4UT9A

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
395
structure length
377
Chain Sequence
MRCIGISNRDFVEGVVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEGKEIKITPQTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
total genus 63
structure length 377
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ut9A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4ut9A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4ut9A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4ut9A03
2HG0A 1OK8A 4GT0A 5KVGE 5LBSA 3N42F 5KVDE 3N40F 4FFYA 4FG0A 5LCVA 4FFZA 2JSFA 2JV6A 3C6EA 4UT9A 1PJWA 4BZ1A 5LBVA 5GZOA 4AL8C 2V33A 3J2PA 1RERA 3UYPB 4AM0Q 3UC0A 3G7TA 4UT6A 5H37A 5IZ7A 1OKEA 1ZTXE 2JQMA 3P54A 1URZA 2R69A 3MUUA 5KVFE 2R29A 4UTCA 3UAJA 1OANA 2GG1A 4UTAA 5JHMA 3IRCA 5KVEE 5AAWC 3N43F 5GZNA 1UZGA 3J27A 3N41F 4L5FE 5B1CA 3WE1A 4ALAC 2ALAA 1S6NA 3UZEC 4BZ2A 4UTBA 1Z66A 5JHLA 5AAMC 2P5PA 2H0PA 1Z3RA 3N44F 3UZVA 1SVBA 2I69A 4GSXA 3VTTA 3UZQB 5IREA 1TG8A 3I50E 3C5XA 4X42A
chains in the Genus database with same CATH superfamily
4X9HA 2NZ9D 4KI5D 5F0PB 3DIVA 1IILE 3KLKA 1WZ1L 3WTVA 1TOXA 1J5OL 3D4CA 4LRIC 5EU7E 4RWYL 1T22A 1HL9A 5IBLD 1PX3A 3Q2VA 2QADB 1G0YR 5I73C 5BRZD 2YJLA 4RGMB 4AQAA 1PZ5B 2V2TB 4H26B 1TO5A 1AGEA 4UOJA 3JTBA 3WELA 2CA4A 4JPKH 4PLJD 1JUFA 2IF7A 3D25A 3NGBB 5IJVB 2DYPB 3KPRD 1FIGH 3OVUB 2MHAA 2V33A 2YN3A 1FUNA 5BO1H 4Z7WE 5AB9A 4OGXH 2WTRB 1X4ZA 3HI6L 4AJYV 5HYEA 1VGEL 4XMLH 3ZMRA 1T21A 2PWEA 4GO9A 1WC7B 1MCBA 3V4PA 4JPSA 5HBBA 2FNBA 3SCMC 1CLZL 4BSVA 5IUCA 1AZVA 3P0YL 2NYZA 4KHTL 1S7XB 1M7IA 1A64A 2HKHL 3H3KA 3VGAB 4JG0H 3JV4A 3KH3A 2IMNA 3TVMA 4IRZL 4LAQH 3MRGA 1U8QA 4LF3A 5FEBA 2J73A 2VZ3A 3G5VB 3EJZD 2ZX5A 3QPXH 4WO0A 4TUJB 3KJ4C 1RPUA 1S78D 1JVKA 1ZVSB 3KYMB 3SBRA 3T04D 3TWCH 4J3OD 3CFEA 3BYYA 4R2GB 2NY4C 3F8UB 1YQVL 3MV8E 4A1RA 4FP8H 4LEXH 2GC7C 1WCQA 4Q6IC 4QHMA 2O61B 2VMJA 1TTRA 3LSOB 4EZMA 3O4LD 4LSUH 3KMDA 1GOHA 5FGCE 3UZVA 5A16A 4FMKA 2W9EL 1R3HA 1QPKA 5AUMA 5EEUA 3LKRA 1U8JB 5D71H 1Q9OB 3T4AB 3B6SA 4WU5A 1F00I 4MNGE 2Z7UA 1J5DA 1U2CA 1ZVYA 1OHZA 5D7LB 1MI5D 5D2NE 5BV7H 3U9PH 1IGCH 1NSNL 2VE6A 1J48A 1ZPUA 3LEVH 3BRDA 3VSTA 5JIPA 1XHHA 4JHUA 3IDJA 4JAMB 3RIFK 4P9ML 1FYTD 3CBRA 3HAEA 3OSVA 1JERA 2NCMA 3IFNH 4AYSA 1QA9A 4LOVA 2RR3A 1SQMA 4P2RA 1I9RH 5DI8B 3TO2B 2R4RL 1G0DA 4NZJA 2P24B 3EOAA 4HFWA 3DXAE 5HI3D 1BF8A 4IGBC 3ARGB 4MJJA 2V7NB 1Q9LB 2QL1A 4F8LA 5JOPE 4XI5C 4QLRA 1U8IA 3QXTA 1M6OA 4ISVB 3UBXA 1GTNA 1O7DE 3C5ZA 2WQRA 2VZUA 2PLTA 4X9YA 3VI3B 4J28A 2A83A 1ZANH 2XWXA 1KLFB 3HG3A 2BCMA 4TUKH 3RWJB 1OPGH 4RMVA 5FM5O 3LKNB 3IGLA 1GS7A 3ELQA 4NIYE 3REVA 1AQ8A 4KI5C 1KMGA 4RMRA 5TDNA 5E4AA 5IB3B 3QFDB 3HBPA 4HIEA 4NCC1 4M02A 2D03L 4UIMA 4FKEA 4HEME 1F97A 3BD3A 1R3IL 4LCWD 1NJ9B 5DS2A 4UZGA 4D0CA 1SJMA 2QHRH 3NJGA 3H4HA 2BY1A 4RBPK 1BGXH 3EJUA 2D7PA 1XL4A 3U2HA 1A0QH 5BS0B 4XCCH 4A68A 4XOCA 1FNEB 1SEQL 3FQNB 5T33L 1BMGA 5IVXE 2D31B 2GTQA 2WIIB 4NZRL 1FI8C 4JRXB 5FA4A 2I5YH 3NT0A 1B90A 4RMQA 1NFDB 1K3IA 3X3FH 4LSSH 1OGTA 1KJMB 1JGEA 1T3FA 4E9YA 1CFTB 4N6QA 3O4OC 3QUML 4KKPA 1U30A 4UBDC 5DK3A 2BJMH 3P73B 1LL1A 1ZLVK 4RAVB 4YSUA 2Z8VC 3NSJA 1MHHA 1YMMA 2Y7SA 3EGDA 5E8EA 1KYOJ 3ECBB 2FUQA 5F3HA 4ODWB 3N5AA 5GRJL 4APXA 7TAAA 5JQHC 4P9HL 2FJHA 1M71B 4LPVA 3UTSD 5ENWA 1WHPA 1BW8A 3U83A 4KOBA 4FQIH 1YVLA 3GI8L 2APBA 3BP7A 4WLCA 2VIRA 3BUBA 5FDWB 3VQLA 2R0ZH 2BZCA 5LKNA 4R0LA 4AV4A 1BX2B 1O0VA 1NCAH 2G5BA 1QBMH 1PG7X 3PWVA 4LDLB 1SM3L 4TQIA 1RJCA 4Y1AB 1JHTA 3BUIA 1CFQB 5GSVA 3SYQA 3W57A 3DMMB 2A2QT 2E7DA 5AYUL 4L0PB 4X99B 2WLYA 1QD0A 1I3GH 2VAAA 5FM8A 1CT8B 2VB5A 3NACH 4BFIB 5EU6E 5L2KA 3MSPA 5CS7A 4TNEA 3QYCA 2AK1H 4HH9A 2X1PA 3NTCL 2VQ1A 4XPAL 1XSOA 5KVDL 2XG4A 3O6FA 4QHNB 3WU1A 1G7HA 4R3SA 2AZAA 5D8JH 4AE0A 2E7LC 1J5IA 3KPMA 2MTPA 4KKAD 4LCUB 2ITCB 2UWEA 3MJ6A 3GMRA 3IDIB 4PRNA 4ZX3A 1CQYA 2DTSA 3V0IA 4I0PB 2VW6A 1KCSL 3QNXA 4AGOA 3KJ4B 2C3HA 3U46B 3EDJA 3OKEB 3BYTA 3P3TA 4NENB 1HZHH 5LXGH 4JM2C 1N0XL 3D3VA 3F6IA 1D9KA 4KU1A 3FB7A 4X6BB 2AABH 5E8DH 3T1FA 4H8WC 3BZ5A 1CU4H 4PYGA 1IE5A 5G5DA 1XEUA 3O45B 3NEOA 5JXEC 2E86A 4KI5E 3RHWK 3D85A 5I76B 3RUGA 4W4NA 4KZ0A 4Y4HC 4DUVA 4NC1C 3TT1L 4XO4A 5I18H 5HI4C 5I1DA 4YBHA 3GIZH 1MFCH 2F8VA 5ID1A 4F7TA 1NCJA 1IL1B 1MCNA 2VXVH 3I9PA 2I85A 5J06A 4AEHH 1OEZW 1QTSA 1MAML 3ILPB 4HQQH 4OZGA 5CZVH 4UIKH 1QLFA 3PG2A 2ED8A 4NQVA 4XZUB 1JGLH 2A6JA 4KO7A 3MOAH 5H2BA 3DO3A 4MJ6B 1X5LA 4XXWA 5FYKL 5CEZD 4JE4B 5KYWA 3FH5A 5AW6B 2QZQA 2A6DA 2F0CA 4KZEH 3VWKB 5CCJA 1R24A 2FT7A 2EDXA 5AVRB 4DP9X 5L0QB 4U1LB 4P59L 1INDL 2IJ0C 2O6EA 4NX0A 5DJ6A 5FYLE 3L1FA 5CGYD 5IP4A 1OP5H 1EVTC 4WWKA 2X0WA 3SDXA 1HILA 4UQAA 1RFDH 3LZNA 4OGAD 4YN3A 4N90D 2Z92A 2YD3A 4LK4A 4N22A 3K46A 6CGTA 3OXRA 5H8DA 5TGBB 4XP1H 1DCEA 1NCDL 3NCFB 4C4KT 3DUHA 1LD9B 1UZGA 3B2UD 3ENEA 5K69A 3HS0A 3L3IA 1QWHA 1NEZB 4GXFA 4ZFZA 1PY9A 5GGQH 1GHFH 1NIEA 3MLRL 2EDFA 3IDYB 4W70A 3ZSSA 4Z7WB 4EI5D 3EZ8A 2VDOB 4HKBB 3UAEA 4JPWH 1K9TA 5FB8A 1EDYA 1J05B 3ZTNL 2EDNA 1WAAA 1BQ5A 1NMAL 4Z3TA 5HPOA 4CKVX 5C9KA 3STLA 