4UTBA

Crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
394
structure length
391
Chain Sequence
MRCIGISNRDFVEGVSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Immune system/viral protein
total genus 75
structure length 391
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utbA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utbA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utbA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utbA03
5IZ7A 4AM0Q 3P54A 1RERA 5LCVA 5GZOA 4ALAC 3N42F 1OKEA 1Z66A 3UYPB 5KVGE 4UTBA 4GT0A 5IREA 3C6EA 5LBSA 1PJWA 3IRCA 5AAWC 3N44F 4UT9A 5KVFE 2R69A 3J27A 3UZQB 3G7TA 2R29A 3UZEC 5AAMC 3J2PA 4UTCA 4X42A 4BZ1A 3WE1A 3VTTA 5LBVA 2I69A 3UAJA 4FG0A 2P5PA 2JV6A 1UZGA 3N41F 5KVDE 4BZ2A 5JHLA 3MUUA 3C5XA 1OK8A 2GG1A 1URZA 4FFZA 2H0PA 2ALAA 1OANA 1TG8A 4UT6A 4FFYA 1SVBA 5B1CA 2JQMA 4UTAA 1Z3RA 5H37A 3UC0A 2HG0A 3UZVA 1ZTXE 3N40F 4GSXA 2JSFA 3N43F 5JHMA 4AL8C 5KVEE 5GZNA 3I50E 1S6NA 4L5FE 2V33A
chains in the Genus database with same CATH superfamily
4XC3L 2E6PA 3WNOA 2NW2A 3GPEA 4MAUH 4UOW0 1J8SA 3QA3A 4N3TA 3WDIA 1CQYA 2ZWLT 4Y1AD 5DJDA 3SKNB 3QFDA 3FB5A 3V2AR 4F2EA 2N59A 1LM8V 4GRLA 3D3VD 4K3HA 4KMTL 5I74B 1H8NA 2HFEB 2XXFA 3KDMA 4Y0GA 4I9XA 3SE4A 1HL5A 1U3ZA 4Z9KB 2A9DA 1LVEA 4YSAA 1BLNA 4MMXA 1YEDB 2FEEL 3BAEL 4LPYA 2EVIA 4RAVB 2ZXGA 3QI9A 4YDIL 4JM2F 2XBDA 1HL4A 4G9FA 3NJKA 3I50H 2VSCA 4B9PA 3DMMC 1JZ4A 1INQB 3D09A 4B9JA 4L9LC 2EINB 1OGTA 4R7DB 2FWSA 5J13B 3QC6X 4U1LB 3N44F 4XWGL 2EVGA 1QBLL 2D7TH 1RV6X 3CPLA 2CIIA 4KJYA 2A9AA 4KXAA 1G9EA 3FUKA 3BMWA 1VEMA 3OHXB 3QRBA 5LGHH 5FUOH 3L9RA 4UNUA 1UA6L 3T0EA 7FABH 4JG0H 1XF2A 4XE0A 3MRCA 3KYOB 2PLTA 3CPUA 3O3DA 3EJUA 3JWOH 4AGNA 5KG9B 1D5XA 1H3GA 3BWUC 4HW6A 3ZBMA 4KHXH 3VD1A 2WSDA 4XP6L 3DETD 4G8GD 2IPKB 5E2JA 4HUMB 5EUOF 3CXHJ 4NQVB 3E0GA 5JHDD 1E28A 3DX9A 4DKEH 3W9EA 4EOWL 4D0DB 3Q44A 2A83B 2FHFA 2JKWA 5C08A 2HSIA 2CLVB 2YGNA 4XPTH 1KTLA 4J6RH 4JAMB 3HUJE 5E1QA 2A6DB 2Z31B 3CU1A 5I28A 5F6IB 3GXIA 1OANA 1C9SA 1MJJB 5AYQA 4PRBB 1DVUA 5AD0A 3Q7JA 3K7UA 2DKMA 4D0CA 3F58L 3QJSB 1QD0A 1NGQL 3W11D 1M42A 1SRDA 3OZ9H 4K4KA 1NDGA 2WWMC 1YNTF 4BJLA 2YJLA 1DQQA 2YQ2A 3UG4A 1ACYH 2WLLB 5I66A 1CL7I 1YPZF 2K0RA 4HT1H 4TOYL 1UM6H 3NAAH 3MRMA 1I7ZB 4LCYB 4F9PA 1RKRA 4I77H 2A1WL 3JTTA 4P5MB 4LNRB 4FTVE 4NNXA 1IFHH 3TYGH 5JZ7D 5KVEE 3T0BA 1U4FA 3TZVA 2F1BA 3MXVH 4G1MA 3RGHA 3SPVA 2JWYA 4EVNA 2OM5A 1B4LA 1HZLA 1MELA 2IBBA 3DYMA 3O6MH 3UTTB 3I75B 2Q5BA 3KPSB 1IBBA 1Q0EA 1CGYA 4LHUB 4PJEA 1QSFB 2KLTA 2ATKB 1PKOA 4Y4FC 4JL1A 2CUAA 4PJIB 2PWFA 4IK7A 4XN4A 2GVYA 1OSZB 2AQPA 4G9DA 2AFNA 1NFDF 1NCDL 4KO9A 4JKMA 5FWRA 4U3SA 3WLBA 2NXYC 4GG8A 2QV2A 2E27H 1N6VA 3R7RA 2X1PA 3ZT5A 3MNZA 1OARH 1PJWA 2UZXA 3C60B 3O4LA 4K8RC 4AYID 4YMPA 2DQJH 3QHFH 3DURA 4GSQA 4YHLL 1DVFA 4I0PD 5JXEA 2VM9A 2OMNA 5TK2A 2NRDA 1KCBA 1XEUA 2BK8A 5HDLA 2H3NA 5FO9A 3WFEH 1EEUA 2DYPD 3D48R 5C9JA 4XP1H 4RGOL 1IKFH 3QORA 5B3SB 4XN1A 1CT8A 1IGYB 3DIFA 2I60L 4GAGH 5LWYH 1T20B 3WS6A 2VIRB 4JW3A 4KK6C 4Y7OC 1NM4A 1QI5A 4ZW5A 5J12B 1ZGLP 2EC9U 2F54A 4UUJA 1UM5H 1BV8A 2YC1A 1CR9H 2DQGH 3HHSB 3II2A 1NIDA 2W0KA 1JPGA 3UTZA 1DANT 2BCKB 2E4FA 4ZMVA 4X80H 3HG4A 3NK3A 4KY1H 3LZPA 5DJYB 2WWNA 3UEQA 2PR4L 1TQBC 3FOMA 3MLYH 3VW3L 4HKZB 2YZ8A 1VLXA 2ADJA 1MAKA 3HZMB 3EYFB 5I1LA 2AEPL 4XZ4A 4L3EA 4U31A 1YECL 2Y07H 3NIDF 4Y8DC 7CGTA 1IMHC 3HNSH 4GI8A 3BLBA 3F01A 3KJ4C 3NEOA 4B5ZA 1AG6A 2YN3A 4Y16B 4X0NA 4CKQA 1U93A 1U91A 4QMEA 3NDZE 4XZUA 1WS8A 2W38A 1U8HA 3DARA 4XI5D 4U7MA 2YFNA 4HUCA 1NGZA 2OR7A 4YEFA 1L9TA 3LB6D 2VDLB 3Q8EA 5GISL 2VLJA 1CL7H 1NKRA 5GGRA 5L8JB 3ECBA 2IANB 3WIHH 4M62H 2D7PA 2V7NA 1JJUA 5CBEB 4GO8A 4BK5A 4LSQL 3KPOA 4KJPC 2QELA 1U2CA 4A63A 1IGFH 4N4YB 1CLVA 1JPTH 4ODHL 4A6YB 5C0CB 5JHBA 1OALA 2C4XA 5FHAL 1CIDA 1UGKA 3MNDA 3S35L 1NAMH 4BDVA 2O6CA 1JAEA 3HE7A 4FQLH 5L88H 3CMOH 4TL5A 2ZICA 3C9NA 5SWZD 3T3PE 3FFDB 4BD4A 1JZ5A 4D8PB 1O7SA 1GKOA 4DVBA 3UP1A 2AJSL 5FDYA 1EK3A 2K4WA 2O4EA 2ILLA 1FNEB 1S9YA 2J7LA 2XTSA 5TGBA 5LBSA 4FXKB 2LW3A 4RDBA 2HVKB 4D7PA 4H0LC 1RI8A 5C09E 3KEHA 4FTVA 4OVUA 2XA3A 2CJ3A 3VXSA 4HETA 4NO0B 3PQYD 3D87B 3RVTD 3L9BA 3LEVH 1E9OA 3B5GA 4TNVK 4XVJH 1J8KA 4JVWA 1H6EA 1SJEA 2WWKT 2AABL 2ARJA 2R39A 3EDKA 4Y2LA 1DVXA 5C07A 4U6TA 4DGYH 3BRDA 3W56A 5I74C 1LO0L 2CALA 1FO0H 4UZSA 4P9HL 5BJTB 1SHMA 1JHKH 1IM9B 4AGMA 1NANI 3HMXH 2ZSVA 3KPNB 1OAUL 3SCMB 4HZLB 3JTBA 1XBRA 3GO1H 2NY1D 1MIML 1Q0YL 1BXXA 4UQ3A 4KRPC 4UAOB 1F6AA 3V7AE 3M45A 2CNYA 1JV2B 5ID0B 1KJMA 4JJOA 2WANA 2BOBA 4KV5F 4XVTL 3W5NA 3VQ2C 4PLKC 1NLBL 3PGCA 2HFTA 4Z7OE 1WWCA 1OK8A 1T7ZA 1N59B 2XWCA 4HISA 2FD6H 4MNGB 4PD4K 4R0LA 4WWPA 2FO1A 1BFOA 2EIZA 4HC1L 5HI4D 3HI5H 4MQXD 4PRPD 1OE3A 3BKML 1S7QB 1UA3A 3PAUA 1CU4L 2R2EB 2E7BA 4GAYB 4FXTA 5GRUH 1WE5A 1RJYB 3MJGX 4P2QE 3GSOB 2HT4D 2Y1ZA 3DX6A 3VACA 1A7PL 1ED3A 2X4PB 1GJWA 4PG2C 1YCSA 2DH2A 1PQZA 1VIWA 3CLFL 4NAJA 3IJ7A 4JPKL 3S37H 5EFIB 3BUTA 4E68A 3W0WD 3SYPA 5K9QI 2ZF9A 4K7PY 5SX4I 4FXGB 2W65A 5DQ9B 3HG3A 4HHWA 5KWYC 2WMPB 1BXVA 1PX8A 2X6CA 3B5HA 