4UTBL

Crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
b'QSVLTQPVSVSGSPGQSITISCTGTSSNADTYNLVSWYQQRPGKAPKLMIYEGTKRPSGVSNRFSASKSATAASLTISGLQPEDEADYYCCSYATSRTLVFGGGTKLTVVGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
molecule tags Immune system/viral protein
source organism Dengue virus 2
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
total genus 48
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4utbL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4utbL02
3MV7D 3VXTB 5IB2B 4LL9A 4RAUB 3QUYD 3C2AH 3FQWB 3HNSL 1B6DA 5F8QC 4MCYB 1QPPA 3IETB 4IRSC 1D6VL 2BNRA 3IKKA 5E2JA 4KAQL 2GTZA 1D7FA 1OT2A 1KCVH 1DE4A 1U58A 5F21B 3U0WH 1OAXL 2ZCKH 4JRYA 4D9QE 3RWJA 5D7JC 4JRYB 2X70B 4Z7WE 2H3NA 1ADQA 2BNQB 3OB0H 2ESVB 2H2PD 4XBEL 4PRDA 2VDOL 4LSUH 1TZIB 2WUBH 2X41A 3P3YA 4LCCA 1CE1H 3H9HA 4MS8D 2NY5H 1TZIA 1FL6B 4LCWB 2AJ3A 4G7YL 5EBMA 3ARBC 4HZLB 2GTWB 5I6XB 3QAZB 2DLEA 5GS0D 5MEQA 4TSBH 3SDXA 5C0IA 4LCIL 3RWFA 2ED9A 4HIXL 5DRNA 1FNFA 3EGSA 3G6DH 4PJHA 2AJXL 5FA3A 3W11D 3WFBH 1F11B 4ISVA 4OFYA 4ZUSA 1BZ9A 1AXTH 4PGBB 5CEZD 3HRPA 3DSNA 1F6LL 5F7EH 2PNDA 4YHPA 2DMKA 1OY3B 1BAFL 2VXTL 1WWBX 5CGTA 5ANMA 3NFNB 3ZYIA 4ETYA 3LQMA 2ADGB 4PJ7B 4OFPA 1WBZA 4LLQB 4RMVA 4Z7VA 2VLLB 3BSZH 4JY4B 4M61A 1CTNA 2R29L 3ZYJA 3NPZB 2R2BB 4WFGD 4YPGA 1T0NB 3GMPB 2DB8A 4LCWA 2YSSA 4U1LA 4Z7NE 4GKSB 2YWZA 1KNOB 1KXTB 4CNIA 1FVCB 3NCJH 2BVOB 5F9JB 4EI5B 1HH6B 1OTTC 5GGQH 3ECBA 1AY1H 1AD9A 1ZT7A 2VZOA 4F9LA 1MCQA 5IW6A 5FYKH 3OKMB 3D48R 5KSBA 1AGDA 1C5DB 3GMMB 4WHTA 2I9TA 2WLZA 2V7NA 3MCKA 3U4AA 1N6VA 1C5CH 4MLSA 1UCTA 5JPMA 5E2UH 1YMHB 3ILQD 5CKAA 5IKCB 3DRTA 4F7TA 4LSSH 1CDCA 4XXDB 3ARXA 4YDJA 2AJUH 4WHYG 4ZOCA 4Y5XA 3L95B 5HGBB 4MSWA 5F1KC 3F8UB 5DEFB 1B90A 1FN4B 3VD5A 3LVEA 3TZVA 3OKNB 1L0YA 4ONFH 2BY1A 2G5RA 4KXZI 1FG9C 3IDUA 1LDPH 4OJFH 1BD2D 4AT6A 4UQ2A 4WO4B 1B2WL 4M7JL 5D93C 3EO0A 3S36L 2IQAA 1MY7A 4MD0B 2WUCH 4YHML 2ADIA 3O6KH 5GJSH 3MYJA 3DX9B 2QQLL 4PY8J 2Q6WA 3MLRL 2NW3A 2XA3A 3BX7C 4AM0B 2IADB 1UWXK 1IAII 4BKLB 4MS8C 3WNOA 4KKCD 2OTWB 1XGRB 4G3YL 4KZDH 1MIEH 1J12A 1KXQE 3V4UH 1IARB 4P99A 4QRPD 3DVIA 3E3QE 3TNMA 3SDDB 3MXVL 4BSJA 1QBBA 3V5KB 2L0DA 3BPNC 3BP4B 4M5ZL 3RGVD 3C8HA 1M7XA 3HE7A 5FGCB 5J6HB 3VDBA 3C6SB 3A67L 4PJEF 1IC4L 3LEVL 4NZJA 4W4OA 1FFNA 4XNQB 5BV7C 4QXTB 4JFEE 5I1JL 5DRWA 3DOSA 3SKMB 3RY5A 3EFDH 2L7UA 3B8YA 1S7VA 2HJKA 1UZ6F 3HPLB 4LSDA 1XIWB 3I6GA 3I3DA 1DEEB 1VENA 1IT9L 2FB4H 3CXHJ 4RWYH 4KRLB 1PFCA 1A02N 1CL7I 3V6OA 3QPXL 4MQSB 1YN7A 3MRDA 2HP4A 5LWYL 1TNMA 4QLRA 3WV0A 1OAQH 4NRYA 1GPOH 5DDHB 3CFJA 1BFTA 4OD1L 1GGBH 3KWWA 2LU7A 4JG1L 5KTEL 5CD3A 3JWOL 4JB9H 2H1PL 4WTZA 4NNXB 5L7XL 1UT9A 1UWEL 3PWPB 4JDZA 4NNPH 1J86A 1Q8MA 1TVHA 2VWEE 3MFFB 1LO0H 3MV8D 4U49A 1G0YR 4JM2B 4KV5E 4ZS6D 3RAJL 1MFAL 2IANB 1J1XH 5DJCA 1PKOA 3TO4A 3MRMB 1B88A 4H88H 2JJUA 1T80A 1OP5K 4HT1H 3IF1B 1I7RA 3PWPE 3LIZL 2VLKA 3GI8H 3RBGA 1DQML 2W65B 4ZOBA 1UZ8B 2VLKB 5A3IC 2CSPA 3MRGA 2ZNXA 1AGBB 1U6AH 3F65A 5DDHA 2FECL 3WS6A 1EO5A 3KPNA 1T89A 32C2B 3MBEA 4G43B 3VGFA 4EIZC 3NFSL 4ODUB 2BNRD 4TNWK 5D7JB 1F58H 5J9PA 32C2A 4G43A 5J89A 3EO1A 2EKSB 4RCAA 4WU7A 4OZFA 2XXMB 4YO0B 4FQQA 1YYLL 2HJLA 2RHEA 5KS9B 3B9AA 1MH5A 1JGLH 5EWIL 4RGNB 1KPUB 3HTLX 5SWSE 2XT1B 4JANB 3ZSSA 4R4FL 4YBHA 3QDAA 2EH8H 4KV5F 2OCFD 2N1KA 4ZSOB 3SE8L 1WAAE 2VLRE 2EXWD 3QHFL 3BIAX 1KB9J 3V8CA 1U3YA 2EC8A 3BP6B 2CXKA 4N1CA 3JTTA 3GI8L 3EOAA 4F3FB 5JOEA 3AS2A 1BGXH 4JM4L 2EIDA 2ADJA 2X9XA 2HLFC 1NFKA 4XNUH 4P3WA 5C6PB 2JB6A 2IC2A 2EDFA 2BSRA 3SDYH 5DMGD 3PWPD 2EECA 3LD8B 2WBJB 3L5XH 4Z0BL 5MEPA 2A6JB 4EXPX 2Z93B 4WEBL 1RZFL 4LKCB 2BOBA 4G9FE 4F9PA 3IAQA 5LWYH 3RDTA 2MHAB 5IJVA 5JDSA 1XGUA 5IB5A 4Z78B 1CQKA 4JKLA 4Q6YA 1IEAA 4HQQH 4E9LA 1T7VA 1NDMA 2ZOLA 4KI1A 4WEUD 3X13A 3G6AB 1UWEH 1AO7A 2VISB 1WFNA 2OJZH 3IKCA 4PG9A 2WBJC 3DUUB 5AYUL 5FM5M 5D1QD 4DN3H 3DX7A 3P4OA 3GIZH 4DGIH 5JXAH 4H5SA 4EDWH 2HYMA 4N1HB 5B39A 4XCFH 3P4OB 3QFDB 2CD0A 2J8HA 1VEOA 2GSGB 1H8NA 1YDPA 4GQ9H 2MKWA 4MAYB 4EZMA 3EOBB 1YMMA 2Q3ZA 2ZUUA 4PJXF 2DRUA 3EBAA 4YDVA 3X3GL 5CD5D 5IGXH 1EBAA 5L88H 1KJ2H 3UJJH 3TF7C 2NX5A 4YDVB 1S7UB 4GS7B 1Y6NR 3SDXF 4S2SB 1O7SA 2HJFB 1ULVA 1XMWA 2FGZA 3OKLB 4OGXL 1XGQB 2HJFA 4KJWD 3CD4A 