2GSGA 2EUXA 1EZLA 2NDGA 4HKJA 2GI0A 3WKQA 1DHKA 1CL7I 4FNLH 3WE1A 4KK8D 3OJVC 1FG9C 2ADJB 4WJG3 1C08B 4Y2DC 2JKJA 5D7SH 3U25A 3C12A 3QZMA 5J89A 1M7DA 1S7VB 4RNRA 4JFZH 1Y1DA 3QUYB 2Y9RT 1INQA 1HXKA 2C1PB 1QFUH 1BFOA 3BLPX 4IIQC 4PRDA 3SY6A 3X11B 4YSAA 1I1AC 2VLRA 4CVXB 1QHOA 1K8DB 4FLHA 3MLZL 1NC2B 3MV9D 5BV7C 5D5MB 1G5AA 5LAXA 1KLUB 1BLNB 3DSNA 3O3EA 3L81A 2HLAB 1BFSA 5D7KD 5DYOA 1VGKB 2QSCL 3B9KD 4JFXB 2G2NA 2CBOA 4UIKL 4K3EL 4TULL 5G2NA 2WZ5A 2BWDA 1T89C 3PAZA 5HHVH 1MFDL 5C6TH 3GSVB 5KYUA 1I9JH 4J8RB 4NYLB 5C6WH 2Z7YA 1CDUA 3AS3A 3JV0A 2DLTA 1OAQL 2HSIA 4PTTB 2ZX6A 2IANB 4YDVB 4XBEL 12E8H 4NAMA 3X3GL 1CIDA 3QIWA 4IRZA 2XWRA 3M8OL 3SBWC 5I1CL 5ALCL 1KB5B 4OUOA 3SBPA 4UV4L 4ABQA 3QCTL 3DRQA 3U2JA 5C8JB 4L8SC 4QHKI 1MCKA 1P7QA 2OCJA 4U0RB 2OMXB 1YC8A 2PMZA 2R29L 1GAFL 3UYRL 4AMKL 4E9TA 4A7GA 2O5XH 2C9SA 3CFMA 2AITA 4P5TB 3Q8CA 3KW7A 4F58L 5C3IA 1JWUA 3UOAB 4WJ5B 3CLEH 3BAXA 3GTNA 4YDLC 1T0NB 1UD3A 4FQXA 5KSVA 1RVFH 3MNZA 2LU3A 4NNPH 2AJXH 1RZFH 3RDTC 5LUMA 3VQ1C 1RUKL 4Y1AD 3QIBD 2FL5A 3FO9A 4U7MA 5DC0A 4QRRE 1V7NL 2D0GA 4M5ZL 4NNXB 2AKRB 5EORH 3US1A 1B4JH 1S7QB 3L1GA 4PRAB 4QWWC 3SGJA 4H20L 4WSJA 4BE5A 3HZ3A 4Y2DA 2KPWA 3BKYL 2Q76A 4LCYB 2IH8A 1TQVA 3QIUA 4KDTA 3CVHH 3ZKMC 3QUZC 2EEBA 2FD6L 4ZSOB 1OGSA 4DVBA 1LE5A 1GOFA 2MCPH 2WSKA 3NSFA 5J12C 1NC4B 1E28B 2OLDA 2DB8A 3UTQB 2NNAA 4U4IA 5TE6H 1DLHA 1MW0A 1BQSA 5DZPA 4OGYL 3S35L 3BJ91 3CFTA 4I85A 5AYUH 2OJZL 4PRHD 4BHUI 3CZLA 3LD8C 1U2YA 4YXHH 5SWZD 3UTSE 2WLLA 2Y6SD 3BD5A 4POUB 4NPJA 1DE4A 5EU3A 1WWBX 3PCYA 5D5ME 2MPAH 1OP4A 5FPIA 2YRLA 4NRXA 1CTMA 3IBOA 1TEFA 5DUJA 2W60B 2XC8A 3QI9B 3ZO0A 4F15B 3NUKA 4GYBA 1IIIA 4KV5E 3FL7A 1IKOP 3D2TA 1OT4A 1JN6B 3DX8B 2APFA 1X6LA 4Y16B 4AKPA 4G8GA 4TSBL 1SBSL 1TO4A 1GZQA 2BNRB 3KPTA 2VQ4A 1WD8A 2WLJA 3QWOB 4XNAA 3V5KB 2H9GA 4QXTA 1RIHL 3LH9A 4UINH 1ADWA 2X1QA 3CAFA 4GLRI 1DR9A 4ZDHA 3OTTA 1NQBA 4NT6A 4MCYB 4TMPA 3QDMD 3ZT7A 5I30H 5E00A 3CFJA 1UD5A 3CDZB 1KBKA 3PIQA 2WQ8A 1CVSC 1NUFA 4BRVA 5C3LD 4K7PH 5J5EA 1U8LA 1J5HA 2EVIA 4MA8L 2FEJA 1QFHA 1CG9B 3DX2A 3KR3L 5EFIB 5F6HJ 1B2WH 1ZT1A 5D7HA 4PWIA 5T1MB 1GY2A 1OQOA 4OLVL 3B5GA 1NCCH 3QRLA 4V1DA 2ICEC 1KJ3H 5IHZB 4N9OB 4ELMF 2Z1PA 3QZWA 4LBEB 3IMBA 1RUAL 1HNYA 4A6YA 4KO6A 4OCWL 2GG1A 5D7JA 1BPLB 4XGZB 1REIA 4R96B 3CFUA 4KJQD 5E9NA 3MXVL 3BISA 3ZE1E 2ZKMX 4JGUA 1RLBA 3Q44A 5ALBH 3U9UB 1D9KD 5BW7A 1HXYB 4LKXB 5LCVL 2K6YA 3SSGA 5FLVA 4P5KB 2Z31A 5FA3A 4YHNB 5J3HC 1T7WA 1HSBA 3GSQB 5C0NC 1K5WA 4DK6A 4LGRB 3PAVA 4OY9A 4XMVA 1K2DA 1JWSB 1UJ3A 2B0SH 5GQBA 3HFMH 3F7RA 4BZ1H 4PJ8D 1T5XA 5FGBC 1PG7L 2VDRL 1JI2A 2NT0A 1OB1A 3MO1A 5LG1A 5C9JB 4OFYA 1JGVL 3E3QC 2OW7A 2VO5A 2MWCA 3WMSA 2P49B 5ISZA 4CL7A 2E9BA 1BYPA 2XUWA 5FK9B 4X6DE 2H5UA 5H4YA 2WLMA 5L7XL 4JFQA 4Y4FC 1SRDA 1T0PB 5F6IC 5E56A 4UF7C 5SX5K 3X12B 2GBTA 4NUQA 4ENZA 4GNKB 3BDXA 1J1XH 3EFOA 4MXVF 1HNGA 4JG9A 3WN5A 4X4YA 3EJYC 2EYRA 2KH2B 4HV8A 5C0BB 3C5ZC 2X05A 2CDEB 1DQLL 2CDGB 2RH0A 5F72S 1TVHA 1Z9LA 1AYRA 2EH7H 4P57B 5CP7A 2OS7A 3N1QC 4IGBA 3VD2A 4G43A 1LP9E 3BUYB 3BXNB 4I4WB 2ZP0T 3LZPA 2CLVA 3T09A 4KX8A 2CRIA 5LWYL 3H9SE 4RWHA 3KYKL 4QXGH 1S3KL 4BXSV 2R39A 1U58B 4TOYH 4QTIL 1NMCB 1ZJAA 4OU3A 1URIA 2XZCH 3NAAH 4CMHC 4FNQA 3TLRA 5GISH 2VWEE 3WDHA 3WUWB 2ZE0A 3MRDA 3D0LA 3FQXA 3KM2A 1IUZA 1ETZB 4LEXL 4Y9GA 4LIQE 5FGRA 1KGWA 1NUNB 1Z0NA 2EIZB 2B3IA 3L8QA 3NVQA 3KXFA 2ZCHL 4PB0H 4YHIB 3GC3A 1N68A 4MJIA 2R1WA 3QH3B 3WFCH 4CKQA 1CD8A 1FDLH 2LGNA 1OL0A 3EJYD 3HB3C 4R83A 5F7DA 4CC4A 5JHLL 1NL0L 3QISA 2R27A 4ZNEA 4YFLF 3IU4H 4U6XB 2Q7NA 4S1RH 4Z7OB 3DJTA 3EYVA 5DD0L 1QSEB 2FK9A 2WIMA 5D7EA 4IHBA 4N2KA 1NCOA 2E6QA 2VL5A 1BZ8A 1QFOA 4NI6A 4UTBA 4QUOA 2GJRA 5F96H 1YJDC 4YSDA 5B3NA 1IV8A 3GSXB 1NICA 2J2ZA 3F65A 2NTFA 2VDKB 3BWAA 3OF6D 2W81C 3MHZA 4XPGL 1OK8A 5DJ2A 5EU5B 3TFKC 1MQ8A 5T3ZL 1HHKB 4ONGL 2V3FA 5DRWA 2XFXA 5IM7A 4OGYH 2HT2D 1TKWB 2IALA 3E6HB 3FQ4A 1XAKA 2APXA 4GMTH 1GS6X 4DCQA 3IE9A 1A7QH 4ETYA 5CGMA 1LK2B 3QJHA 3PWJA 3QFGA 3QQXA 3GRGA 3W9EA 4X0KA 1Z9OA 2WXPA 5K9KB 1FL3A 2PPCA 3LMJL 3NP3A 4ZK8A 3FU3A 4DKEH 4F20A 3WV0A 2V2XB 1U42A 3BPOC 1V7NH 3BWUC 4JHZA 1UA6L 2AXJA 3P4NB 4RA3A 5JOFA 3VFGL 1L3NA 3ABZA 4Q4EA 3ZQ9A 4XO8A 1O5PA 1OK0A 2J8UF 3TM6A 1RZFL 3WN5C 1C5BL 2F74B 3CXDL 4LKCB 3CZEA 4R2GC 5KANG 3B7SA 2YD4A 1RIHH 2P5ED 2CBMA 5EV7A 1BG9A 1BQHA 1I53A 3IDUA 4QRRD 4KKQA 2KDYA 1KJ2A 1IGTA 2VZSA 4A38A 2YSSB 3KPOB 1CB4A 1QHQA 2NYYD 5I8OL 3FU5A 1MW2A 5E94B 5FUZL 4KX7A 4J6RL 4CN6A 5JUEH 2A9AA 2BNRD 2LW3A 3WIHA 1QR1A 3EO9H 5E08H 5A2LH 1I9IH 1IGFH 1UQSB 4KKBD 3UO8B 4PTUB 1URLA 4F27A 3KBHE 3QUXC 4LSTH 2W65A 5I19H 1UOKA 2NY0B 1RERA 1YDPA 3VDAA 2KZ1B 4AQEB 5BMFH 2OMWA 3GXUB 4NO2A 4DO4A 4YXHL 1OKEA 1U9KA 2OL3L 3TBTB 1GCFA 4KVNH 2FVNA 4PJAB 4L3EA 2Y07H 4YWGL 3RE0A 4HUUB 1N7MH 4BFFA 4XBGA 3BGMB 5L6YH 3IK2A 5BMFL 3BX7C 3WJMB 1JNHB 1X5IA 3E6FA 1MH5A 3KGSA 3WS6A 1P5VB 2GJ6B 2XWTA 4ONGH 2P52A 1KFGA 4N87A 3NJFA 1YEIH 2FIKB 5JXAL 3ULUH 5FUZH 2ZF8A 4LPTA 1Q1JL 4ZXBC 1L3WA 4GG6F 1SN2A 5JPMC 3SKNB 3S8FB 4UBDD 4G5ZL 1A14H 5AKTA 3PGDA 3LQAC 3PJLA 4NQED 3QUXB 3HE7C 