4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
2GG1A 4FG0A 4UT9A 5LBVA 2I69A 3P54A 2V33A 2JV6A 4UTBA 4AL8C 3J2PA 3UZQB 1RERA 1OANA 2HG0A 2JQMA 5IZ7A 5H37A 5KVFE 3I50E 4GT0A 3N43F 5KVDE 4GSXA 5LCVA 5IREA 3UZEC 4X42A 1OKEA 4FFZA 5KVEE 5AAMC 1TG8A 4UTCA 3N41F 4UT6A 3N40F 3MUUA 5AAWC 1Z3RA 5GZNA 2P5PA 4BZ1A 3N42F 5KVGE 2JSFA 5JHLA 1OK8A 4UTAA 3WE1A 3IRCA 1S6NA 4FFYA 3G7TA 3UZVA 4BZ2A 3VTTA 3UYPB 5B1CA 3C6EA 2R69A 1URZA 1ZTXE 1UZGA 2R29A 2H0PA 3UAJA 4ALAC 5JHMA 3UC0A 5LBSA 4L5FE 3J27A 1Z66A 3N44F 1PJWA 4AM0Q 3C5XA 1SVBA 5GZOA 2ALAA
chains in the Genus database with same CATH superfamily
3B1TA 2W95A 5F0PB 4P2RD 1MPAH 4G1MB 4G9FD 1KENH 1P84K 2BVYA 3FQRA 5CSBA 3C6LB 1O9VA 3O2WH 3DJRA 4GRWH 4PG9B 3CU7A 4GQ9L 5KYUB 1KACB 3CXDL 4KH9A 4G8GE 3V4PL 1KPVA 2QT6A 5DMJB 5BS0B 5JXED 1KGIA 3O3EA 4MNGE 3DVGA 2NNAA 5LB1A 4K4KA 1JGDA 3L5XL 4LHUA 4HIJB 1RIHH 3UPAA 1X4ZA 3U25A 2FQGA 3UTZB 2MH4A 5I30H 4PLKD 2CA3A 5FS5A 3U6XA 4JM0A 2ZWYA 4S1QL 1UH3A 2LW5A 4RAVB 1SBSL 3IFOB 3LS5H 1DQDL 4XX1E 1J5OH 1MIMH 1OAKH 2F7RA 2V5YA 2CJUH 3L1GA 1LP9B 4ZSOE 3ZQXA 1A3LL 1DP0A 1TZGH 1FAIH 3SDXF 1MCWM 1HCZA 1A6TA 2YBGA 3DLQR 4LSUL 1FYTE 1F4HA 2NQDA 1RZGA 3PREA 4NYLA 4X6DA 5GS0H 4FNQA 1SHWA 4YJZL 4PW3A 4NNXA 4JFXB 2YQGA 5E6UB 3O3AB 2CXGA 4GBXB 2FH8A 4XH2A 5DHYB 1YEFH 3FN0L 1IAIH 4MCYA 1HESA 5H37G 4JM2D 1OTTD 3MRFA 2QTEA 1FO0B 3FO0H 1LILA 2X4OB 3NSYA 3PNWA 4F9PA 3F7RA 1TNMA 2WMPA 4Z7WF 4BQCA 3AXHA 2AAAA 2Y22A 3K0YA 4X98B 5BPPA 3OHXC 2XWZA 3LYRA 3RB5A 3Q1SL 5HHQB 3EYSH 1HHIB 2BNQB 3SE4C 3X3GH 1E8WA 4J4PD 3MHZA 1H5BA 3AXLB 3QWRA 2NY0C 3IGLA 4FGMA 5D1XA 1SHSA 2R56H 5B1BB 4JFWA 2AABL 1YAIA 3UGEA 2ROXA 3JZ7A 8FABA 1CQKA 5ICYA 4WTZA 5D1XE 1U6AH 5T1MA 3ULVF 1JNLL 5KJ7E 2ZXQA 3WENA 2YUVA 5JOPE 3OMAB 1K3IA 1F02I 3QDGD 1EBPA 2H1LM 4J8RA 3HKFA 2ERJC 3L4VA 3NZHL 3EG9A 2Y6SC 3CH1A 5FYKL 2K7PA 2Z31C 4AMKL 3CGTA 1JWUA 5F1IA 1S7TA 1EAJA 3JWDL 3GUTA 1H3PH 1O5PA 4L23A 2X12A 3K74B 4JFPB 3D7PA 2BHYA 3WKMH 5BZDB 4JPWH 2V3EA 4FZ8L 1FLRL 4Q0XL 4EF3A 1S78D 3AAZA 3PHOA 4Z7UA 5C0CB 1DN2A 2W0FA 2VDLL 3REVA 3B2VL 1NCWH 4Z7UE 3EHBD 3S3CB 2OK0L 1INEH 4XHJD 4BJLA 2F7IA 4FCAA 2DKSA 4HZLB 4RWYL 3L5HA 3L2MA 1R0AH 4YUEL 1HOCA 3OMZA 4WFED 3ABMB 5T1KB 4B7IA 4KX7A 2ICWI 3VFWA 2EEXA 4NJ9L 1DLFH 4IIQB 1MJJB 4G1EA 1WS7A 3BSZA 4YSUA 3OLDA 2DWDA 4J1UB 1CBVH 4M1CD 3P9WB 2ZOOA 3P3RA 5T1LA 1VKXB 5EIIA 3EOBB 4HJ0D 5DTFA 2WHVA 1RUQH 2YOCA 4X6CB 1H9DA 4MB4A 2XN9B 3BVNA 1WAAA 3IKKA 1RUPH 2CIKA 1A4JA 2BFVL 2E74C 3GB7B 3IMSA 1F8TH 2FQDA 1WSST 1T6WA 2YSSB 4K7PH 3UP6A 5C0IB 1I7TA 3UBXA 4KXAA 5CEYA 1MHHB 1UB5A 2VDRH 2W9DH 3APMA 4GQPH 4I9WE 4UDTB 4L8SA 4M8VA 3VFMB 4HCRH 3N40P 2Z3FA 3S35H 1BVNP 4X9FA 1BWWA 4OZHF 5I71B 1ETA1 1P0SE 5K33A 3OQRA 4MQ7A 4ADJA 4DVBA 1Q0YL 3I02A 4NHCH 2WXRA 2ESVA 2BY1A 1XAKA 3MRIB 5HI5D 4D9QE 1XTMA 1YC7A 1GC1C 4AIEA 5I1KH 2FBJH 4HGKC 3JQOB 4YDLC 3CSBA 3KPNA 3QUXC 4X8JB 4AX3A 4FF9A 3OKOB 4QY8B 2FX8H 4LCYA 4P23C 1NGXA 3EZJB 4FFYA 1J9RA 4X0NA 3QUYD 4XBEH 4M5ZH 4YHLH 5GRXG 4D0BA 2J5LB 3BQUA 1IGTA 1AGEB 2NUTB 5HHVL 1EWHA 4KI5D 4RFNC 4UINH 4JFYA 4B41A 1FORH 4X6EA 5DR5L 4U1MA 1RCYA 3NZ8A 4XBMA 3W57A 4KJPD 2GTZA 4ICXA 5JNYA 4MJ5B 2ZX8A 4Y4HC 2F54E 1UM4H 2VZ1A 2TSAA 2WW8A 4UTBH 3FUJA 5A6LA 3HMXA 4K3HA 3EOTL 3Q6FA 4K7FB 5DF0A 4LESA 2Y36L 4W81A 2V8MA 3QEQB 5CZRA 2XV3A 5AKSA 4GJTB 5LLIC 4TUJB 3M1OA 4X8CA 4XP1L 5FW7A 3IFLL 2WQXA 4P8QA 3TIEA 2GBUA 4R7NB 4MMZA 3EDEA 4Y1TA 3SPVB 4X6FB 3O2DL 2QSCH 3RL2A 4DKAA 1T2XA 1HH6B 4ONHA 2FO4A 2AQSA 2IXQA 3GEWB 4M5YL 3T4AC 1NEZA 2SEBA 3ELQA 3IDNB 4PGBB 4PJ8B 1LNUA 5CILH 3D06A 2I5YH 1NGPL 4KHTH 2YD8A 4YNYA 1XMEB 1HAWA 4MFHA 4CC1A 1N59A 2YMOA 3U6RB 3IMTA 1OP5H 4HUUA 4JJ5B 2HLEB 4ZUSB 4XMKL 1ZGLB 3X1EA 4XWOC 1OB1B 4V1DD 2BS9A 2EICA 1AR1C 2H9GA 1EAOA 2VDNL 1U8MB 4IRJD 4WW1A 1M6OB 3UEZA 4IK7A 1DFXA 2BSRB 4PJ7B 2PWDA 2QMKA 1EXUB 2B1AH 4WWPA 2B2XL 4X42A 3ARSA 4GEJA 2CO2A 2HJKB 4HIXL 1U3YA 1KLUB 4K5MA 4UIKH 5HJGA 1ZK5A 4A2GA 4AQ8A 2YAOA 3AG1B 4X8XA 3POCA 3MV8B 2DD8L 4O2EB 1J05A 2K7QA 1ITBB 1K4DB 4FKHA 3T71A 1QSFD 1BYPA 3ESVF 3UP1A 3GMOA 3EFDL 1P7QA 5E6RB 1Y07A 3FRUA 4JAMB 5F7LB 3UYRH 1FN4A 3L3DA 2UV3A 4RESB 3ULUE 4R83A 3EO9L 2DEWX 4N2MA 2B5IB 4X6DF 4GUQA 4H8UA 3T3MF 3DO3A 4RSYA 1JGVH 1KXTA 3VGAB 3T6ZA 4ZX4A 1GYCA 1JWMB 3GI9H 4OFKA 5AZEL 3V4VH 3WGUB 3LXAA 5DFAA 3VXRD 1KT2A 3BAXA 3FQTB 3MLUL 4IBLT 4F15C 3LQAH 1NLDH 5F96H 2VLKD 4NWUL 1BYNA 2X41A 5CIPH 2GBAA 3DUUB 3BZ4B 3EYVB 4XTRD 5T3ZH 4LARH 3U6XS 4LLUB 4KJQD 4NUJB 1TFPA 5KVMC 3NIGE 2BLFA 4LFHD 4UQAA 4AI7A 1TXKA 3KW7A 1G84A 4GUPA 5DRZA 4HIIB 2JB6B 1J9SA 4ZNEA 4M6AA 4PGEB 2LFEA 5J12C 4AM0Q 4G6AC 2CLVA 2YRBA 4EN3C 4L5FL 2FLMA 1DQVA 3MCG1 2AEOA 4IOFC 5IQ7H 4CNIA 4XPAL 2AK4B 5DI8A 2P44B 1G9MC 4NI6A 3B9VA 2VR7A 1VENA 2GY7B 2AXWA 2PMZA 4HVBA 3AQYA 4UIMB 5C0NC 3OG6B 3LKPA 4UZGA 3SO5A 3T0VA 3ABKB 4NRXA 3F7VA 5DQ9B 5D1QA 1ZT7B 4DUXA 4LAJH 2ZNWA 5GRJL 4F9LA 2D3LA 2V9UA 1QHPA 2F74B 1CI3M 5DZJA 3ULAB 4U1HA 4LL1A 1P5VB 2PETA 2R1YB 2VXUH 5FCUL 1EEZB 2Q3XA 3VWKA 5AW6B 5E8OB 4UM9D 