5I8OH 2IF7A 1T83A 4MAYC 3DUUA 5I73C 1BZ7A 4PR5A 4LDLB 5IR1A 3GEWB 2Y6SD 1BVKB 5GGUA 1LVEA 4YC2C 4N68A 5IR1B 5JMRA 5JW4N 5GZOC 4MQTB 4NPYA 1F6AA 5D71H 4F33A 3BIKA 5IMOA 5CBAB 4LBEB 5E8NA 1HHKB 4NN6B 1BD2B 1F02I 5EA0L 4XPHL 1RHFA 3VGEA 2QQNL 1Q72L 4CKVX 4ZS7L 5FKAA 3VRJB 1NGPH 3SPVA 5FHBH 4RFOH 5DO2D 4XPGH 3ULVE 4DQOH 3VWJD 4MXVF 1DQDH 5CJBA 1N59A 1I7UB 4ELMA 3S36H 4PLJC 5HI4C 1P9MA 5FYKL 1A7NH 2HTLC 4NBZB 4OCRH 1ROWA 5AD0B 4Z7QE 4PB9L 4PTUB 4D0CB 3C5ZD 1Y0LB 4HS8H 1TZGL 1J05A 4M5YL 4NM8L 5F6HJ 1V3JA 1TJGL 4Q58C 4Y5XB 1JPFB 4RAVA 3D2UD 3UROR 3WMSA 4ZPTB 2HH0H 4ZTPL 1NCCL 2Z91B 5ISZD 4X98A 4FHBD 1JGDA 4NUGH 4QRPE 5B4MD 1LO2L 2GT9A 4QXGL 3GSVB 1FGNH 1CGTA 3ESVF 4HIIB 2EYTA 3WE6B 4UU9A 4HUMB 4WNQA 2Q76A 5EZJA 3TWCH 4YXLL 1LE9B 4JO4L 4IRJC 4Q9BA 1RMFH 4AEIH 1W0VB 2EYSB 2Z4QB 3D85D 4WNQB 2ZG3A 3EO9L 1HIML 5EIVA 3IJHB 3BP7B 2QSCH 5DVLA 3E6HB 1N0XL 4YEFA 2AKRA 1SJHA 1A1OB 4C56A 1A6UL 4KY1L 2P8MA 3Q0HA 3ARWA 4LIQH 1T1WB 1W0WA 2IPUG 2R2EA 5DD1H 1K8IB 4GXVH 1RVFH 5FECB 5DFVC 2V7HB 3WNNA 4JG0L 3U83A 2YPLD 1CXEA 4LCIH 1K4DA 4WRLA 1WGOA 5MENE 5K59F 5K93A 4O4YL 2AGJH 1SYSA 1JGDB 2XKSA 4PRHB 5DEGB 3BHBB 4AG4H 3C8KB 3U30C 3NIGF 4UQ3A 3O4OC 2FHCA 1DUZB 1LEIA 4KJYA 3RUGA 4DKEH 5DD1L 1IGIH 1YECH 3C6SA 4G6JH 5DJDB 4MZ3A 4RRPA 2QR0B 5DS8A 4W81A 4DKFH 4JFYA 4FFZH 3D18A 4IS6A 4HKZA 3WN5C 1FYTE 1MJJB 3QPQC 1A9EA 1FNLA 4AIZA 1UEYA 5EOCJ 2QQNH 2NY5L 3SKMA 5IOPB 5DURB 1XCQA 5D7IA 3C09B 4U4BA 5ACZA 3BN9C 1TJHH 3W5NA 2PETA 3LDBC 2HLFD 1RD6A 1FPTH 4GLRI 3MOBH 4LFHG 5C0AA 4I48A 2ZNWA 4P9ML 4K2UH 3DMMA 3Q3GA 2DLIA 3CDGB 3L3HA 5DQDH 5JW3H 5EZOL 1QLFA 2A83A 4FFVC 4KZDL 1FG2A 2IQ9H 1OAXH 2ZCKL 4HIHB 4CVXB 4X9IA 1MAJA 2BVQA 1I3RA 5DK3A 5J3HD 5IIEB 4GT7A 3ARZA 5CSZA 2NTSP 2YKLH 2C3WA 3LN4A 3O9WB 2NX5D 3NN8B 2JF1A 5EDXA 4OLWL 3EAKA 4TOYL 4KPHH 4PB0L 4HGWA 4YR6A 2XQYG 2PO6B 3HS0B 1CCZA 1UFUA 3OKEB 2Q7NA 1KLGB 1MCKA 3KR3H 5IVZA 4POYA 3VG0L 1T04A 3AFLA 1FNSH 3KHQA 4HK3N 4LSVH 4XP4H 2V17L 3RL1B 5ALBL 4NC1C 1TDQA 5J1AB 1BWMA 1LDPL 1IGFL 3FO1A 3JTSB 3FN3A 4RFNB 3VXSE 5C0FB 4RMSA 1S5HA 4BYHA 3GSNL 5D7LA 5IHZB 2VDQH 2DWEA 2RCSH 2D31B 3QO0B 4X8XA 2VLRD 4ZYKB 4OCSH 1F3JA 2Z9TA 1NKRA 3TCXA 3V6OE 1Q0XL 1XF1A 1XAUA 3BDYH 3P77A 5BRZE 4Y19A 1KEMH 4S1QH 1Z2KA 4UBDD 3GSNH 1G6RH 4LVOB 2ENSA 3VWKD 4U1HB 4NQSA 5T3ZD 4KHTH 5EUOF 5FYLL 1GOFA 4G6KH 4GAJL 4HZAA 4LSRH 3VXUE 5EBLB 3B9KB 1U95B 4LLMA 3QT2A 4N0YL 3PHOB 1YEEH 1C7TA 1UM4L 3EUUA 3BDYL 4S1RH 2DICA 5B4MC 3H42H 4RGMB 4AENB 4ZSOA 1RJZB 5ERWB 4E41B 2R2BA 3O3EA 5TQ2H 3VD9A 4PJCF 4Z7WB 4Y4KD 1CFSA 4G8IA 4J3WA 4NWUL 4NFCA 5FUCE 3D85B 4LLQA 1WCQA 2VIRA 2I07A 4NKOA 4QY8A 4X6BB 2GUOA 4J3XA 2KQNA 1QVOA 3EFFB 5DJYB 3OKMA 2X4TB 4TPRH 4M02A 2NY3D 3MA7A 4P9MH 3SGEI 3IJSA 4V1DE 4A6YB 4O5LH 2BVOA 2XQBH 4CW1B 2FWOA 5ABDE 1BQHA 3BH9B 1Z9LA 3SO3C 1U8OB 3W81A 1OP5H 1KF9B 1Z5LA 5CEXB 5IF0A 4L4VE 3DSFL 1U6AL 4NHCH 4J3OC 4XVUD 2DYPA 3C5ZA 3NIDF 2YKLL 1XGUB 4KTEL 1I4FA 3F58L 4BUGA 4RX4D 1CLYL 1U8QA 4FZEH 1W8OA 1YMHA 4ELME 3P0GB 2ARJB 3L5HA 1G7PB 5SV4A 3S96B 3N0PB 1JGLL 2F54A 3BFOA 5C0NC 2UYLA 4O2FB 3VFPB 2HVKA 1XF4A 5H37H 1UADC 1JI2A 4MGXA 2R0WL 4Y4FB 3F7PC 4C83A 3LKRB 3RI5K 3BDXA 4LK4A 3OKKB 1S78C 4E0RB 4CVUA 3O6LH 1X6NA 2Z0BA 3RBSA 4QXUL 1YEDA 4PJCB 4Z7WF 3PJSA 4PRBB 1DN2A 1MI5B 3JVGA 4ZUTA 3ZMRA 1JGUH 2A1WH 2JJVA 4HXAL 4Y2DB 3SJVE 2MQ3A 4UNUA 5IWLA 2FIKB 4R2GD 4N5UA 3ZKXC 4DVBA 3QO1A 1CR9H 3TEUA 3AROA 1K9TA 1RZJH 3I75B 4TRPH 5KSAC 2YWYA 3GKWH 3QEQE 2E6QA 3QHZL 4HLJA 3QO1B 1NGXA 1XF5B 1HINH 1MCIA 1QKZH 5BQ7B 1FIGL 3ARGC 2OQJA 4XH2A 1NCAH 1MEXL 5CFHA 4LIQE 5C0BA 4I3SH 1PSKH 3ZHKA 2W60B 2Y7QA 2PR4L 4DN4L 3FTGA 3QDJB 3LPWA 2DMBA 4JPKL 1FZJA 4GW5B 4FA8A 3S3PA 2DL2A 3QG6A 2J8UF 3TA3A 4FZ8H 5BOZG 2FJFB 3WO4B 2ICES 2EH7H 3U7WL 3VXQA 2KQMA 2Q7YA 4PJBF 5HHNB 4JQVA 2E9IA 1ZT1A 4NZRH 3O45B 3RDTC 5FO9B 1QQDA 4POZD 5EFIA 4ACPA 4UT7L 1GSMA 4R96A 4PRBA 4MD4A 2GFBB 1BQLH 1D5XA 3NZ8B 1AXSA 5J12B 3LS4H 1FFNB 1R3JB 3QUKB 4XVUC 3MLZH 2I9LA 3O4LD 1CK0H 5IV2A 3QIBB 1Q1JL 3SBWC 3RGVA 4XBPB 3GMQA 4K3GA 4LMQE 3RWHA 2OI9B 3HMXH 3O2VL 2EDYA 2IAMB 1UH2A 5IMMA 3F5WA 2OZ4H 4BFBD 3MRIB 4G8GA 5LG1A 2WIIB 4IDLA 2NTFA 2FHBA 1WCBA 2IWGA 3MODH 4OUUA 2H2SD 5LQBH 1FORL 3KPSE 4NSKB 1X4ZA 2LVEA 1HQ4B 1DBJL 2Y06L 3QG7L 