1T20B 2YRBA 4WEBL 2OTWA 6PCYA 4G8IA 3ZTEA 4TVPL 3VRJA 1Y7VA 1MI5A 3CCHA 1CDYA 4PJ9D 3ZMNA 4MMZC 4IKNA 4H1LG 2NY2B 3A6CL 5E5UB 1ICTA 5SV3A 1BVZA 4CSSA 5JHLH 1BF2A 1KIQA 3S3JA 3E1ZA 1ZAGA 1NDMB 1MIEL 3CXDH 4XAWH 2EDOA 4X0NA 3ETSA 1B3IA 3BO8B 3G5XA 4I2XB 3VFSA 3D4YA 3I9AA 4D9RD 3CLWA 2QLYA 4NO0B 1I85A 3DIDA 2GQHA 2R9HD 5B3SB 1JPEA 2YKLL 4FNPA 4YX2L 1EAPB 1JXGA 1RXLA 1NAML 5J1AB 2MEJB 5KSUA 5CHNB 3N85L 2OFQA 4JO2L 4CW1A 1TVBB 4HG4K 2GC4C 3JT2A 5D2LA 3V9FA 2DQEL 4TOYL 4H25A 3FNKA 1IMHC 1Z32X 1QSFD 1DP0A 2CO7A 4GMTL 5DUMH 5H35B 3VG9C 1NANI 2EDWA 1IFGA 5IMMA 1J5CA 3MRBB 3NSDA 4MB1A 5DJYB 2Q6WB 1HYSC 1I9IL 4HGMA 1VIWA 5C08E 5I66A 2IGLA 4PJAE 7FABL 1WFNA 3IJ9A 2O26U 4L8BA 1OARH 3KVDD 1KGCE 2WNXA 5TDOA 2OXHA 5E70A 1TUPA 3BH4A 4K73A 4ODSL 3T0EC 4RIRB 1SHMA 2WXJA 1ZT4B 1H8OA 1P4IL 1S7TB 3D3VD 4X80L 1N59B 1Y6KR 1L9NA 2X6CA 1U3NA 1WRFA 1L6PA 3FUEA 4MJHA 2Y1AA 1FDLL 1NIAA 3PNRB 3VA6A 1QVOA 2CBPA 5D55A 3IKKA 5CD3B 1XH0A 3PHAA 3QEHB 3SQOL 3IU4L 4U1HB 2K6ZA 2APTA 1C12A 4PFEA 5DS1A 3MRCA 4XWGH 3ABGA 2ATAA 3KYNB 1KCBA 1QFPA 3AROA 3CD4A 4BFRA 2YAQA 4HWBA 4N1CA 3RWHA 3QWNA 5DMJB 3HLKA 3VQMA 4OCRL 2D8KA 4Q0XL 5ALCH 1MJJB 3S4SA 1OSYA 1WVZA 5TQ0H 3SGEI 3O81A 5TFSH 1JV2B 4N26A 4PJHF 5F8QC 1A6WH 3SGKC 2BZ7A 3D4GA 1IM3D 1AXIB 1X9LA 4JFDA 4JKKA 4HOWA 1E42A 4M3KB 3DNKA 3ISRA 1HHIB 2XY2A 2RGSA 2JKLA 3Q13A 3QRFM 5DHDA 4MD4B 5DR5L 3EH4B 3P9MA 3GXDA 3LKPB 4KZCA 3HG1D 4BKLA 4JZJA 1JZ3A 1PEZA 1P5UA 4F15C 3MFFB 3BZFA 4MVBD 1RZKL 4FEMA 4S1SH 5GGVH 1T89A 4I77L 5I2IB 1KJVA 1G7JB 4RMUA 4DT2A 5T3XE 5J1TC 3NCEB 4JPVL 2N1KA 4BK5C 2HCZX 1W0VA 4NKMB 3NK3A 3DX4A 2R0WH 1IAII 1NGZA 3GZKA 1NM9A 3CUPB 1WK0A 3MMEA 3II1A 1IT9L 5DQJA 4GUQA 3AG1B 4XO5A 3GNMH 2ITEA 5D1XD 5L4IA 4NKDA 2YUZA 4YPGA 2YEVB 5I5JA 2ZG3A 1HDMB 1A9BB 5D6CB 3NACL 4PGDB 2Q3ZA 4MAUH 5KTEL 3BIBX 4MNQE 2CHXA 2XIIA 4RQQB 3D18B 3QI9C 4BWUA 3AREB 3FT9A 1CLOL 3ATAA 3HBZA 5SWQA 4JO3H 1SJVA 2ED9A 1ZIBA 4KTEL 4X9GA 3NZHH 1CE1L 3EO1A 3OR6B 4P2RE 3U30B 3MJ8A 3GLAA 4AYGA 4TL5A 4M62H 2EDDA 2BNQB 4J1UA 1FLRH 1OTSD 4JREB 3A6BL 3DGGB 4PJDE 3UERA 4Y2OA 4HEPA 1D5ZA 5FKAA 5DJDB 3PQYB 2VDRB 4RDQG 5FYKE 4NQCB 1JK8A 5HGGS 1X4XA 3OHXC 1XH3B 1VEMA 1ZTXL 3MACH 4LT7A 4DP8X 2MTAA 2H3XC 2Z35B 2YMTA 1AO7D 3MTXA 2NZ9C 3EDEA 1XBDA 4AGNA 2KT6A 5ECGA 4X6DB 2F8IA 1OIOA 3FN0H 4IU2A 3RBGA 4DUXA 3ESNA 1MLCA 4MB5A 2XV6B 3K2UL 3CZUB 3POHA 4LASL 2X40A 1G7QB 4PJXE 4NZRH 1ID2A 4PV9A 4WWNA 4ZI8A 5DHYA 1MHCB 3A5VA 3PLYA 4MA8H 3LQZB 5I1LA 3MGAA 3F04A 4M7ZC 5HDOA 1HTYA 4DN4H 4XVOA 3UTZA 3RVUC 1VERA 3GJEA 4O58L 4WFFE 3JXAA 4U0RC 1V8HA 2ZWLT 3EYFA 4PRIB 3A6CH 2CLRA 2IQ9L 1G6RB 1VFBB 2A4EA 5J11B 3EYUH 3LRMA 3MLPA 1E40A 2YUWA 3MC0A 3QAZC 5F0MB 3P1VA 5BZDA 3GSUA 4AT6B 1T7ZA 2O6CA 4LB8A 2VISA 4L1TA 3PQYA 4QY8A 1D5ZB 3WXVL 1XTLA 2B77A 5LCVH 5DJXB 4Z7NF 1K85A 5CEXB 3APFA 3VGFA 1OLZA 3MJ8B 3PV7A 2IG2H 1L7TH 3CHPA 2EIEA 3HVDA 3RGVA 2R23B 4JDEB 1YNKL 4M1CC 2CO3A 5HYSA 2XU9A 3P0VH 4QRRA 1CS6A 5TE6L 3APDA 2I7OA 1RULH 1BIHA 2YGNA 3N6YA 4DW2H 2JELL 4KGLA 2B8OT 3AREA 2N56A 3ZKSD 3IM1A 2AXGA 2XWZA 3GKWH 2ADIB 4TYUA 5KAQF 1QBLH 1DL7H 4NO0D 4JFFD 2KMWA 1SY6H 2XTSA 2LE9A 1DSFH 4NO3A 1CK0L 2FATH 5AVSB 3LZLA 4EVNA 2A9BA 1L0QA 2BOBB 3LQMA 2JMRA 3I6LD 2FSDA 5B22A 1V05A 5DQJB 2OZ4L 1WZAA 3MMEB 4YHOH 3RJQB 3RL2A 3UZQB 3VXUB 3D85D 1L4IA 1MCWM 2YSTA 4N6RB 2FHFA 1LO2L 4ELDA 5JW4M 4FADA 3HRZB 4UT9A 2AERT 3FCTB 3OHXB 1G7JA 4OZ4B 3I02A 2KERA 4CU8A 1SPDA 3L5IA 2KUTA 3MFFA 3DV6B 43CAA 5E2JA 1P5UB 1BAWA 2QZ5A 2WKGA 4BFBD 4M1GL 1QBML 4ANUA 2ZUUA 1NOLA 2ZJSL 3CX5J 3WFZA 1DDTA 1HYRC 1XGYH 4WNQA 2GJ6E 1QYGH 4LL1A 4N24A 5CLWA 4YBQD 5IVZB 3WNJA 3EIFA 1FAIH 4LQFH 1Q1JH 5MEQA 5F9JA 1U4FA 1B6UA 1EO8L 3NDZE 1U8MA 3CMGA 5HSFA 4A6YL 4Z1PA 1XGQB 1F11A 4YL4A 1ZANL 3LCYA 1NTDA 4I9XA 3T2PA 4H88H 3S35H 4PJFB 2WD0A 5C7XH 3OB8A 1H15A 1IARB 2Y7QB 2ZX7A 3VXSE 4L8SB 1FNGA 3TBSB 4PGBA 1QO3A 4FTVD 1UJ3C 4XPFH 4IK6A 2XVLA 4FQCL 3NZ8A 4KITB 1OTTC 1PSKL 3ILQD 5AW9B 3LH2H 4NZUH 1KB5L 1T7XA 1A7RL 4ZXBB 2VDNB 4KKBC 4NP4H 4ZTPL 3K72B 5FR3A 2NUPB 1RK1A 5JQ6L 1MHEB 3LDBB 5LCVA 1FVDA 3NOIA 1T7YA 2VC2B 4QMEA 1AACA 3ZVVA 4GAGH 1VZHA 4QYAA 3NN8B 5K5YA 2QTEA 2G60L 3PNWA 3T0AA 4ODHH 1T1XA 4JCWA 3FPXA 3LKQB 4XNBA 3IVKB 3CDFA 1HEZB 4L1HA 3BPLC 4ZTPH 3T0WA 1ADQL 3OMNB 4JFZL 4PY8J 3S4SG 2ZG2A 4M6ML 1FHNA 5IMMB 3QHZH 1LEIB 3ULSB 5BZXA 3TVMC 2ILLA 1KTCA 2BMKA 1HE7A 2C9QA 5IMKB 5IQ7L 2O93L 2J1ZA 3SE3A 3TJHC 5DD5H 5CHNA 1S7UA 4JFHD 2P5WE 5EF1A 3JWOL 4TNWK 3U36A 2ORBH 1BOGA 2GTWB 4W9DC 2XQYG 2H26B 3P9LA 4Q9RL 5ICZA 2NW2A 3LKSB 4NN5B 3WJJC 4M3JA 4D9LH 4ZMWA 3K1DA 3WS3B 4PJ5E 2R2EB 3KPLB 4V1DE 4KO5A 1LO5A 4WJKB 2ATPA 5FUOH 4NM8L 3VFRB 4G7RB 4Y19D 5DHVH 3N2JA 5E8DL 4QYOA 3SDCC 1V3MA 3MKKA 4F8TA 4ZO6A 3RTLA 2XRAL 4PU2A 2ZOWA 1YYCA 1KPVB 3TEZA 1I1AD 1T20A 4ZUVA 4MMXC 4OLEA 1BMWA 1D5BA 5DRXA 2WBJD 4U33A 3SKNA 1V10A 4JFVA 5GHWH 1PLGH 3WKYA 2I07B 1CFVH 2ESVB 3CZSA 1TU2B 2CPCA 3FUIA 3U2GA 2I26N 2VXSH 3PS6A 5G4NA 1OE1A 4OUUA 1D6VL 2F61A 5D1QA 4PJBE 3WIHL 4WFHE 1U92A 2D7MA 1R47A 4N0CD 5FYKH 3OV6A 4OLWH 2ENJA 3FJTA 3FYIB 3G6DL 2XYBA 