4QD2E 3TO2A 2D2OA 2R2BA 1GOFA 1UT2A 5EO1A 2YGQA 1UD8A 4OZGE 2K6WA 2YPVL 4Y4HD 1N8OE 4YDVA 1ETB1 1JNJA 3CIQA 2B15A 3CVCA 4IRSA 3GB7B 3FT2A 2QZ5A 3FQ2A 2DJUA 4L29B 1EHAA 2HVJB 3H9SE 1ADQH 4BGLA 2DRUA 3QG7H 5HY9B 1M3IA 3BEWB 4RMUA 5HYJB 1DFBL 1ZE3H 1IAOB 3NEEA 4P2RB 2FGWL 2YKLH 1S9XA 3HG1D 3SDXE 2SODB 4LCCB 2VISB 4FLOA 12E8H 1LP9E 2DPKA 4GIAA 5IREA 1FZKA 2H1PH 4HMCA 3SOBH 1A9BB 3LZQA 3P9MB 1YMME 2A0LD 1BVKA 4QHLB 4X7SL 3WTTA 4NAQA 4Y5YA 5I5JA 4FQHA 4ZW6A 4OCRL 1R3LA 5TH2B 5I6XB 3P4MA 3QO1B 4OZIB 2FEEI 3QUXC 3F6LA 3G6AB 5F96L 1YY8A 1GJUA 2J73A 2PXYC 1RULH 3A0OA 1XF1A 3C09B 1ZLWK 4PS4H 5G4MA 1AJ7L 1K72A 3PP3K 1SUHA 4A68A 1JZIA 3OXRB 2JK5A 1RUML 5DJAB 2OZ4A 2P5ED 1L0YA 1QI3A 4P46B 5B39G 3L3OB 1NANH 3N85L 4PWEA 1TITA 3IFNL 2OTWA 3QA3B 3IU4L 4Y1AA 3QFDB 3FB5B 1IAKB 2BIMA 4YX2H 1RP8A 4NQUA 5EC1A 5LG1A 3VU1A 4LGPB 3D3VA 3T0XA 4YGVA 5J7CC 1OT1A 1KCWA 4AQEA 4N3UA 1TZ8A 2KZBA 5B3JF 4KK8D 5EB9A 5DK2A 1U8NA 2BP5M 3AS2A 4MMXB 3V4PA 2WUBH 1JZ6A 1KN2H 3GUFA 4R4NC 4Q89A 3QI9B 3ZW3A 2ITFA 2X4UA 2D7OA 4G9FB 3IPFA 3MGAA 3VXPA 4XPFL 1IV8A 2P47B 3RDJA 3UJTL 2NY3D 1OGTB 2VE6B 3NSXA 2XXCB 3HC3L 2PYFB 1B0GB 1DBBL 1FCCA 4N1CA 2J8UA 4KJYB 1WEJH 2CIIB 1QEXA 3BUIA 2PTTB 4JX0A 1TEGA 5MEPA 1N2RA 1IJ9A 1H9DA 4NN5C 2BSTA 1NMCB 1A1OB 3L9RB 4QXUL 3EAKA 4M7KL 3N9GL 3TH4T 1KGCE 2ZUQB 1XF2B 3TT1L 3GSUA 4OW6A 5SX4H 2DWYA 4AL8C 2NT1A 1U8PA 2QHRH 3MRCB 4LCIH 3O3DB 4QT5A 5IB2A 2AJXL 1QEWB 4FKKA 4M5ZL 3V6FB 3WXWH 3D4CA 3QWQB 3BE1L 4G8GA 4NUGH 4Y16C 4B97A 4ZTOH 3QISA 3BFOA 3BPLC 1O9ZA 3VA6A 1NGYA 4DOHE 5JHDA 4M5YH 5AZ2L 3DX9B 3W9EB 3PDOA 1SN2A 3HB3C 4IHOA 3WMQA 3ETBF 3V0WH 3MKKA 5KANI 4HU2A 1KTLB 1NJ9B 3OMIB 3GI8H 4MQSB 3T2PA 4IBZA 3ZTNH 1ZY9A 4AZ8A 4YO0B 3F00A 1T2QH 1FG2A 3KJ6H 4KPHL 5JDSA 4DAGL 1ZANL 5AD0B 2F5BL 3LH9A 5DR5L 5LJYH 1LDPL 1WS7A 4Y9BA 1ZWIA 2HT2D 5F9WB 1CFMA 3VDCA 3T8XA 5I75B 4WEEA 1NDGB 5FLVA 5TF1L 1NBCA 2GIYA 3D7PA 3O8XC 5BRZE 2WB7A 1DQQB 2XFXB 5AW0B 3IAPA 4KMTH 3D39D 5I66B 2YZ1A 3K8KA 4UT9A 5EF1A 4Z7QE 3MRMB 2GIXA 3DDGA 1G7QA 5I0XA 5DJXB 3BPOB 1X9RA 1A6ZA 2DQDH 5BQDA 1HX0A 3JTTB 2WCSA 3NABL 3HI6L 3TZVB 3ILEA 1TVBA 4Y2DB 1RFDH 1WG3A 5D96C 3E6HA 3BDYH 3H4HA 3EYOA 2AK4B 3MRPA 3QUMB 3SPVB 1O75A 4EVNB 3VNYA 4HVBA 3F04A 5TD4A 1O6SA 5GRYA 2YD7A 4XWGH 1QBLH 2AV7A 4HS8L 3SDXA 3MV9E 1IZJA 4JB9L 4PJEB 3WO3B 1RK7A 4I9WD 5C0DA 2PETA 1P84K 2X9XA 3TA3D 5KTEH 1UA6H 5JUEH 4YK4B 4JHVA 4LEOA 1WWWX 3Q8CA 4QR7A 2BHFA 1QA9A 5DJ2A 4G9DB 2J8OA 5HYEA 3ATBA 4U3SB 3WLBB 4UQBA 1FZOB 1E9PB 1OW0A 1KBBA 4OCXH 2XXGA 3MNZB 1KYUA 2O5YL 2WLJA 2UZXB 3O4LB 4E9XA 4E9TA 3NIFB 3NJNA 1DVFB 4I0PA 1I9JL 1Z3RA 5AOMA 4BYHA 2GK2A 2FVNA 3IJEA 3SCMC 2FZ3A 2GB2A 5A2BA 2H3NB 2YAEA 2DYPA 4K07A 5C9JB 1I7TA 1FF5A 2DMGA 2CUMA 2MQ0A 4N25A 4UAOC 3KLAB 4XBMA 5T1DL 5LNDA 3DIFB 5CLYA 4FRWA 4KK9C 1ONQA 4UUJB 4JFFD 5EUOE 4B9ZA 1JSYA 2MPVA 2YC1B 4UBDD 2GUYA 1W2KT 5F3HA 4X4MA 1JPGB 2XQBL 2JTDA 5F1KC 5C0IA 1HK6A 3H55A 5DEJA 4PRAA 1IBGL 5I1AB 1HOEA 4KXZI 1VSCA 5GQBA 3TF4A 4NP4L 3FOMB 4H25A 4WGKA 4G6FD 5CP7A 4E9WA 2ADJB 2DLEA 2KUTA 2UXGA 5EO0A 4OF5A 4KROD 3D69B 5I1LB 3TBTA 4Z3EA 3IFPB 5IB4A 1PAZA 3OGCB 4ZO9A 4EQ3A 4YBQC 2EDDA 4HCRL 2ZWNA 2X1WL 4FXGC 4Z3HA 1QNZH 3FH7A 3SGKC 4GUPB 4OF3A 2ZUSA 3KBEA 1AR2A 4K5NA 2Y3NA 4YBLC 4CSSA 1U93B 1U91B 5CEYB 4AT6A 1NC4A 4GRWF 4UNVA 1U8HB 5D72H 3WSQH 4EKXA 3QVAA 3LRHA 3HLKA 5JHAA 4YGAB 1W72L 4UMGA 3DI2B 5J06A 3H7BB 1IGIL 2VDRB 3EFDL 2VLJB 3FUEA 4TNWF 2WLNA 5GGRB 3ECBB 1PX4A 1LXMA 1IGMH 4NO5A 3MRKA 4NUJA 1FLTX 3T6XA 4TVPL 3SBWA 3HS8A 4QWWD 2V7NB 4NXKA 1PY4A 1G7PA 3D5OF 2EUZA 5GZND 1OHQA 3KPOB 3VH8A 3M88A 2H32A 1YEEH 3GRWL 3MROA 5DVMA 4AYDC 3FO1A 4LCCC 3EJJX 2KDGA 4WI7A 4TMPA 5DSCB 4H5SB 2BSSB 1OP5K 1GAFH 4POZD 3P9WB 1E4KC 1TCMA 3HE7B 3LN5A 1BG1A 1WP6A 4N8VA 1BAGA 1P5VA 1OAYL 3C9NB 3M8OL 4AUJA 5SWZA 2YAOA 3DO7A 4M9OA 1ZSDA 3QZWB 3DYPA 2P5EE 1ZT4A 2UXFA 4LAQH 4OCSH 1PIGA 2VDMH 4DVBB 2WXMA 5E6RB 2GI0A 2MPAH 2BOCB 3HN5A 5CBAA 1S9YB 5DUJA 3BGFC 5KBMA 5TGBB 4NERA 2E8YA 3P30L 1W9XA 3QZOA 3DX4A 4PJ8B 4X9FA 5B1CA 1KPVA 5D7SL 4F7CB 2PR4H 1LK3L 3EHBD 2ZCLL 1C5DA 3PQYA 1A6VL 4P46C 2F7OA 1AKJD 5GSRA 5IY5B 1E9OB 2LLLA 1IGCH 1S2EA 4RMSA 4MX7B 5JW4R 4WEBH 2V9UA 1YECH 2FO4A 4QXWA 2C7UA 3LKRA 3O6LL 5D7LD 1W0WB 1INDL 2ARJB 4GRLC 3GHEH 5C07B 4CL7A 3S36L 4OLZL 2FLRT 4QRBA 15C8L 1B88A 5I71B 4EZLA 3SE4C 1HEZB 2GY7B 3LIZL 5G5DB 1ZGLA 4AGOA 1DTUA 4EZMA 1GGYA 2FL5B 5FGCB 2ZSVB 1AXTL 4HKXA 2ZX8A 3L9EA 4GKZA 4N87A 5FV1L 4ALAL 4UQ3B 4RAUB 4Z0BL 3NIDE 3UAJD 1FN4B 1XR8A 4KXZH 1KJMB 3W39A 2BOBB 5EIIA 5K9QG 3BSZH 4E36A 2XVKA 1I7RA 3KCPB 1UXWA 3NFSH 3PGCB 1HFUA 4R0LB 4GFXA 4LSQH 1NBZB 1DBKL 4GEJA 1BFOB 2EIZB 3L3HB 2Y2YA 2EE9A 1MHHA 4PRPA 2GSIB 1I75A 2AQ3A 3D05A 4JG1L 4ODHH 5J6HA 3FL7A 1Z0NA 3T0EC 2ZUQC 2OL3A 2BS71 3US9A 2RTTA 4N9GA 4PGEB 1J87A 2FRGP 3UPCA 4BZYA 3GNML 1G7IA 5B22A 2BS9A 4TM9A 3S35H 2AHIA 1EERB 3F12A 1CYWA 2QGDA 2Z64C 4RLDA 4C4KT 1EXHA 1TTCA 1ED3B 1PQZB 3EGDA 4RMQA 2J57A 3PG2A 3QXUA 3BC9A 4CJ1A 2QPDB 4N24A 1DVYA 5IM7A 2ZCHH 2AJSH 4DP7X 3W0WA 4OFDA 1ITBB 4LDOB 4FFZL 2W65B 5E8OB 4A2EA 2YAMA 