2ZG2A 3QUZD 4GRWE 4BQBA 5DUPH 5CZXC 5F9WB 5HHOE 4RZCB 3P0YL 1NAMH 5TF1L 1R3HB 3BE1L 2GK0B 5E08L 5L0QC 1BFOA 3IDGB 3BEVA 5ELIA 5F1SA 4LLDA 4JY6A 3K0WA 4EUPG 4MAUL 3GMNA 1OARH 2BXZA 2HT3D 1Q9OB 5MENB 1H9VA 3PE9A 3AM8C 5I16B 1OOAA 1RAMA 1AGCA 5JNYA 4Y16D 1D5IH 3MLPA 4U2YA 1ERNA 1CG9A 4YNYA 4HUXA 1OGAA 3OGCB 1E6OH 4HF5L 1TCRB 4PJDF 3ARED 1QP1A 3I6LE 5IVXE 4P48A 3RNKB 1TCRA 3J7HA 4G6MH 3TA3D 3HZYB 3D0LB 1C5BL 3CFEA 3UEZA 3IJYB 1X4YA 2D4DA 1JTPA 3HHRB 3QDGE 4PRPB 4JEGB 4HG4K 4IRSD 4HUWA 4HD9A 4FFZL 2X4OB 3M8OL 3ULVH 5E08H 2Y5TA 4ODTH 5AYUH 5HHPB 3GHEH 3R0MA 5E9DA 5E9DE 2AK4A 4YDLB 3LKPA 3WSQH 4KUZL 4LLAA 2E9BA 3MLYH 5CZXD 5K59E 3GSWA 2N4IA 4U1MA 5J11C 5LVEA 4LDEB 1UJ3A 4BZ2L 1V7ML 2HMIC 4DVRL 4PJGF 5A2IH 3BVNB 3ZTJH 1A14L 5DRXB 3ARDD 2P49B 3JTTB 2OLDA 3SEPA 3GRWL 1MCRA 3G5ZA 4H26A 3IFNL 4KWUA 4E41D 5FA4A 2DQIH 1I1CA 5M7QA 3O11A 4O4YH 3MYZA 5DJ0B 4XCYA 5LQBL 1FL6A 4Z78A 2CUHA 1U8IB 4X0KB 5T1LB 1P4IH 1FHGA 5SWQB 3GUTA 3MMEA 1WJ3A 2DD8H 3OHXA 4P2YA 3A0OA 3B4NA 1P69B 1MQ8A 4TNWF 2A6JA 3GMOB 3HR5B 4WY7L 1ZHKB 4OZFH 3QPQD 4EOWL 5C0IB 4S0TD 1A5FH 1MVFA 4EQ2A 5HYEA 1BFVH 3KPPB 1RZ8A 4NM4H 4QCIA 4NIKB 2MHAA 2IEPA 3VGAB 5IJVB 4GQPH 4IOIB 1TVDA 5HVHC 3GJFH 3P2TA 4Q9RL 4RAHA 1ORQA 4IIQA 2X09A 3QEGH 1P5VA 4JCMA 1U8PA 4OCXL 1FVDB 4RMRA 3KLHC 1IAOA 5B3NA 1I1AD 4OF0A 4JFHD 4FP8H 2GHWB 4PJFF 1IM9B 5ECJE 4Z95L 5K9OA 1T04B 3SE4C 3UPAA 1KB5L 2X7LA 2CJUL 4OGAC 4R26H 2W0FB 3EYSH 1AKJB 3QUXA 4H26B 4MNQB 2BVPA 2ITDA 3K1KC 3L7FB 4FP8L 4HZLA 4XB7A 3DO3A 4HKJA 3E8UL 1I7ZA 1AXTL 4OCXH 5HHVH 1X4XA 4DZ8B 4QHNA 2OSLB 5E2WH 2D03H 4P2OC 3MCLL 5EU6E 2RR3A 4JGUA 2W0KA 1C12A 4ODWB 1S9WB 3A6BH 1A7RH 1CFQA 1Q9LA 3GO1H 4GBXC 4PD4J 3UP1A 2F9BT 1DLHB 3T2OA 2ID5A 5IVXB 4YFEA 1AD0A 5JQHC 5T1KD 1ZEAL 2C1OA 4HFWA 5DHVB 4QRPB 1TVBB 3FB6B 4LVHB 2LTQC 4XPGL 4PJDA 1IM9A 1BM3L 1OAUH 4WHCA 1MRDL 1A6WH 4X4ME 1FZOB 4QXWA 2V2WA 4M62H 3BH8A 1RJYA 4XMLL 4CDHA 2GAZB 1OT1A 3O2DL 1BVKA 4F8TA 4DVRH 5I73B 2ITDB 3L7FA 5HI3D 1HXMB 3BT2L 1JK8B 3LKQB 2FNBA 4S1DD 4U1IB 3MR9B 1JV5A 4JG1H 4G7YH 4WFFE 5FKAB 3DARA 3DSFH 3KYKL 2N7BA 3FOLB 4QRUA 4DEPB 1FRGL 3TBVA 4OZHB 2VDOH 5C0AE 3AGVA 2Q6WB 3HE7D 5FV2A 1T5WB 4P3CL 5JO5A 1DEEA 4TPRL 3P0VH 4YHZH 3K4AA 1CDBA 3KPMB 3STBA 4PBWD 1UJTA 4M48H 4PTUA 4Y4HA 3KJ4C 5GGSB 4WI6A 1ZLVK 4NO0B 4HEPG 4CW1A 1BQHB 3BH9A 3QISA 3T3PE 1QO3A 1CIUA 5GRWA 1KN2L 4EDXA 1WC7B 2JK5B 3P4MB 3KPRD 3EHBC 1RV6X 1RFDL 1GZPB 4X7DC 2UWEE 5FB8B 5K33A 1B4JH 1N26A 2G75B 5AD0A 3WFDL 1FE8L 5GJTL 4DEPC 1Y6KR 2YUWA 4TUJB 4PJHE 2MMXA 5D93B 4JFPB 4J6RH 1DSFH 4GSDL 4P3DB 5DJ6A 3KG5A 3QUXD 2ZCHH 2DQEL 4XHJD 2X40A 3CMGA 1YN6B 4G6KL 5DSCA 4YXHL 4GG6A 2DTSA 3PABB 2ADIB 4M6OL 4F37F 5C0RH 2O5ZL 1S7QB 3ULSA 3BP5B 3DWTA 4ZFOL 1K2DA 5KVMC 1S7QA 4AK1A 4JRXA 3LS5L 4OM1H 5HHXH 3L7EB 2MCPH 4LF3B 2ARJQ 4WFEE 1RIHL 5FOJA 4OZGA 1G7LA 3PXJA 2R1XA 3LEVH 5TDPB 3DRQB 4TVPD 1NGQH 1G6RL 4NYLA 1CFVH 5TDPA 3HPJB 1HKLL 1XF3A 2BVQB 3WIHA 5FYLH 3UYPA 1MREL 3QIBC 4BA8A 3LEYL 1TITA 1INDH 3UJTH 5GS2D 3VXRD 2R0LH 2VLJA 5EO0A 1MCCA 3BHBA 5KSUA 4GSDH 3T0VA 1DJSA 3VFVB 1FYTD 3MBEC 2FL5A 4MA7H 3SDCA 2FR4A 3PXHA 3QXUA 4JFQA 1A7OH 3W0WE 5LXGH 4G3YH 3HA0A 2CKBA 3E6FA 3T2QA 2BDNH 5EBWA 3UC0L 2B4CC 3RL1A 4JQXA 2GJ6A 5HDLA 3WLBA 2ZUQC 4NNYA 1WUNT 4NQDA 5GRVL 4LCWD 2FX9L 3MLRH 4M8QB 2DDQH 4WDIA 3TIEA 3ZZ1A 3KYAA 2ATKA 4L3AA 4ZOEA 3QBTB 5D5ME 4GAYA 3H0TB 1JJUA 4E42B 4R97C 4M43L 3BXNB 5T1KB 1L7TH 1T2JA 3MRCA 1ED3B 1H0DB 3RY6A 1DQQA 4M7LL 4Y88A 1T21B 1FG2B 4O58H 5E2TH 3FFDA 1ES0B 3KPNB 2WWKT 3P4NA 5KBNC 1VERA 2FZ3B 3G6JF 3S7GA 4G9FA 3SE9L 2O61B 3DMMB 3SY0A 4JM2C 5GS3A 2Z93A 3HR6A 2ZJSL 3GKWL 2EXYD 3R4DA 5B21A 4CVXA 4XI5D 2XWTB 3DX8B 5EWIH 5FDYA 1JNHB 3HG1B 1AJ7H 2X89D 4TTDD 5IG7A 2VITA 5CEZL 4OZGF 2CLZA 4Z77A 2WQ8A 5IBLD 1NANH 5DFWH 1JNHA 1S7XB 3R1GL 4HUUB 1IE5A 5FO8A 2CGRH 1BVLA 3LIZH 1S7XA 3BGMB 3CCHB 3PWJA 1I3UA 3VDCA 3OF6A 4NJ9L 5I1EL 2D7TL 1UYWL 4HKBA 1I1AB 1A6PA 3BGMA 4U33A 2KDGA 1AGBA 1FFPB 3N1GC 3CDFA 2E7LC 5M94B 3IGAB 2M8XA 1FZKB 2YD8A 5DC4B 1U0QA 1VKXA 1YPZA 1J1XL 2V9QA 3W9DA 4DOHE 43C9A 2IALB 4WHDA 1BF8A 3TYGH 1E4KA 1DP0A 1MWAH 4NQEA 3QR2A 3UBXA 4WWKB 2R2CA 3QIUA 4P46D 4G9DB 4HC1A 43C9B 3EGSB 2DQCL 3EYSL 4ETQA 2BERA 3O3AB 3TO4C 2GITB 5EUOA 1K5NB 5MHSE 