5EBLB 5ESAB 1QSFA 1UXWA 4UOQA 5IMOB 4GQQA 1ZA3A 3DJSA 3PY9A 5AW8B 2VZOA 4QTHA 1TQTA 3FTUA 2A6IB 4KK6C 4PVLA 4KPHH 4QOKB 5DK0B 3TBTA 5B8CB 1WQVT 2Y5TA 2OMWB 3NA9H 1IRAY 4UT9L 2Z8SA 1I1YB 1TYRA 3K5SA 1LQSR 3FB5B 4HUXB 3NJXA 1CO1A 4X8JA 2WQSA 3NIFE 3Q6FB 3V4VH 3P4OB 3JVFC 2W95A 1I8AA 5CJXC 1QR1B 2VM4A 1C1EH 2AXFA 3MBWB 6TAAA 1FFPB 1OWRM 2ETWA 4JHVA 4TUOA 3TJHD 1QZ1A 1X5XA 1JFQH 1XMWA 2BSCA 3VFUA 2SEBA 2HRHA 4K8RL 5ABZA 2OSWA 3L3KB 3LNFA 4JM4L 5SWSD 4N5UA 5CBEB 4H2CA 4IU3A 5JW5B 1AKJA 1UENA 2VXQL 3NRPA 4KZDL 4HS6A 1AKJB 1FAKT 1QKZH 2YPLB 4KXZH 5CCHE 4E41D 3L3KA 2DQFB 3MOAL 2RJMA 5BJTB 5KVGE 3AW5A 1N5AB 4Z78A 2BNQE 2SEBB 4JDZB 2PTTA 4NWTL 4AW7A 4J23A 2UZIH 5I30L 1JV5A 3SDCD 1H8LA 5KJ4A 3ULVL 1QKZL 4ONOA 2I9TB 4PSPA 3WXWH 4W6YB 5MENA 1QACA 3CN2A 3UAJD 2J6EH 1V5JA 2ARJB 3QPKA 4RSVA 4EIZC 3L3JB 4HUXA 2GVYA 2ZKYA 1H3PH 2VJ8A 1E7VA 3F84A 4IMKC 1PQZA 3TV8A 5T5FH 2OKMA 5EZLB 3IFPB 2VLJD 4JZNB 3WEMA 1E4HA 3GUTA 2ZF9A 3ABMB 4UZUA 4YLQT 4CSTA 3OMAB 3OAYH 4Z7VE 3SDYH 1RSYA 1TJGH 2KS0A 4NO5B 2YARA 6FABH 4PJEE 1A9EA 3O2WL 1MOEA 1QFWH 3DKHA 1F4XL 3EUUA 1KN2H 2CRZA 3CDGA 3JYBA 2XZAH 1UA7A 4UTAA 3LRGA 2A0LD 4XNUL 4KKLC 5KVEL 4OF5A 2X1XR 2W59A 3QQ3B 4DGVL 2R59A 5DT1L 4U6VH 4OUUB 1IEBA 2VH5H 1P6WA 2LVEA 3DV4B 1F0LA 3OMIB 1N4XL 2ERJB 1I9EA 3TONA 4C59B 5GPRA 1MNUL 1TDQA 5IREA 4QCIB 4KJWC 2I5YL 4YHIA 1ZT7A 5TE4L 3I6LE 5IVNA 3FW6A 5D8JL 2VDQL 5DWPA 5TF0A 2O6PA 4K7PL 1UG9A 2EDRA 4EZJA 4W9GC 3O4OB 4JMXA 2H4EA 4HJGA 2BFVL 2ATPB 4ZTEA 1AY1L 4ZXBD 3VFRA 4N4YB 2YPVA 3GMNA 2JKNA 2RCSH 1UT9A 2FR4A 1N67A 4KZDH 2JB5L 2J8OA 2YHGA 1PTZA 4W9JC 3GF8A 4I5BA 5BZWB 3IPEA 5JQIB 4NUGH 4K8RH 4N8PA 5F88A 4Z3IA 2C1OB 2KBGA 4ZZFA 2JE8A 5C0CE 4JBSA 3WKPA 5IMLA 3V79C 3BD4A 4LARH 4PCTA 1HJCA 1BOGB 2GTWA 2YPKB 3KYAA 4G43B 4L2LA 1NFDF 1R3IH 1VZGA 4P5TD 4Z0XA 4AYBA 5E7BA 1TMQA 4M7LH 2B2XH 3BAJA 4K3GA 3SGKA 1HH6A 2YLKA 1ZIAA 3RIFF 2BMKB 4NZDA 3UEQA 1YEHL 2A7BA 2E6JA 2PF6A 3Q5TA 2YRPA 3M88A 3Q48A 4LSPL 5KYYA 1EA9C 3VXSD 3T3MB 1OAXH 4UILH 4YFLI 2XIDA 4R90H 1OGAB 2DPKA 1LWHA 2Z8RA 2RACA 3ZHFA 4UQIM 1JPSH 4JFQB 1F3DH 1VCAA 1PQZB 3GHPA 2OI9B 1KXTB 1WA1X 4LSSL 3NN8A 3X3FL 1W72H 4YGVA 1OE3A 3B56A 3M7OA 3OZ9L 3VFNB 3HJ0A 1G84A 3V4UH 4P3DB 2ARJA 1PLGL 1RK1B 1NBCA 2VDMH 4ZD3H 3BFOA 4LCWB 4JFYB 4B96A 5AKSA 4J3WA 1LO4H 3NZ8B 5KS9F 4OVVA 4WO4A 2O72A 1AO7E 3WIAA 3HUJF 4FI7A 2DYRB 1Q38A 2F19L 4YHNA 5D1ZD 5BJTA 5JIDA 3VMPA 4FABH 3U9UA 3CZGA 2R0KL 5HVGB 5HYFA 4DQOL 1MCJA 4HS6B 4GRWE 1X5FA 2LLGA 4KRPC 4LVHB 3QDJE 2J57A 3F6JA 3NCJH 4B97A 3D9AH 5ERWA 5IVZA 3VFUB 4HLZG 4UQDA 1D2PA 2X4RB 1JZDC 4L0ZA 3FT1A 4V1DD 1ZT1B 5GXBB 4GW1B 3FQYA 1I85C 4OIBA 4D9QE 1I3UA 2AK4B 3RB7A 1LYQA 1DVFD 5AZ2L 2JK5B 1UXSA 3I9GL 5F7BA 4W93A 4Y19E 5I6LA 3EOTH 1EHKB 2AFNA 4YHLH 5C0CB 1PZUB 3LZQA 2P46B 2A77H 5ISZE 1CFSA 1YNTB 3FCTA 2IBZY 2WVUA 1TETL 2VDOL 3EJZC 3D39A 3UTSB 4CJ1A 2J6WA 4J3OH 4BJLA 2ICCA 4UUJB 5I16B 2NY4B 3UJTH 4HMDA 2A6IA 3UZQA 3FQ1A 1OB0A 3OQRA 5DVLA 5IFAL 4U1GC 2PCPA 5DDHB 2BS9A 1UXWB 2YZ1A 5EMYA 5EEYA 1FJ1B 5EBLA 1DO6A 1UXMA 2BNRA 2NUTB 3QWOA 3U0WH 5A3IC 5D2LF 3LEVL 4EZLA 1VLXA 4L4TE 1WS8A 4H4NA 3FUHA 4LVEA 4HT1L 2YD5A 3BHBA 3UZEA 2BIOA 1JRHI 2WY3B 3BGFC 3C6LC 3ZDZB 4DOHB 5IJKC 4FMFA 5FUCC 5KYXB 5BRPA 2V7HB 1TEYA 1M05A 3V4UL 1D5XA 2JQMA 4WU7B 5CSBA 4NM8H 3WG7B 1DE4B 3QB7C 1MHPL 4G6FB 2YPLD 1IBGH 1UVQA 4HSCX 2MQ3A 1E3ZA 4AZ8B 4BGLA 5H37G 1JBJA 5TE7H 3WENA 3GI9L 4XP6H 3EJRA 1ANUA 1BFVL 4WV1C 2DLHA 2G2RA 2OL3H 4QYOB 4YDNA 3DO7B 1UM6L 3UAFA 3BPLB 1A6WL 2CO4A 1E28A 5I5MA 4P9HC 2WUCH 1J9TA 4DVBB 4Q9QL 5D4JA 2IDFA 1AGDA 2E27L 2F15A 5ILTH 4Y2DB 1GHFL 2B2XL 3AB0B 1AZRA 1Q4NX 1I7UB 4XN7A 1E43A 4ZS6D 4AG4H 4Z7UA 4OJFL 1HQ4A 5CBAB 1FH5L 4GIPD 1QYGL 1WIOA 3BP5A 3KL0A 1L9QA 2A6KB 4J3SA 4U3HA 4YHPB 1Z3RA 1NFKA 2ZXQA 4FZ8L 5D93B 1CD0A 1VAHA 3MNZB 3LQZA 5I1LB 1MHCA 4WUUD 1TENA 1E6JL 2N7SA 2AK4E 3KL5A 2CR0A 4HCFA 3K6SA 1G7QA 3ORJA 1NUDA 5EDXA 5F1NB 1SDDB 5D1XC 3OC8A 4K2UL 3CMOH 4ZMYA 1QFWM 1WSST 3HNTH 3GT6A 1CFMA 1NLDL 3HNVL 4J39A 4L37A 3V6OC 1TNNA 4L4VD 2H0JA 2RBLA 3DSFL 4C83B 4ZD3L 4FXGB 1HEZA 1AGDB 4JANB 4AE1A 3K4AA 5B1CA 4Y1TA 2J7LA 3MNDA 3WTYA 3OWRA 1FZMB 1FVDB 4Y2OB 3JWNE 5T3XL 4PTTA 2CAKA 5I17B 1FNSH 2VMCA 5C0AB 1UASA 2R2HB 5EU6D 2AZUA 3K72A 2NQCA 4MJ2A 1UEYA 5DT1H 4ZMPA 5DYOB 2CJUH 1LP9A 3F5WB 4Z77B 1D5XB 4WU7A 4EN3A 4HPHA 3VMOA 2J8UE 2WN2A 3T1WA 4E41B 3VWJC 4DO6A 1TZAA 4I8DA 4Y16C 5GRUL 1NM4A 35C8H 2WB1A 2ZSVA 1L7TL 2RIKA 3LXAA 3D18A 2EXWC 1BM3H 4R7VA 4DK5A 4NHUA 1JI1A 3BPNC 3VA2C 5BW7C 1DN2A 2YS4A 3RIAK 5MEQB 4JFPB 4XMPL 3DARA 1OP5K 3ZHLA 5AKVA 3NJKA 4NKDB 5LGHH 2ADJA 4W9HC 5CLTA 2ZUSA 3HR6A 2EUVA 4WNQB 3CHRA 5JHBA 4UQ2A 3S3BB 1VDGA 4E9XA 4X83A 5I16A 1MCDA 1NGPH 2IQ9H 3STLB 4AQ8C 2XQYK 3VWJB 3T0ED 1AY1H 2VKXA 2X6BA 4NWTH 2YO3A 5I2IA 3C60C 3WNIA 2JKXA 2MMXA 1MQKH 3ARFB 1EDHA 1IKNC 2J25A 4GUCA 2JK5A 3NZUA 3VWJA 4LCVA 1DLFH 2HVBA 4N6RA 4JZJB 4CA4A 1MFEH 4MD4A 4UQ2B 4TVSa 1LEGA 3WE6A 3HS0B 3L3IB 4JFPA 4QKTA 4HIXH 1I3GL 4OF8A 4YFDB 1MUJA 3G9VA 1SHXA 3BVNA 4HJUA 2A9NL 2YQBA 4FG6D 5HDQH 3RUGF 3B2VL 4I0PC 4NHUB 5F7UA 