4UTBA

Crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
394
structure length
391
Chain Sequence
MRCIGISNRDFVEGVSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Immune system/viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
total genus 75
structure length 391
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utbA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utbA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utbA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utbA03
3N44F 3UZEC 2I69A 4FFZA 5GZOA 2H0PA 3UAJA 3WE1A 2ALAA 1OKEA 1Z3RA 1ZTXE 1TG8A 3N43F 3UZVA 5LCVA 4ALAC 3UYPB 5KVEE 3J27A 5LBSA 2JV6A 1Z66A 1S6NA 5LBVA 3VTTA 5KVGE 4BZ1A 1SVBA 4UTBA 4UTCA 2HG0A 4L5FE 5GZNA 5JHMA 3MUUA 4GT0A 3N40F 5IREA 3G7TA 1URZA 2R69A 5KVFE 3N41F 5H37A 5IZ7A 4BZ2A 4AM0Q 4X42A 2R29A 4AL8C 2V33A 4GSXA 2GG1A 3IRCA 3UC0A 1OANA 4UT9A 1OK8A 5B1CA 5AAMC 2JSFA 2JQMA 4FG0A 3UZQB 5AAWC 3I50E 3C5XA 3C6EA 4UTAA 4UT6A 1PJWA 5JHLA 5KVDE 3J2PA 3N42F 3P54A 4FFYA 1UZGA 1RERA 2P5PA
chains in the Genus database with same CATH superfamily
3TVMD 4OR1A 2P7TA 5D7LD 1F2XK 1LO3H 2JLPA 1TYRA 1JGDB 4DUXA 2NLJB 2ICCA 3FOMA 4ODWA 4MHHI 3OKDB 2R27A 4AIEA 5BQ7A 3KPQB 2LFEA 3ASOB 1BZ7B 1VESA 2VN6A 1BPVA 1B6UA 1IIKA 5A2IH 1LJMA 4WTQA 1ID2A 3IGAA 3PJSB 4YE0A 1XDTT 2FIKA 3MLVL 4LCWA 1VFBB 1KGJA 4K9EL 2ENQA 2WYIA 1HXYB 2YUWA 3FQUA 1KWKA 1MCFA 1DJXA 1RJZA 3QO1A 4L9LB 1TJMA 2ATKB 1F2QA 4PJCA 5TDPA 4G71B 5CEZE 3SE9H 3KGRA 4G7VL 4KOCA 4FI8A 5EBLB 4XP4L 5INDA 2Q6WA 4ZMAT 1HK6A 1MJ8L 2UY7A 5JW3L 3FCTB 5C3IA 4N2FA 3P3YA 5KYWA 4IRJC 5HHVL 1AC0A 5K9QI 4K71C 3ZR5A 4M62H 1EEUA 2QFPA 4LEEA 3CC1A 4L0PB 3QEHA 5CSZB 3OB0K 5ITFA 3QUKA 1PKOA 3KJ4C 2FX8H 2VDRH 3BQUC 4AM0A 4KKRA 1HXMA 2P80A 4K73A 4AZUA 1W6LA 2DMBA 4JAMA 4AKQA 4Q9RL 2FEEI 1UA6L 1KYDA 2O6CA 3ARDD 5EEYA 4FQXB 2GK0B 4XMPH 4H5SB 5GRUH 1AHWC 4AL8C 1KLFA 3P2DA 5EO0B 3F01A 3KPRA 3QUZD 5GGVH 1A4JA 2X10A 4WKZA 3HOGA 1X7SA 2HKFH 5C0CB 5IROD 1FLRH 2F15A 3CU7A 2CKBH 3F65A 1MH5B 3QNZA 2H0JA 3ATAA 1VERA 2E86A 3HBZA 1EQWA 2Z31A 1UJ3C 2H9GA 5C0JA 1ODUA 4YK4C 4XH2A 3SQBA 1ZY9A 4RZCA 1GYUA 1CFTB 5AVZB 2CBOA 2WLJA 4ZO8A 3D09A 3NAAH 1PAMA 2DBLL 2GT9B 2Q3ZA 4WI4A 5D7IF 2YAQA 4FX5A 1MQ8A 3X14B 1XR8B 4KX8A 2VL5A 3G6DH 1LDPH 1EH9A 4JFDB 2J3SA 1E3FA 1RK0A 3GSRB 1FAIL 1ZHKB 1MW3A 4NDMA 3APCA 3KYMB 3L2NA 4AX3A 3GBLA 3QDMB 4Y1AD 3L5XL 4H25A 4IU2A 4NFDA 4OF0A 1MFEL 1TZIA 3MYJB 5IOPA 4JPKL 4XWOD 5KBNC 5I9QB 1J8KA 4JM4H 4X7SH 3IDIA 2WUBL 2BIQA 5EZPA 4MA8L 1JD9A 2XZZA 3MRGB 2NY1C 5EU7E 3FSZA 3U4AA 1Y07A 4WUUD 3KPRD 5E5LA 5D5MF 3GMPA 1AGEA 3EIFA 2YEZB 4JR9H 5LGJA 4Q4IA 4OZIB 3MRFB 1K5NA 2K4WA 4Y4FD 4OCNC 1QBMH 5DHVA 3MLXH 2H6PB 3OMAB 1HWWA 8FABA 3OTTA 3G6JA 1VIWA 1BYPA 5HI3D 4EI5B 2N3JA 1SY6L 1NOLA 2AQ2A 2J1ZA 1Y6MR 3RTQD 2X7LB 3VMOA 1AGCA 4JG1L 5I5RA 2BLFA 1IBDA 1XV8A 4ZO6A 1T7ZA 2WQAA 1JGEA 2UZYA 4JFTA 4N8CL 4Y5XB 5JMOC 2CLZB 2ESVB 1BXVA 3NESA 3ECWA 1J1XL 4O02H 4IJTA 3I6LE 4QHUA 1D5IL 4I1PA 3QBTB 2XG5A 4M6NL 1YZZA 2WMPB 1JD7A 3OKLA 3P3RA 4PU2A 2ZCZA 3FYIB 4XMPL 5B1JA 1DFBL 2ADYA 1LO0H 2JCCF 4Z9KB 4KITB 5E5UB 1E8YA 2BRQA 2TSBA 3L4VA 4WFHE 5GGTL 1O7DE 3PLYA 5ESQB 4XWOC 5LAXA 3IAGC 3JT0A 1JK9A 4PG2A 2B0SL 3GLEA 2IH8A 2XA3A 1G4MA 3HAEH 3IKCB 4QTHB 3O6MH 2DTML 2X4SA 3PWLA 4ORGB 4NPYA 1SOXA 4JY5L 5IIEB 1OT4A 1SHWA 4Q6KA 2VZTA 1DHKA 3W2DL 3ESPA 2N4IA 1JP5A 2F1BA 5J3HC 2O30A 1NCJA 2CKNA 5AAMC 1I7TA 1K3IA 3QZOA 4N1CA 3N91A 3RNKB 3VXPA 2C8NA 2OS7A 1GZQB 4L8CA 2I7OA 3ZDYF 3HG1A 1T21B 3W39A 2HRHA 2BVYA 2X0VA 4M43L 1E43A 3CWGA 4L8SC 4OH2A 2ZUSA 1HWGB 4N5ED 4ALAC 4AIZB 2Q7NA 3T09A 3LTVA 4U1IA 3FTWA 3FU7A 1Z5YD 3TO4B 4MNHB 5FUOL 2J8OA 1AR2A 1F4HA 4FC3E 3APNA 4MNGB 3WJMB 1NMBH 1RIUL 5D1ZD 2YR3A 5CLWA 1Z9SB 1QPKA 3QK0A 1KCRH 1BAWA 1HILB 1RURL 3FN3A 5GGUB 2CM6A 2R23B 5FO9B 4Y4KD 1A7NH 4PJAF 2GEQA 1L0YA 5B4MC 5L7XH 4N20A 3L3JA 3MCKA 3GPSA 3CDZB 4MDRA 3LRKA 4FA6A 4NO3A 3PS6A 1TUPA 1RJCA 1DBAL 4G82A 1BBJA 3VXPB 4X6CE 5DQDL 3VAEA 4I18A 4JY4A 3CIAA 5LDSA 2WKLA 3ZLQC 3LEVL 4XCFL 4JRXE 2X4OB 1O7VA 2AK4E 5DEGA 4CC4C 4MJJA 4MNQE 1U4FA 1IBHA 5JPNC 3UX9B 1KIRA 1J1XH 3W9EB 1KOAA 4NN7C 3NJFA 3DXAE 4LAQH 3TA3D 1U8QB 2D2OA 2OXGB 5IQ9B 5JHDD 3ARBA 5ITBH 4RWYH 3Q6GH 4KPHH 2WW8A 2OI9B 3QCTH 3Q8AA 4HBQA 3HZVB 4OGYL 3OM3B 3D7PA 4J4PC 4PJIA 5EDXA 4Z0XB 1NKOA 3DX7A 4FG2A 3PHAA 4J3UA 3MJGX 5AW4B 4AKOA 2GBTA 3MLRL 3RNQB 1FFTB 1T89A 2WMPA 5CLYA 1MHCA 3LN5B 4HSAC 3VXRD 2JKXA 2OP4H 1B4TA 2B5IC 3DTUB 5D7SH 5ACZB 2EH7L 5I24A 4QHUB 4QT5A 5IQOA 1PBYA 5SWZB 1F6FB 1AZUA 1KEGH 3ZUCA 3IK2A 3IFOB 4DW2L 1JZDC 1M7IB 3I84A 1SMAA 1PD1A 1OTTC 2EUWA 4Q6IA 5D4JA 3CVHH 5HDBF 3RVTD 2A9BA 1XXFC 2EDOA 2J2ZA 3BGFC 4UMGA 3UG3A 3QDJB 4P2RD 2ZX6A 1KT2B 3RFZC 3U6RB 3FT4B 5LBSA 2K45A 4YFLI 1V3MA 4UOZA 5KS9A 2CBTA 4FXKA 5JLZB 2N7BA 2Z7ZA 2X3CA 1ICTA 2OW7A 1T66C 3BPNC 2NY1D 4S2SB 4X5QA 5EU7C 1XGYH 3OWEA 2X1WL 1S9YB 4JANA 4Y1SA 1FA4A 3MRMB 4IRZL 3MV7B 4M6OL 3W38A 2Z8SA 1SJHB 3Q9PA 5C2BH 2O6FA 3BP7B 3AS3A 4EXPX 3HS0A 1IAKB 4YVUA 3D07A 5F70A 1CTMA 4H25B 5AZEH 3CXHK 3PAZA 1ZHLA 1P5UC 1PD0A 