2OL3A 5HHME 1MAKA 3QI9C 1C16A 4HFUL 3GNMH 1MCHA 1TFHA 2W0LA 1DL7L 3OR7B 4NN5C 4JN1H 4D9RE 3V5HB 5D1ZA 4XP1H 4MLIA 3O81A 3WD5L 1A14H 1PG7W 3HB3D 1NC4D 1RULH 3N1MC 4OD2B 4D9LL 3T2PA 2NY7L 1HEZA 4KKBD 4M1CC 4AMKH 3T0EE 3ILPA 1NFDF 4AYFA 3QXTA 2QSTA 5C6WH 1KSRA 2OR8A 5IVNA 3ULVD 4P4RA 3C9NA 1U8HB 1YY9C 4FXGB 3VGAC 1LO4H 4PJEB 5CBEB 1KYOK 3NCMA 3NIFE 1IT9H 5IT2L 3QEGL 1FNEB 1OAKL 4CMHB 4LLUA 1RK1A 4I0PC 3EDDA 3QCVL 3ZYZA 2VZTA 4F57L 5FDWA 1JNNH 3M45A 4NQDE 5SX4I 3RQ3A 3B83A 2VIRB 3HZMA 5LGJA 1U8OA 2E3VA 4N9GA 1KYOJ 4L4VD 2VZVA 1M05A 4QF1A 2HFGL 4ZS7H 2X42A 3C5ZB 3O11B 1KJ2A 1YY8B 4WENB 5KAQF 4KK6C 4KI5D 1I7UA 5GISL 4L3EA 4APQA 5F9AC 2VN4A 1G7PA 4KVCH 5DA4A 3UTSA 2Z92B 1S5IL 3QNYA 2AVGA 3BGAA 3GZKA 3VWJB 4APQD 4QNPE 5KG9B 4I0PB 1BQUA 4MA8L 4M93B 3IYLW 3JSSA 1I3GL 2F19L 3BPCB 1AIFB 4HHAB 4ORGB 2YD2A 1Z9OA 1A6VL 3NA4A 1ORQB 5CIPA 2V5TA 5I75C 1JVKA 1MFBH 4GBXB 3MGAA 4QT5B 5DXWA 5DJ2A 2X4QA 3MV8E 1T7XA 1T6VN 2VLKD 3QWRD 5FYJE 2UYLB 5HY9B 1MJUL 2Z31B 3L5IA 3L3GA 4QHLA 1LEGA 2UZIH 4KRPC 3FQRB 3I3EA 4I3RH 5J6GA 1FBIH 2X89A 1KFAL 3GSRB 3MREB 3STLB 4A6YL 1BPVA 4N8CL 2VZ1A 3QFJE 1RUKL 5H35B 3UZEA 3QUMA 3F7YA 4M6AA 2YPKA 4D2NA 1VFOA 1DBBL 1HQ4A 3FFCE 3ALWA 5F88A 1DLFH 1QR1A 5GSRB 3KLAB 3B2VH 3BZDA 5FYKD 3OB0K 3HE6B 3MLZL 4WWID 3O4LE 3TESA 2V2TA 2OJZL 5ENWB 2ZSWB 4HPOH 1PAMA 1JCKA 5HYSB 4QHLB 5GISH 1DZBA 4JFOA 4R6UA 5EPMB 4HGMA 1TENA 5CINL 5KVDH 4O2CB 3PV6B 2D7NA 2AQ3A 3TFKC 1AXIB 4KJPD 5JW5B 3QUYC 5CEYB 1EO7A 2P5WB 3LRHA 4YXKH 2BP3A 1NAML 4NUJB 5TF1H 3GMQB 4XCFL 4UU9B 5I74C 1NFDB 4UOW1 1DVFA 3O2WH 1OGAB 2ADFL 3QXDA 1IC7L 2C9AA 2VLJD 3BGFC 3NZHL 5EZIL 2YA0A 4N0FB 5B3JF 4JJ5A 3WHE0 2K7QA 5IBTH 4AQ1B 1I1YA 1GIGH 2NNAB 3RWHB 4XAWL 5AG8A 3FN0H 1EFXB 4HWBL 2YA2A 4LPXA 1D5MB 4P5MB 1NCBL 2HFEB 2GEEA 4UIKH 3WS3A 3RIFF 3BN3B 4C58B 5F3HA 5F96L 5CGMA 4PGJA 3U4EA 4AEFA 1EO8L 4ELMF 1E4XL 1GOHA 1PY4A 3UYRH 4JRXD 4X4MA 5I1DB 1HILA 3KNBA 5IW1B 5KSAA 2IBZX 4F2MB 3CXDH 3LRGA 3V4VL 3V6FB 3QULB 2DJ4A 2KZ1B 1P84K 1B0RA 3GJFK 2DF3A 1DBKH 1NDGA 4LPWA 1TJIH 4JREC 5H37G 4LCCB 4Y5YC 4ZO7A 3BRGC 1B0RB 1WBYB 5F89B 5IB4B 1YEFL 5F9OH 3T3ME 2KZWA 1IVLA 5HJ3B 5TQ0L 3ARUA 2LAAA 1WBYA 1P5UA 2R8SL 3Q6GL 5CD5C 5EU6A 5IUSA 3WIFB 4CMMA 3OHXB 2V7HA 5A3ID 3I6KB 2K3TA 3BQUB 1P7QB 5JA8B 3SDCD 4PB9H 1OM3L 4P46A 1FYTA 5KN5A 2XKNB 1TMCB 5L9DH 1NUGA 3V8OA 1IAIM 2BNRB 5D7JD 1LWRA 3QCTH 1R3IL 1NBYB 4JFZH 3E1F1 1WVZA 5FCUH 3D0LA 3MNWB 4IRJA 1RUMH 4YIQB 4U31A 5FM8A 1GIGL 4Y1AE 1WZ1L 4PGCA 1NLBL 1G6VK 2FCBA 1LO0L 3NIDE 4OQTL 4HCRL 1A9BA 1I8KB 4XZUA 1X5HA 2PKDA 5EO9B 4PJXA 4EI5D 1V3MA 3WLBB 1MCOH 3U6RA 1NC2A 5E2TL 2BMKB 2QHLA 3T3MF 1NMAL 4X9HA 4UI2A 1J8HD 3HRZB 5KZCB 2P24B 4WY7H 3B9EA 4HX1A 4WUUE 4JM2D 4KHTL 4O00A 3VFRB 1DN0A 4PJBA 1F45A 2VDPL 5KAQG 1I85C 4X0KA 5T1LA 3H0TA 3SDAB 4OFIA 4E42A 4J4PA 5L2JB 4L8CA 4ZFGH 4JFXB 1NUFA 4MX7B 1T66D 4QWWC 1F90H 3TBWA 3UTTB 5D96B 2RQ8A 4FS0A 3B8SA 2ATPB 2PN5A 2PO6C 3RKDC 4Z5RB 2YN3A 4GUPA 4QYOA 1JNJA 5B39G 3FRUA 4OF8A 4G9FB 2O61A 1K6QL 5I8CA 4X5WA 4ZQKA 4Z7NF 1AGEA 3VH8G 3S35L 2FSEB 1B0GB 1GAFL 1ZHKA 2ERJC 4Y5YA 4C59B 1A4JB 2MCG1 1BHGA 4PV8A 4AT6B 4M5ZH 1KN4L 4UIMA 1H3VA 2B0SH 2AV1A 1T2XA 3QPXH 2PCPB 4I5BB 4RGNE 4DZBB 1QEWB 4HC1H 2DQEH 5B38G 2FIRT 2VQ1B 3I50H 4D9RD 3MOQA 3TVMA 2EO1A 4X6EB 1S9XA 3NFPA 5I1AA 5D9SA 3AY4C 1JZ4A 4M7ZC 2YK1H 3A6OA 4X6EA 3WFCL 2F5BL 2D7PA 3VD7A 1JWMA 2YRZA 3GFUA 1KNOA 5E56A 1SEBA 3QIWC 1OF2B 2NY6B 3DURA 3FRUB 4XNMA 5E5MB 5FHAH 1IBGL 1UXWB 1MCSA 3O6KL 5GGVH 3RPIA 3WKMH 1DANT 1KIQB 1ZT7B 4LDOB 5CHNB 1Q0YL 2WWMD 1YNLL 2CK0L 3WN5A 4PGEB 4ZFOA 1TJHL 3P73A 4P23A 4M7ZB 5C6TL 4KRPD 3NAAH 3VCLB 4WTXA 3BD5A 4AJ0A 3EJYC 4ZS6C 4AENA 4F7TB 2AAVA 1MIEL 3MUGB 4PJAA 2V5MA 1EK3A 4NCC2 1CWVA 2J3SA 3RPKA 5DSCB 2K7PA 3SBWA 4QRRD 1HHHA 1FNGA 1WIOA 1YPZF 2LFGA 5D9SB 3ZYOA 4WCYH 1UH4A 4WFFD 2EE2A 3AU1A 4X6DA 3FHQA 2AW2A 3BESR 2F58L 5E2UL 4JY4A 4JFDA 3FQTB 5EFIB 1QA9A 1U8HA 4XVSL 5CBEA 3DETD 2NXZC 3PWUA 4LLWB 4OCMC 1LO5B 1U8KA 2Z31D 4Y8AA 1KN4H 2LV4A 4NOFA 4OJFL 2VR4A 3FZUC 5FYJD 1CT8A 2CDFB 5EORH 1NMBH 4U1KB 4U6YB 5GGRB 1B9ZA 2B4CL 4MB4A 1X9QA 5A16B 1KLFA 2IQ9L 1VCAA 1OPGH 1EEZB 1M05B 3ZE0E 3CVHA 1JF6A 3P9LB 3TN0C 3HUJB 5E99H 1WC7A 3P4MA 3TIDA 4WW2B 1A6VH 2I9TB 2BHYA 5I30H 