2CD0A 4ZG1A 1D2PA 4YSRA 4O2CA 1XGPA 4CC0A 1H15A 3TO2B 2R2BB 5AVSB 1XO8A 4XX5A 2WZ0A 2FQFA 4Y4HA 4YDVB 3QDAA 1TLKA 5AL0A 3ZE1E 4ADGA 1EWHA 3CU7A 4IRSB 4URKA 5F9WC 5I75C 3PUUA 3FT2B 1YNTA 3MNWA 4HWEL 3UPRA 3IB4A 4IJ3B 4OI7A 4EEEA 1YPZA 3KDPB 5DD1H 2WWKO 3NSFA 4B9KC 4L1TA 2YXFA 5KN5A 4K8RH 2AVGA 4I4WA 3WE6A 1KGIA 3HLAB 3U0PA 1S9XB 3BPOC 3UYPA 4F9PC 3HG1A 3PWVA 4CVUA 1QNIA 1GSMA 4OZHF 3G9VA 1FZKB 3DLQR 2R9HD 3TZVC 2BRQA 2H6PA 4L0PB 3IS0X 4BCYA 4Y5YB 4XCCL 4FQHB 1CD9B 4ZW8A 3OKOB 5A6LA 4FHBD 2OSXA 2WB1A 2FX9H 3P4MB 2PKDA 2AJYH 4X2UA 4D9RD 3INUL 2XIDA 3V0IA 4MAYD 1YY8B 2N01B 2ZOLA 3HAEA 1LJMA 1F4WL 3ZDYE 5J89A 4YK4C 3Q5YA 5CCKL 3OF6D 2KLRA 3LS5L 5A2CA 2QADC 1NFDA 5F9AC 1CDCA 3MFFA 3O6FC 2J1KA 1KMGA 2JK5B 2K9UA 5L9DL 2P5EA 4LLDA 3ZJAA 3MGOB 4AQOA 4GUQA 2X4QB 2CBOA 4JFWA 3GXUB 2JVUA 2OTWB 2IQ9H 5DJ8A 1I9RH 1RIHL 1DVFC 1NAKL 1U8JB 2H6UA 4ODSH 4Y1AB 5F88A 4YSOA 5C3TA 4JPKH 3X3GH 5JXEC 2D3LA 4AYFA 4JFFE 3D3VB 4YGVB 1AVAA 2A9CA 4AQEB 1OKEA 4HYTB 5DK2B 3QORC 1U8NB 3V4PB 4B9GA 5AQ0A 4S0SD 2VZUA 2AJ3A 2YPVH 2X4UB 3HS0A 2B5IB 3WS6C 5JIDA 2DTML 3S97C 5LVEA 3VXPB 2VLKE 3QCVL 3RWFA 2CDFA 4DQOL 3VD4A 3R1GH 4LCUA 5IHWA 1GYUA 5I6MA 4WWKC 2J8UB 4CN6A 3WTWA 1DFBH 2EH7L 5KANG 1N2RB 5F7BA 3T65A 4TQHA 4QJ4B 5DTFB 5SWSD 1GYCA 3OM3B 5DJ6B 5IVOA 3V0AC 2QSCL 4YE4L 3GSUB 3FT0A 4R26L 4MCNA 1NBVH 4FFYL 4YDLC 1U6AH 2FHCA 4Q9CA 4QT5B 3V0DA 5IB2B 4X7SH 4LCWE 2CLZA 3HC0B 1N0LA 2BFVL 4G8GB 5D7KE 3R0NA 4KVNL 3IJYA 4CVZB 1NGYB 4TVPE 5JHDB 4ONFH 5F96H 4E9YA 2JV6A 3V52L 4POYA 3DSFH 5IESH 4IHOB 3D0LA 1AKPA 1EIBA 1EJ6A 4LVOB 3WNKA 1CLYL 1U2YA 5FUZL 1JV5A 2XN9E 3L3KA 4HWNA 4F5CE 2Y23A 4Q9BA 4MZ3A 1UFUA 4AK2A 2C1OA 3P3SA 1RUMH 4N1HB 3ZZSA 1FG2B 2YD5A 3NZHH 4KKLC 3VGDA 5JDSB 3NIGB 4AM0A 4BK5C 1QSVA 2AXFB 3N85H 5GGTA 4BBWA 1RURL 1NCWL 1U8OA 3IFNH 3IU4H 4HAKA 1ZWIB 5L2JB 3T8XB 2V5MA 5IJKC 4IKLA 5CEZL 4WTZG 1M7IA 1J1XL 3RU8H 2BP0A 1B0WA 1AGCA 3D39A 4AKQA 4LP4A 3RAJH 4HOXA 2WJ5A 3HE7C 3F7YA 1A6ZB 3OV6A 4AYEC 2ERJB 2R23A 1DLFH 2JKNA 3MV7E 4LOVA 1TZHB 5E5RB 4XPFH 3DV4A 3MBXL 5C0NC 1YEKL 3JWNH 3FB6A 1AQKH 3QUML 3EYOB 3MRPB 4JGJA 4ZMAT 1WGVA 1AOZA 2ZG1A 3HC3H 4NUPA 1BVNP 1A3RL 5I1EH 1O6SB 5CJXA 1BD2D 4OVVA 1DSYA 1AE6L 2XN0A 1ES0B 2AV7B 2YGVA 3IDXL 4G80A 2FX8L 4NQCD 3QUKB 4KKZA 3TA3A 1X7TA 4QXUH 4M7KH 3NRPA 4LEOB 2WTPA 4RQQA 5FF6B 5DJ2B 1JERA 3QQNA 5D1ZD 2AJXH 3ARTA 2CR3A 1K3IA 1KLGB 1L7TL 4KRNA 4M5ZH 3FH5A 2O72A 4XOCA 1WA1X 5D8JH 5TDNA 3FTSA 1X5LA 3HNTL 4WO4B 4I0PB 1KZYA 1T1ZA 5AZ2H 1YQVH 4JO2L 4HUNB 2CIKB 4C83A 5A7BA 1WDAA 3IJEB 3ELQA 5E4EB 2AMUA 1AZCA 2FX7L 1VPOL 2DYPB 2X5PA 3U7YL 1RQ5A 3DGCR 4CU6A 4ZS7H 3UZQB 4DAGH 2G60H 2F5BH 2VLME 5DR5H 5E4OA 4KTGA 3CFMA 1OAZL 5CGMA 1ONQB 4JFFA 5H8DA 3TJHC 3WMPA 1P7HL 2NX5E 3T2LA 2XKSA 3V0VA 1PZAA 1M05B 5BVJA 4BZ1A 1T1YB 1IM3D 5C0IB 4HD5A 4JJ5A 4PRAB 1W8EA 2OP4H 3KVPA 4H25B 1F2QA 1XZWA 2GJ6E 4WGWB 3BH8A 4XMKL 1N26A 3CXDH 3H0TA 5CP7B 3L5WA 2VLKA 5EO0B 1I4FA 4H2CA 3UBXA 1A5FH 3N1GC 2IADA 4GI9A 4I1PA 1F3RB 4A7VA 3S98A 2E7LC 3L7FB 3BGMA 1NMAH 2X12A 5DHMC 2JLPA 4O4YL 5F1IA 4N2IA 4XWOD 1EPFA 2E46A 4JKWA 4PJCB 1N68A 2EZ0C 4TTDC 5LKNA 1XR9A 4L4TD 3WD5L 2HKFH 4N2GA 1Q9WA 3IBOA 4HS8H 3A3YB 4AT6B 3SKOB 1PTZA 1MH5A 4N0CD 3FBQA 3M17A 1PEWA 4MQTB 2YJQA 1YNKH 4KBPA 1FP5A 1G6RL 3QO0B 1AHWA 3RJOA 1MCWW 4NM4L 4NUJB 3T04D 5C70A 1EMTH 3MRKB 2HTKD 5CZRA 1X5KA 4LVNC 4AY0A 5E8DL 2F1EA 2ADIB 3UXFA 3CLEL 2O5YH 3DGGB 2F68X 3ARWA 1BWWA 4JFTA 4W9EC 5GZNA 4MXQC 3KBHE 5C0BE 3MROB 1ID2A 3NCWA 4RA0C 4WV1A 3WCYA 1MI5E 2DMCA 2EICA 1UD6A 2YD3A 3FO1B 1EZVX 3VG0L 3NJVA 4F5CA 2GTWB 3WFZA 25C8L 1KGUA 5KYXA 4Y4KC 4L3CA 4YDNA 3T1FA 2EIBA 4YHML 1A6WL 1FIGL 3LN5B 3G5VA 1OAKL 4N8VB 1P5VB 2G0LA 1SHWA 3QQ3A 2R7EA 5DCCA 1Q8MA 2EKJA 5DMKA 5SWZB 1LE9B 1ZSDB 2J3SA 2Z34A 4LIQL 4YDJB 3RUGB 1XXFC 3BZDA 3K80A 5D2LE 3ULUL 5I6NA 3AABA 3BCFA 4HXBL 2VRQA 1VGKA 1UH4A 1AXSA 1H8SA 2XQBH 2V17L 3V4LA 5E6ZA 2MRYA 3QJXA 1F3JA 1KBWA 2AERT 4F8QA 4NP4H 2VYRE 4PRHD 4DUXA 3VFRB 4G5AA 1C5DB 3PQYB 4UNIA 2PYEE 5GSRB 1Q9OB 3MA7A 3ECVA 5AAWC 2FO4B 1A4JA 3VI3A 2C7UB 3LKRB 5D7LA 1OGAD 2IGTA 1GYAA 3K81A 4X6EA 4ZFFA 3FZUC 4LVHB 5GS0D 4NKMB 1UQSA 5F9JA 4F2FA 3OMNB 4EDXA 1J0HA 4KK5C 2J5WA 1ZGLB 4C59B 4JE4B 1E3FA 3RZCB 3TO4A 2QQNL 3EBHA 4NYLA 2C3GA 4ZO7A 4I0CC 2DM2A 5E99H 1MFBH 1S5HA 2Q86A 4GO6B 4J3VA 1IGIH 2NY1B 2VDLH 4FQ2L 4K71B 4GKZB 2Y6SD 3CHXA 1QX1A 4AIXA 5DZVA 3UAJA 8CGTA 1XR8B 1EBAA 2CR6A 4TVPH 4BEIA 5EIIB 3W39B 3WIIH 4E9LA 3CSYA 3HJ0A 1HYRC 1UXWB 2IAMB 1TQCC 2CE6A 2WXRA 1G5GA 4MMYA 1OZUA 5D70L 5I5MA 4LOFA 4WZ9A 2WJ7A 1MHHB 5F7FA 2OSYA 4PRPB 3VJ6B 2IG2H 3T9WA 4A6YH 3NFPA 3SDDD 3U4BL 3UTPE 1BIHA 4ICXA 3CJJA 1C1EL 1XEDA 1G7IB 1R3JA 3ZTDC 3NTCH 1J05A 2XA8L 2PW2A 3ZUCA 1AS7A 3M8OH 1NMBL 4PB9L 3VMPA 4KJQD 3DETC 5TQ2H 4HUWA 3UDWC 1SF3A 4A2GA 1X9LA 2AKRA 3AREC 5IM7B 1HAUA 3L3GA 4NN6C 3GXMA 4M1CC 5M95B 5A16A 5K5YA 3UC2A 4OTXL 5E94A 3H6JA 2GJ6A 3MBEC 4ZS6C 4O2CB 1XGPB 2CO2A 3S8FB 5FA4A 2C3VA 4PAZA 1OP9A 1XIWD 5CEZE 4HHAB 3TEYA 1LK3H 1JK8A 4Y4HB 3B7YA 4FHKA 2ZCLH 3KS0J 4AVKA 3CSBA 2EDKA 4RETB 1FL6B 4ZFQA 