5FAAA 5EBGA 1DJXA 4N86A 4Y1AE 4NDMA 5I19L 3RWHB 3ZDWA 1MCQA 1LXMA 2C34A 2DJUA 2EC9T 1W6LA 2FLRT 1L9MA 2X2UA 3VH8G 4HP5A 3ARQA 3VRIA 4A7UA 4OZFA 4QRRB 1N6QH 4YDKL 2HFGL 3KNBA 4I9WE 4WI9A 1LM8V 3QEHA 4OZGF 3O8XD 4X5LA 1H3UA 2R51A 5AAWA 2A6DB 5CD3A 1QVOB 3FTSA 1YEKL 2R2HA 2E0PA 2IAND 5C0AA 3WBDA 4IIZA 3BOVA 4S1DC 4OTXH 5DJXA 1B9ZA 3TXAA 1KXQA 3OAUL 3G6DH 1KGJA 1KXTA 1OOAA 2NY0D 2OXHB 1C5BH 3SPGA 4DAGH 1NKRA 2XYCA 3ZR5A 4JANA 1YEKH 4L8BB 5C97A 1QPPA 4P2QA 1SLWA 1MEXH 1OGAA 3MCLL 3QR1A 4L37B 2CLRB 2K0RA 1GGTA 4P04A 1N64H 4UM8A 5FGBA 5FFOA 3SDXF 5I1DB 3OHMB 1NA8A 4UQ9A 2VMDA 4OLZL 3STZA 3FUJA 1OAYL 2WVVA 3TBCA 3ERXA 4E2OA 4AEIH 5AZUA 4YHZL 2XN9D 1GGBL 1TVBA 3WNOA 4NUJA 2APSA 5KSUB 1Q9KA 1X5AA 1BECA 5G5DB 3AY4C 1T7VA 4IU2B 2Z4QA 3Q9PA 1PZDA 4XHJD 3W2DL 3RGHA 4WIQA 3DX7A 4X6BA 2HTKD 4KI5F 4I2XA 1GGBH 1PZ2A 3TTYA 5JYMA 3VD1A 1IC1A 2D03H 2DWDB 4NCC2 4TS6A 5TH2B 3VE0B 3QUXD 5B7MA 1DQMH 2FR4B 4D0DA 3U46A 2K3HA 1JK8B 5I15H 1WAAF 1Z9NA 1KTDB 1SF5A 2AJYL 4IEFB 3NFSL 4F93B 1A6VL 3VYPA 2F6AA 3GMRB 3IDIA 1P2CA 5EU6A 2OTWB 3BWZA 3D08A 4OCRH 4BUHA 3ZYIA 1ZLDA 4EE2A 1QW8A 3VTAA 3D69B 5GS1B 2DY2A 1WEJL 1QAWA 1WG3A 5CUSL 5GRVL 5IEHA 4WNJA 3PDDA 4G7QB 1FQ9C 2NNCA 5SWQB 4ZO9A 3EAKA 2XPGB 4KY1H 4Y2DD 5CSGA 4GBXA 1BYOA 2B20A 3FKUS 4RQQA 3IAPA 3ZUCA 3PXHA 5KOMC 2BRRL 2QPSA 3H2WA 2XWTB 5D2LE 5C92A 4AENA 2EDLA 3CDGB 1ZLWH 4M8VA 5JMOC 1HDMA 4KK5C 3ARBC 1A9EB 1LMIA 2ZX8A 1E5CA 3A4DA 5ITFA 2PCPB 2QPDB 5DDHA 1JXFA 5EC1B 4HPOH 1TSRA 2DQIH 4PJAA 4AVKA 5EZLA 4J3BA 3T0EA 1KCVL 1H5BC 1U8HA 4ZODA 4NKMA 5E5RB 5C7ZA 4APXB 2QKSA 2VTFA 1YNLH 4WHTA 4AQEA 2CGRL 3TH3T 3I9IA 1CLYL 3TN0D 5L6YL 3IJ7A 4PTUA 2EDHA 5AW2B 3WMQA 4YFEA 5C0DA 2XXMB 4UTAL 1Y6NR 2NPLX 3H3BC 2R56H 1CFTA 3IMUA 4A7GF 1FFRA 1L0PA 1JGEB 1JL8A 1OCOB 1T3FB 2VXTL 5DD1L 4AGQA 4UDUA 1DBMH 3HNTL 4HXBH 4CSZA 2C5DC 4JFDB 3MRRA 1AP2B 2DQFA 1E6OL 2Z31D 2B5IC 4Y4HB 3UC0H 3WFEH 4HD9A 5KZCD 5DQDH 2YPLA 4Y5XA 1JV2A 2ADGA 5LDUA 1Z3GL 1T03H 2F74A 4AMWA 2ADGB 4Y5XB 1FNEA 5CBEA 5EB9A 2GBUA 1SDAB 4LU5L 2HFTA 2DIAA 1AP2A 2VAJA 5E8NB 1TTFA 3JV5A 3EYSL 3QW9A 4UDUB 1XGZA 4XZ4A 4XPTH 2CO1A 4GBXC 1I4FA 1RU9L 4JFYA 1FFPA 1E65A 4GJTB 5F7HA 4UYPA 2H2SC 5ILTL 5C0DB 3HG5A 2H32B 4HIEB 2GSIB 4HJTA 5C0AE 1UURA 4Z6AT 1LK2A 2NXZD 3S0PA 1ZT4A 4RAUB 4BM7A 1SJXA 5EWIH 4WEEA 2EVJA 3E6HA 4P4RB 3VDCA 2VXTH 3GJFH 4PIBA 5DD1H 5J3HD 4ZRGA 5TDOB 3T0EB 3WUWG 4G9FE 1EHLL 5FS5A 4OZFG 5DJ2B 3PFUA 2NTFB 2NY6C 4XB3A 3C5ZB 1E4XI 3ARFD 4M56A 4X6CF 3OJMB 3CE1A 3S5YA 2EUZA 1BLIA 5H35A 2CO7B 1IBZA 4GSXA 3VACA 5KWYC 3CX5K 1OAUH 4IRJC 1QSEA 4C55A 4K94H 1S9KC 4PGCB 5DI8A 2NX5E 2QGBA 1EAPA 4XE5B 5J1AA 1X7TA 1NUGA 3RNQA 4X8CA 4Z7IA 3P9WB 5IMLB 3KPQB 3GLDA 4YUEL 2V9QA 1D7DA 4NO0A 3WXVH 1MWAL 4DGUA 4CMHB 2C1OA 5IEHB 2R1WB 2BS71 4DOHE 1XEDA 2VE6B 4I5BB 4Y7MA 3I75A 1KPVA 4BQ8A 3HRPA 2MCG1 5EU6B 1EZSA 3HG1E 2N1TE 1GGYA 5IQNA 4QIRA 2CPUA 2R29H 1LO5B 4N1HB 1LDSA 3I2CH 3VE0A 2YR3A 1USZA 4FE9A 2D0HA 3GLEA 4RFNC 3D1MC 1N26A 4BUGA 2CUIA 4KH9A 3IFLL 2XIBA 3LKSA 3QBTB 3MN8A 2CE6A 3KPQA 3P9LB 3QDHA 3CFEB 3RNQB 4H8QA 3GHBH 1Q9KB 1LVEA 4IGBB 4A7QA 3HFFA 3HE6D 4P57A 1S7UB 2P5EE 3FSWA 1JNNL 1TVHB 2EIBA 3GXIA 3JWDC 3MRGB 1B4TA 2DQIL 1J9RA 2WVVB 1CYGA 3DOHA 3E6FB 4N0UE 2IAMC 3Q8FA 4RH4A 2CGRH 3WN5B 1YNLL 3A4FA 3CVHL 4P23D 2EADA 3LRSB 4OFDA 4ODVH 1HX0A 3GS4A 3N1FC 3ZE2F 5HYSG 3AU1B 5K59F 4P2QB 4KKCC 2YPLE 3DHMA 3LKQA 5GGRB 3S3DB 2GEQA 4P4RA 5A6MA 3L5WA 1VFAB 3F7LA 5ISZB 5BUAA 3V7AG 3FQTB 1IKFH 5CUSH 2IIJA 4ZXBA 4AEEA 5KTEH 3RDTD 2Q7AA 3KNBB 2YGQA 4IBYA 3HEIB 4AQAB 4JDZA 1G4RA 2WYTA 1TZ8A 4JQIH 5E8NA 5J0BA 5GS0H 1UM4L 3WFCL 1BQHB 4OSUL 4KQ3H 3ULUC 4MS6A 3WTSA 1RUQH 4YSCA 1TQCC 2R4SH 1F11B 4OGZA 3AABA 1XBRA 4Y4HA 3AADB 1YPZF 4XGZA 3NH7H 1JDAA 3RI5F 2AJYH 3P4NA 1IFHH 3MRRB 4LBEA 4B0MM 1RZJC 4V2BA 3KLSA 2K70A 5IHZA 1JCKA 3NFNB 1JZ4A 4X6DF 4NN6C 2VSDA 4ODXB 2DQGH 3IBEA 3QHFH 3W1ZA 3LIZH 2J72A 2NY3D 1C7SA 3ARFC 5LXGL 1Q0YH 3FTZA 2X09A 1DQDH 3O9WD 3GKZA 4X8JB 3T2LA 3PIQB 2IC2A 1T5WB 3S35X 1ZHLB 4F57H 3V95A 4WHTB 2IALB 3HRZA 5E03A 4RAHA 5AVUB 1U8HB 1RP8A 3AG4B 1GH7A 5DRWB 3SYPA 4QOKA 5DK0A 2O4EA 5JOPD 2CHNA 4TQEH 4Z7AA 2VN7A 2H8PB 4WI7A 3CSGA 4XC3H 3T6WA 1T6VN 3AQDA 2H2SD 2IVFC 1EFXB 3MNVA 3Q7JA 5IMOA 3GSXA 1K4CA 1FNHA 5I1IL 1W72L 2JJWA 4ES8A 4ZMLA 3B2MA 3R0MA 1IJ9A 2W38A 3MCLH 2DMGA 4PB0L 4R4NC 4AENB 3A47A 3E0GA 2WBWB 1D5IH 3L7EA 3NCXA 3HG2A 3O0RL 3EYVB 3VYOA 3EXLA 4GRWH 1X7QB 2WWMC 4KK8C 4LLYA 4P2OC 3IMWA 3PRZA 4GBXB 5IB4A 3CN0A 2XPGA 1COBA 1TU2A 2GKIA 5F0JB 4PBXA 4Z77A 4AKOA 2GIMA 1AR1B 1CICD 1I8KA 2YBRB 3HRZC 4GAJH 3DO4A 3J7HA 1E4KA 1W6WA 3BDYL 1BM3L 1IAOA 5CEXA 2ALWA 2EIZA 1P2CB 5AL8A 2LTQB 5D4HA 4P5SA 5I17A 1FZMA 1NLBL 3RAJL 4OCWH 2ZUTA 3WUZA 2FX9L 2MPAL 5EF0A 4IS6B 1IKNA 4ZSOA 3GSUB 4AT6A 3RVXC 5BZDB 3WJLA 4FXGA 3FUMA 2DWDA 2M2DA 5TH2A 4C83A 4DO5A 2EO9A 4M48L 5FYLD 5GZNC 2N7BA 4PRAA 4AY0A 3HUJA 3WS3A 1G6RA 1VFBA 4NNXA 1FNSL 3GFUA 3C8DA 3QEUA 5ICZB 2J8UA 2D3LA 2H26A 3LD8B 5E5MA 2FBJL 4LSVL 4OGAC 5F1NA 1AZNA 4FNSA 1BOYA 4XMKL 2ZCKL 2G3NA 3K6SB 4YOKA 1IAMA 3C09C 4ENEC 2CJ3A 1OANA 