3VXUA 4ABWA 4CDHA 1YMMD 3E3QE 3EJYD 1MFBH 5TQ0H 2D0FA 3M17A 1K2DA 1RJCA 4PUBH 3VGHA 1KCUL 3HB3D 3K6SB 3FC8A 5CLXA 2MCPL 4XPGL 5I66A 2WUCH 3F84A 1SY6H 2AQ1A 1N0LA 2UUDH 5A7EA 3VRLF 3TWCL 4MCMA 1UM6H 1HHHA 2X7LB 3D0AA 5INDA 4TVPD 1QEWA 3DSNA 3KXFD 1TSHA 1MCIA 4QHPA 2J72A 3ZL1A 1NDMB 4L8BB 1EZLA 4Y4KB 4W9HC 2X4NA 3SDAA 5BUPA 3KM1A 4Z7VF 1X5AA 3ISWA 4JO2L 1Y0LA 4WEEA 2JK5A 3G6JE 4KRLB 5TF1L 4GRLB 4PS4H 3SGJC 4S2SB 3S5ZA 1M9WA 4GO8A 4L1LA 1QFWH 4A7SA 4ZX6A 1WAAF 3NVQA 1L6ZA 2EYRA 2BSBA 4NKIL 8PAZA 3FO1B 2NDFA 4BQ8A 1UGNA 5IMMB 3BN9C 4N22A 3KBEA 1OK0A 4H26B 2X3CA 2ALWA 3S4SA 1ZT4B 2C7FA 2IWKA 3DGDA 3WE1A 5B39B 3GK8H 1U8NA 1R3HB 1YQVL 2XNAB 4PRHB 1KTJA 2PCPB 2CBQA 4N87A 1CFSB 1TPXB 5L2JB 1T04B 5I1JL 1CU4L 3G5VB 1B3IA 5D7JD 4X83A 4NO0A 2FSEB 4PJFE 2WPGA 4U4IA 2K3TA 1EQWA 4S1SL 2C34A 2F58H 1MFAL 1UWEH 3QYNA 3HUJF 2EECA 1PNDA 1NLBH 3SDDD 4OD2A 3D3VE 1P1ZA 4P2RA 1R33A 4XBPA 2C1OB 3CFBA 3H3KA 3RZCB 2QQKL 5L8KB 2FBOJ 5CN3A 2JKRM 2CGZA 3GKWL 4P2RE 1IM9D 3AABA 3T77B 5ABDE 1PY9A 2XZZA 4G9FE 4OLWH 4OCYH 1J1PH 2NTFB 4AGMA 3TZVD 4FYTA 4IYKA 4PI2A 4JCMA 4JRFA 3RA7H 4O5LL 3CFJA 5ITBL 1I8AA 1W91A 1CDUA 1A0QL 3QCVL 1HQRB 4KVCL 3ROOA 1AI1H 4U3SB 5B7FA 1KB3A 3MJ9A 4PG9A 5KSAB 4WGKA 5TFSH 3SDCD 4L4TB 4Z8FH 1ZLVK 4OVVA 5BS0A 1E4XL 2ITDB 4WWNA 5HDOA 1XO8A 2CJ3A 3CFQA 1UC6A 3NCWA 3TH3T 1JZIA 2YQ3A 2QMJA 3AY4C 1M7IA 4WFHD 3IDGA 1U8OA 3KWTA 3ZZLA 3LV3A 1A6UL 1UXLA 3WCYA 4XNDA 4QUOA 1OM3H 1LE5A 1EV2E 3QORD 5JMRA 4YFLI 3WTSA 2NY5L 2WLNA 3NIDF 4JE4B 1GYVA 1SBBA 1DQTA 3CBKB 2X0UA 4Z7NB 3F83A 5I8OH 1KCWA 5JR1H 4A7GA 4Z23A 3M6DA 3RU8H 5EDSA 1BXXA 5FO8B 1LD9A 4UQ3B 2FH6A 4JM2A 5A2FA 1ZANH 3CHOA 4PY8I 2QADD 3VGDA 1XF3B 1OF2B 3ARDD 5FKAB 4BDVB 3ECQA 1CGXA 2A83B 3FQWB 1OKEA 5KJRH 3DO4A 3L2LA 3L5WB 1Y6MR 4O51B 3VWJC 5DLMH 4BHUA 3A67H 4B5EA 1BPVA 4JFQA 3RFRA 5EBMB 1CTNA 1ZPUA 4O2CB 3QDMB 5AVWB 1FGVL 1QW9A 2ZSWA 1CGYA 5E08L 1DQQB 4NJAH 3GRGA 1UATA 5DZVA 1AC0A 3OHXB 4UT9H 2K4WA 4J3UA 4M5SA 5HYEA 4NWTL 1ZHKB 2Q8BL 4XZUA 2AJVH 1T7YA 4I88A 5G2NA 1HHIA 1KGYE 2AZUA 3LVEA 3V6OE 1YDPA 5EZLA 1CDHA 1DANU 2EZ0D 5IQNA 3DI3B 1G0DA 3JVGA 2PCFB 3CFCL 5BJTA 4DP0X 3IU3A 1S7SB 2UYLA 4LB8A 4XBGA 4APQB 5JPNA 4PP2A 1RK0A 2R69A 3QDGE 3ZYJA 5JHBA 1J8RA 4HWBA 4ZOCA 1WP6A 4QAWA 1GY1A 2KDYA 4H88H 5K9OA 3X1NA 5I15H 3C60C 4FQXA 5ESVA 4ALAC 3DYPA 1JPEA 1HKLH 1IC7L 1WBZB 2VISB 3GEFA 2Z31B 4XWGL 4QNPE 4Z7OB 1DN0B 2C9VA 2EXYC 2ZXCA 4JFVA 1JN6A 3DOIA 2CK2A 1GGIH 1KDJA 2YD9A 2ARJB 3EH1A 5HHOA 1WS8A 2FK9A 3OVUB 2D2CC 3S0PA 2PNDA 4JUSA 5DFTA 2DWSA 5L4IA 5CD3A 5CCKL 2QQQA 5I76A 5D4JA 2M83A 5DA4A 5KBNC 4WHCA 3C5ZB 5ERWB 4OGAC 2NZIA 4R90H 3G6AA 2VYRE 4WFEE 3BPLC 5I6PA 2GT9B 3RWGB 3GLEA 5F7NC 3ZTNH 2AEPH 3CC5B 4O9HH 5FPIA 1KY6A 2VN4A 1OHZA 3D05A 2EIDA 1NDGA 3N43B 4XXWA 3U9WA 1SEBB 1GVIA 1MJJA 4FD0A 2HTKC 3G5YB 1XF1A 1K8DA 1MFCH 2XG5B 3S98A 3JUYA 4J1UA 1BAFL 5FUZL 1XEUA 5BOZG 1UEMA 1AZVA 1WK0A 2WBXA 4FXLA 1UOVA 2J12B 4PVLA 2LTQB 5IY5B 2KZBA 1FLTX 3ATFA 3ULVD 2AQ2A 3BUIA 3NIFB 3D48R 3RRQA 1XIWD 1ES0B 1NIDA 1BQUA 2Y1ZA 4K73A 4NGHL 1I9RH 2OXHA 4M7KL 5HGHA 3JYCA 3L54A 2DEYX 1KCVH 4ODUA 3IAQA 4XNXL 2YUWA 1CWVA 2M2DA 4JRXB 1KFAH 3B6SA 2GEQA 4URTB 4C4UA 5LGKA 1SQMA 2KDGA 4GIAA 4NO3A 1TO4A 4OLUL 4A2HA 2X4SB 1HCVA 3AT9A 4NQVB 1II4E 3IPEA 4FLSA 1NEUA 3OQ3B 1SLVA 2VDRB 3M45A 1AOHA 3QUML 1NTDA 2E8ZA 3AREA 4YDLB 4N8CL 3QUXB 3BH4A 4FQHB 3HBQA 4MDIA 2DAVA 3U4BH 4AIZA 4TLUA 4Y9BA 1PJ9A 4P23B 3LKOB 4Z0XA 3TV8A 4KI5E 1QQDA 2VN6A 2YPLD 3KPLB 1R6VA 3IF1A 3NCXA 1JGLL 3RVUD 1OAYL 3T2LA 4QRTB 2DQTH 3GWJA 2Z8WC 4B6ZA 4M4PA 4WWOA 4DP1X 2UXFA 4JO5A 5EWIH 1JE6A 5TTRA 3S8WA 3MYZA 3BGFC 4XMLH 5ES4B 5DJ8A 2CNYA 4LF3A 2XXCB 1MCBA 3FTZA 3T0WA 4PJAF 3ZKQD 1LEKB 1H15B 3F8UB 1MRDH 2LABA 2QPUA 2A9MH 3QEQA 2ZG2A 1QBLL 3N2JA 4LSTL 4PYHA 5SWZD 3TJHD 3K6IA 1Q38A 5CLTA 2WTRB 3WEBA 4RDQG 2BHZA 4UT7H 3MLSL 2NY7H 4JPKH 2Z7YA 1I85A 2Z0UA 4PRIA 2ZOLB 4QAMB 1OTUC 1AJ7H 5AWNL 1MHPH 3D85B 3F5WB 5C6PB 2VLRA 3O41B 3W2DH 4BHUI 2J1KA 4V1DA 2I9LB 5DU7A 1CLOL 3G9VA 2GSGB 4UB0L 4M43H 1U8LB 1U8CB 1IUZA 1ZHBB 4G7YH 4AL8C 4V1DE 1R34A 4IRJA 4DWHA 2D7TH 4RFEA 1CFVL 1IC5L 2DQFB 3SQOH 1V3JA 4FAAB 5LGHL 2NZ1A 5GGUA 3ZE2B 5JHDB 3PWLA 4PY7B 2GC7C 2AJXL 4DKDC 4OZFG 1BLIA 1M6OA 1KPRB 2P26A 2J44A 4JE0A 4U1NB 3ZN6A 4CSTA 1PIGA 3VI3A 5F7EH 5BS0E 5E5LA 4ZX5A 4Y16C 3UDWA 4XPTL 3I9PA 1QR4A 1FQ9C 2HJKA 4TN9A 4N0YH 3TJEL 5IESH 2EVFA 1UURA 4DQOL 1QSFA 4JDEA 1WIOA 3UL4A 2WYTA 1PKQA 4M6NH 2A6JB 5EEVA 1IU1A 1QSFE 4O2EA 3ARZA 3TU6A 2I85A 5CEXB 4HD9A 4NM4L 3WDHA 3QUGA 4GH7B 5GGQH 4J23A 2HPOA 3MI6A 1DUYB 4GQ9H 1LP9F 4KVNL 3ARUA 3CXDH 3LPWA 3V4PH 3C8KB 4OKVA 1Y18B 4A7GF 4IRZA 2XV0A 3QIWC 3HR6A 2KYIA 3VXRA 1QLEL 3N1FC 3L5XH 4RA3A 5CNHA 1TJGL 4GAJL 3SKNB 1L6XA 4HWNA 3DX3A 1GGTA 3VXRE 4S1QH 4LIQH 4DNLA 3CX5J 3WS6A 1SBSH 1DQDH 2VLKE 3HG4A 4PB9L 4Q6IA 1FVEA 1W0YT 4FXGA 4TLSA 5AD0B 2WSPA 1F97A 5F1NA 3QRGL 1KTCA 5BUAA 4OF8A 4BH8B 3RUGB 5TJWK 3ECVA 3DUUA 5SWSB 2DM4A 3FU3A 1UXSA 1E4KA 2H7WA 3DX6B 3N85L 3NCYP 2CCLA 4FX5A 4LLUA 4R9HA 