1X44A 1WP6A 3IXAA 4NS0A 2CRZA 4RH4A 4BFBD 4FZEH 1NIEA 3D85D 2ZTBA 4JFDA 5E8NB 3G5XB 5MEND 2AJZA 5HHOD 4ODVH 4DVBB 5FYKH 2XC8A 3UIZA 1XX9C 4FJ6A 4P48A 4APXA 4B5EA 5H2BA 1KYAA 2H9GB 2MCPH 2Y2WA 1LM8V 4IOIB 3SJVB 4F57L 4LF3A 4NWTL 3U4BL 1G7MB 2AXJA 1C5BL 5F97E 4RFEB 4QXUL 3QIBB 3ISRA 1WD9A 4ZS7L 2Y23A 4FLQA 4G6JL 3TC9A 2M2DA 3HKFA 4WHTA 5E03A 4F37K 3PP3H 1D5XB 3KHQA 3RFRA 4N22A 2MWCA 3JTTB 1E5YA 4KV5E 1F4WH 3VFNB 5IESH 3P0VL 3IGFA 4LHUG 1Q9WB 2PYEB 2XV6B 4CMHC 2FLRT 3LDBC 3SYQA 2NXYC 4MA8H 4UDTA 1VADB 3I9GL 2AFNA 5EZIL 1NCDL 2CHZA 2P5PA 4XTRC 5INCB 1QI3A 4QRPE 4IBLT 1F11B 5I82A 5KSAA 2I60H 5LBSH 2F53B 5T1KB 4F9LA 3L5IA 3IMVA 5E1AB 4A66A 2L8AA 5JNYB 2QBWA 1AACA 2NXZD 1CG9B 1ND0B 1GMEA 4MCNA 5D96B 5KVMC 1Y7VA 4KUZL 1P1VA 3RVXC 1JS4A 2HXAA 1QUNB 4K8RD 3M17B 4HS3B 3MJ9A 2AVFA 4UIKH 4BV1A 5C0IA 5C0NC 2N01B 3NACH 5D8JL 3RU8H 1P84J 5F1SA 3Q2CA 4ES9A 5GSRB 5J0BA 1JTTA 1R5IB 4N8CH 4GMTH 4WRLA 5TK2A 1NOAA 2BZCA 4EAEA 1IAIM 5C2BL 4F33B 2UVEA 4LSPH 1JNLH 2JI1A 3WKNA 1OSZA 1U42A 5ALBL 3PDDA 3FF8A 2YPLA 4OD1H 2A1WL 2AITA 3FN9A 4IBTA 1DFBH 3R1GL 2Q5BA 3EYFA 1WPCA 1RP9A 2BW5A 4AQAA 1S7SA 4QRPD 3PPEA 2B0SH 1ACYL 2G3NA 1I3GH 4HC1H 1BM7A 4X4ME 1RIHH 3HN8A 2WZ5A 4NO0A 3AWEA 1SOSA 1ED3B 4GSUA 1FP5A 3O9WA 4Z7NE 2PCFA 3OKEB 4JY5H 1IARB 1MDTA 4GRMA 2UY6A 1MWAA 5IB3A 3EO0A 4LCYA 1UWEH 5K9OA 3VXUB 2VXTH 3F84A 3RX9A 3TS8A 4HLZG 3HLAB 1NOFA 4NQVB 4M3HA 4L3ED 5HYJE 4L8SA 2ZUTA 1CGSL 1ET5A 3BZ4A 3PWPE 4RRPM 5EU6E 1HZLA 3TU6A 1GC1C 1JHTB 2KI6A 2UZXA 4NUJB 1BQ5A 3UYOD 3UERA 2W07A 3GBDA 5T3XL 3PY9A 1F6AB 2ATAA 3RZCA 1YAIA 3AFLA 4YXLL 1AP2A 5EZIH 1TFPA 3LNFA 4Z7UB 4J5VA 3PWJB 1RIVL 2P42B 2OKMA 1AFVH 3VI3A 4XPBL 3L1GA 2X6MA 2AK4B 5EIVA 3IDXL 4NZJA 3ZO9A 3QR0A 4WO4B 5D72H 4DERA 3MRHB 1AS8A 1YNLH 4JM2A 3WMSA 1DVXA 3OAYK 1EHKB 2C9UA 4XVSL 5D7LB 1ADQL 1S4IA 5SWSA 5GIRA 3SY0B 2CUAA 1DBBH 2MTAA 4OV6F 5I8KH 3WFBL 4OFPA 3CCHB 5IT2L 4RA3A 1DQQB 2NY5H 5L0QC 3CFMA 4GO6B 3MBEA 2K6ZA 1YEKL 4XZUA 5CEXB 1A7QH 2Q86A 4P23A 4KRPC 3QC6X 2JCCE 3QJFA 4MJIE 4ODUA 4UM9A 4DP2X 3H6JA 5FK9A 2QPFA 1RMFH 3ECQA 5ESAA 1OXYA 1RZFL 3LIUA 2Q20A 1G7IB 2GAZB 3KJ6L 4E9YA 1FVEB 3D52A 2V8LA 4YO0A 1T89C 1G7IA 2GAZA 1XF5B 2HFTA 1MNUH 3H9SB 4HFUH 1UVQB 2VDNL 4WHCA 5GS2D 1I31A 1NC2A 4NUPA 3MMEA 3X11B 3RWCB 1R6VA 3MOAL 5I6XB 2QGCA 1X9LA 4U1NB 3BMVA 3QXTA 1HH9B 3QZMA 1N7MH 1QFOA 2B2XL 1R0AL 3INUH 2OULB 4XC1L 1AG6A 3T8MA 1LDPL 2MQGA 4JDVB 1GOHA 1NGZB 1FFPB 4Y4HC 2DIAA 1OSEA 4Z7AA 2WCSA 4JREC 4ZTEA 1R24B 5DJYA 4JFZH 2OMVB 4XX1G 3B7SA 1VACA 1MFBL 1H8NA 1NIFA 3WHXB 4FI7A 5ICYB 5B21A 3S9DB 2XY2A 4G3YL 3K8LA 3LNIA 1ZVSA 3LZLA 5CHNB 1GA2A 1JCKA 3T04D 5C0CD 3ZKSD 2VXQL 1JXDA 4RIRB 1NLBH 1C8PA 2JMRA 1NCCH 2E7HA 5J6GB 4WV1A 2HT3D 4CGTA 5DJ8A 5HYJD 4UQAA 5B1BB 3SN6N 4YHLL 3BPOC 3SBRA 4PGBB 4NGHL 1VGKB 3LQAL 5G5DA 3VGDA 4FZEL 3CFKA 2Q0ZX 3L1OH 1I9JL 1LP9B 4UOQA 4KJQC 4X0KA 3JYCA 2KLSA 4HK3J 4KK6C 3M46A 1IGMH 3T6VA 3AY2A 4UBDD 2UY6B 2XIDA 2DRUA 4GRMB 5EO9A 5EEWA 3NZHL 1LE5B 1RKRA 5EIQA 4O51A 2HVKB 2IBGA 2ED7A 3MLTB 5I1IL 5CIPB 1A7QL 2ZXCA 1N9PA 4W6WB 4PJHA 3BP5B 4KMLB 4G7RB 3RQ3A 4MKTA 2NW2B 4RMBA 2WKOF 1CGTA 4F57H 2V9TA 4M6NH 2HWZL 3CPLB 3PWNA 5GS1B 2XZCH 3F7QA 4QXUH 1T1YA 3MDJA 2ZKWA 1ZA6A 4WEBH 3SE4C 1H8SA 1MNUL 5DVLA 3V5DB 3WAJA 4Y2DB 5L88H 1KG0B 3QQ4A 4YDLC 4KQ3L 1UD4A 3MOAH 2VR4A 3B9KC 4HT1L 3RKPA 5F9OH 1W8NA 5E94B 4X80H 2VUOA 1IGYB 5I6MA 2RFXB 1Z2KA 4OZHB 5JR1L 4IBUA 1ZMYA 4KMQA 3T0DA 3VWKB 1FG9C 4F3FA 4MXVE 2H8PB 2X6CA 1OOWA 3QUYD 3D3VA 1S9VA 3P4MB 1L6ZA 4XN9A 2VABA 4Y19A 4LVOC 4Z7WA 2IDTA 3ABGA 3WGUB 5LHDA 2ZG1A 4HSCX 3QO0A 3HB3D 3UBFA 4AEIH 2VC2L 4CJ0A 3VDBA 5EU6D 2BERA 4Q9CA 5CWSA 5EUKA 3MRKB 4CSPA 3AQXA 4H8QA 3H3KA 4ISVA 4PY7A 3ZIMA 4KUCD 1K4CA 1HQ4A 3CMOH 4K7FB 1EVTC 4X5LA 3IBEA 3GUTB 2ERJB 4S0TD 2HG5A 2NY5C 4HCRH 2UYLA 3D1MC 4YHZH 4LB8A 3V4LA 1NUGA 3DKHA 3AXHA 1NMBL 1RIUH 3NJJA 1VADA 4OZFH 2Z8VC 3QI9B 3RWEA 5IW6A 2OJZL 1V10A 2BJML 1R4XA 4HMDA 5TDOA 3QE5A 4AT6B 1XHHA 2AXWA 4GRLB 3CDGA 5EBWB 2DYPA 5JQHC 3QJSB 1HINL 2GHZA 4PJHF 1DDHA 4Q14A 2WWMD 3CD4A 2P48B 1HZHL 3VD2A 3UEQA 4FYRA 4I0CC 4J3SA 4DETA 1NTDA 1LILA 2D7TH 3JWNC 1SUJA 4RFEA 4XNYL 3CGTA 3RAJL 2PWFA 1N67A 4B9JA 1UT1A 2X0WA 4GOSA 1NM4A 2BH0A 4UM8A 5DQJA 2PTTA 1V3JA 4P46B 3BN9D 3G5YB 3AB0B 4X9FA 4JJOA 5F3HB 2AXHA 1HNFA 1AYOA 2FE0A 1A2YB 1OGAD 2YKLL 2QTEA 1S9XB 3QB7C 4P4KB 1KJVB 4H40A 4G6AC 1NEPA 3TO4D 5MENE 3FZUC 1QP1A 3RA7H 2AXFA 3GI9H 4JFPA 5T3XE 5E8NA 2EVIA 5I5JA 2BVQB 3PAUA 1NCGA 2GSIA 3PWUA 2H41A 3TH2T 2Y7SA 1A6TB 3UPAA 4Z7QB 2DL9A 4LCUA 1YQ2A 5EMYA 3C5ZC 1KIPB 2HRGA 2XG4B 4X80L 3J07A 1NUDA 4AGNA 3V10A 4TQHA 1EEQA 4PB9H 1QABA 2QADD 4NB7A 4F7TB 4EIBA 3ROLB 4EZLA 2W94A 3RL1B 3NPSB 1S9YA 4XPBH 3JVGA 4ANKA 3PV6A 2DV6A 4U1MA 2AMUA 3LNEA 2AZUA 2IH9A 3TBWA 3IETA 2XV3A 4U7MA 5TFSL 1KXTB 2BSSB 3QFGA 5KS9B 1X7QB 4HUWA 4NWUH 3V52H 5JHDB 1N8ZA 1RHHA 3DJSA 2YN5A 3HZYB 2XWBA 3CLFL 2FWUA 4P3DB 5DHMC 1EHNA 2ZKYA 1O5DT 1WZ1L 4GAYB 2BS8A 5HHOA 3ZDYE 1H6FA 1M3JA 1CLOL 1QFUH 2R2CA 3CVHB 5CD5D 1RULH 2DQCL 1K85A 5ENWB 2AJ3A 3TX4A 4GH7B 4FG6C 2OJZH 2YAEA 4XAWH 