3U1PA 3CXHJ 1B4JL 2K4AA 3BKCH 3BSZL 2HLFC 4LIQH 4HV8B 4OT1H 3ULSA 4P5TA 1HQ4B 4LDOB 5CBAA 3EFDL 4UM8B 4Z7UB 3QSKB 2A4CA 4Z3EA 5ID0A 1P7QB 2K7PA 3BH9B 1E6JH 3L9BA 3MFGB 1ID5I 3S5LB 3MJGX 4S10A 4ERSH 2CJTA 3IVKA 1ET8A 1RURL 2WANA 1HL5A 2YPVH 1M3IA 5FK9A 5HJDA 2AVGA 2QDVA 5DJDA 2Q8BL 5F9AC 5CP3H 1MHEA 4C56A 1IQDA 3DGGA 1BJ8A 5ABDE 4J8QA 2BNQA 2W94A 1S46A 5HI4D 4J8RA 1T5XB 5FFGA 4NS0A 3W56A 2ZYHA 1E8ZA 4JFXA 1DO5A 1VB9A 2OCCB 2AQ3A 1ZRUA 4OFQA 1UVQB 2HLAA 2KC0A 2YD9A 4LHQB 2NW3A 4AUYA 5KVGH 1QO3B 2OYMA 3WY1A 3TBSA 4PJCF 4L1DA 3K81A 3HN8A 1TMCB 3BHBB 1PX8A 4PRDB 3WYRA 2ZZUT 4JQVA 5DJCA 4TULH 4FD0A 4LP4A 1XGQA 1I9RL 4RNRB 4PGDA 5CMAA 3S5ZA 1BQHG 5D6CA 4D7BA 1QQDB 3JWDH 5FM4A 4YPGB 3RTQB 3TYFB 1LEGB 2HWZL 2ZX9A 4V1DB 2ZOUA 3RVTC 3ZW3A 3TEWA 2YA0A 4DH2A 1J18A 4NIKB 2NXZB 1FF5A 1SMAA 4QRFA 1CD9B 4UMGA 4PJ5D 2ENSA 4M5ZH 5EORL 1ZVNA 1W0VB 2F5AL 3R06B 3DV6A 4KTYA 43CAB 3T0XA 4DK3A 3KVQA 2GYSA 3ARFA 1YJDH 2V5RA 3WEAA 1J05A 2BHUA 4OZ4A 2JCCE 1JFQL 5E00B 1A9VA 1OD9A 3NSYA 4QNPE 3R06A 4AL8L 1ZTXE 4GH7B 2AK4A 3V5HA 3LKPA 3ZN6A 4ZDHB 4GW1A 3V55A 2WP3O 2MNUA 3OC5A 4HBCH 3NJHA 3BVVA 4HGKC 4N2LA 5I1CH 4TL4A 1QQDA 4TLSA 3EYQD 3B4NA 1IBBA 3FHQA 5CMAB 3UJJH 1WFMA 2JJTA 1S2EA 3ZQXA 5DJCB 3QZNA 5ICUA 1DZ0A 3FQWB 4EQ3A 1YLBB 2D7OA 5I8KH 3F5WA 4N2BA 2NW3B 1WTLA 3MJ9L 4JDEA 5CJBA 1MFAL 5FYJL 5G4OA 5J57B 4FA8A 4R9HA 4BQ9A 2Y6TE 3N9GH 1A4JA 2H1XA 3H53A 3O2DH 4LCWA 4FL4C 2BSED 3S48A 1QFWI 4OBSA 4C56B 3N42B 1KELH 1KC5H 4UB0L 4P9MH 2ZCZA 3ZR6A 1QWNA 2K3TA 1MCCA 2VDKH 2LVCA 1SEQH 3QORD 4OF0A 2V2WA 2KQMA 3BH9A 5I66B 4GAYB 2C9XA 4LHUG 5DD0H 1IAIL 1MEXL 3NSXA 1Q8MA 1XB6A 2AAVA 4AX3A 5ID0B 3DOIA 4ABVA 1LWJA 4FULA 1PMYA 1G5GA 4KRPB 3UTZB 4C58B 3SYAA 1SDDA 4UT7H 1BVKB 1HH6B 5JR1H 3DETC 2FECL 3ZTJH 4TNVK 3I50H 1FZOB 2WZ0A 2VN4A 2EDBA 4Z0XB 2OBGA 5E0QA 4KQ4L 2A6KA 3BP5B 1AMXA 5E5MB 1MLCB 4AIZB 1OPGL 2J8UB 5EC2A 4B95C 2IEPA 2R8SL 2VN3A 4L1BA 1U6AH 5AVTB 2AI0H 3OR7A 2DQCL 1TEGA 5BZWA 1SXZA 3CBKB 4KAQL 1T1WB 4W6WB 4X5QA 1W2KT 1N9PA 1GMIA 4X9BA 4IS6A 1KIQB 2GK0A 3QIUC 4TQ8A 1DJWA 3BIAX 4CGUB 5FKAB 4P4KC 2IANA 5C0AD 2F19H 3Q2NA 3AWEA 1KCVH 2G2RB 3DO7A 1IAOB 1GIGL 4LCUA 1CXKA 4BZ1A 3DHPA 4DQOH 3US0A 2G3MA 2WXKA 1ZT7B 4YIQB 2G60H 2FRGP 1PBYA 2WN3A 4XX1E 1I8KB 5K1VA 3LN9A 3SEPA 3DSNB 1DLFL 1KLUA 4WI6A 1BAFL 1M05B 1XMEB 2VAAB 2V7HA 3TA4D 1DANU 5JIKA 4N3UA 3RVUD 2NMSA 4U3CA 3ZE2E 1INQB 1QBLL 2C1PA 3RZWA 4TPRL 3WTTA 4OLYH 1S7VA 2NXYD 3B9DA 5LBSA 1IM9D 1A9BA 1WLGA 1I75A 3EOTL 2X6MA 3PE9A 4XBGB 1K4CB 3IYLW 3SDAC 1EFXA 3LKOA 5FHAH 5GJSL 5C7XL 3D30A 3MLYH 2DLEA 1SOQA 3EOBB 4DQAA 4K07A 3GUTB 5KYNA 5HJGA 4JRWA 4JZNA 3VWJD 3MLRH 1AR1C 5DJ8B 2LU4A 1IB5A 5KANI 5L88H 1CFSB 1YNTA 1YDPB 1ZHLA 2W65B 1HEHC 4X4KA 5C0CA 1YMMB 3EGDB 4F80A 9CGTA 5F1SA 3V0WL 4HKBA 2F18A 3P73A 4Z7WA 2HKHH 4BKLB 1SOKA 2FB4H 5C08A 2I9TA 4ODXA 4PWEA 4LSRL 2X4RA 2YK1L 3DYMA 3S97C 3NFNA 4QF1B 2YSSA 1NEZA 4PH8A 3RI5K 2YXFA 3MCYA 3QQ4B 5AOZA 1W8OA 2BHFA 2DQUH 2F1EA 1INDH 5LN8A 1NC2D 4NHCH 1KCKA 2CDFB 1ACYL 4DP0X 1CC3A 3Q1SH 4LKCA 1B2WL 3HW7A 4G71B 4OGQC 3S4SB 3S3SA 2YFNA 3T5WA 4Q4IA 3QI9D 1IFRA 4NLAA 5C07D 3CSTA 4C4BA 5JOFB 4LASH 1KB9J 3R7QA 2ZUWA 1HINH 3KYNA 3S2AA 4JGNA 4OFKA 3OAZH 5EHFA 1C12B 2BDNH 1QW9A 4U1HA 2FQGA 2AXFB 3MBWA 5CZRA 3VWKA 3ZZQA 1QATA 2Y7MA 1TCMA 2FIRT 3GBLA 4JVWA 4JL2A 1PD1A 2WNKA 2HPOA 2AMGA 2QTVA 5KYWB 4WNSA 4IJ3C 3FQTA 1N59A 4ZS6C 5TF1L 4MJ6A 1KJ2L 3N91A 5H2BB 3VFNA 1VFAA 3L5WB 3HJEA 4RIRA 1TQCB 2XA8H 4GI6A 2XFXB 4NB7A 1UGKA 5GGRA 5EOQL 2A83B 1DJSA 3AU1A 3BWAB 4U49A 5EU5A 3TF4A 1ZA3B 4PS3A 4PBVC 4DP7X 4F7TB 4F8NA 1U8IB 5KYYB 3LRSA 3L4ZA 6FABL 4XPBH 1BXXA 2WTOA 5KUMA 2VL5B 1YYLH 1U92B 3QJRB 4TNGA 1UM6H 3D09A 3WJJA 2EACA 2BJML 3SOBH 2EUWA 3P69A 4CW1B 2CKBL 4YQXH 4XP6L 3ARED 2XXCB 3L17A 1BEXA 1WH0A 1UCBH 1MFVA 2I07A 4TM9A 5GRVK 2WV3A 2ZP9A 3SKUD 4OKDA 1D5BB 1NMBL 2QVTA 3L4XA 2OP4H 5DRXB 1RQ5A 1D9KB 3A6OA 3K3QA 1IT9H 3MLVL 2Y72A 5TE4H 4LVNB 2F2HA 2VXQH 5IFHL 3L13A 3ZRSA 1RUMH 4XNZC 4PJ9A 3RP1A 3D0LB 5DMYA 3V8CA 1CL7H 5AUMB 1QSEE 2ZWZA 2AQ1A 4FTVE 3KPLA 2FGZA 3I75B 3QRGL 3TFBA 3LSOA 5I23A 1YEFH 2DQUL 4QCIA 5SX4I 3SDDD 4A7VA 4P8QA 5EPMB 4FFYL 2E46A 5D9SA 2O5ZH 2QQLH 3Q8EA 4Z9KB 2JTDA 5CN3A 1TJGL 4A2LA 3ESMA 1CURA 1IEBB 3IN2A 2FIKA 4PGCA 1KBPA 1TFHA 3QQ3A 1AJ7H 1E4JA 2HKFH 2PTVA 5I75C 2EEFA 3TVMB 5DGRA 1QR4A 1MH5B 2DQCH 4Z7QE 5PCYA 2EYRB 4P2YA 3D7PA 1EHNA 1JNHA 3IS1X 4TXVB 3SO3B 4WSGA 4NO5A 5EEWA 2GEEA 3V4PB 4OZIE 1BG1A 4PN6A 1TITA 2WXRA 2ZP8A 4PD4K 1M71A 1FE8H 3ESPA 1PL3A 5MP6H 1LO0L 3L5HA 4HAFA 4ZX6A 4Z7UE 4MBOA 3VMNA 4ODWA 1FG2B 1TF4A 2G0LA 2Z93B 4RAUA 4ILDA 2E7LA 1MW1A 3I6SA 1TJIL 2WXHA 1MRFH 3VNYA 1WZLA 1JUFB 2GSIA 4LSDA 1UQSA 2H32A 1NCHA 1M9WA 1UFGA 4HZLB 1HJBC 2B08A 3T2OA 5KBKA 2FO8A 1JWSA 1K2DB 1UJ3B 4IBSA 2NY0C 1I4FB 5E94A 1JV5B 3M1CA 4XCCL 4H26A 1IEAA 2FO1A 4GRLD 2EEDA 1IGTB 1MG2C 4JEGB 2Z31B 5FA3B 3WFDH 1QI4A 1DBKL 4JRXA 1ULVA 1LDPH 4D8PA 4DF9A 4K8RD 1VEPA 4UV7H 3P2BA 1ZTMA 1KB5H 4IU3B 5JW5A 3W38A 4LOEA 1I8UA 1VSCA 5BS0A 4W9IC 4A6YB 1MZYA 1QP1A 5DC9B 3LTVA 4GO8A 4FCHA 5FFLA 1CXLA 