4J6RL 4S0TD 1Y6KR 4AXWB 4N8VB 1OSPL 2OXGB 3T08A 2BOCB 2DYPB 4X5RA 2CALA 4QHKJ 3BHBB 2JB6A 4KKQA 2QQNL 5D9SB 4XMXA 3KE0A 3LY6A 4J3OF 5DO2D 1D5XB 1EHLL 5LBSA 3FO9A 1A6VL 3BVUA 3CV5A 4K0OA 1XBDA 3MNVB 5GSRB 3ARGB 3C5XA 1VEPA 2VZUA 5C09B 1KEML 3VD5A 4BFBD 4IOFD 4NKOA 5HDWA 2RBLA 5E4OA 4EQ2A 1WFNA 3MBED 4PWIA 5C3LD 5DQ9A 3A21A 3Q1SH 3D30A 3CD4A 3VMPA 4UM9A 1RK1B 1YMMA 2WKLA 1HS6A 4Z5RB 5D2NB 1HL5A 4R5XA 2C9SA 1QNIA 1YMME 2I9TA 1FFPB 3WS3B 1MW0A 3PQYB 5DJ0A 2AABH 5DHXB 5E8OA 3Q2VA 2H32H 3KHOA 3LRSA 3O6ML 4PJ5B 2G3NA 2YAEA 2HKAA 4BKLB 1JNLH 1SLWA 5A2BA 5CJQH 1TJXA 1L9QA 3CJJA 1LJMA 3KXFE 5DD3L 1MCOL 1MNUL 1W15A 1YEGH 1ACYL 3MRQA 4FNPA 3NZHH 1XGUA 1GOGA 2DLEA 3CFIC 2P7TB 1MCWW 2H3KA 4E41D 4AMKH 1LWJA 3JWDH 1YEJH 2NYKA 5I0XA 3PP4L 5ECJE 5TH2A 1T0MB 3B2UC 3KBPA 1AFVL 3FUHA 4FZ8H 1FLRH 4L8BA 4Q0XH 3WDJA 4GOSA 1KYDA 1KB5L 1QLRA 1VZGA 2N1TE 3DC0A 1VEMA 1HL8A 1Q9OB 2VDLH 5E03A 3B2VH 4H5SB 2Y69B 1K85A 2OK0H 4Y1AD 5CWSB 4RWYH 3FF8A 4UT6L 1KGXA 1PD1A 3LVTA 4NSKA 3VD4A 3T0EA 1U4EA 1D6VL 1OL0A 4X0KB 5DD6B 4Q8BA 3KGSA 1R3HA 3WJLC 3O4LB 4PRHA 3VFOB 3BN9D 3RWIA 3ZT6A 2YD0A 1F1DA 1E9OB 5DRNB 1XH2A 3P9MB 3AVEA 4YLCA 3M46A 3ZQWA 1ADWA 1JK9A 3QIUC 1OAXL 2N0MA 2BFVH 1BXVA 4K71B 2AEWA 1YA5A 3GXIA 2YXMA 2ZAGA 1CFNA 1IM9A 4M7LT 3IJ8A 2XKSA 5C0AD 2ADIA 4ZMNA 4L29B 2W60A 3QHTC 2CKBA 3BESR 1AY1L 3IDXL 3NG5A 3RX9A 1RZQA 3DIDA 3N1MC 4L4VE 4OLEA 3MGTA 1S2EA 1N2RB 1T0NA 3SDCA 3RNKA 1Q0YH 4H40A 4JKLA 4DK5A 2J43A 1UYWL 3EO1B 2E59A 4C55A 3ZDXB 5TE7L 2XHNA 2H45A 4XNMB 4GB9A 1J12A 3L7EA 3QORA 1S7VB 3QP3A 2ZAHA 1JWSB 3CN3A 4LKXB 3KPSD 4FNTA 1M6UA 3R4RA 1F58L 5LAPA 4AE0A 2P80D 5HHVH 4JO3L 3IGKA 5DDHB 4YMPA 3VMNA 4KKLC 2EXTA 2XV6B 3WY2A 4YHNB 4OUUB 4P99A 5JDSA 3VXQA 3WFEL 4DETA 4OD3H 5HGBB 2OQJA 4LK4A 4PV9B 4Z76B 3EXJA 3NJVA 3OKMB 3HG3A 1NWOA 4MRBA 1NICA 4B9KC 1CXLA 5FO8A 3HNSL 2BY3A 3OLIA 1OW0C 1SXAA 2WZPD 2R2EA 1F3DJ 2QKIA 1AQKH 4EZMA 4G8IB 3O9WD 4MAYC 3VWJB 4W1TA 5BRPA 4R5TA 4PGCA 4XP1H 3O45B 3IFLH 4ODHL 3EYUL 1Z7JA 4BGDA 5KVEE 1GKOA 3D34A 4NOFA 3H6JA 1DQQA 3O2DH 2DJ4A 3NEEA 3NFSL 4HUVA 3KVDD 5LCVL 4S11A 1V3KA 3OHXA 1GGUA 4AYFA 4KTGA 1IBGL 4S1DC 4M5YH 4FMFA 5G5DB 3BZEB 3V52L 3FT9A 5BUGA 5I1AA 3IJYA 5DUBB 3NK4A 3SE4A 3HI1B 3GSNA 2XWXA 5K59E 3VFUA 2RR3A 1C12B 4QJ5B 2BNRD 2XACC 4QTHB 4AC2A 4ZFZB 4Q97A 1D9KD 2OTWA 1RZFH 5IMOB 1W0VB 2YZ8A 3WNNA 2PCFA 2WZAA 5MEQB 1XSIA 1M7UA 4MYPA 4HKZB 2R1WB 1S7SA 2VDNH 2JWYA 1SVZA 2EIKB 2X4UB 4NXSA 4P9HH 3MRRB 3WAJA 2HTLC 2ATAA 1OM9A 3ZYOA 1Z9OA 2Y25A 4MHHG 4WNQB 1OD9A 4HIXH 1OIOA 2BSCA 2DQIL 3UCRA 5LXGL 3DTUB 5EOTA 2B4CL 5BXFB 2Z31A 2H0JA 3WNIA 2DD8H 1KJ2L 3CFUA 2ADJB 4WGVB 5GGTA 4F24A 2EEAA 4ZS6D 4HMEA 2BZ7A 3L3IA 3P3YA 4NO5A 5KYWA 1E6OL 2B3IA 3A3YB 4C83A 3EFDH 2BFGA 3OXRB 1J5DA 1MWAA 4Z7WE 1YY8B 3PL6C 5L4MA 3MYJA 2YA2A 4YXLL 5ADOL 4CVZB 3JWOL 1F90H 3BPLB 4HZAA 3EO9H 3TYGL 2DLFL 2GT9A 2YLHA 3KPQA 1EAPB 4JHUA 1D5BA 4G82A 4ZQKB 1SEBA 2C3VB 2APFA 2BOBA 2ZYRA 4HS3A 5AZEH 2BIIA 1EA9C 2XFGB 4GW4B 4UU9A 2X2YA 1EPFA 2VR5A 3VD1A 1QR1A 5FLVA 3DBSA 3ULVE 3MTXA 4FTVB 4ZW8A 3C12A 2HTKD 4HMCA 2PO6D 4I1RA 4ZZKA 3R18A 3BC9A 5AW9B 3DK0A 1HT6A 5AVXB 2OMTB 2JLLA 3WEAA 4KKNA 5TF0A 1VFUA 2DMKA 3WG7B 2BVPA 5DK3A 1I7RB 3BH9A 1G6RL 2JCCE 1YEWA 2G75B 2VWEE 1RJYB 4L5FH 1XX9C 3I6LD 1CT8A 3QDJB 3ZR6A 1TTCA 1TZ8A 4XPAH 5DZ9A 3MBXH 5FDWA 1RIUH 5H94B 3Q9QA 2ZTBA 3I75B 4ANVA 4XMVA 1T21B 1WCBB 5AW2B 5GS1C 5I8EA 4LGPB 3C09B 2C9QA 2PWFA 1T4KA 4P4KD 4Y19D 3CN0A 3ZRSA 1T7ZA 3M86A 3QA3B 3QUXA 4RQQB 3F7KA 4BA8A 2B9AA 3PWPD 5GRJH 3SGEH 5IJCC 2YPLE 4YFEA 5F6HJ 4WWID 1PLBA 1P7HL 1B88A 4J2QA 4N0UB 3DOSB 2F1EA 1KCUH 4YSOA 1ETJA 2A9CA 2MCPH 4TSBL 1HINL 1SFHA 3PHSA 4QRTA 4XPGH 35C8L 5C0GA 2CDGB 4EXKA 2VE6B 4Y4HA 5JQIB 4EZJA 3TWCH 1JPGA 4EVNB 3LNGA 4N6RA 4NZJA 5C0FB 4MASA 5CM1A 1UM5L 4PP1C 2NCMA 3RDTC 3NA9L 1BG1A 5AW5B 3ZY7A 2PPFA 4P5TC 5SWZE 4Z7QB 3RWJA 5IFHL 4FYSA 4ZS7H 3VYNA 2PPCA 3QWQB 3MFFB 4A7QA 3DDGA 4OKDA 1MCPL 3B8SA 3RTQC 5LWYL 1WBYB 4G72B 4JO2H 3ILQC 5IB4B 5JIPA 4JY5L 1FI8C 5I1DA 5TF1H 2CUMA 3QXWA 4LHQB 4R7LA 2WO4A 4X5XB 5JUEH 3QIBB 3WIFA 2XX1A 4E9RA 5IQ9A 7PCYA 1CXHA 4XXDB 4AQAB 4NKIH 4Z0BL 3T4AA 2ZOLA 4WW2B 2OJZL 2P5WB 5F9JB 4W70A 3F5WA 1F6AB 2IPTL 3RY4A 3CLFH 2UZXA 1IGFL 2GSGA 5F2FA 4ZJ9A 3GLAA 1U8LA 1U8CA 5EF2A 1ZHBA 3QUZD 2Z4QA 1YQVH 3WDIA 2YAHA 4K55A 2A99A 4JHAL 3L16A 2GW5A 2J8UE 2GVYA 4IQHA 2MEJB 4NC2B 2HMID 4WO0A 2K3HA 2OSLB 2HCZX 4S1SH 5F7FA 2Q87A 4XCNA 5CUSL 4N6QA 5KVEL 2E9WA 1L9PA 2GEEA 1A5FL 3MRMB 4I0PC 4ONGL 4TMPA 3VJ6A 1QTSA 1HILB 1Q9KA 4FQ2L 1U0QA 1T4WA 2G0KA 3A4DA 3O3DA 5G4OA 3HHSA 5EV7A 32C2B 2CWRA 3IDUA 1RV6X 2QQKH 4TPRH 3BCDA 2RFXB 3GKWH 4FEMA 4A6YB 5EEWA 5LG6A 3VXSD 1J8KA 1UD5A 2V4LA 1OAZL 3F2LA 2DW5A 3WN5C 4YEFA 4WK4B 1LXMA 4O5LH 5ITBH 5AZ2L 1A0QH 4Y2DC 4KVCH 3ZE1F 3DIFA 3HCVB 1DUYA 1FUNA 1WPCA 3K4DA 1E3FA 4PFEA 1S8DA 4Z7NF 3MOBH 3QQ3B 5FYLD 4N5ED 1H6EA 4TXVB 3WEXB 3O11A 1E4XH 3GGWB 1XCQB 4FYQA 4B9ZA 2RB8A 2PP7A 2A3TA 2IGFL 2J7LA 4JHVA 5E9NA 2VRQA 1QRKA 3CHXA 1A6UH 1NC2B 4LCUA 1WG3A 