48A 2HJKB 4R5VA 1XZ0B 4UQAA 4WFEE 4XP6L 5FWRA 3WIAA 1SVBA 1RUKL 2YBRB 3TZVC 1UJ3A 4GEJA 4PP2B 2NY7L 3VQ2C 1M05A 1VPOL 3M46A 2F6AA 2VDLB 4JPIB 5L7XH 4PV9A 1WFMA 4BGLA 1OP3H 5LUMA 1ILSA 3GXNA 4A37A 1E5ZA 2DI9A 3L3HB 4RSVA 3VFNB 2Q76A 2CM6A 4WGVB 5E9NA 3BZFB 3NCYP 1CDJA 1NM9A 4OLVH 5D5MB 2OL3H 1S7WB 5JW4M 4OZGE 2YMOA 5DO2D 1U8NA 4Q52A 2QGBA 3KGUA 1V54B 3MRPB 5CZXD 2YXMA 2AV1B 2PP9A 1B0GA 3OJDA 1BZQK 3ISYA 3V6FB 3B9AA 3QFDB 4R6UA 3BOVA 1DBAL 2KZKA 4YGVA 1ZEAH 1WP6A 4ORGA 3GMLB 1GS7A 1QI5A 1T0MA 3ESOA 3NAAL 3ARGA 1IUZA 4PWJA 4NKDA 2CXGA 4ZMOA 2BCKB 3UPCA 5EO0B 2HX7A 2KPNA 3CVIH 4HPOL 3V6OE 5J6GB 5I6MA 1ZS8A 2RCSL 4A63A 4GAJL 3NN8B 2CIIA 1O7DE 4G5ZL 3K4ZA 2DOCA 3MV11 2ZUQB 3OQRA 3MNZA 3PABB 4P2RD 4UDTA 2YRZA 5LGJA 4KKBD 4KQ4H 4NRYA 3A6BH 3EJRA 5GRWA 1L5GA 4GQPH 3BZEA 4IOIB 5DVOA 2AQRA 5CEXB 5I1AA 4CU7A 3ILEA 4GBXC 4JPVH 2IADA 3EGDA 1W72H 2W9DL 5J6SA 4O2FA 4OGQC 3UH8A 3I6GB 3BSZL 1NGYB 2CGRL 1EZVX 2ZXBA 1OAZH 3DRTB 1MPAL 3F5WB 3U7WL 1F6AA 1I9IH 1C7TA 3MBWB 4TF4A 5D2LE 4HIEB 5F0MB 4HXAH 5I8OL 2CR6A 5K9OA 1YEJH 5EU6E 3S3PA 2FDBP 1QTYT 5IB4B 4XC1H 3D25A 4AUJA 3ARDD 2BFVH 3AWFA 5FV2A 1JOIA 1XSKA 4M9OA 5FOBA 1F97A 3ZKXC 1R3HB 2WQVA 2JJSA 2E74C 4LOVA 1DJSA 5E6RB 4A68A 4X6BB 4OJFL 3BE1L 4M8VA 1Q1JL 4L2YA 2JJTC 3IFNH 3PWPA 3SDXA 4CC4A 1SHWA 2OI9B 1J86A 4I2XA 3GKZA 2R69L 3ESVF 5I1DB 1QO3A 3CCHB 5F7UA 1MVFA 2DMCA 1T7ZA 4GRWE 4WO4D 2CLRB 1HDMB 1N8ZB 2ENJA 4IRSC 4W70A 4OB5H 2AEIT 2VDKH 4RSYA 4YO0B 4DP9X 5C97A 1XV8A 2UZPA 1NFIA 4FA6A 4ZX6A 3DWTA 4NQDB 4JKPH 3S36X 2UUDH 1ZA6A 4OF5A 4P3CL 4M7LL 3TFBA 1AHWB 3HUJB 3BPCA 2BOCB 1JV2A 2AJSH 4GRMB 4ERSL 2K45A 4MJ2A 4I5BB 1CWVA 3R4RA 5GGRB 1KYOK 4PU2A 3U82B 5EU3A 1X9LA 1IRAY 1GGYA 3CTTA 1N6VA 3C6LD 3CBJB 4PM1A 5FM5M 1JP5A 1MFEL 1Z5HA 2EQDA 2WWKO 3K74B 3IPFA 3FQRB 1X5KA 2XA3A 4ZSOE 4WKXA 1J88A 3CVBA 2IH9A 5AZ2L 4BQ9A 1JMXA 2VXVH 3C60B 3HC0A 1J05B 3BMVA 5MERB 1T22A 3QW9A 4IKNA 4N2OA 1F3JB 1IE4A 5FFOA 2L4OA 3BT2L 2MOVA 3WY4A 4N1CA 2FIRT 3QHFH 1BD2E 1QA9B 1IAOA 4GIPD 5GS0D 5IIEA 3GB7A 3MUUA 3MLPA 3RU8H 3UDWA 1QOKA 