4PRDB 4KO7A 1VEPA 1UKQA 5ERWB 1ZXQA 1E0OB 3P11H 3P77A 1NIAA 4GY4A 2VLRB 4IDLA 2WCPA 2YXVA 3B7RL 3WIFA 2NZIA 1MHCB 3G08A 4PR5B 1PZDA 5D6DA 4JLRB 2ZD0A 5MEQB 3DURB 3QUML 1PY4A 4P5TC 2ZXWB 5C3TA 2NNAB 4AJVA 5I23A 1FZOA 2FBJL 1PAZA 1CIDA 4KKBD 1EXGA 1W16A 1U8KA 2DB8A 4OIAA 3RAJH 1S7RA 4OGAC 2K9UA 3F2LA 4LFHD 4NNXB 3EYVA 3LPPA 1YNKH 3MYZA 1R9FA 1KIUB 4Q52A 1TQBC 2O5YL 4HCRA 1H3WM 4FULA 1BIIB 2OYPA 2XVBA 4OB5L 2DI8A 4XR8C 2CIIB 5IB2A 1BWWA 1R0AH 5SV4A 5I1LB 4J12A 1YG9A 4MZ3A 5DJ2B 5AG8A 4NNXA 1OPOA 4ABVA 5AFAA 3GI9L 1W72L 2XBDA 4ZS7H 6FABL 3MCLL 4ZMQA 4HGWA 3MUGA 3GUFA 2VMCA 1JPST 3D25A 4HJJH 3VW3H 4QRAA 5FF6A 3ZTEA 1KPUB 4FLHA 5CFAA 1RPUA 4MNQA 2ZYSA 4O2CB 3BGAA 4WZ9A 3J2PA 4MMXB 5CGBA 3EH3B 3ULAB 2DQIH 1P4BL 1UZ6F 3BH9A 9PCYA 3CSYA 4G8GB 4G9FE 4AMKH 1MI5D 1JV2B 4Z7OB 2LOEA 4ZW3A 4A7TA 4FDWA 1KGCD 4WI9A 4HHAA 5LBSL 4PRPB 1NDGA 3FU5A 3V0EA 3T4AC 5BO1H 1JXGA 2OR8A 4ZFOL 3QFDB 1MG2C 2BC4B 3KL5A 1JDDA 4G11A 2CIKB 2JKLA 3SJVD 1BREA 3W39B 1MEXL 4MA1C 3MROB 4MCYB 3UTTB 4G83A 3NCXA 5CBAB 3LH8A 1FFNB 1ES0A 3NG5A 2D73A 5DD5L 2RQ8A 4M62L 4R7XA 2GEEA 2JKWA 1QFUL 3NK3A 1QW8A 1I8MB 3FULA 1OM3L 4Q9QL 4LSRL 1HOCA 1P7BA 4Z5RA 1U6AH 4JKPH 1XF3A 2BWQA 1PVHA 3IU3A 1R3KB 3D4YA 2Z3FA 3LOWA 3VXME 1OD7A 1TZOA 2QV4A 1F56A 5LAXB 1EV2E 3STLB 3I85A 3ZKMD 1AKJD 4G1MB 5FGBC 1OL0A 2GSIB 5C09B 3WY2A 4F8TA 4PJ7E 5D1ZA 5GGRY 4XAKD 5E08H 1S7WA 1FLRL 3OKLB 4HPHA 3EBIA 5G4OA 4Y4KA 4KQ3H 1I3GL 4AH2B 4QRQA 3NJXA 1BF5A 4ZMTA 1CD1A 3CQQA 2DWEA 2OL3L 3T2LA 3G5YA 1U8JB 3EG9A 2CLZA 3QPXH 1CF8H 3VQLA 2KUTA 4UQEA 2WYHA 2P1YA 5DQJB 1FI8C 4U1KB 4ACTA 4CVXB 1N0LA 1WD8A 5B7FA 5GGRA 4I3SL 2A9NH 5DHYA 1YMHB 4UQ2A 4W9KC 1TZGH 4QRSB 3MCLH 2Z0BA 4PJ5D 1PZCA 4TKWA 4X6FA 5D7EA 2PO6A 1R3KA 5FHAH 4HJJL 5MEOB 4P57A 4RGND 2VDKH 2IAMD 3QUXC 5HSFA 3NJHA 5IBLD 4R97C 1U36A 5B4MD 3IFPA 3RDJA 5D1QD 4QRPA 1DBJH 5T3XH 3B9EA 1X4XA 3KEDA 1FC2D 1NGYB 4YXLH 3X2QB 3G5ZB 3VFSB 1GYVA 2X4QB 1CE6B 1GVIA 5I0ZA 2ZUVA 4LHJB 1AFVL 2XVLA 3BVDB 1UTDA 1CD0A 1BAFL 4K94L 3AT8A 5IBTL 1NL0H 2ZWKA 3M6DA 2JQZA 3KWXA 2BC4A 1NDMA 3GS0A 1RUQL 1AQHA 2DLFL 2ZX7A 3LEYH 4G70B 2DWYA 3QUMB 5D6CB 4PRPA 1SY6H 3S3DB 5E6YA 4NDMB 3TJPA 4PJCE 3BGMA 1H3GA 2GFBA 5IVXB 1JV2A 4X9HA 1IGFH 4POZD 1GAFL 1KCUH 1A6UL 2V9UA 3EDKA 1P6WA 3FT0A 1DQIA 1TNMA 2YRZA 4D9QD 2JXMA 4OZHA 5C6TH 3TL5A 1L3WA 3A24A 1IAOB 3AMLA 2D8KA 2KYIA 1VGEH 4Q2ZA 4YHIA 4BKLB 1NGPL 4U0QB 3QNZB 3VCLB 1JUFA 3BLBA 3QDHA 4DO4A 3ARZA 3WAKA 1YN6A 2VMEA 2X9XA 2IAMC 4BFFA 3MTXA 1CQKA 2GQHA 5GGTH 1THCA 5GRVK 1JHLL 2Z1KA 1A65A 4F7KA 1HCVA 4TQ8A 4EN3A 1AQ8A 3QQ9D 2G2RA 4QHPA 2NW2A 4MXVF 1XBRA 2AQ3A 2ZWZA 4LLWA 4RAUB 4WU5B 1N7ML 2B2XH 3MGAA 4J8RB 2GB2A 5HYSA 3TT1H 1O9VA 4LIQL 2ED6A 3AXIA 1V55B 3ZDZE 3QUKB 2NXYD 3W57A 4D7PA 2QKIC 1ORQB 3C8KB 5DTFA 5JXEC 5E2VL 5JHLA 4JLRA 1CFNA 3HUJA 3IBOA 3PDOB 1HYSC 1UD5A 2AI0L 5FA3B 2H0PA 5FHAL 4B96A 2VLRA 3T2QA 2IPTL 4Z7UF 1SHXA 3K71B 2F54A 4BH7B 3B1TA 4JFZL 3O3UN 5I73C 1QWUA 2UY7B 2BVPA 3VWJC 5IUCA 4RMQA 2B3RA 3UTTE 2MQ0A 2SEBA 4KTEH 4GNKB 1V5JA 2IVFC 3NIGE 4HPYL 3ZKMC 5CEZD 3VXSB 1EXHA 1WZ1H 3WLWD 2Z0UA 2E8YA 3MAWA 4AMWA 4PJCB 2ZOKB 4GXUM 5AW1B 1N8OE 1WWBX 4JO1H 3CK0L 1RULL 2DQCH 3ATDA 4JFHD 4PMEA 4EIUA 1SDDB 2VZVA 3QEUB 2ENPA 1IEHA 2NQDA 5C86A 4N9GA 3P73A 2C7UB 3TTYA 1NL0L 4X99B 2VMDA 2FJGB 1JZHA 2VSKB 4KHXL 2O26U 1VACB 4N2CA 5EIIG 3MLYH 1TCRA 4LSUH 5LKNA 3QZWB 5HHMD 5DJYB 1NAKH 4PLJC 2VKXA 4QXVA 2YSSB 4HKXA 1BVLB 4P5TA 1HFUA 3D51A 1FSKB 3Q2WA 3DO3A 1JSYA 4CN1A 3IPBA 5C08E 1R17A 4LEBA 2X6BA 1JDCA 2XPGA 3VD9A 1JVKA 1WBYA 1DO6A 1L9RA 3K3QA 3L6FA 3L7EA 4URTB 5F71A 3B9KB 2WLYA 1UQSA 2HT2C 3UO8B 1LWRA 3AMKA 4CKQA 3NZ8A 4PW4A 5B1KA 2AS5M 1WZMA 4U3XA 1YEDA 3U6XA 5CUSH 2OTUA 4TN9A 3TBVB 5ITBL 1R3LB 3AC0A 1XB3A 1YLBB 3CSTA 4LL1A 5DHXB 2OMUA 1A7BA 4Y9FA 2FJHA 4WEBL 2ZXBA 1TTUA 5BQDA 3L45A 3B2DC 5GS1C 3KWWB 1TENA 5ICZB 3MLRH 3H8NA 1JHLH 4G7YL 4P2QD 1LD9B 5FK9B 1GOGA 2ESVD 3ZDXE 3FJTA 4RQQA 1P69B 2NY2C 5IHHA 1XAUA 2IEPA 5CJ5A 2GITB 5IQ7H 2IDFA 3G6JF 4M7JH 3ZVVA 4EOWH 5CO1A 1FVCB 2HLFC 4BSJA 5CEXA 2WZPD 1PJWA 1M71B 2IH1A 2R51A 4DW2H 1RPQA 1F13A 5DHEA 4K5PA 4ZO9A 5DGQA 4YHKH 1IJ9A 1ZKAA 3OB8A 2X2JA 2AKRB 4YUEL 3T3MB 3UACA 5JTWA 1ZE3C 1BZQK 5T1JA 4EEEA 2I07B 2R69H 2DOCA 5IB4A 3ULVD 4KKBC 2X70B 1HU8A 1HCYA 3HBPA 5IKCA 3A4FA 3QRGH 2YAFA 4OGZA 1MFDH 1NUFA 3BLKA 3PXJA 1JI1A 5I5IA 2AK4A 4GEJA 2Q8BL 1KJ2B 5JW4R 2VLJB 3U2GA 4HSQA 3RGVC 2ZX8A 3WUZA 2A6KA 2HP4A 3GXMA 3R19A 1E2VA 2YA1A 2FD6H 5C1MB 4PCSA 2GBUA 1OM3H 4UF7C 5FKAA 4DGVH 1U6AL 1J0ZA 2XOTA 3OLEA 5J57B 2BSTB 4MB5A 4W9ZA 2OJEB 4CVWA 5HPOA 3ULVC 3HMXA 3QO0B 4DVRH 1FYTE 2K3HA 4X8JB 5EBMA 5IF0B 3RY6C 3HLAA 4L4VE 2ZCLL 2R7EA 1DDTA 3NA9H 5FUCC 4LCYB 2G5BB 3IDMA 3QDAA 2J72A 5BRQA 2VIRB 4J3XA 1TQCB 1IGYA 1UCBL 1I9RL 3KDPB 3MV8D 4GP5B 2YMTA 5E94A 5IW1A 4DZBB 2OJ1A 3LV3B 1V3KA 4CDHA 1P7QA 3WY3A 2YGPA 1JYXA 4CSZA 2Y72A 2WBXA 3FQXA 1C5BH 3K2KA 2A9NL 1QAWA 3U2IA 2WXJA 5HGHB 1HCZA 1YMME 1AZBA 1KCVH 2C4FT 2Y7QB 2K7PA 4EI5C 4HQQH 1CXLA 3X17A 1Z7JA 2F5BH 4R4NC 5C08B 3ARTA 4ZYKA 2B14A 1ZWIA 3OMZA 4KK5D 1MFAL 4OUUB 