5DMGD 5I0WA 2UZYB 3QIWD 3BP7A 4ZUVA 4OD1L 2HT3C 2NY5H 4NQXB 4W9ZA 4J3XA 4XNZC 1A9BA 3EH4B 4E9WA 4B0MB 1P9MC 5JLZA 1N0XL 3FCSA 1S5IL 4CVXB 1G5AA 5F44A 3X1BA 3DA0A 2D03L 4ES8A 2XV2A 3I2CL 1WWAX 4BZ2A 4GXVL 2LAAA 3GMNB 2JIXA 4OQTL 3F12B 4L3CA 4WUUA 5AVVB 3FFDB 4EN3A 3SYAA 3SBWC 2BMKA 3AU1B 1PLCA 5IB5B 2V7NB 3SKUD 3MBEA 1LE9B 3I9GL 3K6FA 1CFMA 4MX7B 1PSKL 5GSRA 3CHSA 2XOTA 1RZJL 1OQXA 3PABB 5C0BB 3TN0B 3T0DA 4GMSL 3X12A 3VG9C 4MJ6B 3DKHA 5JIHA 1XH1A 3KL0A 3UYPA 4NWTH 1DBAL 1HXMB 3H9ZA 2JKWA 3ULVL 2Q8BH 3HA0A 1IGYB 4G71B 2Z0BA 2X4RA 4R8WL 3MNWB 1RK1A 1KGJA 1TQUA 2GHWB 3T3ME 1N18A 4TOYL 1DVQA 2WWMD 3CFEB 3LXUX 4AW7A 3ROLB 3N55A 2OMZA 3QJVB 2I60L 5JW4M 4N2BA 2WTPA 3POHA 3APDA 4Z7OF 1PYWB 1RLWA 4OW6A 3ZKMC 4LPTA 3CFCH 1OSEA 1HAUA 1MVFA 4DVRL 3FTUA 3KZ8A 1UXWA 5D2LA 2EEFA 1YUKB 4JRYB 1WA2X 1I3UA 1P53A 4A7VA 3HAEA 2MNJB 4YZFF 5K39A 1UA6L 2P5EB 4N5UA 5AOZA 5LDUA 4E41E 1O0VA 1QG3A 3TV3L 4XWGH 1IC7H 3V5DB 3TESA 3MMEB 3ETTA 4NQCB 3I50E 4CSSA 3KH4A 1F3JB 2O6CA 3N43F 4R0LC 3PV6A 3QI9B 5CCKH 4QRAA 1RPKA 2V2XB 1HL4A 5B4MD 4L4JA 2B59B 4DJMA 4QT5A 2X6CA 1Q9OA 3HVDA 4Y1AE 3B2UD 4H5SA 3CAFA 3SGJA 3ORJA 4RAUA 5E1IA 4MNHA 4HKJA 3NIFF 4DSYA 3EIFA 2HLFC 4H4NA 3RQ3A 4FFVC 1EIBA 4QXVA 4ZTOL 4WKZB 2K8QA 2HN7A 4BSVB 1U8PB 4OT1L 1BAFH 5FUZH 4AYDC 3O4LA 1PLAA 4L0PB 2X2HA 1E5YA 2PYED 5DRNA 2YAPA 4S1RL 3H9SA 6PCYA 1F42A 5JORB 2XICA 3VRLE 3HG1B 4JFDA 5AVZB 1S6NA 1J9QA 4NGHH 5C0AE 4M7KH 5BZXA 4XNXH 1JK8B 2VXSL 2VZOA 1MN4A 1CXEA 2AJUL 4ZOBA 4N86A 4KZEL 4YHPB 4LLVB 1GS6X 3ZKXB 1AP2B 3UERA 4EI5C 5T1KD 3QJHB 4OLUH 1OGPA 2H0PA 1BZ9A 4Z7VE 5K93A 1BFSA 1OY3B 1OVZA 3WAKA 2YD6A 5CR1A 5HY9A 5K5YA 3SIKA 3KLAB 4WY7H 2R51A 3QUMH 2GIXA 3EO1A 2OZ4L 4KKPA 1PD6A 1E2WA 4N8CH 4B9FA 4QKTA 4EOWH 1QSED 3KPSE 2VC2L 2VDKL 2FEDC 3OR7A 2VXVH 1ZWIB 1KYOK 4OAWB 5DVPA 3RWEA 1QBBA 3AY4A 3MRCA 4MDJB 3WNLA 2W07B 1JI2A 3TIDA 1DE4B 4LEXL 1OAYH 4KY2A 1KJVA 2CDEB 1KY7A 3T2OA 2CCVA 2H26A 3SGKA 4QRRB 2QVTA 4PBWD 1B0GB 1JRHH 3BVDB 2FWOA 3LEXB 4YHNA 2WZPA 2OCCB 1JPTH 3LN5A 2X4TB 1I7ZB 2X6BA 5ISZD 3OKMA 5IHLB 3DETC 3S5LG 3O9WA 4NIKB 1A3ZA 5GGSY 4GKZB 1MI5B 1NL0L 3DSFL 5JQ6L 2ZUQB 1D2PA 2NSXA 5B8CB 3NDZE 4G8IA 2XIIA 2ZOUA 1KTLB 1QBLH 4G7VL 3T3PE 3NFPA 3CTTA 3JBG7 4WI9A 3O45A 1OZUA 2IDFA 4D0DA 3MV7A 4G83A 5IM7B 4AEIH 2ZKHL 3MNMA 4HA1A 4MAYD 1FF5A 2BSEA 3MLSH 2DBLH 4Y8AA 3US1A 4AV4A 3RKDD 3ZE2F 4A37A 4FFZA 1C8QA 3HLKA 2ZQKA 3K7UA 3UX9B 2A1WL 5B3JE 1D5MB 1KFGA 2J6WA 2BNRE 1CLOH 4UB0H 5DGRA 2FJSA 5KYXA 3ATBA 5B38G 1CGVA 4QTHA 2H5UA 3B9KC 1HX0A 1PBYA 2IAMD 1WBXA 1IC5H 1RP9A 5LGHH 1R46A 1RQ5A 3QH3A 4KTDL 3ALWA 4CN4A 5JZ7C 2MCAA 3MRRA 5DMYA 1FJ1A 1WRFA 3ASWA 4LVNB 4BWUA 1BQHG 1LTXA 4WNQA 3D8MA 4QRPB 4XPTH 5C86A 3O4OB 3C60A 5IEHB 3TJEH 1HK6A 2FX7L 2HJLB 1J8HD 2EDKA 4DQOH 2ZUYA 3EO0A 4KXBA 2O6PA 4D0CB 2ZOWA 4PWJA 4EIGB 4PJ8D 4HOWA 1U36A 2DI8A 2ATPB 2G2RB 1L0XA 1X5YA 4FNUA 4LSPL 2F0CA 4LLMB 2KERA 1U8HA 1O6SA 1ZHNA 3GO1H 3OKLB 3QRLA 4K94L 3D0VB 4JKWA 4M48L 2CUIA 3BE1L 4GEIA 3RUGF 4KVNH 5FO9B 1CDIA 1FH5L 4MA7L 1PY4A 1JVKA 3FTYA 4LSSL 5ABAA 4G11A 1QLEH 1WF5A 1ZLDA 3P11L 3PWJA 1QI4A 3EJCA 4JZJB 4WHDA 4GUOA 4GAJH 1FNFA 1DJXA 2HVKB 1TEGA 3QK0A 4ZQKA 4WWKD 3UAJC 3RFZC 2ZG3A 2E7LC 4NQTA 1MFEH 4PB9H 7PAZA 1BVNT 4K9EH 1YEIL 2GG1A 1RMFL 1SXNA 3TTSA 2F1AA 3CQFA 2O1AA 2ICEB 1B4JL 4DO6A 1ERNA 2FLRT 3KWXA 4X7CC 1HYSC 1ZLEA 4LNVA 3IVKB 2GTWA 1HEJC 3MRDB 4J6RH 1MCHA 4X4YB 2YAMA 4BWWA 1O75A 2UX7A 1IVTA 4POUB 5I75C 2X3BA 2OMTA 4QWWD 1QOKA 2O5XL 3LB6C 2QQNH 4JQVC 3I6LE 3HI5L 2MPAL 2Z1KA 1EHLH 3QULA 4XN1A 1AIZA 1A6VH 3RIAK 1ZSHA 4JN2B 3VQ2C 4NQQA 4Y19A 5CP7A 3WTTA 5A1AA 2OR9L 4NO2A 3NSCA 3LNDA 5H94A 3ECUA 1LO3H 2AXHA 4R3SB 1UKTA 1T21A 4U1KB 1KEMH 1T1ZB 2JE8A 4KV5E 1NBYB 4Y19E 5KBLA 3RWFA 4OZIB 5J9PA 1D2OA 1YY9C 2AXFB 3CZFB 5D2LF 3LRHA 3UIYA 4JK0D 1A3RL 3PWPE 3CUPA 4XN9A 1I3GL 4Q9QL 4AKOA 3LQAC 4KOCA 3GBDA 4UWQB 1NIBA 4G80B 3GLZA 4R4BB 2XIBA 1U8JA 3W9EB 1IQWL 3WHE1 2FR4A 5DJDB 4M9PA 3Q05A 2UZIL 2RA1A 3ZTJG 3VXOA 3JSSA 2V8LA 3FNKA 5C0DB 4HFWB 3O6MH 5AALA 2WCSA 1IQDB 4LOUD 5DEZA 5EU3A 5IHZA 4PGDA 5DHMC 2AGJL 1LEIA 5C0EA 4UILL 3RDJA 4U3CA 1AG6A 4CVUA 5J56B 2N59A 2HT4C 3BKYH 4ZTEA 2VE6A 4I87A 1A6ZB 1BQRA 2XSKA 4R5VA 1MCOH 1MNUH 1ACYH 4XNAA 5EO1A 4ENED 2NXYB 2Z92B 1CDJA 4GSUA 1SXCA 4M29A 3STZB 2FHFA 4NAMA 1B9KA 1T5WA 4P5TB 3B9EA 3PP4H 2F2HA 3MSPA 5KS9B 1AFVH 4W6XB 2Q8AL 1IM3B 4AZUA 4PP1D 1KB5H 1Z32X 4FHJA 4OZFB 3UTSB 2V9RA 1AGBA 1JF1B 5IB4A 1BF2A 1QLFB 2W5PA 3NACL 4PJBB 2XZCL 2WSKA 5DS1A 4HUWA 4X5XA 2R0KL 4LRNH 4KQ3L 4XXDA 2VQUA 1ZS8A 5JIKA 1XWVA 2P5WA 4UT6H 3B3BA 4X6BB 5F9JA 1XB6A 3GXUB 4JDZA 3LZFH 5F7YC 1XBRA 1JIBA 3LKSA 1N5AA 4LOFA 2ED8A 1OOWA 3QUKB 4OF5A 4W9LC 4UDUA 3QNZB 3QJQB 2X1PA 4PJDA 4WFFD 5DRWB 4EJ1C 4N4YB 2ZF9A 3GBEA 1MHCA 3TPUA 4FFYL 2X4PB 4PJDE 4EZKA 5FA3B 3RY6C 1OGAB 1MXDA 1QWUA 4Y5YC 1HFUA 4I0PB 4Y16A 4N1EA 3ZDXF 3VXSA 4PJAE 4XP6L 5IOPA 2EDFA 3FOMA 5EA0L 4HLJA 1NIFA 3VXSE 5HHMD 1DHKA 2Y5EA 1AY1H 2HLAB 3IDXH 4A6YA 5I17B 3QWNA 2OJ1A 4XNYL 1IGCL 1MHEA 4MA8L 5SWQB 