1TU2A 5KVDL 4F8NA 1PAZA 4I3RH 3BGAA 4L4TD 3VMOA 1RZIB 3P0VL 5CS7A 3OKDA 3JZ7A 3O2DL 3ZHNA 2VMFA 5I19H 3ABLB 2JXMA 4WFGE 1HJCA 1ETZB 4LSDA 2Y2WA 2X4UA 4MA8L 2IFGA 2Y3NA 4P48A 5DZVA 5DO2C 3TBTA 4HS8H 3OF6D 1W72A 4FL4B 1V3MA 4N2CA 5DUBA 5HHQB 1KTDA 2FAUA 4HK0A 4PB0H 2FBJL 3RWDA 5F1NA 3LKOB 5I74C 2WNXA 5AVVB 1KJVB 1QLEL 5DLML 4RAHA 1EEZA 1MUJB 1NINA 4PMFA 5I76A 1D5BB 3G5VB 4G80A 4HW6A 5AVRB 4RWYL 1JPFA 5SX5K 5E1HB 4ETQB 2NUPA 5GRZA 1JDCA 3FTYA 3MO1A 1HSAA 3DVIA 2CO7B 1CGSL 1E6JH 1T21B 4UIMB 1BECA 4XPAL 1R5WA 5GHWH 1H15A 2W92A 5K9KA 1PU0A 2WWOA 4HBCL 2QMJA 2OJZH 3EF4A 5EH1A 5C1MB 4CU8A 5JXAH 1FLRL 1G9NL 1YEWA 3QFGA 3OHXA 4UILH 3B7SA 4XWGL 1UEYA 4JN1H 2V2WB 4KY1L 4NO5A 4OZFH 4P9HH 4XCEB 1PZAA 2FT8A 1X5XA 2XPGA 3AWGA 3ZKND 4CBPA 1X6NA 4QKTA 3ZR6A 4EMZA 1INQA 1SOQA 3IU3A 3GTNA 4PRHA 3GSUA 3PG2A 1QLRB 4RZKA 2HVBA 4L3ED 2XXFA 3U9PL 4WWKB 2AEPH 2CO3A 2ZOTA 4R2GD 3L2MA 1KDJA 3OKMA 4IHBA 4AMKH 1A3RH 1NCHA 1KCVH 4QHPA 1JGVH 1NBVH 1WFJA 1ZGLM 1G84A 3QC5X 4HWBA 3FDWA 2QT6A 4LDCA 1KPRB 5KS9F 3D85D 5EF3A 2CDEA 3PWUA 1A6UH 4X4XA 4ZPTA 1OP5H 4E41E 5DZNA 4AG4L 2HLFD 1R3JA 2R7EA 3LEYH 4XNXL 1KFGA 2P8MA 4ZAKB 1DQML 1QZ1A 5D93B 1HCVA 2CQVA 5EU7E 5IQLA 4YSDA 3VWJD 1GOHA 2RD0A 3MLRH 1F86A 3FZUC 4U6TA 1JD7A 2CHXA 4R0LA 5KJRL 1I8LC 3LB6C 4HAKA 2WXPA 4M1DL 4QT5A 2C7UA 1S7SB 1LJMA 3BPLC 5CSBA 2CKBH 2O6CA 4J3SA 4WI8A 3GSXB 3IF1A 2YAHA 3DO7B 1I8AA 2CMRH 2JKLA 2VWEC 4G42A 4FQXD 2E47A 3MNWB 4HUXA 2DB8A 4PLJC 4XGZA 4XXWA 2R9HC 4UUJA 3QEQB 1L6XA 2IDUA 5CILH 1MVUA 1HVXA 1VADB 5IBLD 5F0PB 1UM4L 1P53A 5CKAA 1S7VA 1ILUA 3CFDB 4V1DE 5DQ9A 3FT2A 1QSFA 3K4AA 2G2RA 4HALA 2DEYX 1MCCA 1UADC 3KDMB 4OM1L 2DQFA 3NQKA 5B3JF 5I18H 3E9UA 1BG9A 2W94A 2NSMA 5DS2A 1HEHC 5E7FA 2MPVA 3JWDL 1H3PL 1QLFB 3ES6B 4OH2A 1OD9A 2VDML 2BSTB 2OMNA 3RRQA 3V0EA 4BSVA 1MCWW 4G8IA 4IBWA 2FECI 1F8TH 4KRPB 4DCQA 1RP8A 3MJ6A 3AXHA 4LQ1A 3KZ8A 3EIFA 2CJSA 3AS1A 2Y69B 1JI2A 3L17A 4FG4A 1AKJD 5CP7B 4LLYA 1B4JH 3Q43A 1P1ZA 3N9GH 3FQWA 1U8CA 7CGTA 1BIIB 3MLZH 4ZO7A 3GSRA 5F3FA 3EOAB 4OZFA 3X14A 2K9FB 4QO1A 