4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
3UYPB 1TG8A 5LCVA 4UTBA 1PJWA 5KVEE 5H37A 5IREA 3WE1A 5JHMA 3UZEC 3UZQB 5B1CA 1Z66A 1RERA 3N44F 4UTCA 3J2PA 3N40F 2GG1A 3MUUA 4FFYA 4BZ2A 2I69A 2P5PA 4BZ1A 2HG0A 4X42A 4UTAA 5LBSA 5KVDE 3UAJA 3J27A 2R69A 3N41F 4L5FE 1URZA 4ALAC 3VTTA 3IRCA 4AL8C 1OK8A 1OKEA 3I50E 4UT9A 1SVBA 2H0PA 3N42F 1Z3RA 4FG0A 5IZ7A 1ZTXE 4AM0Q 4GSXA 3P54A 3G7TA 5GZOA 5LBVA 3C6EA 3N43F 5GZNA 5AAMC 2V33A 4UT6A 2JQMA 4FFZA 1UZGA 1S6NA 4GT0A 5KVGE 3UC0A 2ALAA 3C5XA 2JSFA 2JV6A 3UZVA 1OANA 2R29A 5AAWC 5KVFE 5JHLA
chains in the Genus database with same CATH superfamily
1OAXL 1OAKL 3UAJC 5J1AB 2GC4C 3WTUA 5D1QA 2DQHH 3PWNB 2CO6B 1IBGH 1HWHB 2N59A 3QIBD 3RIAK 5JHLL 5EWIL 3WUWG 3UACA 3V5DB 2VYRE 3GNMH 5BQ7A 1JWUB 1SJHB 5DZJA 5LKNA 4EUPG 1UB5B 3WTSA 2WXOA 4XX1E 4PJGF 3GMQA 1LDSA 1U8MA 3I75B 1I3RB 4PJHB 2QSVA 4FNPA 3VU1A 1EO8L 5C6PB 5JHBA 4PJFB 4UIKH 1MJ7L 5CP7A 1JF6A 5EFIA 4ZK8A 2QQLH 5FOBA 1XXDC 1TVHB 1J7VR 3FRPG 2OL3A 4OM0L 3NJIA 1SXAA 3ISWA 4C4BA 3T0DA 4L4TA 3K6SB 5E8OA 3HZMB 3BPCA 4GJTB 4D8OA 4IRZL 3DMMB 2IEPA 1A2YA 3INUH 2YGOA 3IU4L 5I8OL 3H42H 1CFQB 3M1BB 1KCRH 4U0RB 5GSVA 4XPTL 2J2ZA 2OMUA 5KVDE 3KE0A 4QHUA 3DGGB 5HGDB 1MCOL 5TDOA 5LGJA 2X1WL 1MFUA 4URTB 1W2KT 2YLHA 5KSAD 1TYEB 4NAJA 1EMTL 5I75B 5G5DA 3F6IA 2G9KA 3QJSB 4FNSA 4ODXB 1NCGA 3QDGD 1FNAA 5D93C 2OL3H 1YEFL 3S36X 1SZNA 3LRSB 3ATEA 4X9GA 1NC4D 4U31A 3IWUA 4OSUL 2EDFA 2VXVH 5DT1H 3S3CB 5GJSL 2MTAA 1KYOK 3PUCA 3T6WA 1U4FA 2H45A 4GQRA 4E36A 2ILLA 1D7FA 4PJ8C 1KN4H 1NLBL 3CN2A 3O8XA 3UYRH 4OUUB 1XGRA 5B8CC 4MLSA 4K7PL 2XN0A 3CXDH 1IGIL 1RQ5A 2E47A 1O5PA 4O00A 5ENWA 5F1SA 4JFDE 4DPCX 1TU2B 1IMHC 1AP2A 4N8VA 3PGFH 1RK1B 1SLXA 4HUUA 3S3BB 1PSKL 1A6AA 1T7XA 3WBDA 1F3RB 1Q9OA 1SFHA 3CZGA 2BVUA 4XWOC 4XHQA 4YXKL 4YDLB 1I7UA 3P0VL 3PGDA 4TKWA 4I1PA 2FYYA 1MHCA 3C60D 5D1ZC 1EAPB 1GGBL 4Q6IB 2C8NA 2RMNA 4OFVA 4P46A 1U3HB 4LLWB 4HLJA 4NUMA 1JHTA 4TULL 4JGJA 4LSVL 3ZDXF 4MS8C 4ZZFA 5AZEH 1EANA 1PG7L 3HC4L 3B7UX 2WLMA 2BOCA 3UBXI 1F02I 3QA3B 1QBML 2GPZA 3CVIL 4LBEA 4KH9A 3QZWG 1UWGH 1NWOA 1ADQA 4KJPD 1UGKA 2CHNA 1RL1A 4EN3B 3OKMB 4IGBA 1X5YA 2ZKHL 4WTZA 3S88L 5ID1A 1YY8B 4DUXA 2FSDA 3UXFA 3MLVH 2VZVA 5ETUA 2MCAA 5EU3A 3GB7B 2VDMH 3VGHA 1DUZB 3X17A 1MJUH 2AC0A 1KJ2H 2N0KA 4XH2A 4P57A 2WQWA 2G2NA 4ZT1A 2ERJB 4IHOB 4JGUA 3LKOB 5CGYD 1HXMA 1I8IB 1T6WA 4MS6A 4PIBA 3TWYA 3VSVA 4PS4L 2WP3T 4LVHB 4M48H 4LSUL 2AXGB 3Q6FB 1DVFC 1FRGL 4ZODA 5I15H 2XY1A 3SY6A 3WKYA 4B9GA 1PX8A 1AJ7H 4MYWB 3BAXA 4WW1A 4JQVC 1RFDL 4RWHA 3SYOA 5BVPL 1W0YT 5FHBL 3VNYA 4WV1A 1KDJA 4W1TA 4YWGL 2ZJSL 1AXSB 2AVFA 4C56B 4NJ9L 4F33B 1JS4A 3T2NL 3JT2A 4PP1C 2Q8BH 4FABL 4M7LL 1CGYA 1GHFH 1BQUA 2R1XA 2GCYB 4L8SC 1P5VA 5CN1A 1LO3H 4LK4A 4TSAH 3SKOA 2GY5A 1QA9A 2KC0A 3ILQC 1A9BB 2P7TA 2ICWA 2QKIB 4LCWA 4WO4A 5HHPA 5JPNA 3QQ3B 3G6AA 4I1RA 4X6DE 5DR5H 3WELA 2GI7A 2LTQC 1VADA 5IM7B 3BPLB 4EAEA 1WFOA 5KVDL 3KR3H 2V5RA 3P3UA 3P0GB 5HGGS 5D6CB 5HJDA 1ZE3C 3N91A 5CZRA 4MVBD 1IIIA 3BT2L 4GI8A 4MFHA 2UWEA 5TQ0H 3WKQA 4AYFA 4X7FC 4BK5C 4N90E 2NTFB 4J3BA 4JDEB 3VWKB 3VYPA 1L3NA 1D5XA 1DBKH 2EDYA 4ZMYA 1O9WA 1HXKA 3SDYL 1BQ5A 4DTGH 4P23A 3Q6GH 12E8H 1FSKC 3NABL 4F2MB 1SHWA 1VB9A 1MF2H 4AYEC 2P46B 1CGTA 2JK5A 1RJYA 1G87A 4EQ2A 1HXYB 2Y7QB 1GOHA 5KVGE 5D6DC 2UY7A 4GRLA 3AXLB 1Q1JL 1D6VH 4CU7A 4PLNC 1DEEA 4V1DA 2VN5A 3R7RA 3HHSB 3BP5A 1QUNB 3QIBC 3LX9A 1HINH 4ONGL 2K6YA 2OK0L 3HRZB 4PJGE 2ARJB 4H20L 3E2HB 4BSWA 1D9KA 25C8H 1UYWL 1F3JB 1R5WB 2HKHH 2QVKA 3WKML 5HYEA 1OM9A 3H9ZA 5D7IB 4UF7C 5JHLA 4PW3A 4LFHD 5H35A 3FMGH 1YVLA 1S7RA 5EA0L 2DKMA 1DFBH 5HGAB 4AMKL 4HPHA 1IKFL 4XMWA 5D2LF 3SE4A 3HFFA 1MREH 1TZGH 5FA3B 5JLZB 2B5IC 4JE4B 4CC4A 1NOLA 1VIWA 5GS0D 4Q7DA 1DLFH 3N0PB 3RFZC 1LNUB 5DHDA 3CVHL 2R51A 5B3NA 2HFGL 1BMZA 1CDCA 2YZ1A 4JM4L 3PFUA 3WFHA 4RIRA 4X0KB 1OAKH 1MDTA 4IRZA 3V9FA 4HU2A 5J11B 5JHLH 1BF5A 1BLNA 1PZSA 1YQ2A 2MNUA 1U8PB 3B2PA 2JCCA 4M62L 1NDGA 4P9HH 5KSAC 2FZ3B 1FL5A 4BKSC 1NBVH 3IJ9A 3TIEB 4J5VA 4J27A 3WIFB 4HCFA 3ZL2A 1EO8H 3EHBD 2IQAB 1MJ7H 5EO0A 2IOOA 4B53A 3F7VB 5IB4A 5A1AA 1GKEA 4GIAA 4GW4A 4ZNEE 1N68A 2QV2A 2DQCL 3NACL 3VACA 1RPUA 5HDQL 4PRPA 3OBAA 1DDTA 3UZVB 3B6SA 3TBTB 3TYGL 2X70A 4NC0B 4X9BA 1UATA 3PDDA 2FK9A 3PWPE 4N2NA 1GZQA 1KIQA 1NANH 5AWNL 4U1SA 5EORL 2EINB 4IRZH 4QXWA 3NGBC 3ZT7A 1E42A 4NDMA 5EU7C 5JW5A 3ASNB 4PRID 2FQFA 2D7PA 1Q9LA 5I8OH 1JOIA 3U0TA 3C60C 1E65A 2A9CA 2JKTM 4YDIH 1W15A 4ZTPH 2C7FA 2H26B 3OF6A 3ZDXE 2CJ3A 4A7VA 3UJIH 2H0JA 1FH2A 2EIEA 1HIML 3EGDA 3PWPD 3EDJA 1EMTH 4LPTA 3H8NA 4PRBA 7PAZA 4NRXB 3D07A 2O93L 1YEFH 3ASOB 3WHE0 2Z8SA 1I8UA 4DIXA 4OSUH 2RFXA 1OF2B 2F5AL 2VLLA 3MCLL 3I02B 5C0JA 1FAKT 1P7QD 4PW9A 3WI9A 1EEZA 2BWDA 3BYTA 5DZAA 4KJPC 2KHAA 2KZBA 3LVTA 4RX4A 1NLBH 5EOQH 1KELH 4H2CA 2BPBA 4K7PH 2G3XA 4M4RA 1DVTA 4FQLL 1UM5L 1ORSB 3FCTA 4NWUL 2XWBA 1PSKH 1AQKH 1KTLB 1NCWL 1WHPA 3B7SA 3FZUD 3HUJF 4IHBA 4YXKH 4YHML 3FQNA 4LCYB 3B4NA 4DKDC 1OAUL 1UKQA 4KJQD 3ELQA 3QPQD 3ZE1F 5IHLB 2ZXGA 1GGBH 3GXUB 4APXA 