2RGSA 1YG9A 1G1YA 4WLCA 1DQTA 1FYTE 5EZJA 3MNWB 2D4DA 3UPRB 4KDWA 1INDH 2Q10A 3GTVA 4GAFB 5JIHA 3BZ4A 2JJSC 1F4HA 4I4WB 3WE6B 4AKOA 3JWNG 4WIQA 2AK4E 1NDMA 2B59A 3GSQA 3U0PB 5F9DC 3GZPA 3UYPB 3HG1B 4XP4L 4O58H 3U1QA 5HDQL 2A77H 2J55A 3VA2C 2X41A 4A2DA 4NAMA 4F9LA 2YGPA 4J2XA 4HP5A 1JHLL 3L1OL 5J6GA 5IOPA 3UYOD 2V5RA 4ALAH 1JDDA 2Z8SA 4Z0BH 1RZJL 3O2DA 5I30H 3L3DB 4ZQKA 4HK3J 1QATA 4U05A 1A02N 1SY6L 4GBXD 4HS3A 5CUSL 5CCJA 1L9QA 1YEWA 1HVXA 1BJ8A 1VCBC 2I5YH 5BZZA 4HWBL 3RRQA 1B0IA 2ZOLB 5ERWB 2XYBA 5D71H 1JBJA 4F8PA 3IJHB 1UZ8A 5BOJA 3OF6A 1G9ML 3S2CA 1WT5A 5ABAA 4HPYL 5F3FA 1RSFA 3EJTA 4YN3A 4LQFL 3MFFB 1HZKA 3BH9A 4DK5A 4UTAL 2F58L 4RMTA 3NZ8B 4JO8A 4LLDB 1OW0C 4MVBD 4JHBA 2XJKA 2I07B 4RMBA 3VI4B 5F88B 1A4CA 4P59L 4H26A 4JRFA 4F91B 2YPKA 3RTQB 4AYFB 1EUTA 5E4EC 1BVNT 4FFZH 1R0AL 4JHUA 1RZ7H 3RURA 4ACPA 3C08H 1CGWA 2XKNA 4LXFA 2YXMA 2VT0A 5FGBA 2PYEA 4ZOEA 5K1NA 4EZJA 2W1NA 3HS0B 4P3WA 4YR6A 2GHWB 4Q0XH 4Z8FL 1E2VA 2EIMB 1MHPL 5C6PB 1H8OA 4KHTH 3RWFB 3BZEA 3P02A 2BXZA 2CMRH 1OCWL 4PGJA 4JPVL 1E4HA 4PWHA 1NGXA 4A2LA 1UACL 2DI8A 2XWJB 3RPBA 3KR3L 2Z4QA 1HXYA 4QJ5B 1ZHBA 4KVPA 1MCNA 5GS1A 3T65B 3ME0A 5SWSA 1G7LA 5IT2L 1HT6A 2UVFA 2ZUYA 5H35A 2D73A 5E5LA 4F7MA 1FA4A 5F89A 3U48A 4KZDL 3SDYL 2CO4A 1ZRUA 1Z9SB 1UEMA 4FULA 2VERA 2CLZB 4XNZC 2HA1A 1X4XA 4LARL 4JFED 1N0LB 1F97A 1HL9A 3BFQG 4XP5H 2XQYG 2ZD0A 4B7IA 5E1IA 3IJYB 1UENA 1ACZA 1WIUA 5GS2D 4UIMB 1DZ0A 1YEIH 5KOMC 3S5YA 3X17A 3D0LB 4E5XG 3ZZLA 3ASWA 3T0DA 1FBIL 4HXAH 1RZGA 4BUHA 3B7UX 1G87A 1KYOK 3L3KB 4KX8A 1NBYA 2W8CA 3CX5K 1LWHA 1TU2A 2C1OB 2YD4A 3TEWA 2DJSA 3AXLA 3SDAD 4LKXA 1KIRA 3IXTB 1T0NA 1U8OB 5IEHA 3K4AA 2WLIB 1E27A 2IFFH 1M53A 5ACMA 3K6SA 2A9NL 5TF0A 3RIAF 4LIQE 3D39B 3X13A 1AGCB 3ULUE 2EKSA 4JZJA 3F7YB 4S1DC 3WAJA 1AC0A 3QNFA 2R1XA 5GRWA 4ZUUA 2R23B 1TYEB 1GOGA 3G6DL 4P4KB 1I7UA 4WFGE 5EWIL 4PUBL 5DJCA 3FB6B 3BUYB 4W6YB 1G4MA 3MLTA 5CD3A 3ALPA 5TFSL 2XTJE 3PHQB 3QRGL 4N2DA 4G7VL 1PFCA 4W1TA 2D0GA 4XGZA 2AMGA 1BD2A 1OLZA 2W60A 4FLRA 4N2OA 2VN6A 3VU2A 4G80B 4IHBA 4M61A 3MUJA 4NQCA 2VL5A 3TA3B 5IF0A 3RVTC 1N3NA 3BN3B 4Y5VA 4AENA 4OUUA 4YE4H 2XOTA 4R26H 2AXHA 3C6SB 1KB9J 1TNMA 4LHQB 4YHKL 2P26A 5CMAA 5D1ZA 5CF3A 2LGNA 2RAMA 4A2FA 3HR5A 2ARJQ 5DZOA 3B37A 4JHWH 2BFVH 4RISH 3SYQA 2Y7MA 3RWCA 3GMMA 4ELMB 2EO7A 2VLLA 1E67A 4JM2C 4LL1A 4UU9A 4C83B 4Z7NB 1MFCL 3L1GA 5I23A 1PGRB 1HWGB 1PZ2A 1QFHA 5JOPE 2D9QB 4B96A 1Y07A 2F53D 2NY1C 4K71C 1X5GA 1MCSA 3A67L 4PY8I 2F0CA 1H3UA 1DQMH 1E0OB 2GTZA 3O2WL 5HJDA 3IDYB 5C0EA 1JWMA 2Q7AA 4UQAA 2OW7A 4GXUN 3DHMA 5I1KL 3WNLA 5T3ZL 3BO8A 5DS2A 3I3EA 1ET7A 1PD6A 1XAUA 1BZ9A 1EZVY 5HI4C 3X3FL 1CFBA 5IFAL 1GSKA 4L48A 3QIWD 1E3ZA 3V0VB 1UB6A 5LG6A 3MAWA 4O02A 3KPRE 2NY0D 1IM3A 4GXFA 4K3EL 2HZHA 3DXAD 4JJ5B 4PJDA 3P54A 3B1TA 1OOWA 3KEDA 4ES9A 2VRKA 4PS8A 1N70A 4G6FB 3H0TB 3L5WB 1ZS8B 4AMXA 4KROB 3HCVA 1L6ZA 1I4FB 2VUOA 2OMZA 3PXJA 3UBXB 2CRIA 2IADB 4MBRA 1ZLUK 1GY1A 4JPIA 4AK1A 5ABDE 4E9QA 3OAYK 1BIIA 1YEKH 5E2TL 3QUMH 5F1IB 3S7GA 3P77A 4LKCB 5DRXB 1A3RH 3FFOA 1FZMA 5HYFA 1XR9B 4PV8A 1BJ1J 1FE8H 4WUUE 3OR7B 4KZ0A 3RKDD 4XNAA 1QSED 5HGAA 3GSXA 2FX8H 4MZIA 4TNEA 3LEYL 4Y4HC 4U6VH 1HNGA 2X53A 5TE7H 1GYVA 4K5MA 3DOHA 4WFHD 3ZT7A 4U2YA 4DP9X 2BRRH 2VM4A 2I85A 4CMHB 3A5VA 3SKMA 4WNQA 5CJQL 4CW1B 5JPNA 4CA4A 4S0HA 4WQOA 4B9IA 1X4ZA 4CBPA 1BZ7A 4WV1B 1IGJA 4OZHA 2N7BA 4NC1E 5C7XL 3ARBD 3TJEL 4HAFA 2FX7H 1M57B 1T5XA 2YMXL 5KYXB 2A0LC 4IKJA 4L3CB 4AQ1A 4NHUA 1HEJC 3T1FB 1VKXA 3G5VB 2HN7A 3QQ3B 4S0TD 1IARB 1CTOA 2R7EB 1F42A 2G75A 1TJMA 3EBIA 5D1XE 2BINA 4IDJH 4Q4IA 1V3MA 1CTNA 1OAZH 3GJFK 5LO7A 4U1SB 5DK3A 2VXTL 3N0PB 4NS0A 3CQPA 1JGEA 5EORH 3U9WA 1AXSB 8FABA 2PP8A 2JELH 3F7KA 2AQRA 5CU5A 3VD2A 1D7CA 3KLLA 3MLRL 2VDPL 4BKLB 4K2UL 5E2VH 4PRHA 2ICES 3EHBB 2ZOKA 2IVFC 2MIZA 3SYAA 2V4LA 4WWOA 1AKJB 1ZLDA 3MA7B 4D7BA 5JPMA 2DQIL 4I8DA 1N4XH 1JZFA 2K6ZA 1A4JB 3VI3B 5D7LB 1OGAA 4AG4H 4M4PA 4O4YH 5D1QE 1E7UA 4ZFFB 3WTYA 2Z35B 1HCVA 4AE0A 1AQHA 5AYUH 1UQSB 3VFTA 3WD5H 5F9JB 3VD9A 4KK8C 1JI1A 1XGTA 2ORBL 2P43B 1U36A 1CYGA 3JV5A 3Q13A 2FUTA 3SDCD 3NPSB 4NYLB 3HS0C 1E5CA 1S5HB 2Q8AL 2X09A 3UO8B 5CJ5A 2VDRH 3P11L 2OPCA 3EYSH 2YBRA 5F0MB 3AG3B 1YLBB 2NY3C 4I18B 4NM4H 5F3BB 3A6BL 4KUZH 1CFSA 1I1AD 4K7PL 1P5UA 3PP4H 4S1RL 3CSYB 1RU9H 3EG9B 3CLEH 2R1WA 4J3OF 4OLEA 4MMYB 4Y19D 4MXVE 4RRPA 1UWEL 1PKQA 3E6FB 4ZFGH 3RFRA 5HHNA 1BCIA 2FSEA 3SDDA 1CWVA 1YUKB 4JFHE 1KNOA 4L8SC 3VXQA 3VFMA 4NP9A 4UB0L 4NGHL 1AQDB 4CSTA 3VGBA 5JTWA 1J05B 1OAKH 1U58B 1MJ8H 2FH6A 3Q8BA 4HGWA 2FJSA 1Z3GL 4BQBA 4XXWA 4HUWB 2OR9H 3ZDXF 3NK4A 2F5AL 3AXIA 1GOHA 3L3GB 5K1JA 4MJ5A 5HI3D 3ZHDA 3ULUH 3LRSA 4Z18A 3JWDC 5A16B 5E94B 2D3VA 5LBSH 1KGXA 3KVQA 5C0FA 1Z9MA 2AXWA 5FA4B 2VAJA 1XIWA 2Q7YA 4NOFA 1JK8B 1MWAL 1P7KA 1DDHB 2DI9A 2FQEA 4K5LA 5DZAA 3S88L 3ISRA 3TCLB 2Q2EB 4LBEA 2HT2C 3LXUX 4YL4A 5EZJB 1JD9A 4A2HA 4KGJA 5FCUL 4TLSA 3NGBC 5HHOD 1O0VA 2D9CA 1OPOA 1WZAA 1RLWA 3CFEA 2I7OA 2J1XA 3BZ4B 5ESQB 2B20A 4QTHA 2HB0A 1O7VA 1KXQE 2B59B 2DKSA 4GNKB 5DJ0A 3CDZA 4XP9L 1GA2A 1R3IL 2PO6C 2ROXA 1GVIA 