2NY4C 5E8NA 2JMRA 5DFWH 3JV4B 3SYQA 1F6LL 2Q0ZX 1ET8A 1UYWH 3GZQA 4HPHA 2DKUA 2EH7L 1P5UB 1F86A 4JFSA 5FYLE 5TE7H 4UCFA 2OL3B 3A23A 1WISA 3E6HB 3QQ3A 3N9GL 4IEFB 5HI3C 1UD2A 5F9OH 1FCCA 1Q94A 3VFNB 4AQEA 1U3HC 4F3FB 3QIWA 4AOFA 1KC5L 1EDHA 1W9XA 5KYNA 1NGWA 4A68A 3SQBB 3FB7A 2P45B 4JO3H 5JYMA 1X9LA 3VFPB 2XWTB 4J3VA 1IFHH 3IT8D 4MXVE 1MUJB 4K8RL 5F7BA 1PZCA 5I73C 1F2QA 3OAZH 1X4YA 4MXQC 4BXVA 4IU2A 1DCLA 3WFEH 1EEUA 3QC5X 4KK9D 5DT1L 3VFTB 5MP6L 2DS4A 3HE6C 1VAHA 3LPPA 3UTOA 3HNSH 1E9QA 4JRLA 4N24A 5BV7B 1VFAB 2X40A 3GMNA 2XKNA 5TK2A 5ANMA 4U6XB 4LKCB 5KSAD 3WD5L 4L4TD 3G5XA 3WJMA 4E9SA 5AVTB 2LU7A 4XMWA 4ODHH 4U3XA 3EJZD 1H6TA 1ROWA 1A25A 1JDCA 4KAQL 1SYVB 3NFSH 3PXLA 4NNYB 4P2CG 1S7RA 4UI2A 4F2MB 5IROC 1JBJA 2CK0L 1IBGH 3US0A 2V7HB 2WVSA 1F13A 1RZ7L 3V52H 5A6IA 3B1UA 3MV11 4UQBA 1JYVA 4Q2ZA 1K6QL 3VQMA 1AQDB 4UF7C 1CD9B 1MJ7L 2JXMA 5D1ZD 2XRAL 1XCXA 3MLXL 2YJQA 4RMSA 2OAAA 1PYWA 2VAAB 1F2XK 3DVNA 2ZCHL 1KBKA 4LSRL 3VE0B 1T80A 2FO8A 3HLAA 3ILPA 3O8XB 5GS0D 2XXGA 1FNGA 3QDMD 3P3SA 4ETYA 5E6IC 1PEWA 2X88A 4PCTA 4HJGA 4L0ZA 4D9LL 4GKOA 2ORBL 4HCFA 4AITA 1AMYA 2DQIH 3G04A 2X9WA 3UXFA 5EN2B 3VVWA 1DVFC 2Q7YB 5LXGH 2I26N 5BZZA 2B4CH 5DO8A 4HJIA 3GI8L 2XWEA 1KJ2H 4OLZL 3SJVB 5D6DC 3SYCA 3HIZA 4R0LB 3V6FB 1F3JA 1BJ1J 1AD9A 2Y7MA 5IBUG 3HC3L 3ZJAA 5FIEA 3WXVH 2WLKA 1T22A 4BD4A 2W88A 1VFOA 2VLJA 1OEZW 2B59A 2EINB 2VN3A 5IG7A 4YXLH 5ADOH 1ZV9A 3BAWA 4Z3JA 2MMXA 3BUYA 2WQ8A 1E90A 3U7WL 4R26L 1U58A 3NZSA 1RJLA 4HOXA 4APQD 4WU7A 2DLFH 1V8HA 5I26A 4EDXB 3H3PL 2AXGB 3FT4A 3MJ8A 4E36A 4C56A 1VACA 5IB3B 4KRPC 5C08A 1DSFL 3X1FA 5GZOD 4M7LH 1BD2D 4BCZA 2FHBA 3LH2L 4LHUG 2FX9H 4XX1G 1L4IA 3E8VA 4BSVA 2VM3A 4IBTA 3WJLA 2PYEE 2ROYA 1LO0L 5LHDA 5F6IC 2W1NA 2WIMA 3QIUA 2OMUA 5DXWA 4IK6A 1M7DB 2HFFA 4PJEB 4FJ6A 1WTLA 5E2WL 2OTPA 4WRLA 3TF4A 4YSEA 2V37A 2ZKMX 4HIHA 3C5ZD 1FRGL 1U41A 4CKQA 1GZQA 1G6RH 4UTAA 5HP5A 5I24A 4GIPD 3LZOA 1M71B 4LLVA 2JJSA 5IEKB 3MLRL 4APXB 1DVYA 4FOMA 1ECZA 1MCKA 3FTXA 43C9B 4ZUUA 4NAQA 4YZWA 3FB5A 1QSEA 3DO7B 1RHHA 4LCWA 4PRPB 4U1LB 4EI5D 3KLAA 4MQTB 1TITA 1QSEE 2CAKA 1S7WA 4CBZA 1MCNA 2XU9A 3LKQB 3IXAA 3FQ4A 4X6CE 4I5BA 1EERB 4TUOA 4FQQA 4NRYB 5CD5D 2OCJA 5CHNB 1IL1A 1R3LB 2Z35B 2OW7A 4QLRA 4O02L 5KZCD 2DJSA 3GYRA 4HEPA 4YR6B 4DN4L 1IBBA 1E8YA 2XYCA 2W07A 4Z7QF 2CDEA 2F08A 2YRZA 1KV7A 4JRXD 4NT6B 5ISZE 1VGEL 3RJQB 1BOYA 2BHUA 2DQUL 35C8H 4WTZG 1JCVA 4AW4A 3IM1A 1I7ZA 1JNHA 1RZKL 1TJIL 4K3JL 5DZAA 5KOMC 1AR2A 3OPZH 4FNLL 2UXGA 4ES9A 4JY6A 2Z91B 4P5MB 1OW0A 1WT5A 3D4ZA 3NA9H 4WW2F 2DMBA 3D39B 4WI0A 4NZUH 1EFXA 1LQBC 2QZ5A 3HR5A 4MAYA 3VSQA 5IFHH 1S9WA 1KTLA 1NPJA 2I32A 3SYPA 4JKPL 4FP8L 2JI2A 3AUVA 5LWYH 2QVFB 3HEIB 1YPZB 4RRPA 1F1GA 3L9EA 4JY5H 3BUPA 1BWMA 3ESNA 4UAOC 2QGEA 2E75C 4GLRI 2FLBT 1U91A 1OLZA 4J3TA 1EUTA 4PLJC 3IWVA 2CRIA 4Z0BH 2QFPA 2OJZH 1NPUA 4ETQA 3L3HB 5CKGA 2IPTH 1WZMA 5E2UL 3D69A 4NPYB 3QNYB 5KVDL 3V0DA 3B7SA 1IGFH 3GM8A 3EFFB 2WIIB 5H35B 1BECA 2X70B 4HW6A 4NQDB 4NKMB 4EO5A 4H1LG 3ZL4L 2PW2A 3GJFK 1BDYA 4MD5B 1ZGLM 4JCWA 1G7IA 3DX7A 4ZXBC 1V5JA 5EIIG 1JG9A 2VUKA 3TO2A 3V7AG 4IGBB 1QUNB 2NY3D 5CUSH 2PR9A 4ONGH 1A5FH 4F37K 3B2MA 4EUPH 1J8HE 4FQ2H 3FUDA 1LVEA 2ENPA 2ZXEB 2Y5QA 2FJHB 4YXHL 2DQEL 3UBXG 4RAHA 2RJMA 1TETL 3TNNB 5E00B 1KB9J 5K9JL 1IEHA 3RPIB 1ASQA 4WTXA 3KPMA 4LLMA 3CVHA 2EVHA 1JGEB 3OJDA 5AZ2H 3PL6A 3OKLA 4KY1L 4B3EA 3D0VA 2VMFA 3FB6A 5BO0D 2KH2B 5I74B 1FO0L 1O7SA 2JNZA 4KC3B 4PJ7E 3WFHA 2OMVA 3QFJB 3KH3A 4HDIB 3V8CA 3FCBA 1YNTA 5DC2A 2CG9X 1HHKB 2C7UB 1ODAA 1BPLB 3QEUB 2BCMA 2IGFH 4U7MA 2HVKA 2R29L 3VD3A 2K4AA 1SJHB 3GT6A 5AKRA 2J2ZA 4HLEA 1ETZA 3DMMC 1QKZL 2WQWA 4OD1H 3UC0L 2J8OA 3PDOA 2G3XA 4HD5A 1T1XB 4HX1B 4KX8A 1T03L 2VIRA 2OP4L 3PCYA 4OCXL 1BLNA 3NSXA 1S5IH 4CUCA 1NH6A 2VN5A 5DSCB 1NAMB 2D03H 4XRCA 5E2VH 3I2CH 4K3EL 4PJ9C 3DHMA 5I75B 5I1EH 2G3ZA 4GXVH 1EJOL 4HCIA 4OQTH 2J6EA 1KTBA 4H8PA 1BAGA 2Y1VA 1RERA 1G9NL 1D3CA 3O6FC 4LCCB 2P9RA 1K4CB 4POZD 3I9GH 4N2GA 3WFBL 3NBNA 1PSKH 2FIKB 2IDCA 5GQBA 1RZJH 5AG9A 4R3SA 5GS1A 5E7BA 3QJRB 2YD1A 3T6WA 2M1KA 3ZDZF 1J9CT 2BWIA 3CZFA 4I77L 3KWWB 1DBAH 3ULVH 4KFZC 3MLZL 3UZQA 4WEUD 4JFFB 3KCPB 4R8WH 5ELIA 1JMZA 1P4LB 1NEZG 1YY9D 5EF3A 4PMFA 4R4BA 1SGKA 5FM8A 3DXAB 3HZMA 2DYPD 3C6SB 1LO4L 3B2XA 4HFWA 2CLRA 4DVRH 1IEAA 1XCTB 1H8SA 5T3ZD 2QHRH 4BK8A 1KN4L 1OE3A 4GPVA 1NMCC 3RGVC 1S9YB 3N91A 4UUJA 5KSBA 4RMRA 1HU8A 2J20A 5CCHE 4E0RB 1UB6B 3RBGA 2O93L 1NMAH 5KG9B 3ARGD 3FO2B 2C9AA 2GSMB 3W11C 1A6ZA 1UA6H 3BI9X 4LLWA 5C09D 4DCQA 5KSBE 4YH6A 3W39A 3LNEA 1TLKA 3SY6A 4PRDB 1A9EA 3TV3H 4BZ1L 3NOIA 3STZA 2HT4D 4FG2A 3RDTA 2CH8A 4AZ8B 1BVLB 5GS2H 1E8XA 2H2PD 2HKFL 3ELAT 4AQ1B 1KLFA 2FRGP 2WQVA 4I3RH 3MRNB 5A16A 1ROCA 1Q1PA 3MLTA 1PAMA 3RTQA 2VSCA 3MQIA 2EC9T 3MRPB 3N44B 3P0YL 4ZYKA 1TTUA 2DWEB 3PQYD 5DHVB 1QLFA 1JUFB 2BOLA 4GXUN 3CSPA 3O3BA 4PJ5D 2DYRB 4Y9GA 1MY5A 3PGFL 4JR9L 1J10A 2AV7B 1O7DC 2C8NA 4MCZA 2ED7A 5B1KA 5J13C 4TQ8A 2YIHA 2AJZB 1SJVA 3V0JA 4HBCL 3MN8A 1T5XB 2FDBP 3K8LA 3VX0A 4ZTOH 3FT0A 