2BSED 5CGYC 3KLDA 4G3YL 4TULH 3I9PA 4FQQB 4EI5D 3BWSA 4GAJL 1FZKB 5DJ0A 4YVNA 4F7TB 4F8PA 4X9YA 4NFDA 3IJHB 3H2WA 3AG2B 1PG7H 1GGIH 2HVJB 1GGUA 1VESA 3PDGA 2QTVA 3ZE2F 2X4PA 4BCYA 4DUVA 3LIUA 1QBMH 5ITFA 5FPIA 3DUSB 5EBWB 3CVIH 4U1KA 2N1KA 2DQUH 2YMTA 3ARGD 2DQEL 3IN0A 3C6LB 2A9DA 2J1WA 5GS0L 1UXSA 1IAMA 5B1KA 1DSWA 2CRMA 2ZKHH 3SDCA 1A4CA 4NKDA 4ZUVA 1NUFA 1N3NB 2X41A 4FF9A 5AYQA 5I9QB 4O58L 4MLIA 2EC9T 5TH2B 4J3SA 5LGKA 4R83A 3BFOA 4MD0B 3K6NA 9CGTA 5LNEA 3CVDA 1HJCA 5IB3A 5EIVA 4XPBL 3L5XH 1TQWA 4KKZA 1O0VA 2YRZA 1XO8A 2LFEA 1U6AL 1DJHA 4FXGA 4PS4H 1OGPA 3I9AA 4KVCL 4YHZH 4OV6F 1I9EA 1UM4L 1FRGH 2BS71 2NNAB 3QT2A 4WKXA 2V7NB 4M5SA 2W65A 3DBSA 1MCFA 1B90A 1RFDH 4JPIA 3ETBF 5FHBH 3SB3A 4MVBC 4F7EB 4ZO7A 4ODUB 1U8HB 4YWGH 2J57A 2ZJSH 4H25B 3Q2NA 2AHIA 4NJ9H 4OCLC 1FFNA 3T2NH 4ZUTB 4HKZA 1KTJA 1PD6A 2E75C 5LB1A 1C5DB 3ILPA 3NIFB 3O9WD 4K3EL 1BIHA 1T0NB 1G0YR 5DVMA 2BCMA 3VQMA 2VDPB 3KLKA 3JQOB 2EYTA 5DI8B 5KYXA 5EULV 5I16A 1PLGL 2YWYA 2F19L 3EFFA 1DVUA 1CDYA 3MRRB 2KQNA 4ADGA 2HUEA 3PQYD 1CIDA 2VDOL 4BXVA 1CIUA 3S35X 1P4BL 3NN8B 2WUCL 5HBBA 3TP4A 1CYXA 4JFDA 5CS7A 1JNNL 1F11A 2WQ8A 5C0BE 1QQDA 3VH8B 1TQCC 3QFJB 1QFWL 5KVDH 4PB9H 4J6RL 2AJXL 2YOCA 5D71L 1XIWD 3BT2H 4IU3B 5EC1A 3MREB 5K5YA 5D2LE 4KJYA 2X3AA 3S3DB 1ZLSL 4YBLC 3VGEA 3RU8L 4BELD 2IAAC 1NMBH 2BNRD 4QYOB 3UJTL 4JKNA 3IJYA 3POHA 4AVJA 3EH3B 5MEQA 4I9WE 3EGXA 4J3WA 4OGAC 5C0BD 4PGEA 2O6DA 4ANWA 2GJZA 3O4LE 5CIPB 4XAKE 2D3LA 4GMTL 5C2UB 3SYAA 4O51A 2X7LB 4IU2A 2XKNB 1IVLA 3VFWA 1U8OB 5F7DA 1U95A 1ES0B 3K72A 4I9WD 5LHDA 5F1NB 3JV5A 3A4FA 3CVHA 3CH1A 3QO1B 1DDHA 4ONGH 4H20H 4D8PA 1UYWH 2QEJA 3N3EA 4GXVL 4XAKD 1OD7A 4UTCA 3WNMA 4PJAB 4Y8DC 3RNQA 1TITA 1HESA 4U1MB 4HIIA 2C34A 3ABGA 3GSRA 3MRLA 5EA0H 3V6ZA 2X2IA 1KB9J 3EHBC 4I13B 5KUKA 2KL6A 1IKFH 2E7HA 3VB8A 3X3FL 2X9ZA 5TD4A 2K6WA 4H88H 3OAZH 2DLTA 2JIXD 1NBZB 2D4DA 2VLJD 3T3MB 3PY9A 3KJ4C 1EDHA 5C70A 4XAWL 4Z3TA 4G8FA 3WG7B 1TTRA 1DANT 3FT9A 1MXGA 3P69A 5IW6B 3EOBB 1WEJL 1U2HA 3OGCA 2YUVA 3CVHH 2B9BA 4Y5VA 1PAZA 4JG1L 4X5XA 4F5CE 3VAEA 3OJVC 4ZW3A 5DQJB 3PXHA 2DQDL 1CK0H 2MKWA 3EW3B 2VDKB 3EJQA 4M62H 2ZG3A 4ORZC 3BISA 3AXHA 4XN7A 1CBVH 3RQ3A 1DBJL 4FYRA 1DSYA 3EZ8A 1L9MA 1D5BB 1ML0A 2XG5A 4EN2A 1LP9F 1TPXC 5I8EA 1FL3B 2P4AB 4KO7A 5E8DL 3WEAA 2PW2A 4F9PA 4QXTA 3NACH 2DQCH 1AGBB 4JHWL 4UQAA 5CHNA 5E99L 5HDQH 1G0DA 4X6DA 1NGYB 4LCUA 2Q5BA 3HUJE 1KBVA 4KK5D 5AWNH 4DEUA 4NQXB 3ZE1E 3PL6A 1OARL 3D4ZA 2APSA 1WZLA 1RZGA 4FYTA 4KJQC 3FB7B 3QPQC 1KCVL 3L48A 4BINA 4R4ND 2QKSA 3RZCD 2A9MH 2HVKA 4N8UA 4BGDA 1NEZA 1HC1A 1NKRA 4S0TD 4WNSA 4EI5C 3W81A 2N7SA 4JFZL 4EQ3A 3ZE2E 1EFQA 1GC1H 3L5HA 2R56L 1OSZB 4PJBF 3U30C 3GMNB 3FU9A 2F5AH 4K7FB 5T5NG 3VD4A 4QCIB 1DQDH 3EJRA 3FNKA 4ZMOA 1A6VH 4LNRB 1C8PA 3QH3A 1P1VA 1N8ZA 1ZHBA 3ARGC 1ACYL 3L1OL 4QHLB 1A64A 3VG9C 3DVIA 2CK2A 1OOWA 4L8BA 4FQLH 1Q8MA 4PJGA 3RDTD 4NWUH 5SWSD 4YJZL 2XN9E 5F7FA 1M9WA 3CV5A 3WDJA 3WFCL 5HGHB 5DVOA 1OAUH 4AH2B 3ZHDA 1UZ8A 1JNLL 2EO1A 2D0FA 3BP4B 2CJTA 3VRIB 1KFGA 2FUTA 35C8L 3PGCB 4G3YH 3VQLA 2R1WA 4UQCA 5SX4H 2J1XA 4GAJH 5C7XH 1TZ8A 2QQKL 2YAPA 4JDVB 5KVGH 1S3KL 4ODWB 2XN9D 1BZDA 3U0WL 2I07B 4NZFA 3EO1B 3GJFA 5E1AA 2C9AA 4ZG1A 5MENB 1AIFA 1NUDA 1LE5A 2R0KL 1XF5A 4YDZA 1GCYA 4P5KA 2CBQA 2AGJL 1Y6KR 5HHQB 1R5IB 2DQEH 2VIRB 5KYUA 4L0PB 4XZUB 4NZUL 3PJNA 5E2TL 3ARBA 3EGSB 4D0CB 5C0ND 4XO3A 2BP0B 2AXJA 1QNZL 2WGNB 3D34A 4XCEA 4O58H 2EXTA 3RJDA 3KDPB 3O9WC 1VLXA 1MPAL 2IWGA 4F37F 1UCBL 1OE2A 1PZ5A 4AVKA 1U0QA 3ETBJ 2MOQA 1A3QA 1BYNA 5JIDA 2WAQA 3C8HA 5IGXH 1O5DT 4XPBH 4HJIA 5DUPL 4Q6YA 3GJFH 4ZNEA 1U6AH 5D1QB 4FNRA 2HTLC 4KO6A 4RESB 4RGMB 5DJ2A 5C0CE 4H13C 2X9XA 4AOFA 5HHME 1UM4H 5BQ7B 4HPYL 3S9DB 4L1TA 1CN4A 1F5WA 2VCOA 3ETTA 3PWPA 4KJWD 4ACTA 4AV4A 5AG9A 3GMQB 4MA7L 1U8MB 1XV8A 3GUFA 1IT9L 2KUTA 2YA1A 3IGFA 2IDCA 1P9MA 1QSEE 1J9SA 1PZUB 4K55A 5CP7B 4XVUD 5EFIB 3HI5L 1XIWC 5FOBB 2OL3B 3IGKA 3KHOA 2L8AA 3CHRA 5CXPA 5C0CD 4L4TB 5E8OB 2Y5QA 3S0PA 5DRWA 3PWLA 4FLOA 1DCEA 4GT0A 4A55A 4X4ME 3BPCB 1TENA 4NENA 1CE1L 1A2YB 1CXEA 1QSED 2C9PA 4TRPL 2QVIA 1ZGLA 5K39A 3TVMD 5GSVB 4OUOA 1IGTA 2F19H 5E5MA 2J2ZB 2OMUB 3AITA 3QC6X 3N41B 4QHUB 1WAEA 5TDOB 5KJRL 1DEDA 2VDOH 5LGJB 2NY1C 1QP1A 1P4BH 3KPQA 3GSOA 5G5DB 4Q2ZA 4DP0X 1U3JA 4PRDA 2D7TL 3VFPA 5DC9B 1QFWH 4XZ4A 1J5OL 1QKZL 4J6RH 2EDKA 5D71H 2EUZA 2WYIA 4U7KA 2DM3A 4JM2F 3NMEA 1ZLSH 1HWGB 3O8XB 3IVKA 3OHXA 3MV9E 2XOTA 1XGRB 3KHQA 4Z3HA 2X6CA 3LD8B 4ETQA 5ENWB 4P5MA 2WLJA 2O6FA 4E41E 1AP2B 4N8VB 5A40E 1XD1A 4HUUB 3VXSD 1A6AB 1OHQA 2DICA 4W68A 1DYZA 1Q9OB 4N6RA 3NP4A 1I7UB 3PGDB 2FYYB 1X9QA 1A7OL 1MHCB 3FN0L 4PRAA 2B20A 1T04A 2A77H 3NYKA 3PS6A 5EUKA 5JHAA 5EEXA 2VDMB 3GK8L 4HZAA 5EF3A 4P46B 1JBJA 5CCGE 4ILDA 2F74A 2K7PA 3WN6A 1JHTB 2ZUQB 2EKSA 2CRZA 5A2IH 5I6XB 1ONQA 4F2EA 5HHXH 2MMXA 4AZUA 2V2WA 2BOCB 3B8SA 4LCCA 1LP9E 2CD0A 3IETA 4K07A 4PHZA 3FUNA 4LBEB 3CHPA 1RZFL 4I4WA 1I1RA 3M8OL 1NAMH 2DQIH 3UEZA 4IGBB 4LEBA 4BFOA 2LOEA 5ID1B 2ZWLT 2CAKA 4ONFL 2GJJA 1BQLL 1M1XA 