1M42A 2WXHA 1KCUL 4X50A 5C0JB 1MFCL 3DX7A 4N68A 1Q0XL 5IQ7H 3C8KB 3DVNA 1ZK5A 3OKOA 1QQDB 2CUAA 5EBMB 3BZ5A 4PJ7F 5KS9A 3JV0A 1N2RB 1DBBH 4LBEA 4NQTA 1SBSH 1ES0A 1CE1L 1XR9A 4LNRB 3QDMB 4JMNA 2NXYC 2YKLH 1LO3L 1LNUB 5FO7B 4LKXB 2BVEA 5T1KB 3MV7D 4APQD 3I50L 1OSZA 4NQCE 1GPOH 4ZT1A 1P2CA 3G7TA 3SDDA 3ZL2A 2WYHA 1YN6B 3ZE1E 1T3FB 3HVDA 2R8SL 3LKSB 4M43H 4U33A 4UYQA 1JCVA 4X4MA 4BWUA 4KRLB 3BUQA 1PVHA 4OUOA 1J0HA 4Z7WA 3FQNA 4WK2B 2PR9A 3GSNL 4UTAH 2HJFB 3GD1C 3OAZK 2R29H 3AQZA 1YQVH 4MJHA 2GBTA 1I1AB 3IGUA 4NN6B 3TBCA 1OY3B 3BPNC 2FJSA 5AVYB 4TNVF 5EV7A 3H9SE 1NANI 2CKBA 5B38B 4RMWA 1UD3A 1M3IA 1F18A 5FAAA 1FPTH 3I9GH 3QQ3A 1AC6A 1MF2H 4IGBC 2VOTA 6FABH 5KYXB 2GITB 1NUFA 3UGEA 2WXNA 4YDJA 5DUML 4BXSV 5CJ5A 2EXYD 1XGYH 1RHHA 4N2IA 4UNTA 1I7ZB 1CGWA 5JR1L 3L5HA 3QQDB 4Q9CA 4ICWA 3SJVB 4MCMA 5D2NA 4N2AA 4DGYL 2ZX5A 3NIFE 4MSWB 1LE9B 1WFOA 4DOHE 4R2GC 2VW4A 4ZI8A 4X9FA 1OARH 5BV7L 1IGYA 3GBLA 3H9ZA 3AM8A 4ZO6A 1I9EA 1WTLA 5D72H 2WZPD 3SE3C 4MAYA 4HAFA 4B7IA 3O6KH 1AGDB 1AZRA 1IKNA 3GRBA 1T5WA 5TD4A 3NJLA 2CZNA 5JHDB 1CVSC 3OHMB 1CF8L 4J3BA 5SX4H 2VDQB 3C2AH 1ICTA 4JL2A 2ARJB 3L3GB 3ZT7A 1BWMA 4ADJA 1EBAA 3PQYE 4GIOA 5AW1B 4IIZA 4PEEA 1OV8A 1BM3L 5EU6D 4YJZL 3RVTD 1MEXH 4QOKD 3AC0A 5A1AA 1ET5A 3WO3B 3RNKB 2XQYG 3DTDA 4P2AA 4Y8AA 4NKQB 3WL9A 1QVOB 1OT1A 4NM8L 4AQAA 3J2PA 1NCNA 4R3SA 5E1AA 1E30A 4YN3A 1MXDA 5JQIB 2HZHA 3IDNA 4QYOA 5HI4D 2YQGA 1BYNA 4X7FC 1ONQA 5IUSA 4XP4L 4RGOL 2HVKB 4RQQA 5FO8A 5IBLC 2EEBA 1GYWA 4FTVE 3OSKA 5D1XC 1UA6L 3P2TA 3F6IA 3RX7A 1CPUA 1OW0C 1TZHB 3IDXL 4JDVA 1M53A 3WFZA 2EP6A 2VR9A 1VB9A 3VXQA 4Q4EA 1UJTA 3RDTC 1QX1A 1UJ3B 3DI3B 1HQ4A 2K3TA 3DVGB 2BS9A 3E2HC 3G3LA 1F6LL 1M05B 2Z91A 2NQCA 3KPLA 3QZWA 4L05A 4N28A 4M6ML 4PV9B 5CLZA 3UTTA 1LE5A 2L7JA 4MXVE 4J3OH 1RK1B 1DLFH 1S5IL 1XWVA 3GHEH 2Q76B 4GKOA 4UTAA 1HOEA 3VI3B 3ZDYF 2R29A 3QYCA 4NZUL 3EOBA 1KXTB 1MZZA 1IFHL 1EDQA 1UT1A 3L3OA 2WXRA 3HS0A 3W5MA 1FZMA 4J3OF 1IAIL 3HR5A 4WY7H 1F90H 3HE6D 2DLEA 1NSNL 4PTTB 1FFPB 3RWCB 3HBZA 4N2BA 4U1KA 1IJNA 4ZNCD 4IW4C 5JUEH 