5L88L 1GSMA 4TUOB 4D0CB 3RX5A 1YEHH 5AAMC 4DVRH 3MUY1 4XVJL 4WI2A 2H6PB 4FG6C 4Q14A 3TYGL 4APQD 4X4ME 1CDBA 4FP8L 3P4OA 5MI0C 1QLEB 1JF5A 2VGLM 3Q6FA 2YOAA 4FFZA 1HCVA 2V9TA 1I1YA 4KKRA 3DA0A 2BSSA 3BH8B 4ZAKD 1WPCA 4N28A 3VXUA 5I9QC 1MELA 1ASOA 1URZA 3SPHA 3WAKA 5EC1A 4GG6B 2J2ZB 3B2XA 5ITFB 4ZW8A 4FJ6A 4H8UA 1NPUA 5HGAA 3B8YA 1YC7A 3FZUD 2PETA 5ESAA 3T0VA 4YO0A 3ARTA 2H3NB 3KLAA 3K91A 1PGRB 1KEGH 1XCWA 4Y16A 4PBWD 4HFWB 2DD8L 5BNXD 5D4IA 3EF7A 4RISH 1F4YL 2ZAIA 2AXGB 5D1QB 4ZO7A 5EOCH 4GAGL 3QPQD 4K3DL 2EDYA 4LCIH 3O4LB 3RX8A 5G4MA 3RVVD 5BVPL 4QI3A 3UG3A 2QDWA 1GPOH 4ADJA 5HYSB 3IDJB 1LO3H 2DQEH 3D69A 4MJIB 5GS1A 5MP6L 4O9HL 4ZUVB 4I0CC 3VSVA 5BOPA 4I2XE 4YDIH 2IPKB 5F9OH 2VDNH 1ECYA 5FF6A 2BSBA 4YSRA 2YAPA 2B1AL 1U8JA 3FC8A 4IEFA 1KTDA 1M7XA 3P0VL 3SGEH 4YXLL 4D0DB 2WPGA 3TZVC 3WUWA 2N3JA 5KBMA 2J8HA 5BCAA 3QIUB 3RY6A 5GGSA 1ZCRA 3DX7B 4OIIH 1U58A 2AKRA 2K9FB 2MSPA 3R7RA 3EYFB 4PRIA 4QGYA 1OCRB 2HVKB 5FYJD 2Z4QB 4LDCA 5E9DD 2NW2B 1XCXA 2X44D 4KO9A 4G8AC 3T2QA 3TO4D 3S37H 2J44A 1F8TH 5G55A 3KYMA 3LIUA 2XN0A 2FBRA 4NUJB 5DHEA 2HT3C 3G5VA 4AL8H 4NFDA 5DHYB 2CDGA 1T0NA 4IBUA 4XX5A 5EULV 4PJCB 3HG0A 1MFBL 1R19A 3STZB 2WC7A 1NBVH 1EAQA 3JSSA 1M6UA 3VFGH 4X4YB 2ITFA 4A67A 1J0YA 2QBWA 4BSVB 2G5UA 2BNRE 4HJ0C 4WK2B 4P0DA 2W07B 1CGSL 4YZFE 2FLBT 2OYLA 3H2PA 2IWEA 3DJRA 1T1XB 1XH3A 5KVDH 5ISZD 4JUTA 2JELH 1R6VA 4BQBA 4YDVA 2OAAA 2JNZA 2XOTA 3HZKB 4FQXC 2QMJA 1SY6L 4J1UB 3TPKA 1OB1B 5T8IA 1F90H 1OVZA 3QCVL 1E7UA 1PD0A 4WAFA 2NY5C 4RDBA 2J55A 3MRQB 4J7RA 1KB3A 1VGKA 4IOFD 3ZL4L 2C4FU 5DURB 3RBSA 2VC2H 2V9RA 3KCPB 2CNYA 2RQEA 2XQBL 2YD8A 3D4ZA 4OZFB 4YVNA 3MBXL 3U6XS 4P5KA 4L8SA 2JVUA 4Q7DA 3VRIB 1SVZA 2Y7QA 3EJQA 4JRXD 2Y3NA 4F1ZA 1H15B 4POZC 2XKNB 1K8DA 1OZUA 4KFZC 3QAQA 4NDMB 5DD3H 3SDYL 4FQIL 4PJFA 3N1MC 5IBUG 3KEHA 3VFMB 3AM8C 4F37F 5IUSA 1BFOB 4KXZI 2G4GA 2PCXA 4KHXL 5DYFA 3BVNB 4KUCF 1U8MB 3RA7L 1MUJB 5D7JB 3CFQA 2UZPA 3PHOB 1C08A 1JHKH 2MCAA 3WE6B 1BQUA 2Z91B 4YK4C 3QRGH 3CUPA 1NGZB 4FQHB 4HKJB 4J4PA 1OW0C 2X2JA 3OAYK 4HXAH 3J8F7 2DW5A 5FYKD 4F1SA 2YIHA 4OLXL 3JWDL 4EF3A 4LIQL 4MA3B 3I02B 3GRWL 2DN7A 1KEML 3GLZA 2VXSL 3CDZA 3CFJB 5A1AA 5F7EL 3OHXA 3BZFB 3ZGHA 4MCYA 1QSFE 1G7MB 2GIYA 2NNRA 3P9MB 3RL2B 1IX2A 4QRPE 4ZFZB 1MLBB 2BS8A 4G8FA 3EJCA 5KS9E 1CI5A 4EVNB 3ULUF 1GZQB 3SIKA 4NO3B 4U4BA 3BT2H 1V54B 4HSAC 2XX0A 5I6XB 1H8SA 5JXED 1QNIA 3DX8A 5JPNB 2ADIA 3CK0L 2ZSVB 2FX8L 3D0AA 4HU2A 5K39B 3HS9A 3QI9A 2DQDH 4OLZH 3PQYE 4UAHA 1A3LL 4P46C 3SDXB 4EN3B 4NRXB 4KDWA 4FQQA 1BZ7A 3E8VA 1LP9B 5EEXA 2R23A 2B3RA 3A23A 1R24B 4NZTH 5IHUL 4HUWB 2X0UA 2VZ1A 2FWUA 3FTGB 5INCB 4JG1H 1OLLA 1T2QL 1S7TA 1KGIA 2YWZA 2VISB 2CNZA 3B34A 4NQVB 1LE5B 2WJ7A 3ML8A 1E5ZA 1ZY9A 4OJCA 3QHZL 4OZGB 3VFWA 4DP6X 1IC5H 3GPEA 5B1BB 2PO6D 4OM0L 4KC3B 3FT4A 3NPZB 5CN2A 5CKGA 1P5UC 3OF6A 2CGZA 3QZWG 4J3UA 2XN9A 4N8VG 3AJ7A 5GS3A 2WXIA 2NY7L 4ZO8A 4ZOBA 3RU8H 1PLCA 3GNML 4KMLB 4RBPH 4IKJA 4PRPB 3U2SA 3FH7A 3NAAL 3MCKA 2F58H 2FHCA 3RUGB 5I76A 4U6TA 1FRGH 4URTB 1QSVA 3UO1H 2WYZA 5D72L 5J56B 5HDQL 4WJ5A 2A9NH 4YHPA 1BGXL 1SJHB 3O45A 2NQDA 3UDWA 3KL3A 3QJUB 1AXSB 2A99A 4L4JA 3KLLA 2VLME 4GQ9L 3T1FB 2BFGA 4U0QB 3VD9A 5L8LB 4JRYD 1I7UA 4NEHB 1FRGL 3UO1L 2CO6A 2VUOA 3D3VB 1KTRL 1PAMA 2ZNWA 4NENA 1NDMA 4NC2B 2R2BA 3QIWB 4NQCA 2KQNA 1GL4B 1D5RA 5F2FA 3EBHA 4PRNB 4JQIL 1VPOH 3CIAA 3NESA 3CCHB 1KG0A 3QZLA 4MNGA 3T4YA 5DD5L 1G1YA 2P4AB 1VA9A 3QUXA 3HMWH 2XG4B 5IROA 4C4UA 4DNLA 3ULVF 4AZ8A 1MIEH 4B60A 3KPSE 3RZCA 1JSYA 1MCOH 2X0VA 4XVUD 4BFIA 4LHJB 2EC9U 5K93A 5C09E 5KYXA 2EVGA 2VLKA 4CDGC 2E5EA 3A24A 3QIBC 2PR4L 2WXLA 5LN4A 2XN2A 2GJ6A 1KDIA 1UHVA 2VZVA 3D87B 5DEZA 1FIEA 3U48A 4R5TA 2D7TL 5BOZG 1JZGA 1BX2A 2NUTA 1FZJA 1M7DB 1INEH 3HUJE 1S5HA 4MQXD 1FJ1A 4BH7B 5D7KE 4PB9H 1JIBA 2NOYA 5IBUB 4OCNC 4HUUA 2FWLB 3LB6D 1QABA 4ZMNA 1J0IA 5LBSH 4TN9A 3GHEH 1FO0H 1FVEA 4UUJA 2GSGB 1MIMH 3VXRA 2F54A 1MFMA 1H19A 3D39B 3MLXH 3UTSA 4A55A 2A38A 2Q8AH 5FYJH 1OT1A 2H45A 3ECBA 2RQ8A 4LOUD 4AVHA 4I0KA 5FB8B 3HE7B 4ZOAA 5J1SC 3G7TA 2VJXA 1UXSB 4XHQA 1JNNH 3NABH 4FG2A 4XC1L 5I1KH 3UAJA 4YMPA 4ELKB 1NCUA 3DBXB 4L4VE 1KJMA 4GAFB 1EUUA 4UOW0 5ERWB 2BSEA 3FHAA 1P4BH 3TWCL 5DA0B 2VRKA 4K23H 2BHYA 2HTLD 1UB6A 3LV3A 3NJIA 2JF1A 2P5WD 3IMSA 5DCCA 3R1GL 2K45A 1MJJA 4XP9L 5DK2B 2Q7YA 1NANH 2XTJC 4UT6H 3BRGC 3FBQA 3WHE1 2XCMC 4X6CB 4WWKB 4XNYL 2BP3A 3BI9X 2V2XA 3CQFA 4WO4B 5DJ6B 3UCRA 1FL3B 1N5YH 1JGDB 1DVYA 4XP9H 4TNFA 2HMIC 2AEPL 3W9EB 3ESOA 2ZCLH 3WIIH 5E2UL 1GYUA 3A22A 4P3DA 1N12A 3MBXH 1UA6H 2GJPA 2IWGA 3Q6GL 5CINL 4JMNA 4YGVB 3REVB 1XGRB 4ABUA 5D1ZI 3ILPA 1E2VA 2CALA 3S3PA 4AM0Q 1NWPA 1MFDH 2NY6D 3VI3A 1CGWA 4AV0A 2NY4D 1PZBA 3JWNG 2E9JA 4H40A 1OGAE 5DJYA 1JPGB 3MA9H 4CBPA 1OTSC 2HT4D 4KQ0A 5EWIL 3C2AL 1JXJA 2IFFH 2P24A 3EOAB 3L3OC 1P9MA 2NY2C 3NYKA 5D2LB 2KKQA 2CCLA 2WBXA 4Y2NA 3ISWA 3TO2A 3N50A 4E9RA 2K8QA 2D9QB 2A4ZA 1G7LB 3MRLA 2YPKA 1YRKA 3VRLF 1A02N 1U33A 3BSHA 4WTWA 3QJXA 4PW9A 3QORA 4FZEH 5E2UH 5I75B 4JAMA 2HLFD 3M46A 1GJUA 3O2VH 4FFVD 5F88B 4BHUA 1YY8A 5HPMA 5KVFE 3VFSB 3MRIA 3VCLA 1CF8H 