1QEWA 5ETUB 1GZHC 5EU3B 2R15A 4CA4A 3DBXA 3QP3A 4XAWH 4UQBA 2DF3A 4KK5C 4XH2B 4C4UA 2XQ0A 1WEJH 4P57B 3MOBH 3KVQA 4IRJA 1MCSA 5L4IA 3CTTA 3KYMA 1UUNA 1ZKAA 5C0AD 4XMPH 1HXMB 1J11A 4M3JA 4R4NC 4PGJA 4OF5A 2DQDH 3RZCC 3KYOA 2VSKB 3CFCH 3EBGA 1PY0A 3FC8A 1RP8A 2F1AA 1H3VA 4JKKA 4WW1B 4XNMA 4PJBE 2Q20A 2V2XA 1S46A 5E6IC 4G8GD 3AY2A 1NMCC 5E2WL 2J72A 4WV1B 4LRNH 1IEAA 3JVFC 4JGNA 4UOJA 3AUVA 4JHWH 5E99H 1KBBA 3VXUE 2PUQT 4J3OD 3LZRA 1S9VA 2R1XB 5AAWC 4FN0A 4JQXC 2EEFA 5C0BA 2NCMA 1P5VB 1MHEA 5TK4A 4WHYH 3RDTC 3RTQD 3R0MA 3AB0B 1U8CA 4D2NA 2H2SD 5B38G 1OARH 3SKOB 4HFWA 1GYWA 1QA9B 3NZSA 4ODTH 3DETD 2EDEA 2P7TB 4KROB 2ICWB 2JVUA 5J7CC 4LCWB 3LH9A 4WO4B 5HHPB 5JPNB 3AY4A 1RZJL 3VXUD 3MV8D 3G6AB 2X4RA 4M8UA 4OGXL 5AAMA 1P4IH 1AKJD 1K5NA 1VADB 1YUHA 1UOWA 2P8LA 1KCLA 4NB7A 1K8DA 4JFZH 1AMYA 3H4FA 3O4LA 2R56H 5I6LA 3CFTA 2OBGA 3PP4L 1ZHLA 4QAMB 2UWEB 4HT1H 1D5IH 1OTTD 2WJ7A 4JPKH 4AYFB 5F3BA 1D5XB 3MGAA 3L1OH 3QG7L 5F7LB 2MKLC 3CSGA 1WA2X 3BVUA 4P23B 3MQIA 3A6BH 5K9OA 4DEPB 3WFCH 2JK5B 3MLZH 1RJYB 1GS8A 1GRWA 4JPVH 5AB2A 5EEYA 2UY7B 4PJ9C 2Y5TA 1JNLH 3LEVH 3S5YA 4JAMA 4M8VA 4IKJA 1DEEB 4V1DB 2OW7A 1IEBA 1J48A 4KNQA 1ZLWH 1ZS8A 3BP5B 3ZHKA 4H8HA 4YS4A 5KJ4A 2XFGB 1L9RA 4YHKL 3Q7JA 5FCUH 4BSWB 2VAJA 1D9KB 2CLZA 3N50A 1TCRA 3Q2VA 4Y4HD 4ONOA 4OLWL 5H35B 4LLMA 1S7RB 3QGVA 5IVNA 4M7JH 2R0KH 2AFNA 4F5CA 1DVSA 4XVUC 3EJJX 1E5UI 2AGJH 2CG9X 3I6LD 1NMAH 4OH2A 1JGLH 4NZUH 5CNHA 5E2TH 1X4XA 1E9QA 1YY9C 4DP2X 1BJMA 1HCFX 2NRDA 4YSQA 4FXTA 5LBVA 4PUBL 1NCIA 2Y4SA 4IS6A 3EXLA 4XWGH 1MPAH 1SBBA 2D0GA 3HE7C 3L16A 1UCBH 4XBMA 2ZOWA 3TVMC 2Y1ZA 2H2PC 5DFVD 3WFHB 2BSTA 1WLHA 4RIRB 1AYOA 5LCVL 5DUPH 4I3GA 3EJTA 1BLNB 2YMXL 2F58L 2JCCB 1NDGB 4AE1A 4HPYH 1FL5B 3FONA 4P5SA 3HUJA 5E4AA 5F8RC 3VTMA 2H3KA 3ZRFC 2ITCA 4JVUA 2C9QA 5EO0B 2AQ3A 5IB4B 2WBJD 1BBDH 3H53A 4GW4B 1U21A 5A6LA 2A0LD 2X3CA 1ZOXA 5FO7A 4PRPB 1V27A 3B6SB 2X70B 1FG9C 3QR1A 4S10A 4FG2A 1GZQB 1KIQB 4RCAA 3S48A 1YEEL 4U1SB 1ZRUA 3PU7A 1CE1H 3RVUC 4XCCH 4CSSA 4CVUA 4NDMB 3CAFA 3M7OA 4AEIL 3R4RA 4TRPH 5JW5B 5HYFA 1HL8A 1Q9LB 1N64H 3NCJL 3U0TB 4ZAKA 4E9TA 3D5OF 2K9FB 1LK2A 2I9TA 2Z64C 5AOJA 2Q3XA 4BBWA 5KJRH 1LD9A 1NC2A 3KEHA 3EGDB 4F57L 4XN2A 1T0PB 1BEYL 4KGJA 4FYQA 4PRBB 1MXDA 3SYQA 5EBLA 2CKBL 1KC5H 3ZO0A 3VMNA 4OJAA 1WGVA 2XN9A 4RLDA 1J5OH 1P84K 2RFXB 2WTOA 2VLLB 5C0JB 4Q9RL 5I17A 1EEZB 3CLFL 4X5QA 1LEIA 1RULH 4JO4L 3D3VD 3LH8A 4I18A 1QHQA 2VQTA 4TS6A 4DZBA 4M4RB 2WINA 3FCTB 1XL6A 4NQDE 2XWBB 3FTWA 4RDQF 4Q89A 2FEDD 4MHHG 3UTSE 3MSPA 4W81A 3WN5A 3FQNB 4Y89A 5GZOD 3QNYA 3T65A 3Q2WA 3L1FA 2XXMB 3DSNA 3FN0H 4LGSB 3DUUA 2A74C 4APXB 5AW2B 3GK8H 2LAGB 3SDAD 4H8UA 2E4FA 2XX0A 3WO4C 4S0HA 1ZANH 1F45A 4ZBJA 1RUAL 1DQJA 3UTSD 4QXVA 5I1EH 2X4PB 4LL9A 1KFAL 3NCCB 4U05A 2XV3A 2BNUA 4JVPA 4MSWA 2MHAA 5ITFB 4OY9A 4U1KB 3PXLA 4QRRD 1BWWA 1RZFH 3KVPA 3M8OH 5GZNA 1UXSB 4C4KO 3RE0A 1XSJA 3SDCB 3BAIA 3HCVA 4ZO8A 4ZUVB 5C0CA 4ONFH 5F7BA 1KY6A 4X99A 3CPUA 3A47A 4J3OC 3BN3B 1T66C 5AVUB 4QRBA 5TE4H 3Q1EA 3Q8FA 1QSEA 4P49A 4B9JA 2E9IA 5IB3B 2IDQA 1IFRA 2AABH 4DP8X 4FXGB 5KOMC 3K74B 1TFHA 2VR3A 1JZ8A 3V8OA 3J7HA 4KVPA 3CJJA 1X5IA 1I1AD 3CHQA 1T83A 4X4MA 3VXNA 4J8RA 3MRPA 2W65B 1X5LA 4KXAA 2YUWA 4X6BA 1BJ1J 4JPIB 4OCNC 2DMBA 5CUSL 5E2WH 5F88A 2HT3D 5I19L 4WUKL 2Y72A 3UROR 4AE0A 3HG0A 2WPGA 1FFNB 4HX1A 4O2FA 5ADPL 4HKZB 4KX8A 4OQ1A 4QNPF 2ATAA 2CK0L 3ILPB 4PGDA 4F8OA 4OV5A 1RZKC 2H7WA 5CKAA 1PLCA 2XDHA 3MLUL 2EYTB 3MFGB 5KYXB 2FAUA 5I16B 2J1ZA 3HZVA 3EFFB 3J07A 2FUQA 4KXBA 4M6NL 2QGEA 3JWNG 4G7RB 4R3SA 3MV9A 1RZJH 2JKLA 4I2XE 2EDWA 4XOEA 3F62A 3T4AA 4OGXH 4JFDB 4E41A 4MQTB 4DKTA 6PAZA 1F11B 3EKCA 5D7JA 1QQDB 2K78A 1JZ5A 1TSRA 4YEEA 4HLEA 4O5LL 1FFQA 2ZKYA 5I74C 3OC8A 3SDXF 5E4EC 2Z65C 3W39A 3HB3B 3PP4H 5EC1B 4Y4HC 2W0PA 5SX5K 3M88A 4KJYB 3FS9A 1L9TA 1UFGA 4BWTA 1NKGA 4HLZG 1N0LA 2B3IA 4JN1H 2A6DA 2CDFA 2NMSA 4UOW0 5MEQB 5F6IC 2C9SA 4PPTA 3EGXB 2ODHA 2VW6A 4PGEB 4W9DC 3NAAL 5ADOL 2GJZB 5ITBL 2OTPA 4KY2A 2VR6A 4WIQA 1G7LA 1PFOA 3P9WB 4O51B 1FC2D 4J3XA 5F1IA 4IU2B 1GAFL 3ILDA 1WICA 3PIQA 3VFWB 4JRYE 1GGTA 5DFVC 5F7DB 1U95B 3H1ZA 1UJTA 3K72B 4AGOA 3B9KC 5JIHA 2R0LL 4UDUA 5IJKC 1SUHA 3CVHB 3CH1B 1DDHB 4NQTA 1Y18A 1J9CT 4YHKH 2B1HL 4NZJA 1WFTA 2JI1A 4D8PB 3MMEA 3MLSL 3RPBA 1YUKB 3RNQB 5IJBC 4M6OL 3WIAA 1FI8C 3HG1D 5IQMA 4HIIB 3GSRB 5HYSG 3MRLB 2FLMA 4JO1L 1J88A 3V6ZB 2WTRA 4Z78A 5I71B 4JRYD 1CMOA 2AQNA 2BVPA 2BX5A 1NCDH 3BUIA 4ZXBD 2WBJC 2XQBL 4KKBD 4MJIE 4AQ1A 5D7EA 5BV7L 3JV4A 3N85H 3RX5A 4YQXL 4G8FB 4D9QE 1MUJA 5GJTL 3L3IA 1L9OA 1EAOA 4PRNA 4PJBA 4L8DA 4U7MA 3OGCB 3BZFA 1DHKA 3DX9A 4KTYA 5F6HI 4Y5VB 4QHMA 2BP5M 4X5XB 5K1JA 2XX1A 3LZPA 3VM7A 1IFHL 1WG3A 4NO3A 5JIQA 2IH8A 5DUJA 3ZZLA 4BZ2L 3VXUA 2RA1A 1BXXA 2F58H 4IDJL 5TQ2H 5ECGA 2HRPL 4D9QD 4N3UA 3O6FA 3CUPA 2XG5B 2XBDA 2ADJA 5I8EB 4F9LC 1F97A 3T2PA 1M56B 4M5TA 1QWHA 2Y1YA 5EEZA 4HJ0D 2PW2B 3P30L 1ZIAA 4YHNA 5HDBF 3T0XA 4NPYA 2CKBA 4QXTB 5FGCE 5J6GA 5CHNB 1C8QA 1CI5A 1H9DA 2AJYL 2E9WA 1IGJA 3D48R 4X6DB 5GRWA 