5EIIB 4K2UL 5E2VH 3LEXB 3QCUL 1ZXQA 4V2CB 1H3UA 5GGSA 3K4DA 5T33L 3IDMB 4XH2B 3X17A 3PGDB 1ZT4B 2NXYC 1WWCA 4JE4B 3O2DA 3PGFH 3FTGB 3O6FB 3UAJC 4GW1B 1LP9B 2W9EH 4ESKA 4OCWH 4YHOL 3VXQB 1C08A 3VFNB 3WD5H 5D1XA 5L8JB 2DBLH 2IG2H 3EYFA 5L2KD 5C09B 4XXCA 3ZKXB 1EGJA 3K8KA 5GPRA 4OGYL 2R56H 4MVBC 5KSBE 1PYWA 1YEGH 3QXAB 5INCA 5HHQA 1H0DA 1P1ZB 1LO4L 2VAAB 2PYEB 5J9PB 1M7IA 4KK9D 4EQ3A 3NBNA 1XZ0A 4RNRA 3U0PB 4YFLI 1M7IB 4YO0A 3X14A 5FFLA 3BO8B 5I30L 3G6DL 1BD2E 1UWXH 1RZGA 5FECA 2E7CA 4FQ2H 3OKYA 1ONQB 1KPUA 4PG2C 4R7DB 3TBSB 4KI5E 5SWSB 4DGVL 4DFHA 2DQUL 3UYOD 4FQIH 4YEEA 1MSPA 1R6VA 1NJ9B 1SVCP 3MJGX 4RISH 1LP9A 1ZK9A 4KVNH 5FGSA 1TTUA 2QL1A 3QQ4A 2CLZB 4OCWL 4K8RH 4KZEH 1L6ZA 4PJIE 1OPGL 2H8PB 3AREA 3ARDA 1ZA6B 3AXLB 5ACMA 4RWYL 5CJXA 1K4CA 4F7PB 1VDGA 5IBLC 3U36B 3IXTB 4X7CC 5ITFA 2FLRT 1Z9SA 1S9VA 2Y9RT 4XNZB 3MRKA 1NANI 2XRAH 1ZVYA 3BMVA 3FO0H 3SDDC 1FP5A 1D9KC 1N2RA 3VXUB 4DGYH 3FB8A 2V5YA 1E28A 4JRWA 2AXFA 5DJAB 3NH7H 5F1NA 1OTSC 3BPNB 3TV3L 4OGXH 5DC0A 2BNRE 3BISA 4UT6L 3X14B 4GAGL 3NIGE 3PWLB 5J06A 2OP4H 3FO9B 4FXKB 4QHUA 4X80L 4JJ5B 1I8IA 1NUNB 1R3LA 1F4WL 3O8XA 4XMKL 3MLYL 4XPTH 1KTDA 2XPGA 3T3PF 1QR4A 4WW1A 5EC1B 1CVSC 4PY7B 2X2YA 4MJ2A 3I84A 4BFEA 3WL9B 4KU1A 5C3TA 2FGWH 4K7FB 3F58H 4PJ9B 5FYKE 2BCKB 4JDTL 4PRPE 4WW1B 5EC1A 1KENL 4D0BA 5BXFA 2LQRA 5DGRA 2X4OA 2NZ9C 5HBBA 5C0JB 3VMOA 1Y18B 4NHUB 1LDSA 1URLA 2F74A 4G6AC 3VXOB 3WCYA 1YEHL 1IL1B 4YE4H 5BZWA 1QOKA 3OKDA 3F7VA 3QDMB 4NGHH 4PGDB 4KK5D 3ARYA 2HRPH 2K1MA 3TYFA 2VE6B 2RFXA 5DUPL 1BP3B 1E27A 4PGDA 5KVDL 2FATL 4BK4A 1LD9B 3IDNB 1BREA 1R5IA 2VAJA 5HDQL 2F54D 4UUJB 3CLFL 1QLEL 3DECA 2EC9T 5J1TC 3HC4L 5INDA 1QYGH 4NKIL 5D7SH 5FYLE 4DUVA 4OSUL 2VL4A 4L3EB 3M17A 3MLWH 3E2HC 2CLVB 1X5FA 1U8IA 3WL9A 3DYMA 5GSVA 1DQJB 2WBJD 1G0XA 3T0ED 5C0BD 2Y5TB 3CLFH 5BMFH 1M1SA 3FB5A 1Q1JH 3TC9A 5CZKA 3ULUF 2OJEB 2YUVA 4L4TA 1AIFA 5EU5B 3SDAC 4ZFZA 3UTTD 1QYGL 1JGEB 4XXDA 1GJIA 5B3JE 5ADPH 4PUBH 1DBJH 2B20A 5JW4M 1FC2D 1KPRA 2Y36L 3BPOC 5T5NG 5BMFL 4YDKH 1V8HA 2E7BA 1TNNA 2XTLA 4H1LA 2C4FU 3WJJA 5IEKB 1K6QH 5IFAL 1WBZB 4F7MA 5D6DC 1SEQL 3RKDD 3WNPA 1RK1B 3MSPA 4TQEH 4JKPL 1HEZB 2NPLX 4M61B 3HI1A 4JDTH 4LAQH 4KKLD 4QO1A 5D1XD 1KN2H 4N9GB 2G9HA 4QGTA 1L9MA 3S6CA 5I19L 3HAEB 4BH8A 3TBTB 2O5YH 4P23D 2Q3AA 3MZTA 4RGND 2JB6B 2EEAA 1A6WL 3CVIH 1D9KD 1S7TA 3C60A 3UTPE 4ODWA 2NXZB 1CS6A 3PWVB 4HIXH 4I8DA 2VXVL 3HZVA 2H32B 2P44B 1W0WB 3IFOB 4YHNA 3QQ9D 3V0VA 1G9NH 1GC1H 3OMZA 2Z8SA 3BQUD 2GCYA 4HK0B 2X9YA 4PJDE 4XPAL 1IEBB 3V6ZA 1K4DB 1YEFH 2P8LB 1OP3H 1KT2A 4GS7C 1NEZB 5C0BE 5FCUL 1BM3H 1OAUL 2P8PA 3H9SA 4XBEH 4NKDA 4X5XA 3KS0H 3U7YL 1BOGB 2CDEB 2XG5A 1E0OB 4JFFA 1W0VA 4WIQA 4QRRB 5I76B 5DMYA 5J1SC 4OV5B 3NCBB 1E4XH 1M71B 1N7ML 2V2XA 2DI7A 3TPUB 2NY1B 3AB0C 1G6RB 4C56B 4LIQL 4DCQA 1IGJB 4KRPB 4X4XA 3V7MA 3TPUA 5TH2A 4LLVA 3R8BB 3D3VA 4L8BB 4YHKL 1IGCL 3HZVB 5C0DB 1Y0LA 4O5LL 1MRDH 1ZANL 4YK4B 1H3PH 3ROOB 3BWUC 1T3FA 5JORA 3VXSA 1MFCH 43CAA 4PJDB 4PBXA 2R15A 3NZHH 5DZOA 3HI5H 3ZHLA 1AH1A 5F7LB 3BUTA 1OGTB 2GY7B 4M7KL 4OLUH 5E6IB 4K07A 1U58B 4IMLB 3UXFA 3OBAA 4F2MA 4LPYA 2NXYD 3EYVB 4KDVA 4DGVH 5TFSL 3RWJB 4A2MA 2Q76B 5I76A 3P11L 4OV5A 3UDWC 4OFKA 1N0XH 5FGCE 4AIXA 2JIXA 3EYQC 3E6FB 4S1RL 3ULVF 4I13B 1MHCA 4FQLH 2L7JA 1BIIA 2NCMA 2NXYB 1NFDA 1OAQL 3TN0D 4NCC1 1F6AB 4YH6A 5E6ID 1HHIA 5GS0H 3S98A 3RVUC 3ARGB 1NBZB 4HWEL 4MHHI 1RURL 3QHTC 1ITCA 2CUIA 1IILE 4Z7QF 3QCUH 5L7XH 3SDDD 3V52L 5MEQB 4OZIA 3V4UL 3TZVD 2CO6B 3RWEB 4WFHD 4HH8A 5MI0B 1YN7B 4N0UA 3HE6D 1X7QA 1NMBL 4HIEA 4TNVF 4K9EL 1N5YL 3CSYB 1IFHL 3RVWC 3U4EB 4C56D 5DEZA 3SE9H 4LNRA 4QHMA 4ZG1A 2XACC 5C0CA 2VDRH 2WANA 1WEJL 3MJ9H 4M1CD 3VFTA 2HFEA 3HMWH 5I1GL 3VFVA 4CRPA 4OM0L 5DD3L 1UCBH 3O6MH 1L7TL 3SOBH 7FABH 1J8HB 4MNGA 2XOTA 1K2DB 3LQAL 4Y7MA 1S7SB 1U95A 4LLMB 1ORSB 1JN6A 4V1DB 4ZNCD 1MI5E 1YMMD 4ONHB 5DUBB 3D9AL 4DKDC 3U2SA 1HCFX 3ZTJG 5AZ2H 1OCWL 3H9SE 3QYCA 3U2SB 4YNYB 1CTOA 4K23H 3IU3A 4JCLA 4AEEA 1XF3B 4Y2OA 1W72B 5HHMB 2J8UA 1FLRL 3OR6B 3CFIC 4BZ1L 5J56B 1A47A 3QFJB 2CIKA 3CFEB 3NPSC 5CSZB 4ZAKC 3G6JA 3NCCB 1AGEB 2YPLA 3ZT6A 1L6XA 3WKML 1MWAB 3CFBA 1CD1B 4GAGH 2YBRB 1MH5B 5DK0A 2X4PA 3D5OF 5DFTA 5EO9A 4KMTL 1AHWC 4EXKA 3KLHD 3DIFB 4HC1L 2CKBL 3TN0A 