5IESL 2HVKA 1RCYA 3EYQD 2V8MA 2OX5B 1OCRB 4G6AD 3RWIA 4PB9L 2W9DL 3B34A 4J2XA 2FR4A 4C56A 5KVEE 5F6IB 3BQUA 4HMEA 2H1LM 3H3PL 4J3VA 3SDDC 1XQ4A 3NQKA 2XETA 1CB4A 3DIFA 4LSSH 4O2FB 4UM9D 2Y1ZA 3BEWB 4OGXH 3WUWA 4BWTA 4A7VA 2JJTC 4N0UE 5E51A 3EYUL 4I0KA 4NYLB 3DJRA 3HG2A 3OL2A 3HFMH 1EBPA 1RUQH 1PD6A 1QYGL 5J6GA 1A22B 4JEGB 3EJSA 5F7BA 3THML 4CSSA 1T7YA 4PWIA 1AHWA 2ZOUA 3E6FB 3QRGL 3TPKA 2BNRA 2WLLA 1FNGB 2GJ6D 2EDYA 2P4AB 4NLAA 4TQEL 1U3HB 3F05A 3ZE1B 2A9MH 5IHBA 2X89D 3OKOB 4XP6L 1D5BA 3LIZH 1ERNA 3ML8A 4JQIH 3K2MC 4JO5A 4F2MB 5GS2H 1BMGA 2G9HA 4JUTA 3ARDC 3KPSB 2B39A 2APVA 4P4RA 2OMVA 4RDBA 2X70A 1EERB 2WK2A 4XOEA 3P11L 3FCSA 1THAA 3JTTA 4NC2B 5I1KH 1VGEL 1FHNA 3D9AL 1LL1A 3BZDA 1CGVA 3KYNB 4H13C 4WUKL 4ABWA 4YH6A 2QVKA 4OD1L 5H4YA 2A1WH 1JWSA 2LAAA 3BP6B 3HAEG 3QUMH 2WYTA 4LIQE 2FLBT 5HI3C 1T0MA 4TNVF 1L9TA 4HOXA 1UOLA 4B97A 4D7BA 4KFZC 1ZS8B 4U4BA 5FUZH 1YNKL 4H4NA 5TPWH 4OCLC 4NQQA 3UAAA 4X2UA 4BELD 2OL3B 3I6GB 1DEDA 2BVOB 4OLZH 1LK2A 1QTSA 3MACL 5E5RB 1CDHA 1T3FA 1N64H 1OZTG 3GXTA 1DJSA 1XF5A 4WW2C 2AJZB 3EJYC 4G2AA 2YZ8A 3HPLA 1XGRA 4PRIE 4RSYA 3DGGB 4Z7NF 3L3OC 5ESAB 1IIIA 5HGAA 3NGBB 4HQQL 4XNQA 4HJ1A 1YEDB 4P23B 1NA8A 3V6OE 1QFWH 2GBAA 3QAQA 4O4YH 4DN4H 5IHZA 3L7EB 1JZEA 1UCTA 4I2XE 3MUUA 4WWKC 3FCUB 3H3PH 4UAOB 5E4EB 3FNKA 3WNOA 3OV6A 2CMRH 1V27A 4JO2L 4MS8D 3O6FA 4QR7A 1ZGLA 4JHAL 3QDGE 3CZLA 3MRHA 2GIXA 1F5WA 3HFML 4KHXH 4KK6D 3C2AL 2YRLA 4YBLB 2VDOL 4JQVC 2IDQA 2E46A 3U30C 4NO2A 2X2UA 3UH8A 5FA4B 5CJQH 2JQAA 2HTLD 3P2TA 4LVNC 5T5FL 2YSTA 2EXWD 3BDYH 2CK2A 4Z7UA 4K55A 2VKWA 5LCVL 4O9HL 3O3BB 2X4NB 4UUJA 1DP0A 1EGJL 1TQVA 1DUZA 2KKQA 1EO8L 1OGAA 1PZAA 5F1IB 4KRNA 5DRXA 4X5XA 1OAZH 3RL2B 3N04A 1GJIA 2EYTB 5I1AA 1B0RB 3FU9A 1XH3A 4OGQC 4IRJD 4ZMNA 2QR0B 3MUZ1 4L4TB 2EYSA 5K9OB 2CDGB 3DDFA 2DJ4A 5JW5B 2FAUA 3UG4A 3LZQA 3TJEH 2YUVA 4EDXA 5DDHB 3N55A 2D7MA 1U8IA 1J1OL 3HBGA 2HRPH 1CIUA 2F58L 3QXDA 4FG0A 3FUFA 2FNWA 1N6UA 3JXAA 3LZFL 4G7QB 4N0UB 3WTSA 5E8OA 2DH3A 5E8EA 1IFRA 3DETD 1QNIA 2NX5A 1TJXA 3KVDD 4YHIB 1RD6A 5LGYA 3EO1A 1NGQH 5I8EB 1S7UB 3DV6A 4TTDC 3MR9B 1LE9B 4YC2B 4R7LA 1R5IA 4GI8A 5D7JC 1E30A 1KC5H 3SODB 5KAQG 2EXTA 4S1SL 4YLQT 4CSTA 4PIRF 2Q7AA 2O5XL 5LQBH 4CDGC 4DGVL 4OY9A 2QVIA 3HS9A 4HVBA 4QGTA 1G94A 4K3GA 3SO3C 4OLWL 5T3ZE 1HL5A 4JRXA 4BE6A 3ARBC 1HSAB 2XVGA 1XZWA 1U8HB 3WN5A 4NGHH 2XXMB 2ZCLH 3ATEA 3VFTB 3IGUA 3CUPB 3IJEA 1CE6A 5AVRB 2X4QA 2DKMA 4WWNA 1NGYA 3WGVB 3MV01 2WINB 5AYUL 2FHBA 3N9GH 4HMCA 1ZGLP 4HD9A 1X5IA 3QXAA 4JY6B 4UMSA 4HPOL 5LWYH 1I9RH 1G7QB 4IDJH 5ALCH 3TIDB 3F58H 5B38A 4M7KL 5IEHB 3V6FB 4OJYA 5MEOA 1C7TA 1A3RL 2HT4C 2EADA 2HT4D 1JDAA 3OZLA 1ZTXE 4H20H 4KK9D 1OE1A 3KPOB 3PHOB 3WO3B 2X4RA 2CO6A 1QI5A 3G9AB 1GZHC 4PCKA 4Y4HA 3H56A 5ICUA 2IPKB 2JLLA 1AD9A 4L8DB 3TEYA 3F7LA 1BIHA 2F5BL 3HG1E 4K94C 2CE6A 4APXB 4TV3A 4CA4A 5ID0A 5SWQA 4HWEH 4HT1H 5JPNB 3FSAA 3L9EA 3TCTA 4ENZA 2J6EL 1U3ZA 5IUSA 4XN7A 1ML0A 4GXVL 4M5YL 4M1DL 4PEEA 2EXWC 1I7ZA 1OP4A 4KKQA 1D5ZB 4GXUN 3ZKND 2XXCB 4FMFA 1DQKA 3MV9E 1YEHH 4KVNH 1YY8B 3VSUA 1JNHB 3HS0C 4ONFL 4XO4A 3RIKA 5D5MB 1XTLA 4ZS6C 2WZAA 3ZE2E 4Z7IA 5IGXH 2OR9L 1URZA 4MDIB 4R6UA 5I1EL 1D9KB 4NENB 3RVVC 5E8OB 2H6PA 2XRAH 2CHDA 4QWWC 2HB0A 1BOYA 1EK3A 4PJGE 4LCIH 4HZ1A 3QZWG 4FZ8H 5AL0A 5L4JA 1U93A 4HCRL 3SKJL 4LRNL 4FXTA 1WUNT 2B1OA 3HVNA 1WFOA 3ARYA 1WEJH 4DKTA 4PLKD 2CIKA 1SPDA 4OLWH 1KT2A 3RKDD 4W9IC 1TZIB 3OAUL 4W9FC 3V0HA 5A3IC 3DX2A 3MLYL 4LSUL 5J11C 1VA9A 4KKLD 4IW4C 5KVDH 2EYSB 1J9RA 4NRXB 4WFEE 3SKMB 3PWVB 4YSQA 2V7NA 3HRZC 2GJZB 3FUKA 4FS0A 5KTEL 4X5XB 4EBQL 1UD2A 4PJHE 3FQWB 3BAKA 3FT3A 3ZQ9A 4DP5X 3U0WH 1JPFA 2ZE0A 3S96B 4JW3A 1LP9F 1MJJB 5ALCL 3HI1A 3AW5A 1E4XI 1KPUA 2IQ9L 4GAJL 4XMZA 5C0BA 1CDBA 4K0OA 1BEYL 3P30H 3UPRB 2X1OA 1H5BB 5C9JA 1MH5A 1WFMA 5KBLA 3SDXB 4X6EA 1HEJC 1GYAA 5HYEA 4MWFB 2BIHA 3O9WD 4PJIB 4KX7A 2Y1YA 3Q1EA 3T0EA 5DJ2A 4Y2LA 4GW1A 3QDGA 4RBPK 5I1LA 1ZGLB 2R2EB 2FBOJ 1OTSD 2YMXH 2EE6A 3T0EE 2PF6A 4JAMB 4U0RC 2UXTA 1DBKH 1ILUA 3D2UA 3IMSA 4HEMA 5LGHL 3EYVB 1YEEL 3SDYL 1R3JA 1VAHA 3MA7B 3ZYOA 4Z7OE 2ALAA 4PWJA 1KTKE 3U2HA 5DZOA 4QRFA 1N18A 5K9JH 2G0LA 4YUEH 4HH9A 4NO3B 1KN4L 2WWMC 4XT1C 5DEZA 5K93A 3NVQA 3U1SH 4MQXD 1HESA 3IU4H 2B3IA 4BUQA 1CICC 2VDOH 2QQNH 2R23A 3BZ5A 2DLTA 1JPGB 1BCIA 1NGWB 3EJRA 5CCHE 3DROB 4Y9CA 1HHIB 3DC0A 3LCYA 1BJMA 4Z7UE 3ZXAC 3REWA 3SKJH 2V17L 2VDOB 2VDLB 4OZ4A 1JNNL 1N10A 1U2CA 4L37B 4OBSA 4KDVA 1LE9A 2FQGA 4IBZA 4XBMA 3V4VA 2FIKB 1FNLA 3DV6B 1X7QA 4GQQA 2ZAHA 1QEWB 1MZYA 2FT8A 1OAZL 3KZ8A 2K7QA 1H6TA 4DVRL 1ITCA 3QJRB 4G6KL 4AQ1B 4IBYA 1AGBA 5E00B 1T66D 3PV6B 4IBVA 3MLWH 5KJ4A 4ODWB 2FWLB 1IKOP 4MX7B 4WTXA 4EF3A 4LU5H 3ROLA 3CC5A 5CN3A 3LRLA 3WN6A 3SD5A 1SLWA 2B59B 5K9KB 3PREA 4AGPA 2FNBA 1SEQL 3EO9H 4WNQA 1UCBH 2L0DA 4GW4B 5KYYB 5GRYA 4I87A 3AABA 4P04A 2FT7A 3RZCC 1A9EA 1GGBL 1A6TA 2EDMA 3VYOA 3H2WA 4ZUSA 2OQJB 2OZNA 2IXQB 4A7GF 2ADIB 5BXFB 5BUAA 1BQLH 1IT9H 3UXFA 4X9IA 2EDWA 3II3A 3PQYD 3SKNA 1BZ9A 1TR7A 1J5DA 4ODHL 5L4MA 3IFLH 3NCEB 1IBGL 2BCKA 3ZIYA 3D18B 4F2EA 5I15L 4DQOL 4NAJA 4RGNE 