2QQNH 3S3CB 1TLMA 2H8PA 1VHPA 3T3MF 1CE1L 1OPGH 4FQ2H 5E9DB 5J6GB 5IOPB 5H37A 4ZQKB 4OI9A 5IQ7L 4RFOL 3GS4A 4N2LA 2FQGA 2VITA 4GBXA 5CJXC 3IGFA 2V3FA 5KJRL 4MAYB 1JPFA 4TS6A 5I6LA 3A47A 4U3XA 3EIFA 1QBAA 2VOTA 4B5EA 3FBKA 1F1GA 2JSFA 5J0BA 5KSVA 4UTBL 5HHVL 5BOZG 3QIBD 4G8IA 2NY7H 1C1EH 5FYLD 4HOWA 5JYLA 1SYSB 3EOYG 3B2PA 1FNHA 3BH9B 2XA8H 3RL1A 5DEFA 1SOSA 4E41B 3CZSA 5HYSA 1HC1A 2ZP9A 1SFDA 2JMRA 3EYQD 4HDIA 4JANA 4ZDHA 4G1EA 3FAWA 4AV4A 1TCRB 1WCBA 1ZHNB 4QKXB 2QLYA 2J5LB 1II4E 1VERA 4NC2B 4OTXH 1YJDL 3V4VL 1V7ML 5T3ZE 3LV3A 1FVDA 4JO1L 2DQTL 8PAZA 4FG2A 1DVZA 2DQMA 2YAPA 5GGUB 2R29L 1BZQK 4ZFOB 4P48A 4MWFA 2A2QT 4GP5B 4YR6B 2PW1A 1KCRH 4YIQA 4OLUH 3T2OA 5IBLD 1YUHA 2ODIA 1S8DA 1H9VA 1NL0H 2OMTB 4UBDC 3U4KA 3OPZL 5F7EL 1ID5I 1WO2A 3WS3A 1NGXB 4TXVB 3DIDA 4PSRA 4IK6A 1OCOB 2C9VA 4NOBA 3WYRA 2WLKA 2VXUH 3FFCE 4L1SA 5ISZD 1ZHBB 3MUGA 5GS1B 4PJCE 3ME0B 2D3NA 5SWSB 1G7LB 5HDQH 3ETBJ 4JQIA 4KROC 5H35B 3DX2A 4F7MB 5F89B 4QPEA 4YQXL 1MVUA 2CRMA 4I85A 3L1OH 4OFKA 4WI0A 4TSCH 2BOLA 1T7YA 3AU1A 1F0LA 4KTYA 4MGXA 2VKXA 3FTVA 3VCLA 1HILB 2WKOF 4JFEA 1KXHA 5CGYD 1GZHC 4PQXA 2HX9A 4KO6A 1IC5H 2K1MA 1JHTB 4GRWB 5CUSH 5EIQA 3U2JA 3W37A 4JN1L 4B9FA 1PU0A 4HWBH 2JKJA 5AVXB 3ZUNC 1OL0A 4FQIL 4G7SB 5JHLA 1RZGB 4JRYE 1AHWC 4HPYH 1NBYB 2Y7NA 2HUHA 2W0PA 5E1AB 4G6ML 4CMHC 3KWXA 4UTAH 1CJYA 3AXLB 3RX5A 3V5DA 3SDAA 4LKXB 4XO8A 4ZMOA 5J5EA 4F24A 2KLSA 5GZNC 2YS4A 1CFNA 1KCSH 3QSKB 1E27B 2JH2A 1I8UA 4P59H 4RFNC 4WV1C 3K6SB 2I26N 1F4AA 3VUAA 2HH0L 3RDTD 3RUGE 1UH3A 5DUBB 3BKCL 1HHJA 4MXWL 4UV7H 1SF5A 4POZC 2ZKHH 3G08A 4PJXF 4APXA 4DP5X 1IJNA 3KHOA 4JZJB 1XCQB 1PW3A 5FYJL 4ZYKA 2ZOOA 3O11B 4GSXA 1H6FA 2WBKA 2R1XB 5HHMD 4XT1C 4DP6X 4ZUUB 4Z8FH 4B6ZA 1I7UB 1R3HA 2QGEA 3APFA 2WN3A 4EI5D 3MLTB 5CD3B 4XMTA 1U8QA 4JPVH 1L3WA 4PVMA 4OJCA 3TBWA 4XGZB 1S9WA 1BD2B 1F02I 1UACH 2NR6D 3Q3GA 4RFEB 5DVOA 4F7EA 4Q97A 2WTOA 5JIMA 2VB5A 2FATL 4M61B 4NQCB 3EHBC 3B8SA 2VL5B 4BFKA 5IF0B 4QIRA 4UQEA 5D4HA 4GW4A 1NEZA 1N3NB 3TOPA 4AENB 4DGIL 4OUUB 1LE5B 5IUSA 3G5ZA 4KZDH 3D18A 4W9IC 1KULA 3KNBA 3Q5TA 4OJDH 5D1ZB 3CX2A 2HTLD 4JEGB 3DO3A 3HR5B 4U7SA 5JYMA 4X6BA 5I1GL 3HE6D 3NZUA 2N56A 1JF1B 3ILQC 3GMMB 2Y6TE 5IMKA 1WFUA 3MRHA 2ZE0A 4PCTA 1ETJA 1CDUA 2VLLB 3IF1A 4UU9B 2VH5H 3MLVL 3TO4C 3NPSC 3TN0A 3UJJL 1SXNA 4HAGA 1WCQA 3F8UB 1GIGH 2BWQA 2F53A 1FBIH 3NA4A 1TQTA 3OKDB 1NCBL 4C58B 2GTZB 5DUPL 3UAJC 1IC4L 1A1MA 4M93C 1BMZA 5ADPH 2ZAGA 4KOCA 5ALBL 2BY2A 5A43C 2GIMA 3OWRA 1BHGA 2HJFB 4P2AA 3BO8B 4HEPA 5DHEA 1YVLA 1E7VA 2VMJA 3BQUB 4BWTA 3ZN6A 1GGBL 1BZ9B 5DFVD 4RA3A 1MJ7L 3QIWA 1UB6B 2K70A 2H2PD 1LQBC 1IM3B 3QEQD 3ARVA 3I9PA 3QZWG 3DXAA 4UT9H 4F7TA 1JYVA 5FCSH 4PJDB 3X2QB 1JZ8A 5EV7A 2AZAA 3FO9A 3O41A 5T1LA 2LU7A 2F61A 2HKHH 1PCSA 2ZOUA 3QQDA 1QWHA 4TKWA 4TQ8A 4U1KA 4AWJC 4KTDL 1KCVL 1NCAL 3HCVB 1Q72H 4G71B 2OMZB 1UFGA 4NC0B 1K5WA 3G6DH 4JPIB 4MJID 3P9LA 1JWSA 1FNFA 1BIIB 1KENH 5EOCJ 4Q9RL 1PG7X 1WICA 4OM1L 1J0ZA 1HH9A 1EAQA 3P77B 3N3EA 2AK1L 2ICWB 5IVXB 5HGDA 1FZMB 3CFIC 1IVLA 4L4TB 3OTTA 4PV8B 4ZTPL 2W9DL 3PWJB 2VR7A 1QSEA 3KPMA 4FD0A 5HGAB 5I2IB 5TPWL 3BSGA 4WAFA 1AXIB 2NNRA 1IQWL 2Z65C 1QPKA 3OJ2C 5I16A 3FHAA 4LSUL 3UTSD 4MZRA 2A6JA 2LQRA 4X6DB 5CLZA 3MI6A 2Z92A 2WM0A 2H26A 4YHKH 3SKMB 2ZXCA 4H1LB 4K3DH 4MD0A 4EXPX 4WNQB 3FT3A 4BUQA 5JPNB 5GIRA 3VO0A 4GO9A 3WKML 2YHGA 4KX7A 1BZ7B 2F7PA 4EBQL 1XT5A 4U1NA 1ROCA 4M48L 3P4OA 1AG0A 4LRNL 4OZHB 1MAJA 2FNBA 2CLRA 4JRYA 3P2TA 3LZFL 4YFLF 4WW1B 4F9LC 3ARBA 1AI1H 2A6KA 1T5XB 3LSOA 4MJ6B 4EDWH 4AQ1B 3FHQA 4LE8A 4AVIA 2FQDA 4MASA 4Z77A 4OKVB 2HN7B 2G75B 1CFTA 3ARGD 5JMRA 3S8WA 1J48A 5T3ZH 4XB7A 1QFWL 4M4RA 4PJBF 4R97B 5HHXL 3TF7C 3F64A 1KTKE 1X5AA 1JGEB 4LOUC 3PE9A 3TLRA 4K3EH 4XVOA 1QLEL 1WT5C 3AMKA 5E23A 1CPUA 3W82A 1KIQA 1P4IH 1SHSA 1DDTA 2QL1A 4PRHB 4WWID 2LVEA 3ZPDA 4DEPC 5C6WH 4B27A 3ZE0F 3D34A 3PIQA 5K33A 5JPMB 2M26A 1DO6A 2E4TA 4FQJH 2PPFA 2GCYA 1ZHLB 5EZLB 5SV3A 1XZ0A 1OGAB 5D7IE 4GAAA 5B1JC 3QEGH 3O45A 3Q6FA 2NXZC 1JZ3A 4HJGA 5T1KA 2Q6WA 1IBYA 1JF5A 1XGTB 2E9BA 2V2TB 3SDCA 5BZDB 3LEYH 3L13A 1BX2A 4NQDD 3UAEA 3CHQA 3HI1A 3K2KA 2YBRB 3EOAB 5AFAA 3T77A 1M71A 5CZXD 1CFSB 1I1AA 3IPEA 1P5UB 2OZNA 2LAGB 3B9KD 5FKPA 5CJQH 1KZQA 2R1WB 2EYSA 3IJ8A 4Y19A 2W80C 3GM8A 2LVCA 2CR0A 1PKQB 2K78A 3EH5B 1FNGA 1YYML 2UY6A 4JO3L 4MA7L 4R6UA 4XHJC 3GI9H 2G2RB 5HHNB 2FSEB 3NJHA 3SDDB 5C7XH 4CU7A 1KG0B 3TJEH 1GS6X 1KNOB 5I1JL 5I76A 5ILTH 3VXQB 3VFMB 4F37K 2JQMA 3ZO9A 2VN4A 1UADC 4P5KA 1W91A 3BW9A 4AEHH 4N1EA 2VLRE 4TUKH 1U3HB 3GINA 1O9VA 1Q1JH 3B2MA 4FDWA 4WI3A 4PG9A 4HBCH 1JP5A 2FR4A 5AVYB 1RJCA 3BP6A 3RB7A 1U8MA 2MNJB 3OMAB 1OP5H 3I2CH 2VXTH 3LRSB 1CI3M 4J2QA 4FHJA 9PCYA 4BE6A 5M94B 1EBPA 1N0XH 1TTFA 1IAMA 3WTSA 1RZKH 5C0FB 3D1MC 3QJFA 3QHTC 1XIWB 4K2UH 2B3RA 2Q7YB 1IKNA 4QKTA 1KJVA 2WOYA 4FABH 4R7VA 4AM0Q 4K7FB 4LBEB 1MIEL 5FYJE 4ONHA 5HHOA 2O6PA 4A38A 1PG7W 1JZJA 3VTMA 1M7DA 2DTSA 3F65A 3TIDA 3KYNA 3KXFD 4UF7C 2QPEB 2LU5A 2X3AA 2Y7QA 4MMZA 5GGSA 4AITA 1PLGL 2O93L 2IQAA 2VXSL 4X4ZA 5KBKA 4Z7UA 2H8PB 2IWGA 3P11H 3JSSA 4QTIL 5ENWA 