1AZUA 4UNVA 4YSCA 1N7MH 3AG2B 4DO5A 1XR9A 4OT1H 4WFFE 4B96A 2FYVA 4PLOB 4DGIH 3IJHA 4MNQB 2ITCA 2IH3A 5DRWA 4N0CD 2WQRA 4LEBA 3OWEA 5T5FA 4S1RH 5HYJD 3JV6B 4XB7A 3JWDC 4UQIM 3X14B 4Y4FB 4AC4A 5FHAL 3OGCA 3LD8B 4AYBA 3F05A 2C4XA 1SN5A 4I3SL 1CL7I 5ECGA 5BW7C 1MFMA 1R19A 5DJZB 4P46C 4F7PB 5HHME 1PZ5B 2AJUH 2I7OA 4A1RA 4KZEH 5TE4H 5E6YA 3OX8A 2YS4A 1KELH 1TU2B 5DS2A 5C7XL 1SM3L 4N1HB 4DPAX 1M05A 5SWQA 3B56A 4QEGA 5DJAB 2LFGA 2GK0A 3WN5A 2F5BL 3KLLA 3JV4A 3K4AA 5C70A 7TAAA 5DK2B 1TJMA 4Y2DA 2E4TA 4PJIA 4DKFL 3KL3A 4GYBA 1GZPB 3ZDYB 3SY0B 3KVPA 4PR5A 1USZA 2O72A 5DEGA 1U3HB 4F3FA 3P1VA 2P8LA 2XA8L 4M62L 4ZFOA 4MS8C 3LNIA 4F57H 4AM0B 1DCEA 4ZD3H 3C5SB 3SQBA 4K3GA 5DJ6A 5D5MA 1ILUA 3VYOA 4LEXH 4LSVL 3IYLW 5AW4B 1H6FA 3LZNA 4ZTPL 4MWFB 4A2DA 4KDWA 4MZ2A 2QHLA 3DWTA 2CMRL 3PLYA 3LN9A 1TCRB 1UKSA 3VFTA 4XR8C 1IAKB 4HC1L 3UAFA 2DOCA 4PTTA 3R1GH 4XGZA 5AAPA 2L0DA 4QI3A 1JNJA 3RWCA 3BPNC 5EUKB 3D33A 1UOLA 5FOBB 1CFTA 2NNCA 1NL0H 4HQQL 2CBOA 3DSFH 5JQ6H 4M6ML 4L4TE 4N2DA 5EFIB 4WDIA 3KYOA 1TZHA 4G9DB 4LKCA 5C0RL 1FVCB 3NT0A 4G7VH 5GS3A 3SBWA 1N5YH 1J0JA 1B0RB 3NJMA 3L08A 2F53A 4K5LA 3MUGB 1AQHA 2JKLA 4QPEA 4X7DC 4ODWB 2ZKHH 4P2QD 3II1A 5HGDB 3BEWA 2MHAB 1OE2A 2Z64C 4F2MA 1K8IB 3HFML 2AK1L 3LNFA 3RWHB 3RVTD 2VW7A 1XB8A 2A1WH 4L2YA 5D1ZA 2VERA 1EZVY 3BYTA 2VT0A 5ESAA 3S88L 3QNXA 2X89D 4IRSD 5ICXB 3ME0A 4CMMB 3GLDA 1FG2A 2XY2A 2ZXGA 3CDCA 3BEVA 5E1AB 3GTNA 4MDRA 3KYNB 4V33A 1OPOA 3S4SG 1PFOA 2CJTA 1AZBA 4XP5L 4I8DA 4DKEH 1XGQA 4TSCL 3D52A 3C8DA 2Z7WA 4KTDH 3QDME 4BRJA 1WUNT 3MX0B 5GPRA 2L7EA 3VG0L 2IALA 1R3JB 3B37A 3FT2B 4ZOEA 5J11C 4HPYL 5F9AC 3ZDWA 1INQB 3L6FB 2FX7H 2IOIA 4TQIA 3E38A 2BW5A 3IN0A 4BWTA 3RJOA 4XI5C 2O6DA 3NN8A 3P69A 2RD0A 2P8MB 3MO1B 4H0GA 3QE5A 4R0LA 2VN7A 4LSPH 2FEEI 2CRZA 2H2SD 3A6CH 4IU3B 2GITB 1RZ8B 4K94H 5I1LB 4JO4L 1D5IL 4M48H 1TYEB 3BE1H 3SQRA 1BD2A 4WI6A 1DVTA 3COOA 4BXSV 1IGJA 3QO1B 4LSSH 1YJDH 4PS7A 1S3KL 1BX2B 3P11H 5IB3A 3OR6B 4HKXA 3WXWL 4D2NA 1U9KA 4Z7OE 2YKLL 5CBEA 1YEIH 4BCXA 1RMFH 2AKRA 4DOHB 1IT9H 1B4JH 5ENWB 3T0BA 4ZAKC 5TGBA 2XX0A 3Q8FA 2O26U 2AQRA 5TDPB 1NGQL 3MRBB 4QYOA 3FYEB 1M7DA 2G4GA 4KKRA 2WXLA 2O5XH 5AAWA 3U46A 3KPRD 4Y0GA 3BUBA 2BHFA 4Q4EA 4PU2A 4YDIL 3HI5H 4PIBA 2MPAH 2NOYA 2WCGA 4YHZL 2VW6A 1M71A 3G08A 1CGUA 5D1XC 1LK2B 3D2UD 4GXFA 4DIXA 4DP5X 4EI5A 4S0SD 1IZKA 3H55A 4YC2C 2OR9H 3W0WA 2HJFB 4FI8A 4I2XB 5IHUL 2BSTA 4RDQF 5EC2A 3UTQA 2VABA 3ZHDA 3S5LB 3VFSB 3GM0A 3WFZA 4TVUA 3O2VH 3LDBB 4EXPX 4Q9QH 2VM4A 1YG9A 4WO4C 2OYMA 1FVDB 1CD1B 3CQQA 4NRYA 1AKJD 4OIBA 1E42A 1R3LA 2BSDA 4TVSa 5FECB 2CO7A 2GJ6B 3N3EA 4HV8A 1IQWH 4GQZA 4J3OG 4JFEB 2PP8A 2EDDA 5EUOB 2UZIH 4TSAL 1DJIA 1OCZB 1A14L 3FW6A 4JRXE 5FM5O 5AOKA 3F7LA 4QHUB 3QDJD 2K45A 2AGJH 5FLUA 4UILH 3P77B 4H1LH 3BSZH 3IDMA 4Y2NA 1G1OA 3AMKA 4AUJA 4WUKH 3DTXA 4PJBF 3TA3D 4Y5XA 3QPQD 1M2VB 2R9HD 3MA7A 2W38A 2Q86B 4AJYV 4P5MA 1EJ6A 3FSWA 4P06A 4IBYA 5B38B 4U6TA 2OCFD 1G94A 5D4IA 5D7KD 2E76C 2GK2A 1UGKA 1R3IH 3PFUA 1BMZA 3Q44A 1TJHL 2Q8AH 5I8KL 2CDFB 5EEUA 1EO7A 1U8KA 5EBLB 2AQTA 4HH9B 1TLMA 2ADGB 5IVXA 4ODXA 3NACH 2PXYD 4J27A 2XZCH 4NC0B 3W1ZA 2QLYA 1CN4A 4BQBA 2R0KH 1DLHA 3K81A 4GG6B 1EXHA 4KQ3H 3SKJL 2J4WL 1MF2L 3PDDA 4AH2B 2CLZB 4L37B 1A1OA 3QZBA 3FT1A 3TLRA 3VXMB 5JOEA 4OM0L 4RCAA 2BP0B 2JF1A 5FK9A 2WIIA 4A7TA 3B9KA 1Y1UA 2DLHA 2X70A 2BCKA 2OMWA 3LJ3A 2R23A 4G42B 4P2OC 2PTTB 4FFYH 3K8KA 1G7MA 1KENL 2FECI 5D1ZI 4NUMA 5E7FA 3TBYA 3B3IA 1AHMA 3UTTA 1B2YA 4PRNA 5DA0B 3IDIA 1QO3A 2GAZB 4LBEB 4PJIF 4W9IC 4XP6H 4XAWL 1UENA 3QIBD 2ZUVA 3BXNB 3V5HA 4F33B 6TAAA 1OSZA 4KRMB 5EA0H 2FJHA 3AB0B 5KANI 3BQUC 2DKMA 1ZLUH 2X05A 1D5RA 3HVNA 2X6AA 1IGCH 3ARFB 3LS5L 4MA8H 1IAII 4IBSA 1J5OL 1WO2A 3L45A 4J3BA 5D5MF 2Q10A 2CJUL 3MRLB 3I6KB 4XP4L 5HYSA 1W8OA 4L18A 5JHDE 2EH7H 5LGJB 1FAIL 2CHXA 2WINB 2VDQB 3ARPA 5MENB 3BWZA 2UY7B 2A0LD 1FV1B 1WYJA 5GS0L 3N9GH 3QFJA 4FJZA 1T2JA 4HDIA 1T6BX 1KC5H 2ENSA 2IBZY 3K2IA 3ZT7A 2E9BA 3DRTA 3U36A 2V3FA 1YEFL 3HZYB 2B1OA 4WI7A 3UAJA 3RFZA 2E7LA 3HRPA 3GJFB 3JV5A 5K9QI 3DMMB 1KTRL 5E6ZA 1XH3B 2EYTB 4L8CB 1T1XA 4K8RH 1ESOA 1Q9WA 3ZO9A 5DT1H 4ZFGL 3J8F7 2ZICA 4LZKA 4WTQA 5MP6H 1WLHA 2GSIB 1RJZA 4FFWC 5DSCA 3MACL 4NKDB 1S9KC 3BLPX 1AD0A 1ZSDB 2W91A 4LDCA 2YGPA 1A6WL 1UACH 5GGRB 1VLXA 1JFHA 4JQVA 4CSPA 4Y5VC 3RVVD 4ONOA 4R96B 4Z77B 1WFOA 3V0HA 4PJ9D 1E2VA 2XWBB 3K6OA 1ND0B 5F7DB 1E40A 1JFQL 3E80A 4LL9A 4P57A 4U31A 2WLIB 3CLEL 3HZVB 4LXFA 5IB1A 2FIKA 1ADQL 4A2LA 3NSJA 1RPUA 3ISYA 3QCTL 5LAXA 2CK0H 3RUGE 3V4VA 3KWWA 1RZ7H 1XF5B 1PG7L 1FIGH 3HE7B 5BQDA 2E9IA 4JANB 3KCPA 4JFFA 1X5HA 3WO4C 5CIPA 2X0VA 1K6QH 4HMDA 2R4SL 5JW4R 3DX9B 3HS8A 2XRAH 3MRHA 3OPUA 4PHZA 1KN2L 1KIQA 3C6SA 4KTYA 2EE0A 4IDJL 3WKML 5IJVB 3FPXA 3DX1A 1H9VA 4CC0A 1SLUA 3BWSA 4UTCA 3VI4B 4HEMA 3RGVB 3ULUC 4JREC 2NR6C 1PZ3A 2G30A 5C09E 5CP3H 3VGGA 1VGKA 5KG9A 3TBTA 4D9LH 3TN0D 1HSBA 2W65B 1JP5A 2ORBH 3CH8A 1ONQB 1MDAA 2GUOA 2X2IA 5IFJB 1AHWC 2A4ZA 1I53A 5DUJA 3GI8H 1DLFL 5LN4A 3W11D 3B8YA 3DTDA 5JIQA 2IBBA 3KJ4C 