2LU5A 4FFVD 4H8HA 5FFGA 1VFOA 5AAWA 2WD0A 5B3SB 3L3IA 1NKRA 2K6WA 4P46A 3U0PB 2K4AA 1OGAB 3ZU8A 5CIPH 5DD1H 2WXLA 1P5VA 2W0PA 4UUJB 2W9DH 4JG9A 1P4BH 5EFIA 5MENA 2F8OA 4NC0B 3ALWA 1GYWA 4GBXD 2VN4A 4TVUA 1U3JA 4JHWL 4XMTA 2EE9A 4K3EL 2FZ3A 4LSSL 4NIYE 3V2AR 2JELL 4BZ2L 2XUWA 3G6JE 2FUQA 4NO2B 2VQ1A 4YS4A 4RRPA 4D3CH 1MDAA 2ITCB 1X5MA 3CDGB 1TU2A 1QYGH 4AT6A 1NAMH 1XSJA 1LNUB 2XV0A 3TA3B 1P1ZA 1AHKA 3EZ8A 3QI9A 3C87A 4TQEH 3OJDB 3S35H 1OKEA 3BUTA 4YHNA 3NIDE 2FATH 3W0WD 4JFXB 5FYKE 1QSVA 3SE8L 1P7QB 1IBFA 2BHYA 1R47A 1A25A 3HC2A 3GUTA 1VJSA 4ZODA 3GZOA 4IKIA 4RNRB 4R5TA 1AIFB 3EW3B 4JB9H 5IW1B 2F74B 4HPOH 2A83A 4OI8A 1DL7H 1E4KA 1SXNA 3NBNA 3VFRB 3U2SA 4BQ8A 4UU9B 1DZ0A 1RZKC 5E9DA 1HSBA 4DUWA 5M7QA 5ABAA 1BZDA 4MJIB 3UIYA 1WBZB 4JFEB 3D85A 2R2HA 2X9YA 3IDJB 2Z8WC 1ORSB 4XB7A 4PUBH 2ZOWA 4IGBC 4F91B 4YXKL 4B9CA 3HBQA 4XH2B 3QUXD 2MSPA 4XCNA 5IBLC 3US0A 3NRQA 3L17A 1WFUA 2Z93A 1MSPA 2UWEF 3QQ4B 1GGBH 4YGAB 5ETUB 2DQDL 4UNIA 4YHMH 3P4OB 3NDYE 4FGMA 1OTUD 1MI5E 4RAVB 4CVZA 2GCYA 3MRPA 4FFZL 4FQXA 3KPLA 3O6KL 5D7IB 2EE3A 1OSPL 4E41B 1WUZA 2UXVA 3BYYA 3CPLA 3KYNA 4FQIH 4ODSL 3S8WA 1UH2A 2DPKA 3F7PC 5IGXL 5IFAH 8PAZA 2IIJA 1XGPA 3BP5A 3Q48A 3P02A 1DQML 3VYNA 4N87A 1J7VR 2VOTA 1LHZA 4AVJA 5JIHA 3GLAA 1GC1L 3EFOB 4P49A 1YEJL 4HJTA 2G9HB 3X1GA 4M6MH 4XN1A 4DP4X 1FVCA 1SXSA 1E4WH 2VXUH 2RD0A 1SHMA 1JPEA 3BXNA 4JHWH 3CHPA 3VB8A 5B8CA 4FMVA 4NQXA 1XR9B 2R2BA 1WEJL 2OYLA 1BAFH 4K94H 3W11C 2YAMA 1OP5K 3U79A 2V7HA 3VYPA 1JK8A 2BCKB 2XN1A 2P5WD 2OSWA 3C8DA 2Q6WB 1JF1B 4D0DA 4MCZA 4HALA 4P2QA 4FEMA 3LKNB 1CJYA 3PFUA 2ADGA 3II1A 4N2EA 3BEWA 1J88A 1T2XA 3KBFA 3TBVA 4C8XA 4TSBH 1A21A 3L8QA 1VFMA 1XB8A 1A6VH 4G8GD 4P5KA 5J6SA 2QLVB 2W60B 3SE8H 4XNMA 5BXFA 5DURD 4YHYC 1KCUL 3X3FH 3RWIB 3QWOA 3WNIA 2QVTA 1XGTA 4BDVB 2BVTA 1L0XA 4MA7H 3SDAA 1EO8H 4KK8D 5DO8A 4FERA 3OHXB 3BVUA 5IMMA 4YAQA 5C6TL 2WN3A 3CNKA 3CC5B 3C6LB 2CSPA 3QHFL 4R2GD 1NGPH 3UAJA 1ONQB 3I74A 2Z64C 5KOVC 2V5RA 3M8OH 4XOAA 1W9XA 4Y9GA 4TVPH 2F53D 2F9BT 4IKNA 1DN2A 2FK9A 2Z65C 5IWLC 1JZ5A 1XCWA 2HX8A 4N9GB 1Y0LB 2DJUA 4X6DB 3RIAK 2Z93B 2VDLH 5GJTL 3WFDL 5D70H 3EJQA 5IY5B 2ZOKA 3LQMA 5EF1A 4OJFL 5I5MA 1UVQA 2AJVL 1XF2A 3LZOA 3CVIL 4HWNA 4FKKA 5J9PA 4UQDA 4WWOA 3L3DA 3N0PB 5EUOA 2R2HB 1OW0C 3LZFH 1NGWA 4R83A 3ZR6A 1DJGA 2JKRM 2P49B 5I1JH 2EIZA 1OSPH 2OI9C 1L7IH 2IPTH 3ZTCC 3UGXA 3KS0J 1Z9LA 1S7TB 1PMYA 4PI2A 4OGAD 1M2OA 2KBGA 3GM8A 2EC8A 4LKXB 3ZL1A 3T2OA 5CLZA 4OCYL 3SOBL 3PV7A 4MLSA 1R3JB 3DUHA 3MA7A 4WFGE 4XVJH 4DZ8A 4AJYV 3FU0A 5ES4B 3ARUA 3WTXA 5JIQA 4HWZB 1FPTH 4FLRA 3DX6B 5CF3A 4N0CD 1BMWA 2PW1A 4HKBA 1H8OA 4K9JA 1BYNA 4FJYA 4JM2B 4HOMA 3ZPDA 4JE0A 5A7BA 1RJYA 4V11A 1OGPA 5AVWB 4FRWA 1ZLEA 4G6KH 2I07A 4J3WA 4ZFOB 3PHQA 3ZT5A 2XQBH 2EXSA 2GJRA 5C09D 3Q8CA 4ZRGA 3Q5OA 3QG6A 5FGRA 2VMJA 4LU5L 1GSKA 2R4RL 1ACXA 3MRIA 4F9PA 4OSUH 1JF6A 1MKFA 3IVKA 3EO9L 3L1FA 2GITA 3U0PA 1LO2H 2X6UA 3U4EA 1A8JH 1Q1JL 4P9MH 4RQQB 2YO3A 3GDCA 4ENED 2WUCL 4NKMA 4Z7VF 3D18A 3HUJE 5DVKA 1NCWL 5EOTA 2C4FU 2JH2A 2L04A 2H45A 3BD3A 4XHJC 4A67A 3QUMA 3GSWA 5D6CA 1XF1A 3RJDA 5KVFH 3INOA 1R3LA 3KPTA 5EU4B 4MA1B 5TH2B 3ROOB 3SEPA 1UB6B 3MNZB 1I8LA 4Z7OF 2CO7A 1HHJB 1G0DA 4KDWA 1KXVA 2UUDK 4MZRA 1A9EB 1WS7A 4NQSA 4POZC 4HUXA 4PB0H 3HC4L 4WNQB 3Q3GB 4X7CC 1LEIA 1SJMA 2R8SL 3FSOA 2LGNA 4GXVH 1O7DC 4OFKA 1IGCL 1HE7A 3CVIH 5LCVA 1PQZA 3GSQA 4MX7A 5HHPB 3ABMB 2JB5H 2JELH 3IMRA 3EJZC 4P57B 1NGXA 3DHUA 4Q97A 3QZWA 4A39A 2DY2A 4M5ZL 3DMMC 5F7EL 5J89A 3SGJA 4B9IA 2X4UB 3CFJA 3QDME 5D6DC 3VGGA 4QRUB 1Y6KR 2P80D 3QEUA 2X4PA 2V9QA 4U1KA 3A5VA 2E9IA 2NR6A 3UC0H 1M7XA 4FABL 4LKCA 4JZNA 5ABDE 1U8JA 1EDHA 3S88L 4QAMB 4M8QB 1KENL 4UOW0 2ORBL 3M17A 4HS3A 5C0IB 2DLGA 2CA4A 4N0FB 5JPNA 3V0DA 2WN2A 2YAOA 2ZKXA 3TNMA 5E0QA 2I9TA 2JCCB 5ECJE 3LN4B 2CDFA 1JPGA 1ND0A 2JCWA 2IPKA 3LMJH 3OAUH 4YSUA 2VLKB 5HYJA 4BXSV 5C0GB 4PJ6A 4JFFB 3PHOA 1T6VN 5T1KA 3M88A 43CAA 3B7TA 2NQ3A 3P54A 2NW3B 4G9FA 4HIQA 4AE1A 3BAYA 2HJFB 4E9RA 5HYSB 4YL4A 3DX9A 1CBJA 5J12C 1FIGL 4Z7VE 4LPUA 1BV8A 1P7KB 4QF1A 3U0WL 3ZE0F 1JNJA 3TN0D 2BFGA 1D9KD 4LLVA 1S78D 2G2RB 4M93B 4HD5A 4P9ML 5E1QA 2CUMA 5I18H 3MBXH 4YSAA 2DQDH 2G3ZA 4YHML 1BEYH 3P30L 1D5XA 2CNZA 4FXLA 1II4E 2EABA 1DN0B 1UKSA 3UEZA 2H2SC 3QAZB 1JZ7A 2Y69B 3VFUB 4M3KB 4HJUA 3M86A 2V2TB 4OZGF 2X89A 2JSFA 5KBMA 2VZUA 3NFPA 3ESOA 4JRXB 1H5BA 1XSOA 4EVNA 2FJFB 3SGDI 2ZWLT 3B9KD 3DUUA 2QT6A 1ECYA 3TPUB 4KNTA 1V05A 4X9YA 5ABZA 4PJEF 3GJFH 3CSYB 3S6CA 5GS3A 5IMKB 1BF2A 4GKSA 2GK2A 3ABLB 3TJHC 5JW4N 4QHKJ 2NZ9D 4QIRA 1QRNB 1AG0A 5IVXA 5I1HL 1MIEL 2Y36L 2WVTA 4NPJA 5DGRA 3SKMA 2FT6A 5DZJA 1ZHLB 5KW9L 4ONHA 1RZPA 3ESNA 3KYKH 5ISZD 1F02I 1TPXC 4M5ZH 5F7EH 3OC8A 3FU3A 3NFPB 2O4EA 4I88A 3UZQA 4X7EC 4N85A 4E9QA 5KVEL 4L0ZA 3IGLA 4UOW1 4A2LA 1EUUA 5GGTA 1CLYL 2A99A 2PYFB 4QJ5B 1GPOL 5BVJB 2E7LA 3W82A 4J3OG 1CI5A 4PV1C 1HVXA 3QUZC 3PGFL 5DSCB 5DDHA 1BIIA 2H0EA 1PZBA 4W9DC 4MA7L 3BUIA 3OXSA 5IVZA 4Z23A 4JG0L 1E4JA 4Y16C 3WDIA 3FT4A 3GI8L 3RX8A 5AW9B 5CP3A 5EWIH 4X4YA 5ID1B 1P9MC 2NNXA 4Q89A 4E5XB 5D7KE 3L81A 5DS2A 3QJOA 