1KY6A 3F7YA 3G08A 4W4OA 1SJXA 2J7LA 3TURA 4P3DA 1WD8A 1BD2D 4FZ8L 4LCCC 1NCUA 1U21A 3N1FC 3QJVB 2G0KA 2WCSA 2XZCH 2ZYHA 3I2CL 3JVGA 2DTML 2OMZA 4U3SA 4YGVB 4DGWC 4YXKL 1J8RA 1TZOA 2ZSWA 3EYFA 1E4KA 3S2CA 1Q4NX 5AOLA 5A7BA 1T0MB 1NUDA 2H26A 3P0YL 1SXCA 4AIOA 4WFGD 3L5WB 3F65A 3K8MA 4UU9A 1VFOA 2AJYL 2O6DA 2X1PA 5IM7B 4ENEC 2JKJA 2YJQA 4XMLL 3EH2A 4FQ2L 1Q0YH 2DWYA 2JCCB 3CC1A 4KH2A 4JE4B 4GFXA 3QJZA 4O5LL 3ZO9A 5GS0L 2L7UA 1CLZL 4LVNB 4LEXH 3EO0A 5E5MA 3U9WA 3U0PA 5GZND 2GK0A 2Y5QA 1KG0B 1X6LA 3MRQB 4RETB 5I1AB 3GSQA 5JPMA 3RKDD 3HHRB 3EGDB 5AL0A 1S8DB 1SM3L 5F97E 1B9ZA 1F6AB 2V17H 2PPFA 4FFYA 3MUJA 4H26B 4UT9H 3SB3A 3KEHA 4QWWD 3SGEI 4XE0A 5HHVL 3DURA 1R19A 3SJVE 4APXA 2CPUA 3WN5C 4NO3A 4WU5A 4WJ5B 4WWPA 1EFXA 5E4IA 2XJLA 4P4KA 1NBZB 2FWOA 4R90H 3WJLA 5DK0B 4GAGL 3MJ7B 2DL2A 2AVFA 3QNYA 5EORL 1YUKB 4PS7A 3LZPA 5JHDE 2HUEA 1BQLL 1BVNT 4P5MB 5CD5D 1IAKA 4WSJA 3PWPB 4JFXB 4XXCA 3SDXB 3KLHC 4F8OA 4P2OB 5TPWL 3QAZC 4JM2D 1KYDA 2AXFB 1T1YA 2OV0A 32C2B 4ANUA 4EI6B 4Y88A 3CZGA 1KPUB 4BBWA 1URZA 1UB6B 3NIDB 4JJOA 5F7FA 5C6TL 4JR9H 4ODHL 1KB9J 3WKQA 2E7LA 4E41D 2D03H 3ARBC 1JF5A 2OL3B 3FF8A 4F8LA 1A6TA 3V52L 4XP9H 1NFIB 5L4MA 1K2DA 4G83A 1QBML 2LTQB 4HUUA 3N91A 2P24A 1ZA3B 1KXQE 4FG2A 4XOBA 3EZJB 3S35L 1LO0H 1I1CA 5GS1B 3V7AE 1JV2B 2AEQH 5TDOA 3VXUB 5TQ2L 3MXVH 5EU3B 2ZOOA 1OB1A 5AUMA 3CFJA 4FXGC 2Q8BH 1U9KA 5DD3H 2WQRA 5M7QA 3F58H 4JMXA 4ONFL 3FNKA 4UOW0 1KGXA 2YUZA 2WLIA 4N9OB 4PSPA 4RAVB 4BK8A 3QG7L 4KJYB 5IKCA 1A66A 3C5ZA 4V1DD 4JFOA 4XVUD 4L37B 4NQDD 4HPYH 5F7NC 4BH8A 2R2EA 3JYCA 2IQ9L 3OKYA 3RGHA 5GGVL 5IIEB 3GB7B 4JFPA 2L7EA 2R4SH 1TU2B 2QJDA 3W3BA 4ANKA 2BIMA 4XP5L 4V11A 3MJGX 4FG6D 5IVZA 3FO9A 4LSPH 4P46A 2LABA 3SD5A 5DUBB 2NNFA 2JKXA 1X7SA 2Z93B 4MQSB 1A8ZA 1I85A 4UT9A 5F1NB 1TVBA 2JI3A 4J12A 3REWA 5I17A 2GVYA 3FMGL 3ZZLA 2D0GA 3H2QA 3PGDA 4GSDL 1EEZB 3BFWA 3LS5L 2CO6A 4S11A 2VN5A 4WSGA 3UTZA 3J8F7 5I76B 3SQBA 1A14H 1RZ7L 1EEYB 1MLBA 1G94A 5AYTA 1QSZA 3KLAA 2NUPB 3LY6A 4WQOA 2P45B 4FQQB 2H1XA 1HSAB 1I3UA 4N0UE 3UTPE 4RMRA 4AJVA 