2H0JA 4PGDA 1M2VA 2BDNL 1JZ7A 2XIBA 4A55A 4L5FH 4K7PH 3QAQA 4GQQA 4S1RH 2VITB 4GBXB 3IFOA 4QGYA 3C8DA 2ZPKL 1FDLL 3QQ4B 4PJFF 1AZUA 5AKRA 1UWEH 3BD4A 3H42L 1MRDH 4IIQB 4I3RL 4TQEL 3QDGD 1RZ8A 1SJMA 1E4WL 4Y5VC 3G3LA 4ABVA 4ELME 3IETA 2H0EA 3QIBA 4KY2A 5KSVB 2GBAA 1TEFA 4IS6A 1E4JA 1LHZA 3F84A 2P24B 4JKPH 3LN4A 4UB0H 2JCCF 4WY7L 1A22B 3GIZL 3RL1B 1M1SA 4X83A 4KTEL 2UZIL 3X1FA 4JFDE 1PY9A 4HDIB 1BQUA 3QUZC 4W4OA 1HEHC 5ESVA 4ZDHB 2F5AH 3ZHNA 1LMKA 3KD4A 4G1EB 4WTWA 1WCBB 4WFFD 4F92B 1JWUA 1QVOA 2HRHA 3C5JA 3SODB 2P44B 1S7VA 1BMWA 2FEJA 3MUUA 3A4EA 3LV3B 1FVDB 1URZA 1NDTA 1JPST 3QNYB 4ZFOL 4YHIA 3FW6A 4V1DD 3DMMD 4JJHA 4MWFB 1QZNA 4WTQA 1KB5L 3MUY1 3ML8A 1YUHB 2W92A 4PS3A 4W93A 3NJIA 5DRZA 3WS3B 1I8MA 1BMGA 3WU1A 3F85A 2BIHA 3KPTA 1BA9A 4PVBA 4DN3H 3EFOA 5ISZA 3MUGB 4D2NA 1OTUC 5FC9A 5EU3A 1KYDA 4JMNA 5CZVH 43C9A 4QAMB 4WU7A 2Z6FA 5C6TL 1ZXKA 2RCSL 1KEML 5AG8A 4RBPK 1BBDH 2LE9A 3OAWA 1MVUB 5D5ME 2P49B 4F20A 4WI0B 3CHSA 3OLDA 2WINA 4JFOA 3AUVA 1P6FA 3VCLB 2OK0H 4BH8A 1B6DA 4XWOC 3GMOA 1U41A 1CLZL 3D33A 4JFEB 1WA2X 3FSWA 4HFUH 3U0TB 3CSGA 1G7HA 4LLYA 5IHHA 2AF2A 4QRTA 5KJRH 2AI0L 4GQRA 5HBBA 4ZRGA 4JKKA 1TETL 4UV4H 5HHVH 5E2WL 4K9EL 2LLNA 1FC2D 2AJZA 2VLRA 3GSNA 3MO1B 2ADYA 1QZ1A 1D5MB 4WTXA 3V5DB 3SDAB 5JPNC 5AW8B 2X05A 1MHEA 2OTUA 3BYTA 2WWMD 4F1ZA 1CFNB 5F97E 1WFNA 5H2BA 2J25A 4LFHG 2PWGA 4RGND 3K8MA 1I1YA 3TNMA 1YJDH 1HHJB 2EC9T 4APXB 4OF8A 2W94A 4JO1H 3VVWA 1WPCA 4XO5A 1ZLSH 4GQPH 5HPOA 2R29H 4ZYKB 1YY9C 4GT7A 1QWUA 1CXFA 1L6PA 1XTMA 4FQ1H 1P2CA 3DTXB 5E8NB 1R3HB 2XVGA 2DWEA 4EI5A 3GMQA 3X1EA 3OPZH 1U8QB 1UASA 1MUJA 3TBWB 3C5ZD 2NR6A 4F7EB 1AO7E 3Q3GB 4V2BA 3MJWA 4Y4FD 2XV0A 3BXNA 3EJYD 4N6RB 4LSDA 3Q8AA 2X4SA 3VXMD 4WI2A 1NEZB 3DDFA 1J0YA 5JPMC 4YQXH 5LXGH 1BYNA 4H0HB 4R9HA 2XTJC 5TE6H 1YNLL 5E5MA 3BT2L 5BVPL 4M3KB 3CTTA 1Z5LA 1D5IH 4QRQA 4X6BB 3GJEB 5GS0C 1UWXK 3HE6A 1FFRA 5IMKB 3MRHB 4RWYL 5F7UA 1RZFH 4JN1H 1Z5YD 1RIUL 3JWDH 3V9EA 2Y0SA 4LDEB 4N2FA 2KZ1B 4IBVA 3GZKA 2F53B 1QACA 2W9EH 4YNYA 5I0VA 5BS0D 3CIAA 2C7FA 2Y6SC 3GTTA 4QO1A 1M6OA 1NH6A 2R2HB 3FSAA 4PH8A 4G6MH 3GLZA 4KK6D 1P5UC 1UWGL 3N40F 3WIFA 4Y2NA 4BIKA 1CXEA 3PWPD 2XWZA 3Q48A 3WNIA 1V8HA 4N8VG 1Y18A 3CNKA 1PD0A 4Z7WF 3QIWB 2YAFA 1Z9NA 1ZDQA 3SDDC 5HJ3A 2VDKB 3QEQA 1P1ZB 1XMEB 4FP8H 2VAAB 4PJGF 3EDJA 3G9AB 4DO6A 4OCYL 4ORGA 5C71A 3FO9B 1RERA 3O41B 5G4OA 3GIVA 3QQDB 2AEIT 2IALA 4U1KB 5IHUH 3IDMA 3VWKD 1WA0X 1BQHB 4XXWC 3O2VH 4I87A 2D31A 4EI6A 4L18A 4MJIA 3I6GA 2VXQA 1P4BL 1YAZA 1BF8A 3ESMA 5L0QB 1SEQL 2Y9RT 4XN9A 2F9BT 5HGDB 4P9MH 1N5YL 3EGSA 5FYKE 2RD0A 32C2B 3NESA 4D9QD 2MQ3A 3ZOAA 1HI6B 1QSEB 1XIWC 2ZKWA 1RPQA 3AB0B 3KPMB 3GFUA 4PJXE 4K73A 5CN2A 3UO1H 4Z76A 5C1MB 1CXHA 1SQMA 3E38A 4NWTL 5D4JA 5I16B 3P4NB 3UTSA 5BV7B 3RYMA 2DMHA 4X6CF 5CAYB 4RMRA 4EIGB 1D7DA 3PCYA 3QT2A 2H26B 4H8WL 1JMZA 4HJ0D 5J8OA 3SY6A 3FT3B 2GHZA 3TBCA 3VGAC 5CSZA 5GIRB 3UG5A 1UD5A 2CKNA 4MJJA 5E9DE 1T3FA 4X5WA 3NCJH 1XQ4A 3BVXA 2HX7A 2L7QA 4U1NB 2WHVA 3P4OB 1ZT7A 1GGCL 4E9VA 2CLRB 1S3KL 3MODH 4UTCA 2E7CA 3ARBB 2A6KB 1QW9A 4AIOA 4HJIA 4GG6B 2ATPA 1TJIH 2Y7LA 1X4YA 4EUPA 1OM9A 1ZSHA 3VFWA 2C9RA 1RZJC 1ZA6A 3ARGA 4TULL 2CJUL 2EE6A 2WOBA 3QXDA 1WAAF 2UY7B 1DJHA 4GKLA 1WD8A 5B38A 4ABUA 5EUKB 4PU2A 1MJ7H 4ABQA 2XSKA 1QR4A 1MREH 4PHXA 3WOVA 1CF1A 3AMLA 3I9GL 2MCG1 4KI5F 1W8NA 4JLRA 3ULVL 1P84J 2YEZA 3ZZQA 1S7RA 3FB8A 3PIQB 3MOBH 3FQYA 2VDNB 4HBQA 1C08B 2FYYA 2GCYB 4OD1L 4G6JH 4NJ9L 3RFZC 1DR9A 2ZAHA 3GM0A 3LJ3A 3BHBB 4Q9RH 1BGXL 5LQBL 1AO7A 1XF3A 3Q6FB 1CICA 2C4FT 4BK8A 5L8KB 1NGWB 2EUXA 2W91A 4ODVH 2A4CA 3WY2A 3SDCB 1WFJA 2HVBA 4G70B 1BX2B 2GSMB 1DJSA 2DLTA 1COBA 2VNCA 2VMFA 3H53A 3OR6B 4KRPD 4LSUH 3MPCA 5A2LH 5IKCA 4MB1A 3VB8A 4JGUA 2E47A 1M71B 1MFVA 4GB9A 4PLKD 4Z78A 2IOMA 1ML0A 3QNZA 3B9KA 5FKPB 1MFMA 4ZUWA 1PSKH 3DRTA 4N2BA 5DK0B 1MRCL 2EYSB 3WKMH 2WK2A 4NWUL 4Y19B 5BOPA 2Z93A 3U36A 3N40P 4AQ8A 1FNGB 1FVEB 2UY6B 4LRNH 3B9EA 3LQAL 1DUZA 4HPOL 5DRNA 4BK4A 4KKBD 1G9NC 3EOTL 5K9OA 3SN6N 1OK0A 5I76B 3OGOE 3UBGA 4V33A 3FJTA 4UQDA 2VZTA 3T2QA 2OS7A 4DK3A 4P5KB 2WKOA 3BW9B 1PY0A 5DWUL 4BZ2L 1X6LA 4PG9B 3UERA 5KEZA 2WD0A 4JFXA 2P45B 2Y1YA 4E42A 2FR4B 3ZHLA 3BP6B 3L5JA 3BD5A 5FK9A 1DBJH 1J8HB 4G6KH 4HK0A 4Z7VF 3EYVA 3QJFB 2OJZL 1SBSH 4FI8A 2V7HA 4DKTA 4KOBA 1EDHA 4JCMA 3QH3B 1KJVB 3AGWA 3L95B 3CHOA 1R75A 3HFFA 3GQFA 4XH2A 3QBTB 4CUCA 4ZSOA 1QRNB 4OJFL 5MI0B 4QGTA 1FH5L 1EGJA 2ESVD 2MOQA 2WXQA 3FCSA 2Y06L 4PJXA 5E2UL 1M7DB 2A7BA 3JT0A 4L3FA 2W88A 5DD6A 6FABH 5I8CA 1PEZA 3TIDB 1G0DA 3KXFA 2A74A 2QGCA 1BQRA 2NTSP 1TYJA 3O6KL 2IQAB 2X9ZA 1G43A 4JM4L 5JIIA 3UADA 4Z7UB 4UT6A 3ZE0E 1J9QA 4ZZKA 5HPMB 3FU9A 4HIJB 3SKJL 3NJXA 1G5AA 3E8UH 3AXHA 2X7LA 3LQZA 1PL3A 4NKOA 4Y9FA 4XN5A 3WUZA 3WY3A 2DQHH 4YSPA 2PXYD 2VC2B 3IFOB 1JZHA 4AXWA 4HG4K 6TAAA 3UZVA 1DEDA 1E4XL 1F2XK 3GXDA 3HPLA 1JGVL 3DX1A 1J5OL 5EU7C 5IJCC 1YYMH 3ECWA 4W6XB 4NNPH 4ATTA 5E6ID 1RZ8B 2CWRA 2CAKA 2OCFD 3IETB 1UJ3A 3QIBB 1UB5A 3GBMH 1E6OH 4BFEA 4IS6B 4PGBA 5AZUA 2DS4A 3JQOB 3V10A 1KPRA 3UACA 4X5XA 3WKNA 4PJAE 5J9PB 5DZPA 4JCWA 5ESVB 