2CWRA 2QELA 4JDEB 1YY8A 2AEQH 4LNRB 2WGNB 4HHWA 1G1YA 3DX8B 5EEVA 1N0LB 2O5NA 3RL2A 5BRZD 2XA8L 5ERWA 4KJYB 3K2UL 1HNGA 3QUXA 7CGTA 1KCSL 1VLXA 4BZ1A 2H32B 2QPSA 2I9TB 1J87A 4Y16D 4DKEH 5HYQB 2VDLL 5GJTH 3BKYL 4LSDA 4Z0BH 1T1ZB 4FL4C 2EDXA 1XO8A 3L4ZA 4ZUVA 5FM5M 1QSED 1TZ8A 4UT9A 1S5IH 3CFBB 4W1TA 4KAQH 4HLEA 1FVDB 2H1PH 3GTNA 1KJMA 4KJPD 3IN2A 3K6OA 3GRWA 3B2UC 1FL3B 3AUWB 5FYLD 3ILQD 1XCXA 4PJEE 5IQ9A 3MGTA 1YJDC 3N41B 1PL3A 1Z3RA 5CJXC 5A2KH 2O5ZL 3VA6A 3O6FB 3W9EA 5B38B 1MCDA 1DE4B 3D69A 3HNTL 5C0RH 4KZCA 3R06A 4OFYD 4OM1H 5ADPH 1NSNH 4M9PA 5DEGB 1GGIH 2NZ9C 3RX5A 3SOBH 4NC1E 1YMMA 2ZG3A 4MMYA 5K9QG 4QYOB 3C5ZB 3FH5A 4I18B 5DZPA 3IJEB 3UYRH 5BV7H 2Y3NA 3VSQA 3BKJL 3S5LG 3U4KA 1IKFL 5DFVD 5TD4A 1KCBA 2WNGA 3PNWB 3N42F 3ESVF 5J7CC 4PTUB 5HHNA 1OAXH 4BWWA 5KOMC 5EU4A 4J3OC 3QWNA 1QATA 2ZICA 3DGGA 2WO4A 4KROC 5T5NG 2ADJB 3OX8B 3N6YA 5I66A 1LQSR 2UUDH 4UTCA 3S35L 4TULH 3GRGA 2C5DC 3N42B 3WJMA 4MNGA 1EEZA 2HN7B 2IF7A 4X0NA 1PCXA 2R29A 3GS4A 2VUKA 3A6BH 3I6GA 2F54D 4ODBD 1D9KC 3MV8B 4DEPC 2GTWB 5BMFL 5I8CB 5F7FA 2BOBB 4MNQB 3KMDA 3EBAA 2NY3D 5JIIA 3LS5H 1NMAH 2X9ZA 3EH1A 3MQIA 1N6QH 1I1FB 1OM9A 3ECUA 4RGOL 1U9KA 2EIBA 2C3HA 4WI0A 2EUVA 3PHQB 1DDHB 1BVNP 2ILLA 4NP4H 5MI0C 4GRLC 2YZ1A 4RFOH 5HYIA 1KCLA 3LKSB 3GS7A 5IIEA 1D5MA 1J48A 1GCYA 1L0PA 1KCSH 2YPVA 2YHGA 5AW7B 3UJJH 2CIIA 3FO2B 5IB2B 2XXFA 5AYQA 3ZJAA 3FBKA 3KPSA 2FEDC 3H9ZA 1WQVT 3GYRA 6TAAA 5C97A 1JK9B 5D2NC 5GHWH 1UGKA 1QHQA 2PR4L 3MJ9L 5FDWB 4PJAA 3QPQD 2ZSVA 1MREH 2MIZA 4LKXA 3WIHA 4E9VA 2YQ3A 1GHFH 2H1PL 2PLTA 3O6FC 4L4TA 1GKEA 3GSXB 2EKSA 4LVEA 3V6OA 4YHOL 5GISH 3VTTA 3MCYA 2EYTA 2DWDA 2HTLC 2LLLA 3VXNA 3VXUE 4NYLA 2LU4A 4Z3HA 4ATTA 1HIML 1P6AB 5G55A 4KZDH 2E56A 1KGWA 1U3HD 4F92B 1NSNL 3KEHA 1F00I 3AZUA 2HA1A 2FR4B 4MNGE 3TYFB 2WO2B 3PE9A 2X7LA 2DW5A 3MBEC 5FYLE 3V5KA 4LVNB 1BD2D 4YDLB 2DYSB 4KTDH 3QJTB 4NZDA 1A14L 4EMZA 5DHVB 3VFOA 3B2VL 3PJLA 3TBWB 2GVYA 1J0IA 1BX2A 3PWNB 5C0AB 1A6VL 2DH2A 2XNAB 4B5ZA 1OAKH 1B88A 4YC2C 4WHDA 5LNGA 3OHXA 5IMMB 3MLTA 1NH6A 2VW4A 4HV8B 3PL6A 4V2BA 2YFNA 4ZMPA 3SQOH 3ZDYB 4AJWA 4M7KH 2PXYA 1FGVL 3MBXL 2FIRT 3OXRA 2JV6A 2QKSA 2R7EB 3FQYA 3HE7A 3BPOB 2BVQA 5K59E 3BWUC 4GG6A 4LSVH 1XGRB 4I0PA 3QRFM 1PU0A 3FFDA 2VSDA 3RVVD 4LPVA 3Q06A 1FH5L 1MHHB 2Z31D 5KYXB 4ZS6D 5C8JA 3O45B 3S8GB 1T83A 5F3HA 2BVOA 2FBRA 5TTRA 5GS0H 1T0NA 4QHMB 5FXCH 5DQ9A 4XNUH 1KBBA 3CJJA 2WP3T 3VXRA 4ADJA 2NDGA 1UFUA 1UOKA 5I76B 1MLBB 4JZJB 1S78C 3PRZA 1TZAA 2Y36H 3SGDH 1O75A 3W5NA 1TETH 4YSTA 3TASA 5IB4B 3ZL4H 2DYPB 2VDQL 2B9AA 4KO6A 1IB5A 1ZHBA 5EBWA 1FFPA 5BZDA 3ZYZA 2FB4L 3IDNB 3LXUX 2M1KA 5DJZB 5TDOB 3SKUD 1HIMH 5AOJA 3ARVA 2YRPA 3QAZC 1HKLH 5IW6B 3D39D 4ZMYA 3NSJA 4LASH 2IH1B 3U7WL 4KI5E 3LNDA 2B1AH 5ITFB 4OCYH 3ZE2F 4AEHL 1XMEB 1KZYA 3NCJL 4ZX4A 4WFED 4BFGA 4JKKA 5KSAC 3GLDA 4FYSA 4NM8H 4XCNB 2NSXA 3VI3F 1K4CB 1IAIL 1SNRA 1I8MA 5C3LD 4HETA 2WLNA 3MMEB 1LGVA 4MJ6A 4LEXH 2J1KA 3NABL 4HKJA 4PS4H 1G9NH 3PABB 5DUBB 3CFDA 1K2DB 3FN0L 4GIOA 3AS1A 1CVSC 5IFJA 2DWTA 3PF2A 4BFNA 5A6IA 1CXKA 1MJUL 4HWBL 3CTTA 3T9WA 3FUEA 3QO1B 1U8NA 2H4EA 1I8UA 1FCCA 1U8PA 2RACA 5HJGA 1HXYA 3MNDA 4TL5A 4D0CB 4HV8A 2WM0A 1YC7A 2OX5A 3IGAB 3PJSA 3FB5A 2IQ9H 2F1AA 3SKOA 1A1NB 5GIRB 2WIMA 2OYKA 1HC1A 4XPTH 5BQ7B 3V5DA 1P9MA 3MJ7A 4KY2A 3BFOA 4XX1E 5DYOA 2XVKA 1A0QL 2AJXL 1W6WA 4MJHA 3TVMA 5HGHA 1LNUA 4BHUA 1WFJA 4FNRA 3C5JB 3C5XA 1Q4NX 3FFCE 1FH5H 4KFMA 4KQ4L 3TNNA 2C3XA 1BVKB 1CFMA 3CSPA 5CMAA 2ENSA 4NQCB 3BVTA 1WWAX 1WE5A 4GG6F 3LV3A 4L4VD 3V5KB 4Z7VB 4OQ1A 1OF0A 1KTLB 4XVUC 4O51B 4JMNA 3V8OA 2J56A 3SE3C 2MCAA 4UTBA 3LRSB 2VIRA 1SN0A 1L4IA 4Z18A 1TT6A 4MAYA 2IPUG 1MHEA 1LP9A 4X0KB 4KV5F 4R84A 3BKJH 3WJJA 2WZPA 1KCKA 2BVPB 4PBVC 4LLAA 4FQPA 1OANA 2P8MA 3UTSD 1JYVA 2VLKE 1CVRA 3ZL4L 1K8IB 3IU4L 4JKLA 3O0RH 2DTSA 3RVWC 4K23L 3WS6C 2D3VA 2VR3A 2FTAA 2Z7UA 2MMXA 4XCCL 5DS1A 3SSGA 4TS6A 2ED9A 2NY4C 2XTJE 1WZLA 4I9WE 1CFBA 4FE9A 3MNVA 2Z91B 1KTLA 4L3EE 2ITEA 3NCJH 4BFOA 3SE6A 2V17H 1E90A 1I1AB 3ZE1F 4BHUI 3V7AE 1M2VA 1BXXA 1TVDA 3AT0A 4XXWA 3UBGA 4L8BA 4N0CC 7FABH 3SDCA 4EN3B 4AQAB 2B59A 3SPJA 2BOCA 1UZ8B 2AGJL 4XN4A 5B39A 2DMHA 3TVMB 4GO8A 5CN2A 3BVNA 1OD9A 2A9DA 2CD0A 2I9LA 1I1FA 4HU8A 1AGBB 2D3JA 3UBXI 4APQA 4P2QE 4JDTL 5KJ7E 1HN1A 4B60A 1A6WH 4WTZA 5GJSH 3V4VB 5GZOD 4D0CA 1Q0EA 1S7QA 2D0FA 2W0FA 4OU3A 1G6VK 3TEUA 4Y19E 3UO1L 1CLZH 3N06B 1U8NB 5L4FA 3MFFB 2NSQA 4RVBA 3X11A 3RDTA 2YA2A 2WXIA 3KPRE 1IT9L 3CSFA 5D71L 3V4PB 3WIAA 5JZ7D 1NAMB 3DROA 5CLTA 3TIEA 3WNLA 4UT6H 3V4PH 2E27H 4QXGL 3AY4A 4ONGL 4CC1A 2DICA 1PYWB 5I15H 5H37G 2FQDA 5FM8A 4KKAD 1RHFA 1RP8A 5BV7C 3X13A 1ZCRA 5HHMB 5H8DA 4ZMOA 1IUZA 4YSCA 3FB7B 4K8RC 2K1MA 3G5ZA 4AQ8C 2EXYC 1O5PA 1RK7A 3DJTA 2AQQA 3D08A 1MF2H 3EJYD 1T22B 2A0LD 3I3BA 2UX6A 1P4UA 1Y18B 2N56A 5DJZA 3IDNA 4MSWB 1MIEH 1H3VA 3GJEB 4LQFH 3W9DA 1FDLL 1DE4A 1IAMA 1MFMA 2IPUK 3FT2B 4MMZC 2YSSA 4HKXB 4C4KT 4JGNA 4LSTH 5C07E 5TGBA 2CHXA 1SLVA 1MCSA 3WFZA 3PCYA 4TOYH 4TSAL 4N2IA 4LE8A 1MLBA 5I76A 2HZHA 4AQZA 3DK0A 1EZVY 3I9PA 4XCCH 1JPTH 5FYLL 5HDQH 4AGOA 4BZ1H 