4ODXA 4MKTA 3DUSA 3V55A 2NR6C 2E9IA 2HKHL 4DWHA 3OB0H 1MJUH 3S3JA 3QUKB 3RJOA 5D70L 2VUKA 3NH7L 4KNSA 1I53A 4PJAF 4BK5C 2LE9A 5ENWB 3MRBA 2OTWA 5F89A 1UH2A 4KHTL 4YDMA 5HPMA 3IGLA 4OFPA 4NQCD 5E6ZA 4OCRH 2BVUA 2Z8VC 3RGBA 2YPLB 1WTGT 2XPGB 1D5MA 1QWUA 3WFDL 4Z23A 3CH1A 4BEIA 4NFBA 4FQ1L 2VABA 5C6PB 1EAJA 3C5XA 3K71A 3IU3B 4DEWA 4PRHB 4F1ZA 2O5YH 2ENYA 3P69A 4FG0A 5AYUH 3BIAX 4OCWL 2N0MA 2IAMD 1WSST 4CN4A 4AQ1A 3S4SG 1J12A 4PG9A 2BP0B 2JQAA 2X4QA 1PLGL 2YEZB 1YY9C 3O6ML 4CN6A 3KXFB 4RDBA 4FKHA 4HWEL 1AGCA 1NMBL 3K6DA 4ZPTB 3X11A 4AM0A 1EIBA 1R3JB 2YMXH 4NIYE 1TF4A 2C8NA 1BM7A 4NHUA 3WJJA 2XV0A 2YQ2A 4GQ9H 4OY9A 5C0DA 3TJEH 4PI2A 3EJZC 1HHGB 1W0WA 3K6SA 5C3TA 4WWKD 4WKZB 4R0LB 1OTTC 2Z8SA 4I2XE 1KBVA 4L5FH 4XNMA 5E6ID 1J87A 2C7UB 4QXTA 2WGXA 2EDOA 3VMPA 3LXUX 3PYCA 3DK0A 3WYRA 4UQBA 3QO0A 4G42B 1IBGH 3NCMA 4QYAA 4JFQA 4HUXB 1A7QL 4XGZB 2EIDA 4PVLA 1MVUB 3G5XA 4YK4B 1UT2A 2YQ3A 1HJBC 5DQ9B 3FT2B 1QSFB 3EH1A 2G2RB 3PQYD 1JXFA 4EPSA 2QZQA 3IXTB 1C5CL 3S8FB 1B4RA 2IIJA 5IGXH 5E8OA 2DQFB 3L95A 2W1NA 5FX3A 1KLGA 3ZL1A 2XRAL 1WO2A 2GBVA 1QEXA 2YZ8A 3HZYB 3HS8A 2EEDA 1A02N 5MEQA 1B88A 1UACL 3WN6A 3B5HA 3MRDA 3US9A 4MVBC 2CNZA 2LU3A 4A7SA 4X4YA 1YPZB 4P23D 4Y8DC 1FH5L 3QORA 4HT1H 5FUZH 4DCQB 3OTTA 4XO8A 4K3GA 4MNQB 4JKKA 2X89A 4BXVA 2JFCA 4DUWA 4U1IA 3I75A 5FYLH 2MNWA 1HEJC 1AHWC 4XPTH 1P1ZB 1RZKC 2A6JA 2G5BA 4MHHI 4R7DB 3AGVA 3UJIL 2ZX9A 3UP1A 4WUKL 5GJTH 3GSRB 3BRDA 2H2SD 5BV7B 4OZFB 1EHAA 3X14B 2EAEA 3WE6B 5C09B 1DBJH 4F93B 2LGNA 1N67A 2IH8A 1PL3A 2BJML 1CDBA 3O8XC 2WWKT 3MRMA 3C60C 3DX7B 4TNGA 4OCYL 4FQLL 3D87B 3ETTA 3DVNB 4HJ0C 2LAAA 4KRPD 2H8PA 2VDPL 4CSSA 4AQZA 4MYWB 4X6FB 1ES0B 1XR9B 3RWIA 1O5DT 2CBTA 5IHUH 1A7NH 2HFFB 3U46A 5IVNA 4LCUB 1OSZB 1VCAA 4LGSB 3UAEA 1AP2A 3NSYA 5I24A 4YSCA 3O6FA 4JUTA 3SDDB 1P4IH 2N7BA 5BMFL 3QFJE 3A67H 4K8RD 3WLBA 4JVPA 5IY5B 4O9HL 1X5IA 3QNXA 1AZBA 3P9WB 4UNVA 4HZLA 4FL4C 4Z7WB 3CMOL 5I30L 1KEGL 4XNAA 2IPTL 3VG0H 1G1KA 5I6KA 1RK0B 2CD0A 5JIPA 4UOW1 5TH2B 1J11A 1CG9A 5T1KD 1BV8A 4FCAA 1AMYA 1R3IL 1ZVNA 