4HALA 1QOKA 4LCUB 1MFMA 3E8UH 5ERWA 3U4KA 5A16A 2EABA 2KDGA 3FT1A 4J4PD 3DVNA 3PL6B 2ED6A 2HG0A 2FEDC 4AEIH 1F3DJ 5GZOC 1HYSC 1RZGB 4AUJA 1SEQL 2WW8A 3NCJH 1YYLL 1KXHA 5MI0B 4AK1A 1Z9MA 3KPPA 2TAAA 5FAAA 3LXCA 1M7DA 2ZIDA 2HVKB 3EBIA 1VA9A 4G9FE 2YEVB 1NEZB 2JELL 2SEBB 3SDAC 2FLRT 3HS0C 3RWHA 1BEYH 4NNXA 3UZEA 1URLA 4KITB 4HHWA 2CKBH 4BUHA 2VXQL 5K9JL 5AVXB 4N2EA 2D7QA 2OQJA 4KKAD 4NFCA 4S1RL 3U36A 4K94H 4IMLA 4YHLL 2DV6A 1XBRA 2VLME 1JK8A 4Q9RH 2OZ4A 1OPOA 4G6JL 3WIIL 3WS6A 3QH3B 1N8ZB 1ZHBB 2DIBA 4G9FD 1SOSA 4I0PD 2OR7A 4MMYA 4D9RE 4FL4B 3S96A 4NN6C 3L1EA 4L8BB 4U1IA 4PJGB 4OLUL 4JO2L 3ULSA 2FVNA 2VQ1A 3V55A 4RGNE 3GS4A 4A39A 1NCAL 4F92B 1BZQK 1YNKL 2WSKA 1KIUA 2YA2A 1UZ8B 3L9BA 3X2QB 1NTDA 3BSHA 3CFUA 3PUUA 3T08A 2BHUA 2CMRL 1BG9A 2R1WB 3L13A 2ZX9A 4POYA 4FTVE 2OZ4H 4L0YA 5C07D 4FE9A 3L08A 3GJFB 5E1AB 3GXNA 1KFAH 1Z3GL 1AIFB 1LE5B 3VD2A 4F2FA 1XF5B 4MQXD 4U33A 3GGWA 4P5KB 1GXEA 2HT3C 2V5SA 3VQ2C 1BEXA 3IAQA 4JRFA 1VFAA 5GISH 5KYUB 4JREB 3BWZA 3FB5A 2R4RH 3ARBB 4QNPE 4FTVD 5IHZA 4JO3L 5PCYA 1TQVA 3BRDA 2HMID 3I2CL 2AQRA 4XCEB 4Y0GA 4JS7A 4KO5A 1AR2A 2XG4A 3RLSA 1O7DC 4KFMA 1PJ9A 1PZ5B 2WYTA 3VGAC 4Z3JA 3B5HA 2ZYHA 4JM2A 4W9CC 3IDIA 1LDPL 1YEDB 3A22A 3U7WH 5DJ2B 1NLDL 1YEWA 2PCXA 4PWFA 2Z8VC 3NEOA 3PWPB 4HZLA 2ZCLH 3DHUA 3SDXE 3LQAL 5BRZE 2H1XA 2VDOB 4JPQA 4YSAA 5B39A 5T1DL 4XBGA 4NKQB 4D0BA 3I6SA 4YDMA 1WF5A 3OB8A 3LQZA 1GR7A 4QEGA 4WUKH 3IMSA 4YHYC 5I19H 2EIZA 3ZDXB 5SV3A 2WKGA 1RAMA 5DRWB 5ADPH 3PWLB 2EXSA 5CKGA 2W59A 5D9SA 2YQBA 2WNXA 1IM9D 5E03A 2CK0H 4LLVA 4NENB 4NGHL 5TTRA 1NL0L 5GGTA 5J12B 3HNTL 4ZMVA 1ZGLB 5K39B 5D1XD 3MLUH 4FFTA 5DVKA 4OCMC 1IGTB 3ZDWA 5E5MB 1KWGA 4HMEA 4M6NH 4N2KA 4F7KA 3N1GC 3KPQB 3REVA 3GSOB 1MIMH 3UO1L 4Q2ZB 4MZRA 3TO4D 3UIZA 1E9OA 1NFDF 1P53A 4PRDB 4NQDA 3VFPB 5EZPA 2CGRL 4NRZA 3UTSA 2GUOA 4O5LH 1SHMA 2BVOA 1A65A 1WBZA 5K1VA 2FQGA 4EXPX 3G7TA 2Q6WA 2ENQA 2OV0A 2QTEA 5GGTH 3IVKB 3OHXB 1X6NA 2BIPA 4NUJA 4ETQB 4LHUA 4P5MB 4KKBC 2EIKB 3H9HA 5DMKA 3RG1C 4L3CA 5E94A 3DRTA 4YXHL 3RYMA 1KJMA 3NAAH 4N6RB 5ADOH 2ZUXA 5ITBH 1YEGL 3AMKA 3WMPA 1HNYA 3OWEA 4OZFA 1F41A 3S4SA 1T03L 1F4WL 2UYLA 5JW4Q 5L9DL 1G43A 1T04B 5EUKB 1G7PA 4WF7A 1ITCA 1GAFH 2XBZA 5EIIA 3QJHA 2F74B 1FZJA 2EKSB 2YN3A 3ARDC 3HKZA 1ONQB 2W92A 1BAGA 4PTUB 1OT2A 2V2WB 3WTVA 5PAZA 1UT9A 3KWXA 4LCCB 4BD4A 3MLSH 3IETB 4M6OH 1E5ZA 1VFUA 3BGFC 2FQEA 2BRRL 2E0PA 5HDBE 1R9FA 4I4WB 4DGUA 5DC0A 5KVEE 4HJ0C 3V0WL 3Q13A 3ZTDC 2XQBH 3DHPA 2HKAA 3LQAC 3RPKA 3MN8A 1M1XB 4PI2A 1QEWB 1XH2A 2Y7NA 3KWUA 4YQXH 3DBXB 4HEPG 2X1OA 1AZZC 1I7TA 5GJTH 2HJLA 1A3LL 1Y07A 2B14A 4J4PC 4IRJB 5FECA 2ICWI 3ZXAC 2NZ9D 3KYMB 3MXVL 3G6DL 4NI3A 4A2DA 2IH3A 3NA9L 2D7OA 4M5ZL 4DO6A 1IFHH 1BJ1H 2ZX7A 2W9EL 5DZPA 2NLJA 3KYOB 3WFZA 6TAAA 3CXHK 5I0DA 2WVTA 1DVZA 1FNSL 2O5NA 1S3RA 2HRPH 4XNMB 2E7BA 5CILL 4BIKA 4TUUA 1FG2A 2V2XB 3TJEL 4HUWA 4KNTA 4KKAC 4NQEE 5HDRA 1U92A 2PO6D 3F85A 1IEAB 1VACB 5IB2A 2VXQA 3JYCA 5GIRB 3RGVA 2AJYH 4WDIA 1IC7L 4I0PC 4I2XA 5J56B 1JYVA 1BD2A 1S9VB 3RURA 3HLAA 4ABUA 2B9AA 1XZWA 1MHEB 4GO9A 4X4KA 1U8CB 5FYKU 2QGBA 4HFWB 4BE6A 3CZEA 4A7UA 5JDJA 3LNGA 1SEQH 4KUCD 5ALBH 1YYLH 2ICEC 3JXAA 5T5FL 2LVEA 2A99A 2ZYSA 3FQWA 4R7VA 1H6FA 3KG5A 3X12A 4Z7NB 2ENPA 2JELH 2X4RB 3BMVA 2PYEE 4PJ5E 1I1FA 1K5NB 1YUHB 2P8LB 5HHOD 3P0YL 2F6AA 1K8DB 1QVOA 2Q86A 1YEKL 2R7EA 5DD1L 3O4LB 3RILA 5K9JH 4S1RH 3KNBA 1UG9A 4DESA 2EH8L 4MA1B 1ZHLB 4R4BA 4YHLH 4OI8A 4JFUA 3WIIH 4G6JH 1U58A 4MQXC 4JRYA 5F3BB 1H3PL 4ZXBA 4RMVA 1WFJA 1V55B 1VZIA 4JQVA 2DI8A 4OLZH 1AR1C 4HA1A 5K9OB 4NO0A 5AYUL 2V3FA 1NCAH 2KBGA 5F9WC 2BVTA 3GYRA 4MJ4A 1W16A 4JAMB 4JVWA 1A1OA 1TTCA 1IEBB 3L2MA 3JBG7 1AHWC 1ZS8B 2CMRH 1PBYA 4MJIA 2IBZY 4Y1AE 2MPVA 3WTYA 3HZKA 2CLZB 7CGTA 5I1JL 4QHPA 2XTJE 5GS1A 1TCRB 4Y1TA 4AYGA 4GBXC 5B1CA 3NJFA 1Z3GH 3P9MA 4LLMB 2VC2H 4LP4A 2YAMA 1N10A 1EV2E 3ZQXA 5E56A 2FWLB 4GXUM 2CPCA 1TFPA 4MD4A 3K6OA 4Y1AD 5LAXA 4BH7A 4JO3H 1E9QB 3E3QE 3BLBA 1J9QA 3I2CH 5KVEL 2GBAA 3C6SA 2J7LA 2EXYC 3OJMB 4IS6B 4FI6A 4X7TA 3DC0A 3JWOL 3N40P 3LDBC 1M4KA 5D1XC 5LDUA 2BSTB 4R2GB 4TNWF 2G5UA 4N0CD 1LDPH 3RL2A 4PFEA 3ISYA 1NLDH 4HGWA 1NFDE 3HG3A 4ZQTA 5ALCL 4P4RA 3U4AA 4GYBA 3FONB 4UYQA 3HUJB 7TAAA 4MNHA 4QO1A 1RIHL 1TEFA 3ZE1B 1JVOA 2ITCB 2H3NA 4Q9BA 2J5WA 4LCIH 5T1DH 3N5AA 4B96A 2DZEA 4GS7B 1QBLL 3QJVB 4I7ZC 4JPSA 2E27L 2WO2B 1K6QL 2DB8A 3P11L 4N86A 1O6TA 1F3DH 2JTYA 5LN4A 5FO7B 3M86A 3MA9L 4G9FA 3ESNA 1F1DA 3FYIB 4IBZA 1YAZA 1HDMA 3BWUC 5IFAH 4BFRA 4OJCA 3ZE2B 1NL0H 1SXNA 5CEYA 4HH9A 5F7EL 5DK2A 5T3ZH 2H41A 2AERT 5KZCD 3KMDA 1OAYL 4KRPB 2WMPA 4ZAKB 2C1PA 5F8QC 2P24A 4BQ9A 1LK2B 1R3HA 4TXVB 1A6PA 1OE1A 3FO9A 2V33A 1LD9B 1NC2B 2VRAA 3EYUH 4OIFA 4N26A 3DROA 3N6YA 5EBLB 2VZ3A 1UCTA 2XN9B 1E0OB 1AXTL 4BHUA 2F8XC 2CGRH 1ZHNA 1X5KA 4CDHA 4KUZL 5BZZA 4X9HA 3TCLA 5JHDE 5I17B 3RDJA 3NA4A 1LEIB 1LM8V 2EJ1A 2JJTC 4UOQA 4JB9L 3QEGL 2NT0A 4I18B 1TSHA 4H8WL 3KGRA 2XQYK 4P2YA 4DZBB 4F3FA 2WINB 1HCYA 4UQIM 4FTVA 2VN7A 4YXHH 5E23A 5GRUL 1RLWA 4Z7VF 5DCCA 4ZFFA 1YNLL 