1TZHB 4AL8L 3HC0A 2EZ0C 4GMSL 4CADA 4G8IB 3NCFB 4U7KA 1FH5L 4F7PA 1NL0H 3MRJA 1OW0A 2A9ML 3EO0B 4R97B 5IFHH 5JTWA 3LS5H 2O26U 1JTTA 2UWEF 4R4BB 4FQ1H 5CZVH 1DN0B 4PJBB 3TCLB 3BD3A 1BAFH 4X80H 4ZAKA 3BEWA 3FO2B 1JWMB 2J1KA 5J3HC 5SX4H 3SO5A 3OJVC 4JDVA 2EDEA 1IGML 5MEND 5ILTH 1DR9A 4FXGA 4PJEA 3DUSB 4R0LB 1QRND 3GBMH 4NQCD 4NO2A 4PLKD 1A6AB 2V9TA 3C6LC 5EOQH 3JWOC 3QO0A 5F7KC 1KIPA 4U6HB 1JP5A 3VH8A 3P30H 3BZEA 2UY6A 1F2XK 2P5ED 5AAMA 2QQQA 2IPKA 3G9VA 3DYOA 2DQCH 1I8IB 1U3HA 2VZSA 3DX6A 2HMID 2X10A 3GKZA 4EKXA 3PGCA 5IHLB 1UACL 4Y1AB 5F7YC 3CUPB 3C60D 2ADGA 4X5WB 3WS6C 1AI1L 1SY6A 3EW3B 1ZA3A 4YHLH 2XTJD 4FQXA 4NQED 2EH7L 3U7WH 4L8SC 3L5JA 1ZGLP 4K94H 2GSIA 3BOVA 5IBUG 2ZPKH 4OLVL 5L6YL 4MDIA 4WI8A 2E9WA 3LH2L 4K3EH 2PTTB 4XNUL 3TA3C 4Q0XH 3AUVA 3L3KA 1OP9A 5EOCL 4DZ8A 2OSLA 3OF6D 2FIKA 3B5GA 3MRDB 5D1ZD 1R3JA 1ZV5A 2LU3A 4CVWA 4H8WL 3P9LA 5JQ6H 1S9WA 4X99B 4FFWC 3KWWB 3D69A 2DYPB 1XH3A 4ZUWA 4PREA 2OQJB 1KIRB 3IU4H 4MJIE 5IVXA 5JMOC 1FJ1A 5F7DA 1N59B 4K3EL 3FMGH 3VMPA 3ZL4L 4KDTC 4M1DL 5CWSA 1JRHI 5DHVA 3VXSD 5IB3B 3N85L 2NY6C 4R4FH 4OCLC 3HNTL 5EO1A 2MPAL 3GSNB 2M26A 1XF4B 3HAEH 1ZA3B 3R1GH 5I0ZA 3WIHL 3WDHA 4QRRE 1OB1A 3SGJA 4J4PC 3MRMA 4JAMA 3U82B 2XWJA 5HDOA 4XT1C 2EXYC 4LU5L 4G80A 3RAJH 1H3PL 1L7IH 1AP2B 3STZA 5IESL 1ZLVH 2A6DA 2D2OA 1HDMA 4NNPL 1WZKA 1BX2A 4X4YB 4FZEL 4C83B 3MZGB 5B38A 4UDTA 5DI8A 4PJXE 4X6DB 1DQMH 2N7AA 1YC8A 1EV2E 3WE6A 5GGRA 4LAQL 5CEYA 3TT3H 4X6BA 3VXUD 4UNVA 1A0QL 4Z0XB 5TE4L 3QEQD 2FJHB 3MUZ1 3NGBB 3TZVC 3HC4H 3EDJA 1U91A 2E8ZA 2X4RA 1CT8B 2KL6A 5E8EA 2QKIB 4ODHL 1ZT4A 1A1OA 4WTWA 2CMRL 4PJHF 5F97E 2BRRL 3AAZB 3LZFL 1X5YA 4YGAB 1L0QA 3RWCB 3L3OB 2X4QB 1WFOA 5FAAA 2XN9A 2ADFH 4FTVE 4TSAL 3FT2B 5SWSD 2J6EL 4LRIC 5E95B 1KLUB 3DI2B 3GIZL 4JFHE 2EYRA 1OLLA 3T2NH 5C0CE 3X12A 1AGCB 2JJTC 4PRNA 1QLEH 3HPLA 1T7ZA 4P2QD 5FEBA 4XBPA 5EU3B 1IQDA 5IQ7L 4LHUA 2ZP0T 3WFHA 3DHJA 1IQDB 1G0DA 1KEML 4Y4KB 4K94C 4GQ9L 5HGDB 3FO9A 3ZHDA 5C09D 4F80A 1EHLH 2F15A 3MV9D 1UJ3C 4FFWD 2GJZA 3HPJA 3MRLB 3O3UN 3RDTB 1T1ZA 3AAZA 2VH5H 1UXSB 4YAQB 15C8H 5ALCH 3LZFH 2GJZB 3SDYL 1Z3GL 1DFBL 1IM3A 3CDGA 3QQ3B 4ZFFB 1RIUH 4TUKH 3O6FD 3L3OA 1IKNA 4YBQC 3VGBA 1LEKA 3ZSTA 4P59H 2XRAL 3X13B 4BQ8A 2EYRB 2W60A 2Y7QB 1X5IA 4NWTL 4MNQE 3OJMB 1FC1A 4FQHA 5KS9F 5E6ZA 4IM8A 1NEZG 5BO1H 4UT9L 3EHBD 1FFOA 1FPTL 1M7DB 1R3HA 3RUGB 2UZIL 2VZ3A 4J1UA 2YD3A 5F1NB 4H0GA 2R39A 3IXTA 2BHZA 1MJUH 1I3GH 4HKZB 1FGVL 4U1GB 1QFUH 4N8CH 2D3VA 5GJSL 2FX8L 4QOKB 3T4AA 1G7JB 2A38A 5ACZB 3SGJC 4L3CA 5FKPA 3VFRA 3RWFB 2B5IC 4P2QE 3VU2A 4I9WD 4AG4L 2IAMA 4PGBA 3QZWB 4PLKC 4D8PB 1E4WL 4OZHF 4J3SA 1P7QA 1R0AL 1MCOL 1QLFB 2ZOKA 4NBYB 2YR3A 4JFEA 1ZS8A 2V7NB 2XWTA 3DX8A 1F11A 4ISVB 2XKNA 5E2WL 5FYJU 3WO3B 1JZ8A 1J8KA 3EJYD 5IKCA 2DYPD 1QHOA 4BUHA 3B6SB 4NRXB 2VXSH 3QULA 1W2KT 1G7HB 4GW4B 3SGDH 4M7KH 1DDHA 4YIQA 3WJLA 2IAMC 4F15C 1NDGB 4OF7A 3BJ91 4ZD3H 2EDLA 3CNKA 5FUOL 3PP3K 4WFGE 1KTLA 3EO9H 3MRRA 4C4KT 2YRLA 3MRPB 4G5ZL 5JHDA 5HD8D 4ZUUB 3I2CH 5FGBA 4LP5A 4PTTB 1IGCH 3MCLH 4NQEB 2GQHA 3UBXB 3IRPX 5E00B 4PRDB 4NC2B 5HHOD 3TO2A 3L1OL 2Q20A 3QZWA 4HXBH 4D8PA 2VC2L 2Q8AL 5LJYH 3D25A 35C8H 4GRMA 3VXRB 1ZSDB 5BZDA 1CFQB 5DMKB 1EAPB 4U1JB 1WWWX 3LKSB 1G9ML 1TJIL 3MUHL 4ALAL 1AD0B 5DMKA 3T1WA 5GRJH 3DROA 3OR7A 3FONA 5ILTL 4ZO6A 2CJUH 4AZ8A 4UV7H 4QTHA 4QRPA 2E27H 4C56E 1GHFL 2H26B 3HR5A 1T89C 4ZUSB 4I9WE 4TUOB 5T1LD 5AG9A 2IPUK 1KG0A 5C07B 3U9UA 1SMAA 3HZKB 4Q9QL 4NQCA 4CL7A 2GT9B 1B0WA 3PL6A 1RJCA 2H41A 2YC1A 2A74A 4L4TE 3ZE2E 3EDEA 3MJ8B 2OXHA 3DIFA 5FHBL 3VFPA 2HVKB 4FQCH 2Z8WC 3DPBA 1OL0A 5JLZB 4YGVA 1EAJA 2MOVA 1GRWA 4PTTA 3E3QC 3QNZB 4NCDA 1JYVA 4QRQA 2X7LB 3KPOA 5EZLA 4OZFG 3MRFA 3T1FB 1U8LB 5HVHB 4GKNB 2AEQH 3G5ZB 3ALPA 1NGYA 1D5BB 2R1WA 4YUEH 1LO5A 4B41A 2OZ4A 3D39A 3KPRB 1PEWA 3LCYA 1QD0A 4QHNB 3BW9A 5EORL 1C1EH 4IRSB 3HN3A 3WUWA 4U1KA 4U6YA 2BNUA 1KEGL 3HLAB 3RPIB 4X7EC 3SJVB 2ZSVB 4H20L 4TUJA 4L1HA 4WW2A 4JVPA 2PXYD 3NA9L 2R1YA 4X9FA 3HE7B 4TVPL 2R0ZL 3IKCB 3K80A 2PCPA 3A6CH 3PGDA 4PJ8A 1ZHBA 5KSVA 1TXKA 4PJAB 5I9QC 3OGOE 2UZXB 4TNVK 4X7SL 1EZVX 3BP5A 5CBAA 5IMOB 3CU1A 1T5XB 4XRCB 5DTFB 1ND0A 5DMIH 4Y16A 3MJ9L 4JRXB 2DQHL 4LRNH 1D6EA 2DAVA 1FV1B 4WO4A 3RHWK 3QI9B 1ZHLB 2AJUL 4HF5H 4L4TD 