3ROLA 1E65A 1AQ8A 3OKNA 1JWUB 3VFOA 3H1ZA 1CD0A 3TN0C 3C5JB 2ZX9A 1IAIH 1S7VB 1T0PB 4IGBD 2E9GA 3L2MA 4R4ND 4DETA 2VR9A 3TX4A 3TPKA 4V1DA 3DMMA 1C5CH 2BIOA 3FN0H 3KMDA 3R18A 3V8CA 4ES8A 4YWGL 4LL4A 2X10A 3OKKB 3PXHA 5C2BH 3LH2L 4P5TA 2LU4A 3ABMB 4ZAKB 2H2SC 3QIWC 3ZTJH 3V9FA 2EDLA 1I8MB 4GXVL 2NY0C 1P7QD 4TQIA 4WENB 3GSRA 4YXKH 1KPUA 2WBJD 3EFOB 2JB6B 5ISZB 4F8NA 5DMGC 1B0RB 3LPWA 4B9CA 5EU3B 2R69A 43C9B 1QHQA 4WU7B 1Q9LA 3FQTA 3OZKA 4ANWA 1CDBA 1MCIA 3APNA 3EH4B 1JDCA 3B1UA 4QTIH 2FGZA 1A2YB 2X4RA 2WINB 4JFOB 2W07A 3WI9A 2BDNH 3GBNL 4PRDA 3DPBA 3O2DH 4QRPE 4BH8B 5L0QC 3GMOB 4M7LT 4LLVA 3UGXA 4NQXA 1V10A 4X6DE 2EVFA 2GTQA 3BN9D 1G7HB 4PP2A 2ZPKH 1FDLH 3HB3D 4IOFC 3VB9A 1G1CA 3H42H 3NDYE 4I3RH 4TQEH 3ZMNA 1GC1L 1EZSA 2WVUA 1IVTA 3GSNB 4WFED 4X7DC 5AAMA 4JRXD 3LS4H 1BZEA 2VUKA 3QAZB 1I1RA 4F1SA 2UZIH 3FB7A 1MHEB 2OTUB 3V7MA 4Z0XA 4R7LA 5TJWK 3EZJB 3QJRB 4FZEH 5CNHA 2CKBB 1I53A 4AIZB 1CG9A 4PJFE 2EDNA 3RDTB 3K6OA 2VGLM 4F7KA 3NP3A 3ARBC 3TNMB 3QDMD 2VO8A 4HCIA 4PBDA 3D51A 3NACH 4KU1A 1AGBB 2EDRA 4Q2ZB 2QQKL 2E75C 3BCDA 4ERSL 3QB7C 2IH9A 4M3JA 5IFJA 3T8MA 3TBYA 4LEXH 3ESPA 1DANU 2R59A 4LGSB 1SVZA 5HHMB 5KSUB 3ULVE 4PJBA 1P2CB 4CADB 5HGHB 3HKZA 2DWEB 3K74B 4EI5B 1NIEA 3D2TA 1L9RA 3UBXG 1X9QA 4CNIB 3C5ZA 4KI5D 1P6AB 2QTVA 2CXKA 1ZXQA 1CGXA 2XPZA 2VDOB 1BPLB 1IT9H 2EH8L 4Y4FA 1F3DJ 3OXSA 3IDJA 3RVUC 3QXAA 3WENA 2X4SB 3VXMA 5JIPA 2RCSH 4NDMA 1KEMH 2QSQA 5KYWA 1QBMH 2A9MH 5E24E 2B9AA 1X5HA 4S1QL 1N12A 4LQ1A 1NLDL 1ZMYA 3SPIA 1ZCRA 3MJ9L 1V7NH 3UBHA 2PWEA 3N1QC 4N8UA 4QRQB 4R96A 5D7HA 1TDQA 5ECGA 4IOSD 3UEZA 3HE6B 1AC6A 3QR1A 2B3IA 3BVWA 4MA1B 1EFXD 1NCGA 1DUYA 4OBSA 3SDCC 3CFKA 4ZUSA 5KAQF 4YNYB 5E2WH 5BS0A 2WUCH 3IFLH 3CZFA 5EOCH 2NY5L 3I6KA 1JZEA 2P5WD 1I1AC 2ICWI 2IPTL 3IN2A 4KK9D 1BYPA 3WIFB 5GS3A 1U8LB 1KFAH 3PWPA 4CVWA 4AYSA 5ACZA 3FRPA 1X5JA 4MCZA 5I73B 1ILSA 3JVGA 2VDKL 2TAAA 2PCFA 5HJ3B 3QEQB 1IFRA 3IDNA 1KY6A 4GS7B 1RK1A 2A5UA 3CDGA 3MCLL 5I8EA 3GIVB 3CN0A 2IALB 3KL5A 4MD4A 4RVBA 5EZIL 3VWKA 3ZDXB 5F93C 3SE8L 1H19A 2D31B 3FU0A 5EBLA 5IBUB 4XCNB 4MJIB 3I6GB 1BVZA 3CXHK 5BMFH 4OB5L 1TO5A 3D4ZA 5HI3C 3QW9A 2VL4A 1J7VR 2ALAA 4P2YA 5EPMA 1F41A 3L08A 4OCMC 5K9JH 3BQVA 3QFJE 4AQAA 2P7TA 4KVCH 3M1CA 4PWGA 3I50L 5K59E 5HHQA 1IKNC 1SDDA 1MCWM 3LDBB 5JIQA 5E1HB 4FQQA 3UTSB 1D9KD 2HWZH 1TJGH 1QFPA 4GXUM 1QP1A 4HCGA 4JG9A 4BQ9A 3T0VA 1KJ2A 2FBOJ 4LK4A 1S46A 5BVPH 2BNQE 2QKIC 2UWEE 5E56A 3GUTA 4XN2A 4QF1A 5CSZB 2F15A 3FSZA 4KKAD 5LGHL 5FUOL 1T3FB 4X5WB 4CN4A 1LYQA 1NUGA 3HPJA 4RWYH 7FABL 3MOAH 3AWFA 3AS0A 4MMZC 2YWYA 4IRZA 2XJLA 3GHPA 2OXHA 3S3PA 1OF2A 4ZW7A 3PL6C 3QZBA 3WJJC 4BHUA 1IKOP 4U1GC 1RD6A 3C6LC 5LCVA 3H2QA 4ZD3L 2EP6A 1HSAB 1UWGH 3VFWB 2OTPA 2YPLD 3MRNA 4QRRD 2NNAA 3ARGB 2AQSA 3VRJA 1U4EA 2YBGA 1EQWA 3VGGA 2X6MA 2DYSB 3UGUA 1GGIH 3FCBA 2WXIA 5B38B 1TTAA 4XPTL 4J6RL 5AOIA 3VFUA 5KS9F 4WO0A 2KBGA 1SQ2N 3QIBC 1ULVA 2JCCA 4L37A 4P57A 4GIPD 2YEZB 2G3ZA 4OGAC 3KGRA 3BVDB 3FB8B 5KSBF 1I3GH 2GAZA 4W4OC 3EYQC 4GRLD 2FYYB 1IEBA 2EE0A 1ACYL 2KMWA 1XGRA 1NZRA 1UM6L 4Z7WE 3L4YA 4ZUTA 3RE0A 3TL5A 5TDPA 1CF8L 4FNTA 4J3BA 2CO3A 4EF3A 4WEMB 1IFHL 3SJVE 5DDHA 1ZLUH 2Y24A 3G04A 4NQDB 1A3QA 2N0MA 3MXVL 2HRGA 2WYTA 5IKCB 5IBLC 3O6ML 4AX3A 2I69A 4KKCD 3SYCA 2YXVA 3U6RA 4H1LH 4MSWA 3GXTA 4MLIA 3R4RA 3QNZB 3B9KB 3ATAA 3Q01A 4NIYE 1UCTA 3VG9B 3DRTB 4QY8A 1MCEA 3APCA 3SO3B 4OGXH 2Z93B 3MLWH 4ZMQA 3FONA 5J11C 4HSQA 1HIMH 4PM1A 4QHUA 1FGVL 4PJHA 4Q6KA 4P8QA 2FIRT 4QRUA 4L1HA 5DRNB 4NQED 3TFKD 2WO3B 1P4LA 3CFDA 4N2NA 3JBG7 1PX3A 2E27L 3BKJH 3V0EA 2VUYA 1OARL 4FEIA 1MFDL 4ISVB 1TZIA 3QHFL 3BRGC 5CGYC 5CP3A 4PBWD 1CN4A 3C8HA 4OLVH 4TULH 4JFXB 3U9UB 4E42B 2G4EA 4CGUB 4XB8A 3WFEL 1HHHA 2ZSWB 4ZMPA 3G6JA 3MZGB 1ZTMA 1IKFL 3EXLA 3EYVB 4EKJA 1Z2KA 5IEKA 3F7RA 2H3KA 1PLBA 4H8UA 1CFQA 4GAGL 3ULVH 3PV7A 1RSYA 3WNNA 4AMWA 4P99A 2AEOA 4M7JL 5T5NG 1ICTA 1S7UB 1CR9L 1E4XI 1FFOA 2JB5L 2DQGL 1A7NH 5AWNL 3T5WA 4FMKA 4XH2B 1WAAE 4KY1L 4MNQD 4ZSOB 1TUPA 1OGSA 1OB0A 3GMLB 5F8RC 2ESVA 3MLYL 3QFJA 3FCSB 3RG1C 4CRPA 5GS0H 3KBPA 4XPAH 4W9LC 5DD6B 5I8CB 3KXFB 2A74B 3PXLA 3E80A 1A1NA 4XAKD 3GZQA 2ROYA 2O6EA 4MAZA 4Y9CA 1QI4A 4BFNA 1BBJA 3QJVB 2F1AA 3AS3A 4N0FB 1P4UA 3ZRCC 2IF7A 4YLQT 1HKFA 2C9XA 2XV6B 4PV9A 5E8PB 5F1SA 2X7LB 3LQZB 3AC0A 4NKOB 2PXYA 1I31A 2NR6C 3LRGA 5D2NA 3MRIB 1MLCA 4AXWB 1TTGA 5L4JA 3Q9PA 1MRCH 3O3EB 1TF4A 2VJ0A 3HPLB 3LAFA 5EZPA 3WY1A 1CL7L 5E6IA 1EXUB 3QDGB 3EOTH 1UJ3B 3GGWA 3O6FD 4I2XE 4PP1C 5CR8A 3SO5A 4M62L 4IMLA 3BH4A 2ENQA 3ESUF 3V9CA 2HTLC 2IMMA 1KPRB 4U0QB 4X5XB 2EVJA 3ARZA 3O3AA 1FSKC 3TWCL 4BZ2H 1T89A 3OSVA 1JPTL 3ROLB 3K1DA 2MH4A 3BPCA 1T03H 5C0RH 1INEH 3OKNB 4ZUVB 3S3JA 4X50A 3SHSA 3ZE2B 4YHNB 4GW1A 3OG4B 1NAML 1I1FA 4FQLL 5CEXB 3QORD 4IGBA 5A2KH 2XUWA 2IOOA 4Z5RB 1KXTA 3W1ZA 1IBZA 1UURA 4V1DB 3DMMB 4J3OC 1SYVA 4XCFL 2C9AA 2MOVA 4P23D 4FFWD 4WDIB 5FO8A 1EANA 3LVTA 4HOZA 4WWKD 5DFVC 1VFOA 1X5IA 4AJYV 4R83A 2IJ0C 1IZKA 1P7QA 4PJGA 3S34H 5E2UH 3GSRB 2FB4H 4OM0H 3SJVA 1KPUB 2WBJA 1ASOA 1X5MA 5A1AA 2Z1PA 4X4XA 1ODUA 2KYIA 1UWFA 2AITA 