4FX5A 1J0JA 3MJ8A 3RGBA 3K0YA 3WN5B 1YEGH 4PRHE 3QNYB 3T65B 3BAEH 2E86A 3DSNB 4WI6A 2F18A 3TPUA 3UMNA 1JGUH 1XAKA 5L9DH 3DUUB 4JEGB 3U0PA 1ZPUA 5H37A 5IREA 1B4JH 2NZ9C 3VVVA 4YLCA 1O6SA 2NY3D 2O5ZH 2BSBA 1CD8A 3TN0D 2K45A 1WLGA 1YJDC 2BK8A 1M57B 3VE0A 1I9IL 5L0QB 2NY2D 1DQJB 1E6OL 3TOPA 2G3NA 5FDYA 4WNQA 2BNUB 4MSWB 2MHAB 2GFBA 4MWFA 1CXHA 1NCCL 4PVLA 5CJBA 5D7KE 1PTZA 4GKZA 3Q8BA 2BRRH 5DS1A 2PO6C 3IEAA 3APCA 3Q8EA 2HG5A 3HCVB 5C0CB 1XZ0A 4L3ED 4X99B 4IDLA 5HHMB 1YNTF 5H37H 3OVUB 5I1AA 4OVUA 5DZ9A 3SDXA 4LPYA 2XJLA 1A3LH 4MQ7A 2V9TA 5BRZA 1JF5A 1QSEB 2P5WE 1NGWA 2D03L 5D7KD 4B9PA 5ECJE 4CU8A 3MXVH 5D4JA 3GKWL 3U82B 1FORL 3MRMA 4ZOCA 1BFTA 5I6PA 2W9EH 1LWJA 4Z7AA 3GDCA 1J1OL 4M43L 1JXJA 2Z8WC 3VXNB 1BJ8A 1RIVL 1FNSH 1GY2A 3INOA 4J8RB 1CF1A 1A66A 2R9HD 3MRPB 3OZKA 3VH8G 4B9FA 4X6BB 1W6LA 5T5FA 4RFNC 2B3RA 3AG1B 1IGFL 5F88B 4WFED 1I85A 4RRPM 5AVVB 4NP9A 4LLUA 3UTTD 1FYTD 4I77L 5IW1A 3S8WA 1BOGA 4N2IA 3ESMA 3D18A 3FF8A 4HX1B 4O2FB 1KLFA 1IC7H 3QUKA 3RVXD 1TLKA 3RA7L 1XGTA 1E40A 2CM5A 4PGDB 3S2CA 4OV5B 2BH0A 3GTNA 4N2GA 2BC4A 3HZVB 1VPOL 4X50A 4WHDA 4E9SA 1QBBA 2KLSA 1K8IA 4R3SB 2CGYA 1BZ7A 3ARRA 3CGTA 4HUCA 2OULB 3MV9B 4GLRH 2JH2A 3ECWA 1BZ9A 2YK1L 3US1A 1MFDL 3HE6D 2I9LA 1D7DA 1MKFA 3T4AB 1CLCA 4E41B 5IEHA 5D7JB 3OR7A 5D2NC 1YEKH 4DGVH 1WIOA 5A2JH 1TETL 3W39B 2EH8H 1AD9A 3HVDA 2N3JA 4B60A 4G82A 3AW5A 3QUXA 4ANVA 2DLHA 2FX7L 3AREA 5DD3L 3FSZA 1N0LB 5EN2A 2A6DB 2CDFB 3BKJH 4DH2A 5KBNC 2OW6A 4ODHL 3S6CA 2P49B 2ZCKL 2I7SA 1DE4A 2X6MA 1UXWA 5IHUL 3PAYA 5IBTL 2FX8L 3GJEA 3R7QA 1JYXA 4AEHH 2J6WA 4HZ1A 1U4EA 1G7LB 5K1NA 5F1IB 5KBKA 1O75A 1RI8A 4D7PA 3PIQB 1TZHA 1SN2A 4TNFA 4WSGA 4KY1L 4HAGA 4PLKC 4UDUB 3SPVA 1MQKL 1PZ2A 2WLIA 5L88L 1Y18B 3ZK0A 4APQD 3FUIA 1AC6A 1MAML 5DEFA 1OGSA 5I1JH 3MMEB 5EBMA 2VR5A 1USQA 5CSGA 1BWMA 1S78C 3BH8A 1JZFA 4RWYH 1P5UC 4U1GC 5BVJA 3KYAA 5JOEA 2WTRB 4Z78B 3PRZA 2BVPB 4WFGD 2DQTH 2DKSA 3OLEA 4AQ1B 1URZA 1JGIA 5KAQG 2KYIA 3JV4B 2AZUA 5EMYA 1MUJB 3L3IB 1JCVA 5DZVA 3SCMA 5KVEH 4XPHL 4PRNB 4PJBB 4L8DB 3EADA 3BZFB 2CSPA 3DX9B 1HI6A 4ZMZA 3JWOH 3OJ2C 4NQEA 4QHMB 4WI0A 1ZXKA 3RTLA 4NO3B 5HJ3A 2APWA 4KI1A 5HJBA 3QXTA 3ARFB 3ASWA 3VXUB 3MRJA 2ATPA 4A2LA 1N6QL 2PF6A 4YFDB 1XGQA 3MO1A 3QAZB 5EUOF 3MLRL 3O6FB 1RIHH 3OWRA 3L3OC 3JWDL 3CUPB 3ABKB 2ADJB 4XVTH 2BSRA 2OMYA 1ANUA 3RWGA 5TDPA 1QBLH 4HS3A 3S34L 4YHNB 1EX0A 2E27H 4G1MA 4NPYB 2CKBB 2V4LA 3RP1A 2KKQA 5J6GB 2OCFD 2JJWA 1KCSH 1N26A 4JMXA 1IGJB 3PE9A 1ODAA 4Z7VE 2PYEA 4PJ5A 3QXUA 2IALA 3PNWA 4JKPH 5A16B 5ERWB 2R4SH 3GI9H 3Q8AA 5H94A 1SM3H 3CLEH 3DVNB 1CLVA 2QPUA 3P4OA 4MJ6A 5DURD 1OAQL 3O6MH 5D4IA 3KPSE 4XMZA 1A7PL 1MHHA 3KPPB 4IJ3B 1LHZA 1M7DB 4NBXB 1IZJA 3MJ9L 5KANG 2NY3C 1ETJA 1BPLB 3QS2A 2WCSA 3RWHB 2PP9A 4NNXB 3O2DL 4M5YL 3TN0C 1SUJA 4JKWA 1T7YA 1AXTH 2OQJB 3U36B 4IMLB 4ZMXA 4GFTB 4KUZH 1SOKA 1OOAA 1JK8B 4N8CL 1GTNA 3V4VL 1SNRA 4JB9H 1Q0XL 1MCWM 2QJDA 3QEGH 2WJ5A 4ONHA 4H8WH 4MMYB 5I0YA 3S96B 2Y23A 4Y1AA 4U1IB 3ULSB 1A6UL 1OSEA 5GRUH 2W0FA 2VQ1B 3TLRA 3ZL4L 2HWZH 2OR9L 2G30A 1OT4A 2V17L 5IR1A 4NKIL 3E9UA 4GQQA 1KIUB 1KUMA 3ZTJH 4OGQC 2DMGA 3AS1A 4PMFA 5E6ZA 1YPZF 3UEQA 3WKNA 2FX9L 1J1XL 3DYOA 4X42A 2Z34A 4QF1A 3OKNA 3SBRA 2FWSA 4I88A 1I9IH 4K8RL 1L0YA 5GRJL 2X88A 4HULB 2CIIA 3SSGA 2R9HC 3WAKA 1YMHA 3FKUS 2D0HA 2G60L 2BSCA 2O72A 1ZWIA 4UIMA 3GGWB 4ZTOL 3S35H 2WLKA 3I50E 1VFAB 1CDJA 3F00A 3BD4A 3LKPA 3FB5B 2YJLA 5L8LB 1IKNC 2E5EA 5IHZB 4WU7A 4BGLA 3K6FA 1NFDA 4PBXA 3PG2A 3RVXC 2WBKA 3T0EE 4B9IA 2XG4B 2G2RA 4LB8A 5KBMA 1IBZA 1L0QA 1B0IA 3WHE1 4OTXH 3TWCH 4JM2B 2JQAA 3ZYZA 3GKWH 3IDIB 1RY7B 2IADA 1UH2A 1FORH 5GS2D 2XCMC 2NNCA 4M43H 1J1OH 5ESAA 2PTTA 4HZLB 3DECA 1RIVH 3QIWD 1H0DA 3T0ED 5D96B 3STZA 2AQQA 1MCEA 3S3PA 3TM6A 5B39B 3QZMA 5CEXA 5ACLA 4XBGB 2YARA 4D0BB 3QW9A 4ALAL 3ECQA 2BY3A 3DJ9A 3SJVA 4NSKA 3LQZB 3WENA 5CD3A 2D9CA 2EIZB 4DP5X 1UEYA 3Q06A 2J21A 4I77H 5TF1L 3UBXA 3ESOA 1AG0A 1EFXD 2EICA 4RMSA 5D9SB 4N8VG 1RIUH 4BJLA 1DZBA 4IRSD 4LLVB 3RA7H 4B9ZA 3SGEH 3QRGL 1THAA 3OXSA 3IE4A 4EDXA 1SGKA 1XEDA 3BUTA 4L8CA 1ZT7A 4PVBA 5DZNA 4HKXA 5TE7H 4FG4A 3QYCA 2ZOUA 5JHDA 4BCXA 5CJQL 2YD9A 4Z8FH 1JGDA 5J13B 3NRPA 4FI8A 1UT1A 2RALA 5A7EA 3B3IA 5CFHA 3REVB 1MFDH 1VDGA 1BG1A 3FOMA 1E3FA 1E9OB 3FRUA 1XCXA 4NQDB 4APQC 3VYNA 2Z31D 2J8UA 4NRZB 2N01B 3DTUB 3UTSB 2GUOB 1X5MA 1UASA 1TETH 3QDJD 4PRHA 4BEIA 1HHKA 2BVOB 1WBZB 2QHLA 1FGNH 4ZFQA 2Q6WB 4CJ1A 2FX7H 5DD3H 5B4MC 3U25A 4NUJB 4P2RD 4WTZG 3OC5A 4LHUB 5IQ9A 3H9HB 4ODHH 2Q8AH 1EZLA 5DMKB 4E0RA 4L3CB 2L7JA 5E94B 3DRTB 2ZCKH 3K8LA 5INCA 5DHEA 3L9RA 1KJMB 1J86A 2HSIA 4KVNH 3D33A 5IBTH 4JFSA 4CC1A 1IQDA 4UB0L 4OZFB 3S4SB 3E7JA 2NW2A 3UIYA 1ZDSA 2UYLB 5AAPA 5BV7B 2HX8A 1G7PB 3C5ZD 3DOHA 3S5ZA 5I5IA 4PP2A 1DQTA 4DN4L 4G9DA 5EIIB 1JWMA 2GK0A 3QJHB 5HI4D 1FZJB 2NPLX 4JFPA 3BPNB 1LEGA 1MRCH 3WUZA 5C86A 1FCGA 1NEPA 1MQKH 3VRLF 5EUOE 1X9UA 2V5YA 1TCMA 2DM4A 1KYFA 2HJKA 2MNWA 5JQ6H 3UZQA 2WXNA 4N5ED 3VFOA 2P5WA 1GYAA 1KPUA 1JFHA 3G5YA 2EIBA 3ZUCA 2XLLA 5KG9A 1RVFL 1JV5A 