4QRSA 3SOBL 2VSCA 3QUMB 3KJ6H 3AMLA 2ICEA 3IFPA 4Y4HB 5JDJA 4XWOD 1HKLH 1JZ6A 4F7CA 1P7KA 1KBGL 3OKLA 4I3RL 1BJ8A 4HIHA 1WLHA 4WHTB 4MCZB 1G7IB 5GRUL 2Y07H 3CVHH 5GS0L 4I2XE 3CIQA 3REVA 3FQXA 1BZ7B 3N50A 3IAGC 3VI4F 1G7IA 3VFTB 3L3JB 1K3ZA 4L9LC 3FN9A 4EUPH 3DVNB 3WEXA 3WYRA 5EB9A 3V95A 5D2NB 1OAKH 2P5WD 1VB9A 3FKUS 3KYOB 2BRQA 3GBLA 1U9KA 4MHHG 4IMLA 5HYFA 2R9HC 3PL6D 4WUKL 2CH8A 4IOFD 1JNLH 3U36A 3G5XB 4WI5A 1HI6B 1QACA 4QRTA 3OG6B 1R5WA 1QFWM 3B5HA 3K2MC 4NN7C 5IK3B 4ZDHB 1BQLL 1MHHB 1U8NB 2YZ1A 2HT2C 4JPKH 4PJIA 2VERN 5MP6H 1X5AA 2AXFB 1VEPA 3IDJB 3DXAD 1YJDL 1JBJA 1FDLL 4YDIH 4BFIB 4JZJC 1PG7L 5F3BA 5CILL 4YJZL 3MCG1 2FH6A 3BO8A 5C70A 5I71C 3TVMC 4OD3L 1JPFA 3VGDA 1QO3B 1F4YH 1NCAL 4EIGB 1FO0A 3UBXI 3RUGE 1BECA 3MLXL 4WO4C 3D39D 3KNBB 5KSAB 2AK4E 5C0CB 5D2LB 2DQGL 5FO8B 4D0DB 3B2UD 1QFHA 5C0GA 5C09A 5I1EH 2AJXH 3OXRA 1MI5D 1N5AB 4BSVA 3BGFB 4Z0BH 4HKBB 4D0DA 3F7RA 1PKQE 2HVJA 4LHUD 5D7KD 1X5GA 2Q8BH 3WFEL 5F96H 2PTUA 1T4KB 4HCRA 1P1ZA 2IGFL 1XCQB 1N7MH 3JV4A 3WO4C 3IJHA 3U9PL 4J8RB 1CLZH 3MBEB 1VEMA 2B1AH 3QIUB 3RX8A 2X4UB 4H8WH 1BOYA 2A73B 1EVTC 3HNTH 1UZ6E 4NO5B 4KKAC 3E0GA 1DTUA 3MRNA 2VQUA 1FLTX 2X4UA 2HN7B 5SWSA 3QWQB 1KCLA 3ELAT 5K9KA 3KPQB 1ACZA 1I7TB 4G8EA 2FD6L 3FT4B 1NCDH 5E1HB 4JY5H 1FO0B 3S4SG 3CMOH 4KVNL 4U1GC 5GGVY 4LNVA 3WUZA 5TQ0H 4L4VB 5D70H 3PGCB 4QOKE 2W1NA 2Y5EA 5F8RC 4TQEL 4ZXBC 4NT6B 3EDKA 4HUUA 4MJ5A 2CRIA 3H3PH 5BV7B 3O4LA 5D72L 5JA9A 1JI1A 2B5IB 5I66A 5HTSA 1U36A 3CCHA 4MJ5B 1OAZH 3KXFD 5I8EB 2UY7A 4JFYB 3U4BH 2ZUVA 4KQ3H 1R5VB 1LE5B 1FVDA 3JXAA 3OAZK 3T4YB 4D3CL 4J2XA 3BKCH 3JUYA 3BYYA 5EOCH 3GSUB 4S1SL 1NC4B 4R0LA 1YQ2A 5IFAH 4UB0L 2BY3A 4Z7UF 3TIEB 3UTPD 4NWUH 4KUCF 1EEUA 5JHLH 5DRZB 2BC4B 1MFDH 3SKJL 1QSFD 3MXWH 1A5FL 3GIVA 3S9DB 3I75A 4MYWB 4OTXL 1CD8A 1V7NH 1F4AA 2VL5B 2ORBH 4LHUG 4NO2B 3W9DB 2BFVH 1PG7H 4K7PH 4PJ9C 4RIRB 5KOMC 3MNVB 4KKBC 5ESVB 4X6FA 4JLRB 3ZDYE 3C2SA 3M17B 4OFVA 1R3KA 2E5EA 3L5WB 4POUB 2Y4SA 1XR9B 3CJJA 1NLDL 4JO2H 2NY5C 4NGHL 4L3ED 1F5WA 2NLJB 4U1NB 5DR5H 1CBVH 1G1CA 4D0CA 1N8ZA 1IGMH 4OLYL 4MA1B 3V0VB 1IL1A 5ERWA 4ODSL 4NPYB 4BZ2H 4PJ5E 3S4SB 2HKHL 5IG7B 2ZCLH 3V2AR 1T1XB 2DM7A 4MNHB 3TYFB 1DDHB 4P5TC 2VLRB 4R8WL 1LEGB 5DC9B 1J87A 1KT2B 5LKNA 1UM5L 4YPJA 4HUVA 2XA8L 4JFFE 4ZYKA 5DFVD 4NQDD 3GSRA 1M6OA 2MWCA 2OS7A 4NKMA 5DJYA 4PJFB 3GSXB 3GK8L 1X3DA 3M07A 1T6WA 2VL5A 2JELH 4MQXD 2G9HB 1JZ7A 2JCCF 1MRCH 4GKZB 1YDPB 3F5WB 3RVVD 4X6FB 4JQVC 2ED7A 5A43C 2EE6A 1HK6A 3MLUH 2XZAH 2NX5B 4ELMB 1RUPL 5EU5A 3Q1SH 2O93L 1I75A 4LKCA 4JKWA 3QCVH 4P2RE 1YY8A 5EBLA 4MVBD 1ZLWK 3LOWA 1JPSH 1X44A 1B2WH 3GHEL 4K55A 4M7JH 2DN7A 4LASL 1HHGB 4UZGA 4MSWB 3QIWA 3MUJA 4MNHA 3KPSD 1NDMB 3VXPB 3OAZH 2A6DB 1DQTA 2XWBB 2OR9H 3UTOA 5L88L 3DMMD 2Z31A 4MAUH 4KPHL 1WFUA 2XZAL 5CJOL 4X83A 1T7WA 4HS3A 4YHYB 1AY1L 4JHAH 1M6OB 4I18C 1JF5A 2YA1A 4FN0A 5I6XC 3ORJA 2FO4A 2GAZA 4DKEL 3PDOB 1LILA 4L9LB 1OARL 1CFNA 2GJ6D 3NH7L 4YGVB 3ULSB 3QFDA 2ZUTA 3LSOB 1KV3A 4M6NH 3N9GH 2KH2B 4UV7L 1UH3A 4L9DA 3RNQA 5B38B 1GOGA 3ARDC 2AJYL 5DO2C 3TP4A 1ZMYA 3TBVB 5C71A 5D6DA 2C1PA 2HT4C 5ADOH 1EUUA 2Z35B 3RY4A 5GRZA 2DLHA 1U92A 4HV8B 4I18B 4GJTB 1J0YA 3UTSD 4OI8A 4OZ4A 2HKFH 4NO0A 3RWCA 5F7EL 5DVMA 1FCCA 1EXUA 2A83B 1DUYB 1ZGLB 2P8LA 5E8EB 1H8SA 3DXAA 5GRVK 1CE6A 4ZXBD 5LCVL 3FT3B 3VFOA 4RFEA 5KG9A 1BOGA 5FO9A 1QQDB 4FQ2L 4QHKI 4PS4L 4YBQD 1KPVA 3H7BA 3IDIB 3OX8A 3TJHD 3I02B 5AAWA 4UQ3B 1MJ7L 2I9LB 1A9BB 2N56A 3CSBA 5CMAA 2WUBL 4BELD 4M9OA 1MI5A 5DS8B 5TDOA 4FQLL 5DF0A 5C09E 4YHOH 2EEBA 1AHWA 3NOIA 1CGXA 5EU6B 5DWUL 4PP2A 1GHFH 5JPNA 2C3XA 3L3HB 3PHQB 1TZGH 5SWQA 5BVPH 3LPFA 1O7VA 5J8OA 1T3FB 5ESAA 1WZ1H 5T1KA 1MJ7H 1ONQA 1VPOH 3TBSA 1WSST 1ZGLA 5J57B 1RK0A 1I9RH 3BAEL 3U9PH 4YC2B 1NCTA 1I1FA 3JVGC 3S5LB 2FJFA 1EFXA 4QXGH 3QJFB 25C8H 1VFAB 4LQFH 3GGWA 5I1DA 4P0DA 2DQJH 3JZ7A 2EDXA 3H7BB 5IP4A 3VXMD 5IM7A 4N8VB 3GHBH 1M7DA 3FQWA 4NQVA 3UTSE 2FD6H 5E03A 5ITFB 1JZ2A 1L4IA 4RBPH 1MFEH 4ZPTA 1QRNA 3X3FH 1TTFA 3MRRB 3LV3B 2GK2A 1OAYL 4NP4L 4IDJH 5EC2A 2OR7A 5IW1A 5E6YA 4ZUUA 5IFHL 5GHWL 3GSVA 4LSPL 4O2CA 1NCWL 4F37K 5HDBE 4HT1L 5A1AA 2AJYH 1MQKH 2EO9A 3K4ZA 4K3HA 4XAWH 2JIXD 5JOPE 3U79A 3LEYH 3MC0A 2ATKB 4OKVB 2P5WA 5D7LB 5AYQA 2ESVA 5CP3H 2VR5A 2HFTA 