4RVBA 5JHLA 5D2NE 1WC7B 1YNKH 5KUMA 1CBVL 1ML0A 3PQYE 1IE5A 1P7KB 2G9HB 3MRPA 1ZT1B 1N3NA 2BP8B 4UNTA 5FR3A 4IJ3C 1FCGA 4PJ5E 2MSPA 1DVXA 1G6VK 1B6DA 1RUQL 2GBVA 4MJHA 4MSWA 2PTVA 2FZ3A 3FMGL 4R26H 5ETUB 2PW1B 2C26A 2VLLB 4X7TA 3H3PH 5I16B 4PJEF 1CD0A 1M53A 1RPQA 4D7PA 2YD5A 5KN5A 4B9YA 1DSFH 1SQ2N 3UO1L 1SY6A 4LT7A 2VDRL 3HC4H 2Z8RA 1GC1L 2P5ED 3LH2H 4HCRL 3B4NA 4NIYE 3FTSA 2YAQA 3D25A 4YHIA 3T0XA 3ZMEA 1G1YA 2XXMB 1C5DA 1LO0H 2C9PA 1U93B 1ZJAA 1W80A 2BVQB 5HYJE 2CO3A 3BRFA 4NQCD 1SMOA 3TJPA 5GZND 3MRKA 4G59C 4F5CA 2XI9A 3RY6A 4GW1A 3L4CA 3QI9D 1B4RA 2NX5A 1M57B 5EU6B 5I1KL 4Y5YA 5FYJD 3GUFA 5H4YA 5FWRA 4KUCF 4OFYD 4P46B 1FRGH 5C0JA 2QR0B 3VAEA 2P1YA 2IF7A 4QHLB 3E3QC 1WFTA 3JWNH 5IB2A 2WWOA 3MLRH 1T20B 3VWKC 4AKQA 5J6HB 4L1SA 3ZRFC 5DJAA 4HF5H 4QRSA 4EAEA 4HG4K 2FL5A 1UD6A 3S3PA 1DJHA 4GG8B 3QQ9C 3WLWD 4KMTL 3UJJL 3RGHA 3Q3GB 2BIOA 1UM4L 3VW3L 1GZPA 3SY0A 4ANUA 4UTBL 1CICB 4PBDA 4X5WB 2TAAA 2WWNA 3OKEB 1WZKA 3VMOA 4H8QA 3T1FA 4R7VA 4TL4A 2QBWA 4QF1B 4CA4A 1R24B 2FYYA 3C5SA 2ICWB 4QKXB 5J1SC 5KVFL 3S36H 2KQNA 4ELMB 4F7TB 3IE9A 1ZA6A 4AYMC 5HDLA 3PXJA 2WXIA 5F97E 1DTUA 1V55B 4IOSA 1FFOB 3CVCA 3MR9B 2OMXB 4LEOA 1VGEH 4UQCA 4NKQB 2UWEA 3QAZB 3MRGB 4OCNC 1L3NA 2DQUH 4TUKL 4UYPA 3N41F 4OBRA 2QSCL 4RH4A 1OXYA 1YPZF 4PV8A 5IVXF 1E5AA 1IAKA 2CO6B 3HC0B 1RZKH 3HE6A 3NCFB 4LDOB 4LP5A 4XVUC 3TH2T 3F3HA 3LIZL 5M95B 4FNLH 1YEDA 4WI4A 3NA4A 2Y7OA 4PCYA 1AS8A 5IBLD 4PWFA 5PCYA 1I1YA 3LH8A 5I23A 4G9DA 5F3BB 1R5VB 3P4OA 5MI0C 4JKPH 4GKLA 4P2QE 5DVKA 1CR9H 1L9TA 4BFNA 2G5BB 2X89A 4ZMQA 2Y07L 3FFCB 4MD4B 4Y2OA 1BXUA 5A3ID 4ODTL 2QSQA 5IROA 1PX3A 3SD2A 4E42B 5IKCB 3RWHA 3LXBA 4QRRD 3L3KB 4MA1C 1I1AB 4YQXH 1FFNA 2EDMA 1KGUA 5E2UH 1NDTA 5KVDH 4NFDA 4JUTA 4CMMA 3F6IA 4UIKL 3AS2A 5AL8A 3L13A 3GRWA 2G4EA 4LP4A 3GS0A 5IBUB 3B83A 5J0BA 4HU8A 1MI5D 3L4YA 1VEOA 5E2TL 2V2TA 4LASL 4YLBA 3MGOB 4AV5A 3ZSTA 5JXEC 1ITCA 1F11A 1JTPA 4AYID 4G8GB 4GKSA 1AS7A 4NZDA 5I2IA 3UYRL 4O00A 5E6IA 4GY4A 5J11B 4PLKC 4KO7A 1KPVB 1SVBA 3O3EB 4AGLA 3DVGB 2NNAB 1R1CA 1JGDB 1A7RL 1DVFA 3L6FA 4LHUB 4OFIA 3SPJA 1IJ9A 4L3EA 3DPDA 2DQEH 1G7PB 4YXHH 2A6IA 4UT9A 2XVKA 1TETH 5D6DA 3MO1A 5K9JH 4JPSA 4N2IA 5MHSD 1G7LB 4XI5D 1BF8A 1NLDL 2CU9A 4J2XA 1G9HA 3IAPA 4KY1H 4Y9EA 1ASPA 4LARL 5C2UB 5L0QC 1A6TB 5BQ7A 4YE0A 4X6DB 1FO0H 1RZGB 2EDYA 4NYLB 4ZMWA 4JM2C 1MQKL 1OTTC 2OW6A 3RURA 3VQLA 3AG4B 3U83A 4NNXB 2HG0A 4H20L 2FWSA 1YEKH 2JQAA 4XH2B 15C8H 1KTDA 3V0FA 3CFNA 2R29H 4QRPD 5DZNA 3B7YA 3MRFB 2AJSL 4PY8J 4GSXA 1QKZH 5DS8B 3PNWB 3TO4D 3UC0H 1LWRA 4K23L 5IREA 4IBVA 1MFUA 2EDNA 4J3OH 4PTUA 1NCGA 4OCXH 1JZ6A 2C5DC 2WMPB 3GSXB 3QFDA 4XVTL 4J4PC 4B7LA 3MRBA 4K3EH 3KPRE 2GY5A 5ADPH 3FB8A 1KPUA 3K2KA 3FJTA 3D2UA 3V6OC 1EJOH 4BIKA 2ZIDA 4AEEA 5HVHC 3RAJH 4KKBD 4FA6A 1RH8A 3DROA 1YUHA 1JD9A 2R69H 4JVPA 1H5BB 2CHDA 1G9NH 5HSFA 5FKPA 1I7UA 1XL6A 3DARA 5D1XB 1MAJA 3LPOA 4G6KL 4YC2B 4BUHA 4C4KO 3WFBH 3VGBA 2A9AA 1NC4A 1MFBL 5TQ0L 3U0WL 2Y7SA 3FFOA 5T1MB 4QRQB 2ZWNA 4RISL 1L3WA 3QZMA 1AKJA 2WUCL 4FTVE 2KLSA 4I77H 1VRSA 4R97C 1TDQA 3MLZH 1WITA 3MOQA 4J8RB 1JZ3A 3S8GB 2GCYB 1FVDA 1NPNA 5J57B 3EG9B 2LVCA 2ZX9A 3WTYA 1QFWI 2VAJA 1SOSA 1S78C 2GJ6A 1X6LA 1GXEA 1JWUB 1QACA 1S7TB 4JFEA 3VRIA 3GUTB 2EDXA 2GFBB 4TQEL 2BC4A 3MOAL 4CDGC 3ERXA 3RIAF 1LO4H 1IAMA 4EKXA 4ZRGA 3EHBC 3QDJE 1F00I 5HPOA 3AAZB 3TA3A 3PHOB 4Z7UB 1KN4H 2W0FB 3IE4A 1GKEA 3REVB 2YC1A 1UWXH 2H41A 3N44F 4JZOB 2Q1EA 2OV0A 1ZAGA 2OX5B 1ZDQA 1HOCB 3WOVA 4QTIL 5EDXA 5D7KE 3VFWB 3D51A 4M1CC 3VD7A 4BZ1H 2NY1D 2WLYA 3J7HA 5I0ZA 4R6UA 4HJ0C 4G1EB 3BIKB 3GK8L 4TNFA 4FI7A 2DWDB 1RULL 4ZX3A 2VITA 3H2PA 2V33A 1PD0A 5T1LB 5JA9A 3TS8A 1KLGA 5EIIB 3FXIC 1RKRA 4N0UE 5DTFB 4H0LC 3KR3L 3BVNB 1XR8A 4C4KT 1A4JB 2XWJA 3PGFH 4P07A 4JR9H 4JKKA 1IBFA 2XVBA 4AH2A 1NLBL 2G3MA 1I7TB 5EO0B 1FL5B 3UBXB 4KITB 4HBCH 5CEYB 1UB5B 4NS0A 3VXMA 3VD0A 4YBQD 2C3HA 5CJ5A 2BP0A 4QOKD 3AROA 4HJUA 2NXYD 5CGYD 1S5HA 5HI5C 1Y1DA 3QHZH 2G2PA 4U49A 4KDVA 2YWYA 4Z7QE 5C1MB 1FH2A 2I24N 4MQ7B 3AM8C 2CKNA 1FSKC 3SPIA 4BFKA 3I02B 1ZD6A 4AVKA 5KYYB 3UPRA 3RB7A 4ZXBA 4WV1C 3NFNA 5FHAH 3QUYC 1WLGA 4YBLC 3KPNB 3UTSD 3C5JA 3WEOA 1UOKA 4KI5C 3GPEA 4OCRL 4LCYB 2LVEA 4DZ8A 3ZDYF 1NGXB 1VDGA 2MTPA 4F33A 3QZNA 4G2AA 2G5UA 3QXUA 4D0BB 3BQUB 1IGTB 3UPCA 4KJPC 1C7TA 1SM3H 4JFYB 4ICWA 3MNDA 4X6EB 4IBQA 4U1MB 3NZ8B 3BZDA 2F5BH 2F54B 2XVGA 4AEHL 4U1SA 1E7UA 2GTZB 3I6KA 5JNYB 1T83A 4UZSA 5B21A 3UBFA 4BFRA 2UWEF 3PHQB 4DKFH 1GHFL 1PKOA 1WICA 3IRCA 5A6MA 1TZOA 3Q6FB 2C1PB 1BBJB 1E0OB 1CF1A 2L4OA 4KDTC 3WE6A 1JZFA 2ZOKA 4M62H 1YN6B 4AIOA 3CCHA 3M7OA 5KJRL 4U0RB 3UCQA 5DLML 3P30L 5E8PB 3NIDB 4GP4B 3DMMA 1NJ9B 4LSVH 4MD0B 3CE1A 5AB2A 3HC2A 4HAGA 4IMKC 2CMRH 2XBDA 4FHKA 1H3TA 4HC1H 4NC1E 4ONHB 2GSIA 4FMKA 4HLZH 2FO4B 2IXQB 4BCYA 1NOFA 4NKDA 5IUCA 4PJ9A 4B0MM 1NEZB 2SEBB 1DJWA 1LNUB 2EXSA 2ZXDA 3NCJL 4HQQH 4NDMA 2BS8A 4GO6B 1N59B 4FFWD 3VXPA 5D4QA 4NN5C 3V0AC 5C0RH 4HUUB 1DEEA 3O6FA 4NOBA 2YA1A 3V4PA 2R2HB 2XPZA 4WKXA 3HZVA 4XPHH 1X5LA 4RGNB 1EUUA 3E0GA 