4TYUA 5MHSE 1HT6A 4C47A 4AI7A 2G75A 4RH4A 4W9FC 1I7TB 3I50L 4TQPA 2ORBL 1L7IL 5BZWA 2HJLB 1XDTT 2ED7A 3F7RA 4XPHH 5IK3A 4MMXC 5ISZE 5FECB 1I7ZA 2NXZC 4X8CA 4MCMA 5E2JA 1GY1A 1MRDH 2IH3B 4LPUA 1FPTL 5CCKH 4FLRA 4OCYH 1MWOA 2NLJB 3RWEA 5IIEA 3FHEA 3IFNL 1UOVA 2EIMB 3EUDA 3D4YA 3HE6A 2FBJL 1N6QH 3PHOA 5E9AA 4JFHE 1G9NL 1U2CA 2XIIA 1BXAA 2EVJA 3MLRH 1FG2B 4HUWB 3JWDH 5ISZD 3MJ9A 2WXHA 4GAAA 3D85A 5GRZA 2NY6C 4MCYA 3O2DA 4ZYKA 5IB2B 2V8MA 2FT8A 2VO8A 4NP4L 5SWQA 3RGVB 1Q9KA 4WDIB 2BIMA 4I2XB 4FFYL 2P42B 3TESA 1BD2B 3HLAB 2PMZA 4Z3FA 4LLAA 4JFHD 1INDH 2YXFA 4AQ8C 3DURA 4LSDA 3V4VA 1KGCD 3HR6A 3SD5A 1RZQA 1JZJA 2X28A 5BS0D 4M7ZB 3ZGHA 4HOMA 1YPZE 3S3SA 3CBJB 5IOPA 5JXAL 4JN2A 3MUJA 4LL4A 3FQWB 3X12B 3MRKA 2MQ3A 3MJ9H 1I1FB 4PGZA 1OALA 1QVOB 3O2DH 4M5YH 2R7EB 2Q86B 1UKTA 3CDCA 1E4KA 4R97B 3KNBB 2XV2A 3SE9L 4R4BB 1IE4A 4Z76A 2PXYC 5DVPA 3SPHA 3VUAA 3EUUA 2XHNA 3VI4F 4M7LT 2ZP9A 4N8CH 3UBGA 1OQOA 3GBDA 4JRYB 4DN3L 4CW1A 3V4VH 2IJ0C 1Q0XH 1KPVA 1TEGA 2G9HA 4Z9KB 3ZT6A 1JVKA 1V54B 2VC2B 3L5WA 4DJMA 5HP5A 4ZMNA 1YYMH 3KPRE 5FB8A 1A6UH 3ZKXC 2YWZA 3ZL4H 4NO0B 3WNJA 1WS8A 1X5AA 4TUKH 1HSAA 4TM9A 5FYLE 3M1OA 5GGSA 1F1AA 3DMMD 1UB6A 4QOKE 4CSTA 2IGLA 4FULA 1A1OB 2XUWA 3QWRA 4XN8A 1KYAA 5DD6A 2FX9H 3A5VA 4MJIB 1OP3H 3CH8A 3EBAA 1WUZA 5LGHL 2EZ0D 3HZKB 3JWNC 2UXVA 2H6OA 1FCCA 5GS1B 3LPFA 1EJOH 1WWWX 3OAWA 3ATDA 4K8RH 4U1NA 3QIWC 3P9MB 2G60H 2MCG1 3HI6L 4TQHA 2O5XL 3E0GA 4K9EH 1V3JA 3A4EA 4MMZC 4ZTOH 1AQHA 2Y6SD 2QADB 3MACL 4YGAB 2LTQB 3R8QA 5EG6C 4MD4B 2WM0A 3ABLB 3DTDA 5LAXB 3SGJA 3TBBA 3QDAA 4BH7B 5DRZA 3FAXA 3F64A 1A7QL 3C6SB 3RIAF 4IRSC 3MRHA 4X7TB 1URIA 2DM7A 1JTPA 5JQHC 2MH4A 1WD8A 4O9HL 2VMFA 3ZTCC 1KYDA 4GO6B 2HLAA 2VNCA 4WGKA 4QWWD 3GFUA 5FGCB 3RL2B 4PREA 1C5CL 1FFPA 4HGWB 3LQMA 4Q97A 1U3HD 1P6FA 4Z7VA 4P4RB 3HG2A 2Y7LA 1NCHA 4KGLA 4MNHB 4QO1B 3WY3A 4YO0A 3MLYL 3UADA 5FOJA 1JGEA 2ZICA 4UQ2A 4UV7L 2H3NB 2J5LC 3NZHH 2LW3A 2OMXA 1KACB 3BP6A 4UMGA 1D5RA 2IANE 3RAJL 3KPSA 4BA8A 5CFAA 2VM4A 1KBPA 4IIQA 1WC7A 4YE4L 1WBXA 3QXAA 4G9FB 4EN3D 1IGYA 1G0XA 1HDMB 4WI3A 4JFTA 2LW5A 3LNFA 4OLEA 5T8IA 3MLXL 4WCYL 5CEYB 3IS1X 4HH9B 2IGFL 1ZK5A 5DK2B 5JXEC 3FO1A 1AS6A 3ABMB 3G04A 2WMPB 1RUPH 2C1PB 4HJGA 3L7EA 2OMTA 2P24B 5CJQH 3C5ZC 1R3HB 3FO9B 4W9ZA 1FF5A 3NJHA 4RA3A 1ID2A 4W4OA 4WNJA 5HI4C 3VRLE 4AEEA 1YAIA 3A67H 1YNTA 3DROB 5A6MA 2ZXBA 3X1EA 1DQML 4QD2E 4N9OB 1RSFA 4RGNB 2I27N 1ZHNB 5F7KC 5AZUA 2X38A 3TCLB 4XP1L 4N5EC 1QFUL 2BRQA 1XSOA 1T1WA 2D7MA 4Z0XA 1J0YA 3UYOD 2QPFA 5DHMC 3UOAB 1DJIA 1MW3A 1A4JA 2WTPA 4F3FB 1DBAL 4FTVB 1AYRA 1T5XA 3PJLA 4PI0A 1U3NA 2CZNA 5HVWA 1MAKA 4ZFFB 4XX1G 3MJ8B 4G5ZL 4H4NA 4YC2C 3K8MA 2Z35A 4AM0Q 3TPUB 3U0PB 3UDWC 1TQBB 4FG6D 4DWHA 1AHMA 3VWJC 1O6SB 5B7EA 2YA0A 3GSQA 3W82A 2AQPA 2BIHA 1IARB 3NSYA 2X44D 3K5SA 4ZW5A 2NY5L 5FUCE 3QIUA 5FYLL 3MLPA 2QV4A 4GW1A 4JO8A 3VE0B 3R8BB 4F7CA 1IBBA 4KK9D 4YIQA 1DQLL 3CX5K 4WNQB 1C7TA 2GFBB 4MWFB 5AKTA 4GKZB 4M7KL 1QACA 1P7BA 5T1KD 3GIZH 1QRNE 3NFPA 5DEGA 4JZJC 2HG5B 3F2LA 1QW9A 2IWEA 3T1FA 2K0RA 3AS3A 1CLZL 1XZ0B 4AL8L 3OKEA 1KBGL 4Y5YC 3VWKD 4Z7QF 3I50H 5JZ7D 3SDDD 5I1AB 3SDXB 2NX5E 2ORBH 4MQ7B 5BRZB 5IWLA 1P7HL 3LHAA 1NGWB 4OI7A 3NCYS 3CQQA 2D31A 2AJVL 2CHDA 3WXVH 4AYSA 3MRMB 1FPTH 1AGFA 4KDTA 1CUOA 4PHXA 2IGTA 4MB3A 1F56A 4RZCA 3IFNH 1LO4L 3QJZA 5LAPA 5AYTA 2FBJH 2OYMA 3SZ6A 3GRBA 1G9NH 2Z31A 5CP3H 2IDUA 1AACA 1YN6A 3F01A 1N19A 1C08A 3VI4E 2PWGA 4QLRA 3ZBMA 3DX3A 4FNUA 4YSSA 5JTWA 5F3HA 1AGEA 3EOAA 3IPBA 4OFQA 4ICXA 4LLUB 2O61A 4XVOA 5IW1B 3VD0A 1BOGB 3D18B 2GG1A 4XMKH 1EERB 1KLFB 1G5AA 3QUKB 5JW3L 1PIGA 5AZ2L 4OU3A 4KX9A 1X7QA 1XGTB 3WXWL 1G9MC 4TVPD 1PD1A 2YPLE 1FO0L 1PLBA 2BC4B 3F58H 3NUKA 3T0AA 4E9LA 2DJ4A 4JG5A 1K8IB 4OAWA 2APTA 1B9KA 3DMMC 1BZ7B 1C1EL 1JWSA 1SQMA 3DX0A 3RB7A 5JXAH 1HHHA 3VGFA 5AVYB 1BZ9B 1X6LA 4U0RC 3HAEA 2I9LB 1DQVA 1JZGA 3DJTA 3QHFL 5H8DA 1E2VA 5CM1A 3BESR 5IEHB 3QXWA 2YPLD 2E9GA 3O4OB 3OR7B 3K4AA 4GG8A 5KN5A 3BMWA 4BWWA 2UUDK 4QRSA 2LU5A 3SE9H 5I75C 1AD9B 2NY5C 3IJ8A 3QUXB 5E2VL 2A6KA 2QDVA 3APNA 2ED8A 3AREB 3VXME 4HP5A 1D6EA 5EZIH 4DN3H 3FFCE 5EN2B 1KENL 2Y6SC 2RHEA 5FEBA 4JKLA 4OLYL 4PD4J 5C8JA 3UPRA 4P59L 3RPIA 4R84A 1DE4B 4FNLL 1UXWB 2YFOA 5EUOA 2CH8A 2LFGA 3GJEB 3I6KA 3LZNA 1BVLA 3SO5A 3ZKSD 2ZOLA 4M56A 4YL9A 3HNVL 2XA3A 3QEQE 4R8WH 1TZHB 5HDBB 1JI1A 1XGZA 4YDLC 4LOUD 1WA0X 1KIPA 2VITA 3HC3H 2LVCA 4PWJA 1E7UA 2I7OA 3SPVB 2WLIB 3ZTEA 1CFMA 4XPAH 5EDSA 4Q6IC 5LGHH 1OEZW 2VZOA 5DEFB 1U3HC 3O3DA 1R4XA 2IDTA 5EBMB 1IILE 1V3MA 1HQ4A 2TRYA 2FE0A 1Z0MA 5ISZA 3BH8B 1PAMA 3QEQD 1SOQA 5BVJB 5KW9H 4GP8B 3HI6H 3SGDH 3S97C 4Z23A 2O5XH 1BX2A 3WNKA 1ZGLP 4J2QA 1JERA 1EO5A 1B0RA 1QZNA 3MACH 4GRMA 2DI9A 3QDME 3FTGA 4TNVK 4AGPA 4EN3C 3WFBL 3GSNL 3WNNA 5J57B 4X2UA 2DLIA 1MSPA 3SCMB 4S0SD 4EUPA 3MTRA 1HI6B 4OLVL 4LASL 3T6VA 2W9DH 4NQEB 4WI0B 4N2MA 3NJJA 3DX4A 4O9HH 3UPAA 3G9AB 3B2DC 4Z5RA 5HJ3B 1KT2A 2KPWA 3GBLA 4PGBA 1CL7L 1MLCA 1NEZG 1C5CH 4BM7A 1RERA 3MRJB 2ERJC 2ATPB 4OR1A 5E95B 1EWHA 3L4CA 1XGQB 3MO1B 