3NJFA 3LEVH 5FGRA 3NIGF 1FNSL 3VD2A 4YL9A 3UMNA 2FEEL 4JHAL 4RH4A 3MREB 1DQDH 4YDJB 3CSBA 4N0CC 4EI5A 2N7SA 4FQJH 1M57B 3B34A 5I0ZA 3NPZB 1MCPL 3D2UA 1I1AD 3CZKA 4TLTA 4B9GA 5C7XH 1IGYB 3C09B 4MRCA 4NB7A 3THML 1HKLL 2ZP9A 2MCPL 2IG2H 5EF1A 3MQIA 1G7IA 1T5WB 3FQYA 4XBMA 1GOFA 3BAKA 5DDHB 5TDPA 4CKVX 2Z4QA 2AQ2A 2YK1L 3SCMD 4Y5XB 3SJVD 4A6YA 5BXFA 1SMAA 3EFOA 1GH7A 1OP4A 3SEPA 2E9BA 3UP6A 5E1IA 5F7EL 3ARVA 3QEGL 5ALBL 5E1AB 3UERA 4HUCA 4OLWL 3AQXA 3MRGA 4KUZH 12E8H 2R56H 1ONQB 5JHDD 1DEEA 1V3JA 1X3DA 3E3QC 3NFPA 3SYAA 3UTQA 4BWTA 4ZAKC 4PI0A 5DR5L 4DZ8B 4JDTH 5D93C 4H1LB 1KC5H 1QSFE 4IMLA 1UD2A 2NX5A 1O6TA 3JSSA 2X38A 3SKUD 5I66A 2WUBL 4X9GA 3ALPA 5CFHA 4LVOB 1U95B 3TF7C 4BH7A 3VXQB 4ENZA 5F0LB 3NACL 1QASA 5EZIL 1CDCA 1HQ4B 4ELDA 5E9AA 1CXFA 1EZLA 2Z91B 3KPLB 5B3NA 4OZHB 3KHQA 1CXLA 1J1XL 1MW3A 1XD1A 5T1MB 2UXFA 2K7PA 1CGVA 1T7XA 8PAZA 2AI0H 3CX2A 5EO9B 4K9JA 3F7PC 2WGNB 5DLLA 3HRZA 4J4PD 2GIXA 4X4KA 2Q2LA 3MUGA 3U4AA 3VG9B 1ZTMA 3EOBB 4TUOA 5FB8A 3MLTA 4NBXB 4C4KO 1RLBA 3G5ZA 3IJSA 2JV6A 1FZMB 1A1MA 3C12A 2XBDA 1BQRA 3HR5B 3DA0A 1KXHA 2WBKA 2TRYA 3RILA 4U1KB 5IT2L 4YBLB 2Q7NA 4AIEA 5DJ6B 3G08B 4XOEA 5B4MD 2PYEA 3TEYA 4P3DB 1ERNA 1ED3A 4KRPC 3ZO0A 3E6FB 4MNGB 4XXDA 3FTZA 5CBEA 5KS9E 2UZIH 4POUB 3FU8A 2OMZB 4BSJA 3MCLL 3MJ9L 2ZSWB 3EYFB 2PN5A 2F5BL 4NPJA 1F0LA 2AQPA 4F5CA 1PNDA 2H26B 4NSKA 4YLQT 4N2MA 3AU1A 3ZJAA 2K9UA 3WLWC 1RZ8A 2ADJB 4L2LA 1A4AA 4UU9B 4X6CA 2A9AA 4WHCA 4YEEA 3VAEA 1PG7L 4KZDH 2R0KH 1SHXA 1KCKA 2HPOA 4TL4A 3SKNA 2HT2D 5JW3L 3GMMA 1BW8A 3FRPG 1HWGB 3LZQA 2B14A 4M6OL 4PG2A 2JJUA 2J88H 2OW7A 4R26H 2IAAC 4X4ME 5IJDC 2EC9T 1MJJB 2X1XR 4YHOH 3OKLA 4L4VB 3WNOA 5A2IH 3D30A 3EO0B 2YEQA 4DKEH 2CO4A 1T0OA 5JXEC 3ZBMA 2E3VA 3ARGD 3FN9A 1B0IA 1UATA 3GSQB 5JPMB 3UTPD 2Y1AA 1DFXA 4HKBA 3UZEC 1KBKA 4PV8B 1W6LA 4G71B 1LEGA 5B3JE 2A9CA 3MPCA 5KSVA 1AHKA 5TK2A 4EJ1C 2OJ1A 2ADGA 3NJGA 4OLXL 4GRLA 4LCYA 4AZ8B 4KMQA 5D2NE 4GUCA 1DANT 4NO3B 2W8CA 1G1CA 1C5BL 4JRFA 1EFXB 5JDSA 4EOWL 1A6VL 5DTFB 1PZUB 2X09A 5F6HJ 4MDRA 5IROD 2WN2A 5HYJA 