3WL9A 4ALAL 2XTLA 4EQ3A 4WW1B 4ACPA 1WVZA 2NSMA 3FRPA 3HFMH 3EYOA 2AK1H 2CO4A 3UMNA 3RL1A 5FA4A 1J8SA 1XF5A 3RG1C 3S88H 2E9GA 4EIUA 4LIQE 3AWEA 3WO4B 4N2HA 1A4AA 5AVQB 1FFQA 3ESPA 1HKLL 1BXAA 1T7XA 1MNNA 2WP3O 5FCSH 3VM7A 1GRWA 1J05B 4XP5H 5F9WC 4TSCH 1OV8A 2EKSA 2HFEA 3BAYA 4HH8A 1P7QB 3FRUB 3ABGA 4K15A 2UY6A 3VG0H 3U4EB 2A77L 1FN4B 3L3DB 3SO3C 4XMZA 1HZKA 1QRND 2WWKO 3VX1A 1UCBL 3MV9D 2W65A 4HPYH 2GC4C 1F4YL 4POYA 4O9HL 1FZMB 1AHWB 5IFJA 3UZEA 1KXTB 1NKOA 2DM7A 3FSVA 2WYZA 1EVUA 4XCCL 2X0WA 5I8CB 4XTRC 2DJMA 2YMTA 2A4EA 3OB0K 1MFCL 5DFVD 1HXKA 4Q6IC 5AUMA 1KT2B 4KJQC 3LQZA 3TVMD 5K9KA 5F72S 2JSFA 4IJ3B 1RD6A 4JO4H 1D5IH 5KVGL 2HH0L 2DQHL 2VQ1A 2OI9B 2H32A 4GUPB 2UVEA 2VLLA 2DWYA 2DV6A 5DRZB 2C3WA 3O8XD 1S3KH 5I16A 4JMNA 1SPDA 4WFGD 3MBWA 2IDTA 2P5EE 1U92A 3WXWH 4KZDH 1QD0A 1BIIA 2CLVB 3Q5YA 4D3CL 1KCSH 4HBQA 1QVOB 3F58L 1BQSA 2YKLH 2GB2A 4CNIB 4RGOL 5DI8B 2NNXA 4NQCE 5HGAA 1HWGB 5I9QB 1WWBX 1LWHA 3V6BR 2VRKA 3SJVD 2CSPA 3DRQB 2F68X 2J25A 3NK3A 3ZE0E 4OFYA 5FYJE 3A6OA 1K72A 3LKPB 5B7EA 4JGMA 1NGQH 1ETB1 5E0FA 3F7VB 1U2YA 5D1QB 3NMEA 4OVUA 5BW7A 2IMMA 4N8VG 3EJYC 5DHDA 2VL4A 4U1HB 4UZUA 4YDIH 3VDAA 5HVWA 3BIAX 4YHZH 3HB3C 4QHLA 1U33A 4X4XA 3JWOC 3VWKB 4HISA 2L7JA 2VTFA 1T20A 3VXUB 3S34L 4QCIA 2WOYA 5EUOF 5FGCE 1K2DB 5IMKA 5I66B 3VVVA 5I0DA 2NW3A 4C47A 1OOAA 4MMYA 4OIIH 3PGDA 1CK0H 4W9CC 1HHHB 2AERT 5INDB 1PG7W 1QEWB 4X5WA 4BFIA 3CX2A 3PS6A 4JHZA 1BZ7A 1R24A 3NABL 4TSAH 1MW1A 4MAUL 4HPOH 1CGWA 1BFVL 4NP4L 1EHNA 2X4NB 3TL5A 1FFOA 4UBDC 1Y0LB 3MR9A 1HHJA 2GTQA 2JK5B 2Y3NA 3EDDA 4PJ6A 5D70L 3CMOH 2NY7L 3N42B 1J7VR 4I1NB 4NQUA 4O4YH 1A65A 1HNGA 2CO6A 1CGTA 4HP5A 2EYRB 2APWA 4W9FC 4BGLA 3HAEG 4PRPD 1HZHH 1ZOXA 1ED3B 3WY1A 4Z3TA 5JO5A 1S9VA 3GSQA 5J89A 3CMGA 3S4SB 5D7JC 4KKCD 1X5ZA 1U8NB 3V55A 1TJHH 3R19A 3BVWA 4HS6A 3QQ4A 5MI0B 1H0DB 1R5VA 5I8KH 2KPNA 1ZLSL 3K0WA 2HX7A 4NO0B 3UYOD 4X9HA 1MELA 3SDDC 3RX7A 3IS1X 3BD3A 4QRRE 2P52A 3GBML 1DBJL 4RRPM 3SKJH 4F7EB 2J4WH 1MF2H 4RGMC 2ARWA 1F0LA 4OD2B 4ZOAA 4PGZA 1MCRA 1P1ZB 4P2RB 4XBPB 4OZGA 3TZVC 1XGRA 5F89B 3CFBB 5A40E 4OM0H 3W82A 4QRUA 1X7QA 1MI5E 1NBZA 4LLYB 4HSAC 4OZGE 5B1CA 3B7UX 1ORSB 1JGIA 5FXCH 1X9RA 3ZIMA 2R0WL 4KTEH 3C9NB 5EB9A 3E1ZA 3NPZB 3WY3A 5L6YL 3KGUA 3IN2A 3MGOA 1U95B 5GGQL 3CFJB 3SDCC 3I6SA 4J6IA 3ROOB 4G8GA 1M9SA 2EUWA 4MNGA 2D9CA 1MCEA 1RU9H 2EXWD 5CZXD 1QASA 9CGTA 3G5WA 4XAWH 1OT2A 3QORC 1JL8A 3DJSA 1EXGA 3CZLA 1M7IB 1YRKA 3O2DA 4AJ0A 3IDGB 1YECL 1U8OB 2Y4SA 3AACA 1G7PA 3IDYC 3LV3B 1SEQL 5MHSE 1LE5B 4LIQL 3DURB 3MPCA 1LGVA 1V54B 3SKMA 3S37L 4ZSOA 4QXUH 4HUXB 3VCLA 4YHYC 3TGXA 1F56A 5DLLA 1G7LA 2YEVB 4K07A 4ZFFA 4OCSL 2H47C 2WANA 1FYTA 4KQ4L 4XP4H 2QADC 2XZQL 3ARDC 3CSTA 4KXZH 2RIKA 3UO8B 1OAUL 5L9DH 1HZLA 3ZTEA 4PRBA 2KZWA 1LD9B 4M02A 1U2HA 4JM2B 4CRPA 4F37F 1PL3A 1L7IL 4JEGB 2H3NA 3TO4A 4PJCE 4IGBD 4QRPE 4RA0C 3ZZSA 2QKIC 3NRPA 1OANA 4EI6A 2D31A 2YXWA 4JFQB 3FZUD 3GMQA 1M3IA 2HWZL 5E4AA 5DS8A 1RUKH 1N9PA 2ZSWB 2OYLA 5DHEA 4ZFGH 3QXTA 4ZAKA 4X9BA 3VRJB 4FE9A 3GSXA 4J28A 5FEBA 3IGUA 3MACH 2F7OA 5AENA 3ML9A 4A39A 4FCHA 2EZ0C 4XZUB 1A6WH 5HVHB 4FDWA 4HETA 2J3SA 4HJSA 5D4HA 3VA6A 1YDPB 3I9AA 4U7SA 4YDJA 5EZLB 1ORQA 3PYCA 1JFQH 3WIIL 4BINA 4RNRA 2BVUA 2YRLA 4LOEA 3CLEH 4NM8H 5BJTB 1CXFA 4N9GA 5LN8A 3IU3B 4PVNA 1ADQH 2UYLB 4XBGB 5JPNB 3GNML 4PP2B 4QRQA 5DK0A 1RK0B 1E8ZA 5GGTH 3UG4A 3QCTH 4MBOA 3VI4F 4ZPTB 3KD4A 4R97B 1IC4L 4MZIA 4A2FA 5K9OB 3CHRA 1PG7H 5CJQL 1L5GA 4WO4A 2RHEA 2A38A 3BD5A 4FQXB 1YEGL 5ESVB 2GCYA 4RZCA 5FYJL 5BZWA 1IKFL 4ZT1A 2R4SH 2VDMB 3EDFA 1JN6B 1LYQA 1YEJL 3RTLA 1KN2H 2GFBA 5HHOB 2Y2YA 4IDJH 4OCWL 1T89C 3EHBB 4LAQH 1IIKA 2P28B 3WJJC 3I9IA 5CD3B 1JYWA 1I8IA 3HPLA 1KBVA 1LMIA 1KG0A 5I76B 4WU5A 5M94B 4OZIE 2HFGL 4N9OB 3FQXB 3G6AB 4JZOA 2AS5M 5C97A 1J0YA 2OX5A 4L5FE 1KJMA 3GDCA 1RZJC 3ARBD 5IR1A 3UOAB 3U2SB 1NDGB 3GSUA 3T8XA 1KXQE 1XQ4A 4XOBA 2LE9A 3J07A 4Y2LA 3BIKA 3E6FA 1K8DB 2FJGA 4ZZFA 3ULVC 4MJID 1XIWC 4AMXA 3DXAD 1SVCP 3FONA 3OGOE 4BH7A 4PG2C 2APSA 2YUXA 5LQBH 4YSSA 1Z3GL 2YN3A 2YKKA 3FMGH 4B9GA 3GKZA 2EYSA 3CSYA 4QOKA 2OXHB 2VWEC 5HGHB 2V0AA 5CXPA 2ZCLL 4ODUB 5F7KC 5KSUA 4WAFA 5EO0A 1FL5A 4HU2A 4QOKE 3JV0A 3UO1H 2EVJA 3GMRB 3GHBL 4YK4C 2H6UA 1GC1H 3B6SB 1EVTC 1MJUL 5B1AB 4B95C 2V2WA 5HD8C 4NO3B 1B0WA 2DLTA 5KS9E 1D5ZA 5L8JB 4P2OA 2BRQA 3FTVA 2WXNA 4HOZA 5KYYA 2VXQL 2VJ0A 4WV1B 1PS3A 3UTSE 1JXFA 4GSQA 3AREB 3QUYB 4ANWA 4YBLB 3LZPA 4YVNA 3VTMA 3QXDB 5F7UA 5KBDA 2R7EB 3RHWK 1CGSL 2ZWSA 4MDIB 4AIZB 3KNBA 5MEOA 5TD4A 3RVUC 1R5WA 2QVIA 3QJSB 5E99L 4Z0XB 1NCJA 1VJSA 4V11A 5C9JA 1QQDB 1AZZC 4DPBX 3IF1B 1DO5A 2JCWA 4J5VA 4PVBA 2YHGA 2JKIS 1KNOB 1Z9SA 1DQKA 3KDMA 3PY9A 4MS6A 3V10A 2Q9OA 4ELMF 2F54A 1Z2KA 3BUTA 4K2UL 3FCTA 2H8PB 4OD3L 3N1PC 1P69B 4BBWA 4KMTH 3UJJH 2ZJSH 4MNQD 4WI5A 3PHQA 3VW3H 5DJ8B 3EYQD 2P47B 4LF3B 1F45A 2NYZA 5F9DC 4OBSA 2C1PA 5FF6A 1BBJA 3TJHC 4Y4FD 4OLVL 4KBPA 5FFOA 1E6JL 1FZOB 3EGDA 3MLVL 1YN6A 3T2PA 4A04A 1IFRA 3AUWB 2DIEA 1AQKL 3FQ1A 3GXFA 3IU4L 4MYWB 2BZDA 4PJGE 1SXSA 2YMX