1JZHA 1NQBA 2K8QA 3OGOE 5DUBA 3V8CA 5IKCB 4LVHC 1VRSA 2X2YA 4G70B 5SWZE 2BSRB 1Z1WA 2OMYB 3R4DA 4UV7H 3RVWD 2VDQL 4X83A 3RWGB 1OP3K 2I69A 4HS3B 1TTGA 1YPZA 4G1MB 4OBSA 4UMSA 5BXFA 4FFZH 4HEME 3L5JA 4EUPH 1JZ6A 1KYOJ 2OJ1A 3CZFA 3DX7A 2CE6A 3PWVA 2PYEB 3C6LD 4PJ5B 2IALB 3U4EA 3PNWB 2JKNA 1CZ8L 2WLNA 5C0RH 5J8OA 5H94B 4YAQA 4BQ8A 3P4OB 3MLXH 4WCYH 4MJ6B 1NH6A 2C7UA 2NYYD 2VJ8A 3CDYA 5J6SA 4JPWL 2FO1A 3DPBA 1EPFA 4DVBA 1HKLH 2VW7A 1MHHB 5GGVH 4FG6C 1UOKA 1GH7A 2AV7A 4S1QH 1XR9A 3Q5TA 4PSPA 4TSCL 2J6EL 4NAQA 1D7CA 1QAWA 3V0HA 2E46A 3MXWH 4AX3A 4DP4X 3QORA 5DO2D 3C9NA 4L2LA 4BSJA 2VRKA 5ICZA 2QKIC 1E8YA 3KPRA 3KW7A 4KK9C 1CFTA 1WWBX 3KBHE 3OJDA 2ZQKA 2X6AA 3DVGA 4ODXA 3VCLA 3BPLC 2HJFA 1QFUH 4QOKA 3HBQA 3D4GA 1TNNA 2IAMA 2B4CL 3HHMA 5FYJU 4ONHB 4RNRA 4GXFA 1QWUA 4Z7QE 3W38A 4Y1AB 1I31A 1KGWA 4BH8A 1E3ZA 6FABL 2W0FB 3HTLX 2XTJB 3UJJL 3VWKC 2X12A 5IR1B 4XNQA 4G5ZH 4A2HA 5DJYA 1FHGA 2DL2A 1MRFL 5IUCA 3HG4A 2M8XA 4HIHA 4B3EA 2BFGA 1OXYA 3GHEL 5DWPA 4QRPE 2QQQA 2ZPKL 1LQSR 4QF1B 3OKNB 1OF0A 2RTTA 2OMNA 5FYLH 1QR1A 5LG6A 2IG2H 5HI3C 6PCYA 2VM3A 5BW7C 1DQLH 3BAYA 3Q8CA 3DHMA 2CIIB 3ZKMC 1MW1A 1YMHB 4JY6A 3G08A 1JHLL 3V4UH 3HRZC 4UIMB 1ZWIB 3QFJD 3IFLH 2YRLA 3E2HC 4NBYB 4L18A 4M7KH 3MU3A 2QLYA 2MNJB 2Z0UA 2PPDA 3LKPB 5F9OL 4MJHA 4MBRA 4PV1C 4WU7B 4UTBL 4BQCA 2OR8A 4AL8H 1NFDB 2WKOF 3LXAA 1IO4C 2HAZA 3GMLA 3FQUA 4FKKA 1S9XA 4KFZC 2G2RB 4A2FA 3BVDB 1MW2A 3BIAX 4TQ8A 3ORJA 2AEWA 2XSKA 3MLWL 2IANA 4ZFGH 2IADB 1ZT1A 2WQRA 4DUWA 1FO0A 4LIQE 1XH1A 3AU1A 1N7ML 2OMZA 3DIFA 5ESAB 2PTTB 4ELMF 1H0DB 1OCWH 5C71A 3UAEA 3WKPA 5DMYA 3O3UN 2GC7C 3QC5X 1W80A 3STZB 5J11C 3VJ6A 3W1ZA 1KGXA 2GJPA 5T1MA 5CEXB 3PJSA 2X42A 4RAUA 3FQRA 1KCKA 3RWDA 3DO4A 3SJVB 4NSKB 5CD3B 4NN5B 4N1CA 4UYPA 1AANA 1N12A 3UBXB 1TJGL 5JW3H 1AXSA 5FYKH 5EHFA 5AZ2H 1TOXA 3WXWH 3R0NA 3FO0H 2CXGA 3TEYA 1IAOA 3OXSB 4LOVA 3UG3A 4EDXB 1FO0H 1OPGL 1BDYA 1ZT7B 4NC1E 3ZUNC 5FM8A 4L8CB 3FH8A 4HKXB 2E9JA 4PEEA 1FQ9C 4AC4A 5JHDB 3GLAA 3LPWA 2ZUVA 1JGDB 5F0JB 2F7PA 4RQQA 4WWID 4FA7B 1C1EH 5DMJB 3T3PF 5MP6L 2OS7A 5HTSA 3B3IB 5GGVY 3NJNA 3QHFH 4M8QA 3SBWC 3FOMB 3FRUB 5ESQA 5AW8B 2ITEA 3CFMA 2J8UB 2NY2B 3C6EA 3MRFA 4MJ2A 3B9VA 4PRHB 1HHKB 4W6WB 4YOKA 5GPRA 3S37X 3RY6A 2CBTA 4NYLA 2YFNA 3H56A 5D6CA 3VXOA 3FTXA 4N5UA 5T1KA 4MZ2A 2QR0A 3B9AA 1KENH 2MWCA 5IQ9B 4E0RB 3HEIB 4WUUE 1VEMA 2DWSA 4OLYH 3CX2A 4P59H 5INCB 1CLYL 3L9RB 4OI9A 3X14A 1S5HA 3GSUA 1CR9H 3IMUA 2R1YA 1IQDB 3SDDA 4Z95L 4X6CF 3ZO9A 2NW2B 5DS8A 1AGCA 2VXUL 3HNVH 2YD8A 2ZAIA 5DDHA 2F53E 3FBKA 4PP2B 3BEWA 3GSNA 5HJGA 4G9DB 4F24A 1JWMB 2GK0B 2V5TA 2Y2TA 3CSPA 3AS2A 3II1A 3PABA 4JFPB 5DEZA 1QRNA 4Z3EA 4WHYG 4XHJC 3VRJA 1LEGB 1B4TA 2J12B 5ILTH 2ZG1A 3TBWA 5F6HJ 4NUQA 4GP4B 4X80L 2HJKB 2NX5A 3UZQB 3MPCA 2D4FA 3VFOB 2P5WB 3UBHA 1KPUB 4P2QE 2EE2A 2VZTA 4U3CA 1CS6A 2F53D 4M1DH 3G5YB 3RVWC 2LABA 2YGNA 4XT1C 1M7UA 1K4DA 5KG9B 3L4WA 1JV5B 3NBNA 3S5LB 1QBAA 1J5HA 4DHLA 3P2TA 1A4BA 1DJXA 3WFBH 2G75B 4F93B 3AGVA 1R3KA 1WH0A 2VN4A 3C6LC 5F9JA 1NOAA 3V0JA 5BZWB 5IK3B 3CHOA 3E8VA 5CJOL 4C83A 1I7ZB 4OLVH 4N2LA 4LASH 4P2QD 3VI4A 2NYYC 2I32A 4DPRA 5F2FA 1WV7T 3MUHL 5I9QC 4JKMA 3RIFK 1LNUA 3DHJA 3ABZA 4HC1H 2HP4A 2NSQA 3IS0X 3RWEB 5IIEB 1CL7H 3HE6B 4JRWA 4DQOH 2ZNWA 1WITA 3PHOB 1S5IL 3QUYA 4C4KT 4HETA 4NUGH 2Y2YA 5DO2C 2BHFA 2PPFA 2YPLA 2HX9A 8PAZA 3UYPA 4EZKA 1HHJA 4LIQL 1H8SA 3KCPA 3PCYA 4YSOA 1M6OA 3D85B 2VDQH 2J6EA 1MJJA 4YSRA 1TQTA 4U2YA 3D6GA 1SVBA 4MCYB 3VFSA 4ZYKB 4C58B 3ARDA 2YPKA 3M46A 2JKWA 5SWQB 1XB3A 1FWXA 1Q9KB 2G0KA 4N0UE 3GTVA 2F15A 2PR9A 4FNQA 3W5NA 2NNFA 1CZ8H 3DURB 2KDYA 1XMEB 1HNFA 5CLZA 3V4VB 1AVAA 4WEBH 2YEZA 4ZRGA 4Y7OC 1I8AA 1JG9A 1NIFA 4JPWH 5F7UA 5KBPA 3UTPE 5IOPB 1G7MA 2Q7YA 4JN2B 4N0YL 4TQEL 3VXMA 5ACZA 1R3LA 4ZD3L 3FFCA 2NNRA 3FTZA 3MRKB 3TH3T 4N4YB 4X4YA 4TSCH 2J6EH 3TT1L 3LS5L 3OSVA 3NRFA 4GUCA 4N20A 3CFBA 4R90H 3UAFA 4G7VL 4Z76B 1CXIA 4GUPA 3QEUA 4FAAB 1KCUH 3QEQA 3VQ1C 3ZDYF 1EXUA 4CW1B 1B4LA 5AW5B 5E7FA 1KPVB 2G9HB 4G5AA 2PYFA 3OLIA 3QVAA 5B1JA 1F8TL 3L5WB 5FB8B 6FABH 1ROCA 5E6IB 3WV0A 1E43A 2AAVA 2QZQA 3UJJH 4AGQA 4R9HA 4N8PA 3EDEA 1HSAB 1WT5C 4M61A 4MGXA 5GGSB 4UTBA 1UB6B 5E9NA 3PDOA 2ZYRA 3GHEH 5DD6B 1EO7A 2V3EA 2ZPKH 4OCSH 4U1HA 4UTAL 2XWEA 3QDMA 4ELME 3BZ4A 2D2CC 2WQXA 5EC2A 4MA3A 4JFOA 4U1NB 1XT5A 1MELA 4FJYA 5BZDA 2C3VA 4QHKI 2WSDA 1JHLH 2GJ6E 1XF3A 1I9RH 3SE3A 3EG9A 1CCZA 3MRDA 3MLTA 2W81C 2OI9B 4JHVA 1BFVL 2X1PA 5F9OH 4A2MA 1Q90A 1L5GA 2Q10A 1O9ZA 1T2QL 3CDZA 3C2SA 4UTBH 4AQAA 4LQ1A 3ROOA 4ATWA 5DRZB 4AKOA 2PLTA 4WTXA 3MRHB 3BYYA 1W72L 3CU7A 5SWZA 2GJ6D 1MZYA 3ZHLA 3SGKC 3U48A 1A02N 2HLAB 3T3PE 3MLWH 4ZX4A 4HEMA 4PREB 1OK8A 3OV6A 1FFPB 1R3JB 3K2MC 5AL8A 3P40A 1N7MH 4BHUI 5DSCA 3CK0H 1A7NL 4Z7VB 3N42F 3V6FA 1IBGL 4YO0B 1DQQA 3AZUA 1HSBA 5C09E 4AZ8A 1JGEB 5H2BA 3BD5A 5IZ7A 4UQ2B 3GNML 1QYGH 3VFTA 2MQ0A 2NNAA 2OMXB 3BP6B 2AK1L 2Y7SA 1BVZA 3F7YA 4ZMLA 3H7LA 3KPSB 2CJUH 3APFA 4IIQB 3ZW3A 1WC7B 4UIKL 1AZRA 1WBXB 3QXAB 4PIRF 1IGYB 2QQLL 2D2OA 2WYZA 3QNXA 5FW6A 