5D7LA 5CEZL 5T3ZE 3CLFL 1S8DB 3PL6B 4XPTL 3DTXB 5D6DC 4X9IA 3V0JA 3GMNB 5IT2L 4X6FB 4ZFFB 5DC4B 4YUEH 3LN5A 3QNXB 4HJGB 4I0PA 4O58H 2CK0H 3ATFA 3E9TA 3FQXB 1P9MC 4FNRA 4IDJL 2DMBA 1G94A 4M29A 4GT0A 1MI5B 4WWID 2ITCA 3W5MA 5A16B 2BW5A 2EDTA 1DQJB 2CUMA 1AKJD 4NLHA 3M8OH 3H3PL 4QHMB 2O61A 2JXMA 2J20A 5IBLC 3LNDA 3K80A 4KUCD 2XQ0A 4GIOA 5KN5B 2VM3A 4X9FA 4I4WA 2JKSA 1B9KA 5BPPA 3DV4A 5CP7B 5L8JB 1X9UA 4TUJA 1SLXA 3GB7B 3FQRA 1CFQA 4LF3B 5GSVB 1WA0X 1FO0L 1P5VA 4PJ7B 1A6TA 4K9EC 1T83C 1TZHB 5CINH 3WJMA 4FFYA 4FG4A 5FDWA 3B8SA 3T65A 2ZCLL 2X53A 1T21B 3TOPA 4L3EB 2DD8H 3AU0A 3IFPA 2DTML 2WTRA 4UTCA 3ABKB 1DVFA 3KJ6L 4HWNA 5AD0A 2Y5EA 1RJLA 4RGNB 2VDML 2X6AA 4HU8A 3NCWA 4B3VA 1J8KA 5F3HB 2PCYA 3P30H 2NT1A 3L3JA 3AMLA 1BBDL 2PP9A 4M43H 2VLLB 3V7MA 5JOEA 2A74C 1X5JA 4G9FA 4LP5A 3UCQA 5MENB 3VX0A 5C0RH 4OI9A 3TT3H 2PTTB 2XVGA 1OGTB 3QUKA 5K1JA 1SXBA 5HHMB 1N5AA 4Z78B 4IKKA 1KJ2B 4LKXA 4AKQA 2D73A 1OM9A 1PFOA 5FA4B 2Y2TA 3O9WC 4PCYA 2OYPA 2G3XA 2D31A 2L04A 1JDDA 1U8KB 5KVEE 2WWNA 3NG5A 2BIQA 3O3UN 4HF5H 3MRPB 4OB5H 3K2UH 4PJIE 1X9QA 1QLEL 3LH8A 2ZNXA 4WTZG 4WRLA 3DHUA 1J8HE 1JTTA 4X4XA 2Q8AL 3MLXL 3AMKA 2Z7WA 5T1MA 1J9CT 1NJ9A 2FX8H 5HGHA 5JMRA 1SDYA 2XJLA 1BSIA 4YR6B 5ELIA 5K9KA 3IDNB 4JDTL 1FL5A 1FHGA 2AEQL 2OA9A 2ZTBA 3UBXI 5JTWA 3RY4A 4LRNH 5LWYH 1FN4B 3PWJB 3HNSL 3TBBA 2B7DT 4MXQD 1UADC 3FB5A 1G9ML 2NY7H 3RU8L 2V6HA 4YGAB 3ULUE 2YKLH 3LKNA 2Y5TB 4GOSA 3RWJA 4BIKA 4BK4A 4NT6B 4R97B 5B8CA 1DBJH 2IWKA 2GIXA 4MBRA 2F58L 3G6JE 5TQ0L 2LAAA 4QTHB 4PVBA 5B7FA 1RMFH 3WFBL 4EIGB 4D3CH 1QHPA 2H9GB 4QXTB 3NTCH 1G7PA 1QSFB 3I2CL 3RX7A 2DICA 1EK3A 1GY1A 4HH8A 4CU6A 3DYOA 4Z8FL 2A1WH 3AQYA 1OF0A 2CM6A 5FWRA 1KIPB 2FYYA 4R90L 5EZOL 5IEKB 2R83A 3T6ZA 5K9JH 4PG9B 3CLFH 5B38A 3UPRB 3OAUH 4U6XA 3PHQB 1QA9B 2W60A 5F1IA 2P28B 2MOQA 1IIKA 2ESVA 5F6IB 4ORZC 1ZV2A 5I0XA 5E8PA 5F7DB 3FRUA 1KBGH 4Q56A 2WLLB 3QH3A 3D39E 3CFIC 1D7CA 1TLMA 3KGTA 2BOCB 4PWFA 1QASA 3CK0H 3FUFA 3WNMA 1RUPL 2L7UA 5AVYB 1DLHB 1GZHA 4PW3A 4Q89A 4ODVL 5IJKA 4PLKC 3ALWA 2UX7A 4QHLB 4NJAL 3KBFA 1F5WA 3LKRB 4OCYL 4RFOH 4C56D 5LNGA 2E59A 7CGTA 4TQPA 2I7SA 2XPZA 5TK4A 3B2VH 1A6ZB 2XQYA 4LCYA 1SXAA 3LNEA 2CK2A 4TLUA 3H55A 2JB5H 2EEXA 2R2EA 1ACXA 2G3ZA 3KHOA 2YD2A 2OX5A 1NAMH 2B5IB 2DDQL 1A6AB 3P0GB 1E2ZA 3FO9B 2CLVB 3UC2A 1L9OA 4PJGF 3BUYA 3BXNA 4W9FC 2NY6B 3ZJAA 3U36B 1C9SA 1M2VA 2G30A 4Y89A 4ZMXA 4OM0H 3CN3A 1AG0A 3E80A 3QO1A 2B4CC 3PXLA 1ZLUK 2VSCA 1U8QB 1UYWH 2CDEA 4LCCA 3LIZA 5IMKA 1UM4H 1JWUB 5ICXB 3U0TB 1LEIA 1RKRA 3EFOB 3GTVA 2WINA 2O6FA 4QO1B 1PD6A 4ES9A 3GBEA 3TEUA 4P46B 3UTPD 1WC7A 4BZ1L 1X5MA 1AGBA 4QHPA 5C8JA 4TV3A 5HI5D 1BWMA 2RHEA 3DRQB 2OZNA 4WTZA 1KB5A 5A2AA 5IOPB 3PNWB 5EUKB 4XPBL 5GRUH 4M6OL 1F1DA 3BCDA 3WNKA 4B9IA 1QNZL 4XO3A 3B5TA 3E8UH 4H8WH 5C9JA 2ESVE 3IETB 3MO1B 1JDCA 4JO4L 2NUPA 3CQQA 4KGJA 5CWSB 1AVAA 3GSVA 5KYUB 3QEQB 4U1IB 4BK8A 5AW1B 4WO4C 3WFHB 2FO4A 4FJYA 5BRZA 5D2NB 4AXWA 3VXQA 1H3PL 1PZ5A 3IGAB 4KDTC 4Q2ZA 5FHAL 1HSBB 1BLNA 3O3EB 4W9EC 3ZE0B 3K8LA 4PGBB 4N3TA 1FNGB 4R6UA 5EOTA 1RZQA 4QXUL 5D5MA 2I32A 1HXYA 3SD2A 2VN5A 5IHWA 3JQOB 1T22B 1G9NC 1E5AA 3T71A 4N1EA 4CVXA 3KR3H 3ECQA 4DP1X 2P80D 3ECUA 5FO8A 5K1NA 5HHVL 2F7IA 3QUYA 3GXNA 1D6VH 2YA2A 3GHEL 3MQIA 1UWFA 3X17A 2Y0SA 1TTGA 2BH0A 3L3DB 5F9JB 1SF3A 2BVPA 4J3VA 4Y5YA 4U3XA 2IOOA 1U8OB 2D2OA 2OMZA 5GGTA 1BF5A 4F8QA 1WHOA 3LN4A 4F7CA 1MRCL 4N20A 4FXKB 3HNVH 4MXVE 1A7NL 2OZ4A 3S8WA 1USQA 1GYVA 1A3RL 4BSJA 1U8LB 2X87A 4JZJC 3B2DC 3TEXA 2DKSA 4B0MB 4AGMA 3IDYC 2F7OA 3PU7A 1YMMD 1F1GA 1MCFA 4K9JA 4D9RE 3OB0K 5IFJB 4CJ0A 3B3IB 3G6JA 1EGJA 4DN3H 1F2QA 5J11C 2Y36H 3EBAA 4PJ8C 3P40A 4EUPG 2GHZA 4Q9QH 2BOBA 1LD9A 3V5KA 2C4FT 3QUYD 3PDGA 4Q9RH 1CBVH 4Y2LA 4G8GB 2BVOA 3W5NA 2PW2A 1JOIA 4PRHE 2JH2A 5I24A 3OXRB 4K71B 4L4VB 5TGBA 3X2QB 3ZKXB 1E2WA 3OB0H 4PLNC 4HCGA 3EHBB 2Z92B 4GS7C 2E75C 4HUCA 12E8L 3X3GH 2DL2A 2QSCH 1I1AA 1KGYE 2B1AH 1GYCA 4KK9C 4NQUA 1JNLL 4ZW3A 2AJUL 1E90A 2RTTA 2RFXB 3EDFA 3SGDH 4U1LA 1SEBB 3KBEA 4F33A 3RGVB 5I1HH 1KGCD 1HSAA 5LG6A 3GM0A 5GRZA 3VXPB 4HFUH 1X7SA 5F9WB 1IC0A 3UTQA 3LZOA 4FS0A 1OAYH 2A6JB 4NSKB 3WFDL 4QY8B 1PAZA 3VU2A 2YAEA 4WKZA 2KZKA 1A66A 3HG1B 4BEIA 1IGFL 3OJ2C 4XMWA 2KPNA 2XV2A 1XTMA 2BVEA 4HWZB 1QFUL 1FA4A 2Q76B 4FXLA 1HQRA 1BIIA 4LVOC 4E0RA 2OSLB 4NQDB 3DPBB 1WT5C 5ID1B 1KY6A 3GJEB 1NAKH 2FL5B 4OCXH 4JQVC 1BD2D 1WUZA 3NCCB 2B1HL 5E2TH 5CJOL 5D1XB 1R3LA 3MUGB 5HXMA 2X9YA 3FU9A 5KSVB 3D85B 1BVLA 1YPZA 2BNUA 4PV9B 5JW3H 2XICA 1N8OE 3QJVB 2R1XB 4JFSA 4B5ZA 4ELMB 3MJWA 1E9OB 4XBEH 4JKNA 5KS9B 1DJHA 4JPWL 2OULB 1LE9A 4X6DA 4X7SH 3V52L 5LGJB 4JHWH 1VZIA 1U91A 5H37A 4D9QD 1OT2A 5KOVC 3WKNA 1A3LH 2GFBA 2OMXA 3DYPA 4UM9B 3NCJL 2FH8A 2Z35A 3FSZA 3HC0B 4NQQA 3RVWC 4Z7VA 2JKWA 3FUNA 4M1GH 1AD9A 1IBGL 4HJJL 3OKEA 3FU7B 3II3A 1ITBB 2FX7H 3LB6C 4GQ9H 4GY4A 3WO3B 4LLDA 5BUGA 3S36L 3KXFD 1YG9A 4OAWB 2NDFA 2UWEB 4FOMA 1KCRL 4NPYA 4XXWC 2O6DA 3ZE2B 3F58H 3NIGB 3RTQC 5D1XE 3HC3L 3DETD 5KBLA 4Z7OE 3O6FB 4QHNA 3EO1B 3OR6A 5CCKH 2VQ1B 1FFQA 4HC1A 5F89B 3H2QA 3U4EB 2OQJB 3UJIH 2XZQH 5LAXB 1IGIH