4PJAE 1PS3A 3LKOA 4NRZB 4U1GB 2D9CA 4D2NA 4ZUVB 2OCJA 4S0SD 2ZXQA 4PRHD 4D94A 3SZ6A 2WWNA 2UZXB 3JWDL 4U1JB 7FABL 4I2XB 1QPPA 1XGQB 3JSSA 1WAAA 5IHWA 3ASNB 4LNRA 4WSJA 3UZEA 3PWVA 3DGDA 3DGCR 4JFDD 4WFFD 3FT9A 2IQAB 4LPTA 3WEAA 3QJXA 3LH2L 3C8KA 4EE2A 2ZAIA 5HHOE 3AM8C 5JHBA 1E4XH 1IEBB 1CXIA 4KZDL 4NI6A 4XXDA 3KVPA 3L4WA 4DKEL 1CXFA 1Q0YL 2AJUH 2A73A 4NO0B 1VF5C 4P46C 5GS0L 5HD8C 1QKZL 1NCIA 3MV7A 4HCGA 1W8EA 2JQMA 2HJKA 1L9PA 5CS7A 2G5RA 2PWDA 5DSCA 3EXJA 1FFQA 1S5IL 4JFUA 1VFAA 1DVQA 5DK3A 4PRID 4GG8B 3BH8A 2VLJD 5H35A 4GP8B 3ULUE 1KTCA 1YO4A 2C1PB 3SE4A 2YPLB 1PSKL 4PLJD 4H0IA 4DKFL 2ZX9A 1CDYA 2BSDA 3W5MA 2CO4A 2I32A 1MELA 5JIDA 4PWHA 3NCCB 1HEHC 1TXKA 2Y6TE 4EI5D 3Q05A 3HNTH 1ZT1A 2J5LB 4KNSA 1SN2A 5J6HB 1UYWH 3EHBB 2CJUH 2IOIA 5DRZB 3RHWK 3IFOA 3U7WH 1EXUA 1I82A 1E9QA 4F20A 5F3BB 3OMNB 3WNKA 4BGLA 1YECL 5EU3B 5AOMA 4HUMB 2GFBB 4TXVB 4UB0L 1OQXA 5ADOH 4QTFA 4PYGA 1BMZA 1FZKA 2PCXA 3N44F 5GZOA 2BHUA 2KL6A 4O5LL 5FF6B 5EOCH 1OB1A 2BMKA 3C75A 3GSVA 4KXBA 3DNKA 1G9NL 1OTTD 4OW6A 1NDMB 4QKTA 5JNYA 2J8UF 1MJ7L 2BZ7A 2YQ2A 2ICEA 2I26N 3BQUD 3LQAC 4U1HA 2Y7OA 2X28A 3SQRA 1D2OA 1W72A 3RIFF 4TULL 4F58L 4F8QA 5TJWK 2YBRA 5L8LB 1NCBL 4OD2A 3LJ3A 4ABUA 2G9KA 1WC7A 3T3PF 3MNWB 3U1QA 1AO7D 3HZMB 4U4IA 4LLVB 3VGFA 4YR6B 3VGAB 4PV9A 5I73B 3IFPB 1D5MB 3P1VA 3PXLA 5IVXF 3RVWD 4YSSA 3L3HB 3C60A 2BSBA 4FNLL 5T3ZL 3UL4A 4E42A 3IMWA 3QHTC 3QNYA 4JFFE 4P2YA 4X8XA 3WMPA 4WI0B 2VCOA 5F0LB 4WHTB 5GRVL 3IMBA 3D48R 3N50A 4Q6IC 2X1PA 4FP8H 5JQ6H 1KNOA 2QKIB 4JGJA 4MA3A 4EKJA 4JKWA 2Z4QA 1T5WB 2V0AA 4TVPL 3T0AA 1K6QH 5HJ3A 3H7LA 3MV8A 1AZRA 2FL5B 1WZAA 2X4TB 2JCCA 3FO0L 3M1CA 3LPOA 1NC2D 2A9AA 1CD1B 1Q90A 3IT8D 4N0FA 4M1GL 1YEFL 3GSOB 3FTVA 1EEZB 4AH2A 1R33A 5KBDA 3WKQA 4IRSC 3WDJA 2PR4H 2GJ6B 4DTGH 2BP3A 1SQ2N 2F7QA 4P3DA 1SGKA 3NH7H 3PUCA 2QL1A 5D1ZB 1MW2A 4M8UA 3KDMA 1B4JL 2R56H 1BZ8A 1N0XH 2DZEA 1WHPA 4DP0X 4PTUA 5HHNB 3MUJA 4OCXH 3ZOAA 2X0UA 3HTLX 4N68A 1KXTA 2BSSA 1NC4A 1L7IL 1ROCA 5F1NB 1TPXB 2ADFH 4PREB 4WO4C 4Y4FC 4DKDC 4YEEA 5MP6H 4U1MB 3ZQWA 1EDQA 4MBRA 4G6ML 4N0UA 5E6SB 5E6ZA 1I1AC 2BFVL 1M4KA 2DQGH 3DO4A 3ALXA 4Z5RB 3K0YA 1PQZB 3DRTB 3RUGA 5DT1H 3JV6A 2W88A 2JI3A 2X87A 3S5LB 4MZIA 3VFVA 4F7TA 1LTXA 3VGEA 4MASA 1BZOA 4ODXA 1O6VA 1M05A 3SO5A 2BIIA 3T2PA 4S2SA 4X5PA 4LCUB 1KGCE 1YYLH 4PREA 2EDKA 2NYKA 1TYEB 2XIIA 3SHSA 3V0GA 5HHQB 1HHJA 1UJ3B 2B15A 1FL3A 4OCWL 2I5YH 3DUSA 5DJDB 1FNAA 1FRGL 4LXFA 2J1WA 3WEOA 4NQED 3QYMA 3O2VL 1BZEA 1RUKL 3GSWB 4AITA 3BD5A 2BY2A 3T4AB 2XQBL 2MNWA 3VD4A 4YFEA 1I1YB 1CL7H 1EA9C 2EVFA 1B0RA 3WLBA 3COOA 2Q7YB 5E8PB 3QXUA 1A2YA 3VA2C 4ZD3H 5DRXB 5EN2B 4L5FL 2A74A 3FQ4A 2QFRA 1A5FH 3EJCA 4GAGL 5E2JA 5GJSL 3U4EB 4MMXA 3QUXB 3UO1H 2PTTB 1FUNA 5SWZD 4IK7A 4CADA 4KXCA 4PJBA 3NP4A 1KNOB 1E5UI 2QKIA 4YZWA 5CZVL 3GC3A 4E9LA 1E5ZA 3FL7A 1HL4A 5JQ6L 3EUUA 3HCVA 4H7VA 3O4LA 1UACH 4PBDA 3AY4C 3AT9A 1XIWC 3QH3A 1AXTL 4K5LA 4OJDH 1WWWX 1JL8A 4UT9L 1LK3L 5DVPA 2YRBA 3C6SA 4LOUD 1AI1H 3FRPG 4KRPB 4PJDB 1I9IL 4YSRA 3DHPA 5LGJB 1QFPA 3HZMA 2VRQA 1N3NB 5DLLA 4HWZA 3PFQA 1YEFH 1IC4H 1VEMA 4HA1A 2R0LH 2NY6C 5JXED 4WHYG 3LIZA 4WFFE 2EEFA 2NNFA 1LEKA 1IZKA 1W0YT 4JY4B 4XN5A 2XQYG 4NZRL 1M1XB 4OIIL 4EI6B 4NEHB 1MIMH 2FHCA 1PEZA 3I6KA 4OUOA 1OB1B 2XTLA 4OF5A 3R8BB 2H5UA 4GPVA 2ADFL 4HF5L 4DK5A 4Z7WB 1OCCB 5IMLB 1G9EA 4I0PD 3VJ6B 1FL5A 4A7UA 2A9CA 5GGUA 2R0KL 5MEPA 4ZUWB 2AQRA 4LDEB 2CLRA 1KJ3H 2ZF8A 5CZXC 4LASL 3VWKA 2DQUL 2W8CA 3WTWA 2F68X 4JCWA 5DURB 5GRJL 3KYOA 3HHRB 5HHOB 1J0JA 5I6LA 1TTGA 2M83A 2Z31B 4NM8L 3ASWA 4OJEH 4HUUB 2W9EH 3NIDF 2V33A 1Y0LA 1T7VA 2EEBA 1P84K 3U83A 5A2BA 4UV4L 2V2TA 4WKZB 4I3RL 5KSAD 3KXFA 3IETB 3VFUA 5A43C 1GZQA 5H35B 4K8RH 4L1HA 1AR1D 4OCRL 1DLFH 5E7FA 5SX4I 2EVGA 1I7TB 4RSVA 1T5KA 1ONQA 4KJWD 3HC3H 3JV0A 3TBSA 5CN1A 4U7KA 3GB7B 5SWSE 4FQLH 2OFQA 1CMOA 3E1F1 3V4VL 4HH8A 2DYPD 3D30A 4YAQB 4IMKA 4NZFA 4V1DA 5AOLA 1Q0YH 1KIPA 1MCKA 2AJUL 2HJFA 3AXLB 5EUOF 4DESA 1PY0A 4X5RA 1SMDA 4GS7B 5AWNH 3U7AA 1LE5A 5E6IC 3O2WH 5I18L 2VXVL 3ENEA 1ASPA 4Z8FL 1TEGA 4JPQA 3RY5A 4F2MA 1I3RA 4IMLA 5BOPA 1PX3A 1WLHA 3CFKB 4GQ9H 4JQXC 1X9QA 5C7XH 4QRTB 1SUHA 5MI0B 4GINA 3LS4L 3DOHA 4LCCA 3G9VA 4W4OC 4KU1A 2P5EA 1BLIA 3HMXH 1AI1L 2RGSA 2RJMA 1FNSL 3ARRA 4NKIL 4L4TE 1FLTX 3UROR 3G5WA 4O2FA 3E8UL 3WUWB 1UOWA 4NRZA 4LKCB 1JVOA 4PJFE 3QYCA 4APQD 2EEDA 4B6ZA 1ZK9A 2PWHA 4GP4B 3VSTA 3P2BA 5BOZG 2YN3A 4IOFC 3IJ7A 1OE3A 4M48L 1UG9A 2F5AH 1CC3A 4Y5YC 3VG9C 1XEUA 1EIBA 1R24A 3PXHA 3R4DA 3KPQA 3ZE2B 5L2KD 3MOBL 3VX0A 4W6XB 3QG7H 3FT2A 2GPZA 1NANH 5D7IA 1ILSA 4MSWA 2C1OB 3GSQB 5HHPA 2YEZA 1IE4A 3RWEB 1VZHA 5I1CL 4A04A 4H8PA 5DC9B 1NCBH 2WQXA 4Y9EA 3Q3GA 2XTJD 3VM7A 2K9FB 1ZPLA 4YL9A 2CAKA 3OD3A 4OVVA 4U1NA 1HHHA 4J3BA 4ALAH 1CGXA 3GTTA 4PY7B 3WI9A 2EVHA 3B2MA 4BK5C 3CQFA 3MRKA 4N8VA 2HLEB 3RURA 4DGYH 4N28A 2Q8AL 3AREA 4NSKA 5IR1B 2AGJH 3QQ3A 2O61B 3TTSA 2NX5E 1YEIL 4UQIM 4GSRA 4R26L 2W0KA 5D1XC 2KDGA 2ENYA 4PY8I 5DD6B 3S4SB 4FQLL 4ODUB 5B3NA 2QQLL 1S7QB 2ODHA 1A6WL 1SF3A 2OJEA 3AWFA 3T0VA 3WXWL 4DT2A 3LAFA 3TF7C 2DD8L 2F74A 1DQQA 