1NFKA 1U8IA 4LARL 4PJ5E 4BV1A 1NCJA 1S3KH 4K23L 4LVHB 4N2EA 2KLRA 4W4NA 5AW2B 2QSTA 2ZICA 4P59H 3VDAA 3UBXA 5C0CA 1KDIA 1NCDH 4UT7H 1IAKB 2ZUYA 1X44A 3N0AA 5IMKA 2Y1ZA 4GXUN 4G1MA 5FCUL 1T1YB 3VGAB 1BX2B 4Z7QF 2AJXH 2FHFA 2HT3C 1RV6X 2XYCA 4HIIB 2D2OA 2X1WL 2XWJA 3L81A 4WK4B 3TPUA 2UY7B 1QSEE 2F58H 3K8LA 3CNKA 4PJ7E 1L0XA 4LPUA 4F15B 5DURD 3S34H 2PTTA 4HIJA 1F11A 1NGZA 1OAXH 4HUUB 1UM5H 4LSSH 5E9DB 4YNYB 2H9GB 2P24B 4CGTA 4I9XA 4KUCF 3ZMEA 1IBHA 2HRPL 1D9KC 3CK0L 4QRPA 1IC5H 4P4RB 4B5ZA 2DYRB 3VYPA 1CBVH 1OB1B 4PJBA 5AUMB 2KC0A 3CZEA 4P99A 4WW2F 3MMEA 1KJ2H 3B7UX 1TTRA 3JV4A 4Y7OC 2XUWA 1NIDA 3PNRB 4E5XG 4AEIL 3FU7A 1HQRA 3BIKB 3V5HB 1FVEA 2GTZB 5ALCH 1TJGH 2WLIB 4P0DA 3CDZB 5T1DH 2IWFA 4JFOB 4TV3A 3S5LG 4BH8B 5DFVC 1WZLA 3D09A 2YUWA 3UTTE 5B7EA 3ZGHA 3A21A 4JFPB 4ZFQA 3AFLA 5HGHB 3D3VA 5LAXA 5T3XE 1UXLA 5C8JA 1MCIA 1TO4A 4HFUH 2X0WA 1FFTB 5CWSA 2KUTA 5I26A 3RLSA 3TN0A 1Z0MA 3GXPA 1BMZA 4ZPVA 1TQBB 3NFSH 3TH2T 1AS7A 2NOYA 3R19A 2BMKA 3WNJA 5ANMA 2A9NL 1RUPL 3O3AB 4F7MB 4FN0A 3BWAA 2PCPA 3REWB 2PWGA 5I17B 4I3SH 5AAMA 3VE0A 3PGDB 3B1TA 1YEGL 2CO6B 3NZ8A 3UTZB 3CFMA 3SQBB 3VXRA 2LT9A 1MLBB 3FONB 2A4ZA 5GS2H 3ZRFC 1ZSDA 4PJDF 1MFMA 4HYTB 2CALA 3V0JA 4ECNA 2NUTB 4OIIL 2R0ZL 1F58H 5ESQA 4W9KC 4B7LA 1RERA 4JFUA 4PJ9C 2WY3B 2YAMA 1G1YA 4MMXA 3O4LE 4LHUG 4Q0XL 4X99B 3ZQXA 1E4WL 2VSDA 4TN9A 5FFLA 5BO1H 3BIBX 5JQ6L 1QI3A 2OTWB 1P7QB 5EIQA 5FXCH 2OMBA 1ZLVH 5JW4R 5ESAA 4D9QE 3NFNB 2YFNA 4GMTH 5IQNA 1RQ5A 3B5TA 3CDYA 5IB1A 2G3NA 5BW7C 3QFJD 4DEUA 4HAGA 3VDCA 2X4TB 4TRPL 2X1OA 4HWZB 5E4OA 4R8WH 4WW2A 2WLHA 5CUSH 3SKJL 4LBAA 1OZUA 2YSSA 4ELKA 1QEWA 3B37A 1IKFL 3GIZH 4FXKA 4JO1L 4AQ1B 5ETUA 1MNUL 4X42A 2X4QB 4JCWA 1MCOH 5C0GA 1MAML 1DCLA 3MNMA 4LVNC 1AGCB 1KJ2A 3X11B 4K5MA 1ACCA 2BH0A 4TSBL 5C0BB 5FKPA 2XNAA 2Y36L 1TXKA 2EIEA 4PRHD 2AAAA 1RZGB 3Q6GL 5EHFA 3ZDYE 2H32A 3PFQA 5C0DB 4ZFOA 3K6SB 4ZK8A 2X5PA 4XNMB 3AT0A 3VGEA 5GZOC 1TR7A 2WBWB 4QXTB 3MXWH 35C8H 5MP6L 2RB8A 2N59A 2VZOA 1AZNA 2ZOUA 4TULH 2JTYA 2AMGA 4JFQB 2IV8A 3BFQG 1MHPL 1SDDA 2LLNA 3TONA 