2RA1A 1Q9LB 4L8DB 2WVSA 4F2MB 1ETZA 3MLXL 4DGYL 1NUDA 2WN2A 3I50E 1A6AA 1PNDA 2W07B 5H37H 1FO0L 2FYVA 4IKNA 4PRDB 1XH0A 3D12B 4N5UA 1JHKL 2APTA 4LLVB 2DM4A 4NQXB 1JS4A 1WVZA 2ZX6A 4LLMA 1WFOA 4YFEA 3VYPA 1ND0A 3UG3A 3GO1L 2FWOB 3PWNA 4K94C 1JGVH 1J5OH 2X28A 3US1A 1DSFL 1KTJA 4HIQA 2H1LM 4Z95L 1URLA 5BZWA 2YQGA 3GMRA 4X6CA 5DURD 3V95A 3N42F 3FTUA 2CCVA 5HD8D 2E7HA 1C12B 1F1DA 4GPVA 1QQDB 4YBHA 1DCLA 4JRXA 3HHMA 2X9WA 4NQTA 4U6XA 5ITBL 1A7RH 4XMUA 3FB7B 2FEDD 2LABA 2ZWKA 1OAJA 3HI5L 4Z0XB 3EW3B 2CKBL 1Z9PA 4QRSA 1K9TA 1UOVA 2ZKMX 4WW2F 5GRUL 1CG9B 1FLRL 3Q9QA 3QDMA 2COQA 3LNHA 1K4DB 3KG5A 3JYCA 2X2YA 4FCAA 4JMXA 4DP4X 5JW3H 2YIHA 4OLYH 4UIKH 1VFAA 4F57H 5C0ND 3ARGC 4PJBB 5AW7B 3STZB 3LH2H 1FJ1A 4F3FA 1NIFA 3BP4A 3QWOA 3KWUA 1QPPA 1UD3A 3DV6A 3V5KB 5IHBA 3C5ZB 1MNUL 1O9WA 4FTVD 3QDHA 1LP9F 4LPWA 5T5FA 1HTYA 4P3DB 3VTAA 4E2OA 4Y4FB 1XSOA 4OKDA 3AM8A 1ZPLA 3IDJB 3MMEA 3QXAB 4JQIH 3VXMB 1OAQH 1DEEA 2OMWB 3DTDA 3ULSA 1G9NH 2YAQA 3UL4A 1ADQL 1XTLA 3DUHA 3PRZA 4FFTA 3ARDA 1EUUA 3GBNH 3MREB 4HIIA 3M1BB 2TSBA 4WU5A 4FQPA 4R96B 1UXSA 2YKLL 4IOSA 1CICC 4ZOCA 3DRQA 4H88H 2B1OA 4FJYA 1H5BA 1T6BX 12E8L 5E0QA 1DUYB 4FC3E 3KGSA 4H1LG 2H1PL 3SOBL 1AGDA 5GS2H 4I2XA 3TM6A 3EBAA 2H3XC 3WDHA 1WAEA 2K7PA 5C3LD 5BS0B 4NQEE 2QT6A 1GC1H 3CZFB 5CZXC 5L4MA 3I6KB 2P5WA 1DJZA 3ATFA 1W0VB 3VG9C 3JZ7A 1CC3A 4ODUA 3BDBA 5E51A 2OSLA 3PWPB 2QR0B 4FGMA 3FRPB 4MCZB 4W9GC 4AQ8C 1OVZA 3GBEA 3U46A 2PCFB 1TQBB 3IDNB 1YN6A 4PJ7A 3GD1C 2D7NA 1J8HE 1MG2C 2QDWA 4FLSA 3CDGB 3BP5A 5I8EB 1G7JA 2V2XB 4IBQA 2VDQB 4Q74A 4MD4B 4MZ2A 1JRHL 4AC4A 4QHPA 5I26A 1FZJA 4YX2L 3RL2A 2MSPA 1XGQA 4HULB 3HZKA 3M7OA 3RGBA 4TTDD 2EZ0D 3KJ4B 1EAPB 4PRNA 1T1XA 1YAIA 4Z7VA 4YXHH 1GR7A 2B4CH 4U1MA 5EPMB 2WUBL 1KN2L 4BWWA 4JDTH 2ZWZA 1AAJA 2CK0L 1QRNE 4AQAB 4XMWA 1ECYA 3L2NA 5CS7A 1SDDB 5JW4Q 1DQVA 1FL3A 4NNYA 1KYOJ 1ZV9A 1D9KA 2ZWYA 1BW8A 4RIRA 2DB8A 1KJ2B 3LPGA 3BAJA 3H9ZA 1WEJL 5FYJU 2ZYSA 3MXWL 3LPFA 4N0UE 2EXTA 3GUTB 2XG5A 4MXQD 4A39A 1FC1A 3RHWF 1FFPA 3TCXA 3MCG1 3HPJB 4A2MA 5GXBB 4LCIL 3MYZA 4Y4KD 4ZO8A 2IBZX 2OXHB 1L5GB 1OF2B 5ANME 1GYWA 2D7QA 2KERA 4J5VA 3QQ9D 5IUCA 3WLWC 3TVMD 2YEVB 2DIJA 3WXWL 2CM6A 4LPXA 4HOMA 4QHMA 5F21B 4FAAB 5PAZA 1TXKA 4ZTOL 3C8KA 3N41B 1SLVA 4Z6AT 5IV2A 2VO5A 2YPLA 4QRRA 3MRNB 4M5YL 2NNAB 4X6FA 1OB1A 2MJWA 3VRJB 3D2UD 2BJML 4MCYA 1XB6A 3TU6A 5CR1A 4RNRA 5LGYA 4Z7QF 3V0WL 2BSBA 4X7TA 1WAPA 4KQ4L 5DQDL 3VFUB 2PR9A 3ZTNL 2VDKH 1UJ3C 2EEFA 3WNMA 2ZYHA 1T2QL 1CI5A 4OJAA 5DD0L 2JCCB 4L37B 2WIIA 2EDXA 3MCLH 3UC0A 2V37A 4PW4A 1BG9A 5EZIH 4OIIH 3ROOA 1MCOH 2VSKB 1Q94A 3SE8H 1LDSA 3D4GA 3G5XA 3FZUD 3K6FA 2N7SA 4JE0A 4OB5H 4AIEA 1VFMA 4XO3A 1WWBX 5C09D 4ORZC 1MHCA 4KK5D 2EDQA 2WQUA 5HGGS 4XNXH 2DQDL 3PY9A 1AMXA 5TDPB 4FERA 5DZNA 3CK0L 5EN3A 5DDHB 2DI7A 2NY4C 4FADA 1L0QA 1RFDL 2VMCA 2XPGA 3BGAA 3Q2VA 4NI6A 3BDYL 3U4EA 4KRPB 5BV7H 5AW4B 1RXLA 5ID1B 2F8VA 4KITB 1YMHB 4P5TC 1ET5A 5L6YH 3U6RB 3F7LA 1S7TB 4MSWB 1RP9A 3MZTA 3WV0A 1LILA 3K6IA 3EJQA 2HJLA 2BNRB 5KYUA 5KTEL 2KPNA 3IKCB 3STLA 5H37G 3L8QA 5JUEL 3FONB 5AVTB 4GUCA 4QHUB 2UXVA 4PJHB 5JQ6L 4HWZA 4NQEA 2EECA 3VXUE 2ZXWB 3U6XS 1P4LB 3CFDB 1SGKA 4OCXL 4ZXBA 2EVHA 2WVTA 4GKNA 1XHHA 3ZMEA 3ZTEA 5FGSA 1TZIB 4ZD3H 3ARED 5I1IH 4ZFZA 4WK0B 3WUWG 4QYAA 5K9KA 5DYOB 1TMQA 4M1CD 2IXQA 1RAMA 2XQ0A 5IFHH 4P2QD 3WHE1 3AQZA 1HHHB 1QWNA 4H8QA 4P04A 3G6JB 3MBED 4ZS6D 2ZUWA 1EHLH 5B39A 3U9PH 2NZIA 5D93C 5IEKB 4RDQG 4X98A 1S78D 2BCMA 1USZA 4K9EC 5AAMC 1H0DA 1NEUA 3BP7A 2H41A 4P3CH 2HLAA 3O3UN 4ZOAA 2QJDA 1A6TA 4XCEB 2VDNH 4L8CA 5BRPA 3F05A 2RR3A 1EEYA 3CH1A 3U4AA 3B43A 1XCXA 2QLVB 4MNQA 4FG0A 4RGNC 4Q52A 2BVPA 3H54A 2ESVB 5KS9E 5MEQB 3CQQA 5F44A 4YJZL 4IKKA 4OGZA 3QIUD 4URTB 5AOJA 1CF8H 3BAYA 4DCQA 4FMVA 1G84A 1A1NB 1SFHA 3H9SD 5KUMA 3HKFA 2APFA 4PFEA 4PGCB 1WHPA 2UZPA 5FEBA 5KSBE 5LNEA 1BBJB 1UKTA 4JK0D 3BX7C 2K4AA 3IMWA 1QNZL 3EFFB 2JFCA 1WTGT 4TSBL 3L5IA 1C7TA 4HQQH 5FUCE 3QUXB 3RVWC 1DQKA 2IOIA 2X2IA 2PXYB 3C5ZC 3Q2LA 4U1IA 5D72L 3WSQL 1MLCB 5AENA 1KTRL 3TBSA 3MN8A 4UM9D 1SMAA 1YMMD 4QTFA 5ETUA 3EJYC 3O81A 5JR1L 3AT9A 5KVDH 1FGVH 3WHE0 5E6IB 1XF4B 3PNRB 4JHAH 1IGML 1XGUB 4N20A 3GGWB 3GK8H 3L4WA 3N43B 3O6FA 4YPGB 3L48A 3BUBA 3D9AH 5F6HJ 1ET8A 1FIEA 1M4KA 3KM1A 3PNWA 4FLQA 1MFDH 2VN7A 3WIHA 1J10A 3O3AB 1YEEL 5KBLA 1E5ZA 4FNUA 3T8VA 4F58H 3HRPA 5E9AA 3BPCB 5C0AE 1YO4A 1VENA 2GSGB 3CBRA 1GAFL 5T3XL 5C8JB 4GW1B 4G6AC 1TTUA 4OCWH 1I1FB 5IVZA 5GZOA 3ZDZB 1MFUA 1O6VA 3IJ9A 1LWRA 3FUMA 4U1JA 4HKBA 5EO9A 3VNZA 4C56D 1OQXA 1CD1A 1EVUA 4OCSL 4LAQL 2EIKB 2VDML 4M7JH 2F6AA 3VXRE 2J4WH 2F19H 1XBDA 1JYWA 4HUVB 2EUWA 1SYVB 2MPAL 4Q6IA 1RPKA 4P23A 3DWTA 4X7EC 5AWNH 2JB5H 5FO8B 4WWKA 2YARA 2SEBA 4W9FC 1ECZA 2NY2C 3JVGC 2P8LB 1HDMA 1P7QB 1QBBA 1F58H 2GY5A 4PJGB 4ZK8A 3LHAA 1TOXA 4NN5B 4OCLC 4JKLA 1PCXA 4C4BA 4N85A 3K6DA 1IGCL 4Q14A 5AVRB 2GC7C 4WEBL 3TXAA 3WFBH 3KPPA 3TURA 3MV8E 2WLYA 3QJTB 5T33H 3VWKC 2LT9A 1KTCA 1ETZB 3GHEL 2VZSA 4YSEA 1DJXA 4LPCA 1A6AB 1NEZG 5B4MD 3ESOA 3BPLB 1NC4D 1KGCD 2VC2H 2R27A 3AITA 2WXOA 1ND0B 2J1YA 3HB3B 5FYKU 5F9OL