3NIDB 5AW0B 4AXWA 4IRSA 4X7FC 4HIIA 4LPXA 2VXVH 2VQUA 2XZQH 4Z8FH 2VR7A 3QCVL 2Y5TA 4DTGL 5C0CA 5GQBA 1XZ0A 1AJ7H 3BAWA 4WWKB 4NN5B 1J9SA 3H53A 4LVHC 2DMKA 2R56L 1WWCA 3QQXA 5FC9A 2NUTB 2IAMA 5GRWA 3TA3A 4P4KC 4N2AA 1G6RB 1UUNA 1I8KB 3HW7A 1FBIL 4JZOA 1VPOH 1TVHB 3HMXL 1DR9A 1XSIA 2BP8A 3NN8A 2VQ1B 4P2RA 5D7HA 1AHMA 1UURA 2FZ3B 3GZKA 3Q6FB 4XPGH 5ADPL 5LO7A 2YD2A 2EDLA 2Z91A 2ZCKL 3K72A 2WZ6A 3MRLA 4KTGA 4M02A 3ET9F 1FF5A 2XPZA 4MAUH 5F8QC 3QUZB 5TQ2H 2A7BA 2JF1A 4PMFA 4MGXA 3L3IB 2J8UE 1FDLH 4TUOB 3SPVB 1VGKA 3DPDA 3GQFA 5EV7A 4L8SB 1P2CA 4Y5VA 3D06A 4NQVA 4R4ND 1RJLB 1RZ7H 1OAXL 2VLKD 5DJ8B 3HI5L 4TLUA 5BW7C 1QOKA 4UQ9A 1XF2B 1FV1B 4N8PA 5DLML 3MJWA 3VFWB 3PJNA 2OTUB 1GGCL 3GF8A 5CHNA 3O9WB 3BAEL 1XH2A 3HE7D 2OZ4L 2DQJL 1NBZA 2Z31C 3AS2A 1N19A 3ZTJH 5KYYA 3JWDH 3MODH 2DS4A 5DWUL 2WLZA 4HBCL 2ISDA 4WTZG 2ZONA 4YGVA 3ARDB 5DMIH 1SFDA 1KB9K 3CFNA 1KULA 3I50H 1UXMA 1KYUA 5TF0A 1YEIH 4PIBA 3CQPA 1KBWA 4JDVA 3O4LE 1UACL 1CD9B 4YBLC 1UH4A 1J0YA 2Y7MA 4OIFA 2FYYB 3IDUA 4Y4FB 3KGSA 4HXBH 1IM9D 2X05A 2GUYA 1SDDA 1JXFA 3A21A 3BP4B 3JQOB 4P5KB 3E2HC 4ICWA 4QOKD 5J12B 4YZFF 3LKNA 1QUNA 4MCZB 4GJTB 3GK8H 1S2EA 2IMNA 4OIIH 1U91A 2ZUQC 4K2UH 1NBVH 3L9YA 3P0YH 5GZNC 2V7HB 4UIMA 4JJHA 1ETJA 1YAZA 1ZE3H 1XR9A 2R2BB 4F5CA 4K3DL 1JRHI 1SQMA 3BXNB 4HW6A 3IMUA 1C5DA 2CJSA 2WVUA 1KFAH 4M4RA 2XWDA 2YK1L 1ZIBA 2YA0A 2FQFA 1ID5I 1C08B 1Q9LA 3K72B 3EGDB 5HDLA 1LO5A 1E27B 4MAUL 5E1GA 4AL8H 1XGPB 4KUCF 3MUY1 4ZTOL 4FNPA 1DBMH 1ZHBB 3HEIB 3O3EA 3V0IA 1TVHA 3SGKA 5FOBB 1I8KA 1SXBA 3KPLB 3QFJD 2OMYB 5LB1A 3RWDB 1SXAA 1BD2E 3U25A 1MJ7H 4DH2A 4X4ZA 2P43B 2LE9A 3K8KA 3P4OA 4WI6A 4KJPC 2VT0A 2Y5TB 3I3DA 5AEAA 1IV8A 5C9JB 2OTPA 4ELKB 3NUKA 4HIIB 4HIEB 2IV8A 1ZT7B 3TM6A 4BFRA 5J1TC 1OAKL 5AW2B 4ONOA 5A2FA 1G5GA 4PG2C 3RZCB 1WG3A 3EYSL 1AQDB 4KRMB 4J7RA 2JKTM 1MHHA 3DOSA 3MODL 5DWUH 1JGVH 2DM2A 3H54A 3BZ4B 2WLHA 2LW5A 1GKOA 2WLIA 2KLRA 4A7GA 1NEUA 3J7HA 3BGMB 4JFEA 4U6TA 4AYGA 3P69A 2O61A 3QUYB 3JVGC 3B3IB 4G43B 5DZNA 1MWAB 2VW7A 2RMNA 5LUMA 1N5AB 2VITA 3QZNA 3MZTA 4YZFE 3FO0H 2XN0A 4LCVA 1JHKH 1DANU 4HK0A 1MCPH 5K33A 4MDJA 4MQSB 4MYPA 1F1AA 4F7CB 1SVBA 3ZO0A 4G9DA 2H2SD 4YN3A 1L5GA 3MLZH 4X7DC 3GK8L 2C1OA 2WLKA 2CKBL 1B4JH 2YLHA 2Z34A 3AG2B 3D4ZA 4OCXL 4D9RD 5C0ND 4DGWC 2NY2B 5FCSH 1UB5A 2XLLA 4PJDE 5CR8A 5LN4A 2ZNWA 4K5NA 3DDGA 3AJ7A 3ZY7A 3VQ2C 1OOAA 4Q6IB 1KFAL 3QORC 1MRCL 1M7IA 4JFED 1JMZA 4YHPA 2H6OA 1UWGH 4WW1A 3A4AA 4A6YL 1A02N 1J11A 2DWEB 4KHTL 3LXBA 2QVMA 2ETWA 4ALAL 3UTPD 3TZVD 2VDNB 3GJFB 3BFWA 3C9NA 2Q8AH 3ZT7A 2ROYA 5DJAA 1W80A 2B8OT 3RJOA 1KTRL 1T6WA 3SY6A 2F53A 5BRZA 5HDWA 5I74C 4NBZB 2RBLA 3EYOA 4RDQG 3K6IA 4P2OC 2ZT9C 3CDFA 3FO2A 3WOVA 5CCKH 1QRKA 1G7QA 1AAJA 4HXAL 3E3QC 2X4OA 2FX7H 1QNZL 4CJ1A 1I85A 4XP1H 1FZMA 5LG1A 5KANI 1GSMA 5DC4B 4GQZA 4XPFH 5DMJB 1PDKB 2V3EA 4POUB 4WEEA 1BLNB 1JJUA 5I16B 1RI8A 3D0VA 2EC9U 3KXFB 5FYJE 3UTTA 4PJXF 3L3JB 1CTNA 2DLIA 5EZJB 5J11B 3HE6C 4WV1C 4YIQB 1OARH 1UM6H 4IOIA 4L37A 3SJVA 1D5IH 1NDGB 3ZRSA 3I50E 1RZKL 3OG4B 3TLRA 3ZN6A 4KGLA 1RVFL 5FYJH 1QLEL 3QJZA 2D3NA 3ZHKA 3Q2VA 3U0TB 5ICXB 3BH9B 3VRLE 3VGBA 2W59A 2CLRB 1MVFA 1NEZG 3L4UA 4GI6A 3GSUB 3FFCD 3O3AA 5KVGH 2QHRH 3GXFA 3OJMB 5D7KD 1SOQA 1YN7A 4Y16A 1IFHL 1X5FA 4PV8A 1CYWA 1MIML 1FYTA 4ZO7A 4RGNC 1JZGA 3BWAB 3O4OC 1VKXA 2NX5B 4IBWA 4LLMA 2R0KH 3NSXA 3C5ZA 1YEGH 5I1GL 3ZMRA 1YMMB 5KVGE 4NZTH 3HAEA 1HKFA 3QXDB 4R90L 1WO2A 2WC7A 3S98A 1SMOA 2J1YA 1KYFA 3CFQA 3R06B 2IFGA 5I6OA 1QLRA 1LQBC 3PG2A 5I30H 4FQ1L 2IGFL 4L1DA 2Y25A 2DQJH 2ICWA 1XCQA 3BPNB 2W9EL 1SBSL 3E9TA 4X5WA 4NP9A 4XGZB 5ISZE 3DYMA 3DX1A 4M7LL 2XY1A 4NJ9H 3O2DA 4ZFZA 4BM7A 3NZUA 5HXMA 5JW5A 2E9BA 4JMXA 1VEOA 3OAZH 4HJIA 4H0LC 3WIIL 2Y5EA 1I4FB 5F7WC 5I1AB 1BFSA 5JOPD 4CADB 3TCXA 3HI1B 4JDTH 2GY7B 2UWEE 1FIEA 5T1KD 4ADGA 1JXJA 3JTSB 5KBPA 4MD4A 2BS9A 2PETA 5HYQA 1TF4A 2WBJC 3BZFB 4PPTA 4XMLH 1SOKA 1A7NL 3ABZA 5TF1H 3IJSB 1JGEB 2IG2H 1ZJAA 2XV2A 1CLZL 5F96H 1DQDL 1H3PL 2Q7YA 2DMCA 2GJZA 1MCCA 2ZPKH 4GRWE 2LTQC 4N8VG 3DXAD 2YAPA 5DWPA 1B2YA 5HHME 1X5ZA 4O00A 3QIBD 3VG0H 3BSZL 1TJGH 1UWYA 3I9AA 2VAJA 4DOHB 4HULB 4F9LC 5GGSB 3P0YL 3C6LC 5AKVA 1FJ1A 3TWYA 2X44D 2HFGL 5C70A 2QGBA 4L3CA 1UT2A 3CG8A 3LKPA 3OXSB 5IVZB 4G7SB 1FNSH 2ICWI 3ME0A 5A16B 4YDZA 1U58B 1M05B 3UTTD 1BEXA 4ZBJA 1CFSB 1A4BA 2EXYD 4LGPB 3Q2NA 3S5LA 3MRGA 3LY6A 4JHVA 4DP7X 4HG4J 5AB1A 1HS6A 4QI3A 2MPAL 2MKWA 4N6RB 3ZTDC 2K78A 1A6PA 3JBG7 3TN0A 5JHLL 3BHBA 2F5AL 5I0WA 3LHPL 1SEBB 5TDNA 4BGDA 2ENJA 3KHOA 3BKMH 4P59H 5DMKA 3V8CA 5L2KA 3T1WA 1JG9A 3GHBL 3VACA 2XTSA 2ZCHH 5HI4C 2GC4C 3FK3A 4FFWD 1KXQE 3WD5L 2B08A 1T0OA 1Y6NR 1JPTL 5MHSD 1T2QL 4GSXA 4H1LA 3B2PA 4NKDB 3AU1B 3BJLA 4P07A 4ZNCD 3GHEH 2AABL 4BKSC 2MRYA 3NIGB 1XB6A 5F7DA 1H15A 3O8XB 1ULVA 2MCG1 4MNHA 1WFIA 3C5SA 3FU7B 4CN6A 3B3BA 5AVVB 2A2QT 2FJFA 5K1NA 4L8DA 5LDUA 4KQ0A 1QFWM 4QKXB 4UM8B 5EZJA 4U1SB 2AF2A 2CO6B 2X4RB 5D1XE 3F12A 5FV1L 4FA7B 3RWGB 1D7DA 3D0VB 43C9A 5I16A 2CA3A 4WK2B 4XCEB 3BP6A 3S3CB 1J12A 1DN0A 3CZSA 3L4XA 3WIIH 1PF3A 4E42B 3C12A 5C6PB 3EJPA 3RGVD 1FORH 4OM0H