4IGBD 5IHWA 1A47A 1TJGH 2EP6A 3PPSA 1YEIL 3QXVA 4X6CE 2WNKA 2OAAA 3Q0HA 2MSPA 1L9QA 1LTXA 1QPPA 3FO1B 4X4XA 3WTTA 3G04B 4CN6A 4RGOL 4HJGB 3L7EB 2OMTB 3WHXA 3JT0A 2FIKA 2ZOKA 5IBLD 3ATAA 1KCRL 5MP6H 2PCFA 5JR1L 4QI3A 5F7YC 1XHHA 3VFNA 1C16A 4HVBA 4ZMQA 1YNTB 3V6OC 5DZLA 4K23L 3ESUF 1BQKA 5I30L 1ORQA 2HPOA 4AWJC 1KXVC 3AGWA 1BP3B 2OL3L 4DP9X 3LMJH 2BCKA 3C09B 1T1WB 5E2UH 4Z0XB 2R8SH 1SY6L 4QRPA 1ZV2A 2FGWH 2R2HA 4KWUA 3ARZA 4W9KC 1A4JB 1KIRA 3O3AA 2AF2A 3FFOA 4JFEE 1T5XB 2AEOA 4GSDL 4N6QA 2IF7A 5DYFA 4R0LC 5FF6A 1CDUA 1T2JA 2Z35B 4KK8C 3PGFL 4Z95H 3WNLA 1H3TA 1HNGA 5IJVA 2YXWA 5EF0A 5BUGA 3H4HA 1YEHH 3GSQB 2YAOA 3AABA 3TJPA 3QIUB 4XXCA 4JFED 4KROD 1UD6A 4GW1B 4LCWD 1E27A 4XE0A 4WO4D 5GGQH 2Q76A 5T1LA 4F7CB 1EHXA 3WY4A 2Z7ZA 4YIQB 3U1PA 5C0IA 2UXGA 2F54E 4X80H 4TSBL 2GIYA 5GQBA 5D72L 4Y2LA 2XV0A 4BZ1L 2YZ8A 4MB4A 1KDIA 2CR0A 3QUZC 3FSWA 1AH1A 4TUOA 4HIEA 2WXRA 3NFPB 2R69A 4U3XA 4L4VE 4UI2A 5DEGB 3T1FB 1UWGL 2R2EA 3BQUD 3OKEB 4AG4H 4LSSH 3VSQA 4M93C 1NCBL 1N70A 1O9VA 4ELKA 5CJOH 1PGRB 2JB6A 2G5BA 4P23D 3VMOA 3BH4A 2VDML 2D31B 3IDMA 2JJTA 2XXGA 3VSTA 1MJUL 4DK5A 1KJ2L 2W60A 2FT6A 5IESL 1AGFB 4XMLL 3BUDA 4RZCB 2XTLA 1OWRM 1WBYA 1YCSA 4V1DD 4M48L 1J10A 5D1QC 2R69H 1F13A 1T0MA 1WD9A 2Z31B 1YN6B 4RGMC 1C08B 3GZQA 2B59A 4LIQH 1D9KD 1KGIA 2VDLL 3P4NA 1G9EA 3I3BA 3MV7E 5G4NA 5F3HB 1AGEB 1AJ7L 3EOAB 5GGRY 3ZDYE 1IM3A 5JOFB 2A1WH 1UTDA 2EDNA 2XU9A 2O61B 1YC8A 2TRHA 4BKLA 1UA3A 3EO9H 5J06A 1SPDA 5C2BL 5JUEH 3G5WA 1X7QB 1HEJC 3TU6A 1AGBA 1BXVA 1HH6A 2VUOA 1WQVT 1AG6A 3JTSA 4U2ZA 1FE8L 2GTQA 2W91A 1B2WL 3N04A 2Q8BL 2BNQE 4EBQH 3BDYL 2IFFL 2JI3A 4RFOH 4XBPA 2X0UA 4OAWB 1LO3L 3T09A 1JWSB 4N0YH 4AW7A 3KZ8A 1HHHB 4XPAL 5DK3A 4ZD3H 5AVZB 2F1BA 4ZUWA 3ULUF 1IRAY 3TJHD 3HAEB 4WUUA 2WXPA 3TT1H 4LVEA 3LS5H 5HDLA 2AQ1A 4NLHA 1KV3A 4GG8B 5KN5B 1BFOA 4QRSB 4WKZA 3OQ3B 4G7VH 4OCXL 2FWUA 3KR3L 2A6KB 3ZMNA 4PAZA 4ABWA 2F53A 3AQZA 3EOYG 1D6EB 3VDCA 2ROYA 3TNNA 4GKSA 4GO8A 2WQVA 5L8JB 2HTKC 4G7SB 5D70H 3B7RL 5TQ0L 5C8JB 3OXRA 3UPRB 3RPIB 1F8TH 4HG4K 5EUOB 4PRPD 3GLDA 1DBKL 2DH2A 3I6KB 3K0WA 3O8XC 4ZS7L 1PCSA 1BVLB 3OR6A 4P4KD 3LD8C 2ZOLB 4U6TA 4YNYA 2HVBA 4XCYA 5C1MB 2MOGA 3MUZ1 4DTGL 3RKDD 4P2QA 2OPCA 3G3LA 3KPLB 4KQ0A 3O11A 3Q44A 5I5JA 3F7PC 1KIPB 3WSQL 4JY4A 4EKJA 3SEPA 1W72A 3L3HA 5C3TA 3QZOA 4JMNA 2ZCHH 4GPVA 5I8KL 5ICUA 1A1NA 1AAJA 1ROWA 1RU9H 3O3DB 3OF6D 4MA8L 4NKOA 4P46C 2ESVE 5EU6E 1NCNA 2ZUQC 1HQ4B 3WDHA 1GGCH 3GUTA 4FTDA 4YGVA 5I6XC 5ISZB 3FJTA 4FHJA 2HKHL 4NBZB 5DJZA 1ZV5A 1EHNA 1HTYA 2E6PA 1BQHA 1BX2B 2BHZA 1B0RB 4PBDA 4GRMB 1CQYA 1DFBL 2X6BA 1T2QH 1X5ZA 2WWMD 3FTGB 5C0DA 4RX4D 3U46A 1MREL 4FHKA 4J1UA 4QR7A 3MBWA 4D9LL 3NCMA 2FYVA 4EUPB 3O6LL 1TZGL 1A8ZA 3NCXA 4O2EA 5GHWL 1OQXA 1YYCA 1G7JA 2WHVA 3HPLA 2XT1B 4Z5RB 2W8CA 2FEJA 1KT2B 4PGBB 1VJSA 1FN4A 1MLCB 5CJXA 3MBXL 4HUXB 1CFNA 2VXTH 3O3EA 2FJSA 4N0UA 5K69A 1A7NH 3PNRB 2Z4TA 5DUBB 2ZUTA 1MCQA 2FO4A 4WFHD 3BPOB 2DTMH 1DVYA 4P9HL 3K5RA 3ML9A 2DMKA 1NBVL 3D06A 2AK1H 1YPZB 5BXFB 4IBTA 2K3HA 1EGJL 5E1GA 4GMSH 3CZFB 4IKIA 3DX7B 4WV1C 3PWVB 4OCWL 1OW0A 3U4EB 2UXFA 3SDCD 2FR4A 2WNGA 1YEIH 2DLGA 4YAQB 3IDGA 3T0WA 1SY6A 2C7UB 1TDQA 2YMOA 5LVEA 1CFBA 2IIJA 3DPBB 4DVBB 1JXFA 2R83A 4RGOH 5CBEA 1FAIH 5FM5M 4EJ1C 4FYSA 4JL1A 3AB0C 3HNSL 2XA8L 4AGMA 4F8LA 2AV7B 3LIZL 4R5TA 3UCRA 1XR9B 2QELA 1E2WA 5JR1H 2WKOA 4G7QB 5CO1A 3QORB 5JIIA 3C9NB 4YDIL 4KROC 4K23H 5ICZB 4ZTPL 4FQJL 3KPRB 4WO4C 1MWAL 2JCWA 5JPNC 3LXUX 3UJIL 1CFTB 3QI9D 3CU1A 2LHAA 2YEQA 3OJDB 1M3JA 5JOPE 5I30H 3DVGB 3VCLB 5DU7A 5G2NA 4I87A 2HJFB 2Q7AA 4G6KL 4QOKB 5CSZA 4HHGA 1FUNA 1JNJA 2RH0A 2AXWA 4KKLD 2IAMB 5L4FA 1SY6H 4IOSA 3W0WE 1XVSA 3KXFE 4RNRB 1BYPA 1ACXA 2DQMA 5DVLA 2APVA 2VABA 5FGRA 4BZ1A 4BH8B 4ELMA 1XSKA 5EOQL 1KELL 4L4JA 3I85A 2HLFD 2ITDA 4GSDH 4GIPD 4P05A 4WW2F 4XNQB 4HWNA 3AQYA 5F70A 5DJYB 5HDOA 5FLVA 2GJ6A 2XXCB 4P23C 1AQKL 3SGEI 4HIHB 1GVIA 3NTCL 2LR4A 4GKOA 4QTFA 1QR1B 4GRLC 5AOMA 5LWYL 4QMEA 3V7MA 1IAKA 2QHRH 1KJ2A 1RJCA 5DO8A 4JFDD 3BVXA 4TSBH 1KWKA 4JY6B 3G08B 5D72H 5B39G 4BZ1H 1D9KC 4JO5A 3SPGA 1GGIL 1PG7X 1BVKA 3HB3D 4L1SA 4ODBD 3T77A 1ZLUK 1A14L 2Z8RA 3VMPA 4C8XA 2VJ0A 2XKSA 2DQUL 1PQZA 1XH3A 3GLEA 4K73A 3GMLB 3SE4C 3FQUB 1NCBH 1S9XB 1CGSH 4MCNA 4W6YB 5C09A 2MQGA 2IWKA 3B9EA 4PU2A 1ZSHA 1AY1L 1NSNH 2DJMA 3QG6A 4YHIA 4CC4C 1KNOA 3FUFA 1PNCA 2IANB 3M1CA 1XFPA 5IW3A 5IESH 2GEEA 3ULUE 1ZT1B 4XMLH 4NN6B 1FO0B 3FW6A 3AU1B 2OMZB 3L5XL 3DIFB 4GAFB 3FH5A 3SQOH 1AI1L 4K3GA 5HD8D 4YHZL 1T0OA 4X6CA 4XNAA 3VJ6B 1VERA 4K71B 1IAIM 4FLHA 4P8QA 5K33A 3PJSB 4RAUB 5T1MB 2AXFA 2DQ6A 3BX7C 2VDLH 3HZ3A 3FQRB 5LO7A 1LILA 4WJ5A 3RWDB 1CLOL 1IIKA 3HFML 1XCTA 4R7DA 4Y16C 4OGZA 4B0MM 2AKRA 1XXFC 2C9VA 2VWEC 4LHUG 5J0BA 1HWWA 1KGJA 5C2BH 4XC1L 4AMKH 1IAOB 4JR9L 3U9PH 4A7GF 1FE8H 1B2WH 4E9RA 2CWRA 3WFEL 3BDYH 1XD0A 4Z77A 4OZFG 1X7TA 2IFFH 1QUPA 3S4SG 4S1DC 3ZZQA 2VSMB 4ZJ9A 3NIGF 4RQQB 4TLUA 3OKYA 2O4EA 2CPUA 3S8FB 4M8QB 4JFEA 4AYDC 5ESQB 3DGCR 2YD6A 4RMRA 4X98A 5I1IL 3MRFB 4D3CL 1LO2H 4OD1H 5ELI