3UMTA 4FXLA 4NJAH 4J2QA 4E9YA 2ALAA 4JZJC 3CDGB 1NBYA 3Q1SL 1KSRA 3L5IA 3NZHH 4PJDA 4P2OC 1IGMH 1QBLH 4W9CC 1AJ7H 5C3IA 2CA3A 1W8NA 2IBZX 4B6ZA 2A6DB 5MEQB 4MQ7A 3QT2A 5FDYA 1KLUA 3EFDH 2IANA 4X4YB 3GLZA 3EJQA 2K7QA 1UOVA 1QSFD 4K3JL 2LTQC 3CVHL 4B0MB 5GS1C 4U1IB 3I75B 2WP3O 2G5BB 4M1CC 1CCZA 1TZIA 2DQJH 4JFZH 4QHKI 5I15H 5ADPL 2V0AA 3F85A 5I1KH 5HHME 3RX9A 1G9NC 3LN9A 2CJUL 5D6DA 1BHGA 3TL5A 1A7OH 2ADFH 2AJUH 3QZBA 2IXQA 3V5DB 4GT7A 1UWFA 1N64L 5H2BA 5AEAA 3RWEA 1IGJA 3GM8A 4KV5F 4QDGA 4X80H 4AVIA 4FI7A 3D9AL 2MTPA 2B59A 4XVOA 4JQXA 4E42A 3LEXB 5MHSE 2FNWA 3AVEA 3BAYA 1UM6H 3KPMA 4WTXA 2BINA 3IAQA 1JHLH 1EJ6A 2Q1EA 3R18A 5JTWA 4CJ0A 3N85L 3H3BC 2ZCKL 4UTCA 1TQWA 4HV8A 5EZLB 4EUPH 1AP2B 2ZZUT 4PJ8A 5IBUB 4BQ6A 3O6FB 1BPVA 4K5LA 4UM8A 4BFOA 4BUHA 1T1WB 5HDBF 2VM4A 4A7VA 1JZJA 3SY0A 2EIMB 1SEQL 4HS6B 4PW9A 3CC5B 4HZLB 3LIZH 3PL6A 4DTGL 4ZMVA 3C8DA 5EWIH 2YHGA 3U4BH 3TX4A 4ODUA 5I71B 3HE7B 4TTDD 3QRFM 2K4AA 1CG9B 4HGMA 5F9OL 1X5LA 4XVTH 1U3HA 4B41A 4FA7B 4YGAB 4MA3A 3EBHA 3HFML 4HKZA 7FABL 3DUHA 3PNWB 4ZJ9A 2XTJB 1MIML 3UYRL 3BAWA 3WCYA 4EI5B 4I3GA 1H19A 2EYRA 5K9JH 4BQCA 1MWAH 3OPZH 3E1F1 4Y0GA 3IRCA 3E9TA 4RESB 2ATPA 1N8OE 4OCNC 3L4UA 3IETA 1CFVL 1XH3B 5CN1A 5HGDA 3VW3H 3ULUL 4S0HA 1KTCA 1C8PA 1DN0A 4U1HA 5T8IA 4XAKD 1G7IB 3D0LA 5HPOA 5KYUA 5TDPB 5EU5B 5MEPA 3HZVB 1OAKH 2Z4QB 2NLJA 2EVGA 4B9KC 4Y1TA 1JNNL 2AKRB 2BP8A 3ATAA 3ME0B 3P73A 5ERWB 2JVUA 5A7EA 1ZANL 1SLUA 2A0LD 4P57B 1FORL 3RNQA 1B0WA 3DJRA 3SDCA 3CSTA 3O3BA 2XLLA 2ZNWA 4N5EC 5IQOA 1CLCA 2V6HA 4JFDA 4RRPG 4U1NA 4PJHB 1P4BL 4MAYD 3L2LA 2NNCA 1RURH 1OTUC 1K3IA 3TO4B 4XHJD 4TMPA 2P4AB 1QUNA 3GEWB 3NFPB 3UTQB 1JIBA 5GRXG 3EG9B 5FHAH 5HYSG 3OC8A 3IDJA 3QJQB 4IMLB 2GSGA 2NX5B 5FUCC 1HWHB 4IIQB 4U6VH 5I66B 3ARYA 3HZ3A 3VWKC 3TA3C 3F6LA 3DRQA 1QSED 3IS0X 4M5SA 1A5FL 1NGXA 4R97B 4XVJL 2FBOJ 5I73B 5EIIG 5IZ7A 5EF2A 4EUPA 2X6MA 3ZL4H 4GG6B 1NDMB 2PWHA 5JORA 3VU1A 5ID1A 4I48B 3RWFA 4W9DC 4R84A 2VUYA 5DC0A 1ET8A 3FBKA 2RA1A 5CF3A 3O2VL 2GY7B 4ZW6A 4JO3H 1FFNB 1T83A 1M7XA 4YK4C 5JIIA