1FZKA 4CDGC 3HKFA 5ICZA 5HYSG 5TPWH 1F4XH 1S7WB 2MQCA 4PJIB 1EA9C 4QOKA 1A6AA 4U0QB 5LGHL 4JO1L 3NACH 1KCVL 1KJVA 1G7JA 3V7AE 2E7LA 5D7JA 4KKLC 1U3HD 1GZQA 3M1BB 2YUZA 2F5BH 2MCPL 4LGRB 1HSBB 2C3VA 3U48A 4JN2B 2APBA 3IETA 1NSNL 3AS3A 1AC6A 1MWAA 3CFBB 3ULVC 4FG6D 3MJ9A 4PGEA 3ARBA 4UDUB 5DURD 4LLDB 1AO7E 1P4LB 3RZCA 1AKJD 3VXOA 4H1LH 2QEJA 3O0RH 5DJZA 3S88H 3DMMC 3K2UH 5C0FA 1MLCB 5ICYB 2BDNL 4U6XB 1S9XB 4OLXH 4N8VG 1I3VA 5EUOE 1C5BH 1FVEB 5ISZA 1GAFH 4NKOB 3UCRA 3X11A 4FXLA 5I0DA 1B4JL 3DX9A 1FNGB 1U8LA 4MA7L 4IJ3B 4GAJH 3RGHA 4QTIL 2YD4A 4H25B 5JUEH 4XVJH 2HFFA 5E8PA 4EVNA 1S5HB 1T0NA 3OZ9H 5I17A 4XCYB 5IB1B 2B1HL 3UTTA 3IFLL 1JGVH 3RNKA 1YNTA 4JRXE 5J13B 2YPLB 1DFBH 2CLVA 4KRNA 3DXAE 5C0AB 3SE4A 3RVVC 5GQBA 1INQA 3W82A 5GGSY 4MQXC 3DBXA 1CXLA 2FEDD 4GRWF 3UZQA 4L4TB 2G75A 1A4JA 1A3RL 2A6KB 4OCSL 3U0TB 1F42A 3C5JA 3MLSH 3RZCB 3FONB 1RFDH 4NC0B 3V52H 3QZWG 5GGTH 1ZLWH 4X7TB 3HFML 1IGYA 4OSUH 4NQSB 4ZQKB 1YN6A 1W0YT 4AY0A 4J23A 4Y89A 3BKML 3L95A 4YR6B 5HGBA 2OM5A 4XP5H 1KENH 1DQLH 1CI5A 3VRLE 4PGCB 3C09C 3C6LA 2VDQL 1EUTA 3VG0H 4LU5H 3KLDA 3KS0J 3ILPB 4QT5A 4L3EE 5F7HA 3QHFH 2YEZB 4ZNEA 4GMTH 1CIDA 4Q6IA 2IADA 4U6TA 6FABL 2VDNH 3RZCC 2ERJB 1F4HA 3IXAA 4JO1H 5E1AA 1CLCA 1NAKL 5HGAA 3TBYB 3QNXA 4UT6H 2H6PA 4OLXL 3MCKB 4PJHB 4OF5A 5C7XH 3SQOH 1ZVSA 4XNYL 3C08L 4Z0XA 1JPTH 1RZ7H 4MX7A 5JQ6L 4HJ0D 3GRWA 4KQ3L 4YHPB 2X4NA 1F58L 3QDJA 3QB7C 2F53E 4M3KB 1FN4A 1FRGH 4OZHE 1RZGB 2EZ0D 1MRFL 1EJOH 1CDGA 2NTFB 7CGTA 3O6FA 1F4WH 3L5WA 2V6HA 1Q94B 3QNYB 4PRPD 4UTBL 4UMGA 2MPAH 2XIDA 2VLLA 3H9SB 4X8JA 5BV7L 2EH8L 3TA3B 5TE6L 3KXFE 4XP1L 2XWJB 2IFFL 1FL3B 4OB5L 4YPGB 5IBUB 4HWNA 4Y5VB 3QIBA 1FL3A 5TF0A 4M93C 5T5FH 4I0KA 3JBG7 2V2XB 5D1ZC 3QA3B 2HWZH 3MRCB 1QSED 4MXWL 3WDJA 5DT1L 3MBXH 4KKNA 2P46B 3QA3A 5IMMB 4Q74A 5F3BB 3WFEH 2J6EA 2VTFA 4K71B 2P5WE 2HRLA 1TQCC 5FYLD 5JR1H 4L29B 1IAIL 1TPXC 1XGYL 4HIJA 4KK5C 4F7EA 1KIUA 3AS1A 2IAMD 1GPOL 4JDZB 1MCWM 1N3NB 1OP3K 2ICWA 3T77A 2NNAA 4YHIB 3GBML 2BVYA 1HYRC 4U6VL 5BQ7A 5KTEH 4I77H 1CYGA 3AM8A 4LHJB 4ODXB 4JPWH 2CO7B 3O45A 3ZDXF 1ZWIA 2GJJA 1A1MB 1PKQB 2C5DC 3LN5A 2Q86B 5IJKC 3VXTA 5IB2A 5CP7A 3MFGB 4UOW0 3OTTA 1MNUL 5DQJA 3PWJB 5E9DB 2ZPKL 2EDQA 3CX5K 5DJXA 5FO7B 3P9MB 4GMSH 2FYYA 1R5WB 5DQJB 1N6QL 1YEGL 5EU4A 1BBJA 5D1QB 4Q7DA 3BDBA 1HH9B 3NCEB 4OF6A 2DLFH 4JFDB 3BI9X 1VA9A 2X70A 1VESA 1YEDB 1RHHA 3PWUB 5IB4A 4WW2F 4Z8FL 3KPSA 4ZDHA 5TDNB 5EG6C 1XR8B 4OKDA 3MLTA 5FA4B 5E6IC 1CQYA 3T4AB 5CEZH 5ICXA 1JZ5A 3IJYA 4N8PA 1MF2H 5I8KL 4DQOL 1NAMB 2GTWA 4KUZH 1QSEE 1PZ5B 4LGPB 2OMBA 4G8FB 1WBXB 4LSQL 1TVHB 3HCVB 4UAOC 1YY9D 1A21A 1SJEB 3A67H 3DVGA 3PDDA 1AFVL 3PABA 1CGUA 1EDQA 3K1DA 4GFTB 1EGJL 1H15A 3VMNA 1A6ZA 2XZCL 5B8CB 1S7SA 3QXWA 1QSEB 4NDMA 4D9QD 2I5YL 5B39B 4ZAKD 3HB3C 3MGOA 1QSEA 5DRXA 1H5BA 4GRLA 1AQKH 1DBMH 3IVKA 2HLAA 4NRZA 1SJXA 1KFAH 4UUJA 4DW2H 4AH2B 4DAGL 5LAXB 4O02L 5FF6B 5BS0A 4XCEB 2ZUYA 3MODL 1I9EA 1T1ZB 1JWSA 2VH5L 3DLQR 2P24A 3SE3A 4GAFB 5GGRY 1S7RA 1PZ5A 4FRWA 2OTUA 5F7UA 4HUNB 2E8YA 3PWLA 1KELH 1XGTA 3RJQB 4APQB 4QNPF 1SVZA 4KVCL 4GOSA 5JXEC 1K3IA 5DQDL 5JW3L 5KSBB 5HGHA 1SJEA 4P2RA 4CVZA 2CIIA 3GMLB 2BY0A 1YZZA 4M4PA 3TM6A 2DI9A 4HLZG 5SX5K 5SWZD 1H15B 5JDSB 4HJGA 1FO0H 3DRTB 4NN6C 4XP6L 5I8EA 1J1OH 2XPGB 2QBWA 5EH1A 2A0LD 4QKXB 5DEFA 2PO6A 4H1LB 4J6RL 3HS0A 1TETL 1JNNL 3BKJH 3T8XB 3IDYB 3S37L 3V0WH 3CH1A 2VDMH 4HUVB 3BE1H 3O3BA 4LSQH 1BFOB 2YD9A 4UIMB 3LV3A 2VKWA 1AR1C 3TNNA 3MRGB 1S9VB 3ULUE 3GB7A 4G42A 2J8OA 5H8DA 2DIBA 1N2RB 4U1IA 1P7HL 4Z8FH 2VDRL 3VWKB 4RIRA 3S34H 5FA3B 3F12A 1CD9B 5KS9A 3WFBL 1AD9B 3RZCD 4XC1L 8FABB 1S7WA 3GIVB 2VXQH 4ODSH 5T3XD 3RWIA 5HYQB 1CGSL 1AGDB 5I1LA 5GZOD 5C08A 1B6UA 1IEAB 1F90L 1HHJB 5CGYD 5TFSH 4EI6B 4XBGB 4U3XA 3B9KD 5DGQA 1N8ZB 4ZPVA 4S1SH 3O2DH 2FBJL 4YDJB 1MWAL 2BRRH 2JK5A 1ZKAA 3MRBA 4Z7VB 1JFQL 4LARL 4KH2A 4NKDB 4ZTOL 5E24E 5L2KA 3ZKNC 4NO3B 3L3IB 4KMQA 3NFNA 3GMRA 1ZEAH 2X1QA 5K9JL 5E4IA 4YLQT 3BH8B 1VFMA 3QP3A 2EYSA 5HHOB 3CFDA 1E4XI 2JB5H 1HXMA 4OI7A 9CGTA 5KANI 3CLEH 4TN9A 1AC0A 2QSCL 5CUSH 1A4KB 8FABA 4X99A 1ZLUK 3D69B 1HIMH 2J4WH 4M62L 4G7VL 5F9DC 5GGTA 2OL3B 3QHZH 1T20A 3RVXC 1F3DH 5IHBA 2UUDH 4I3GA 1HH6A 5EBMB 4BQCA 25C8L 1CF8H 4B0MM 3K74B 2X1PA 5T1DL 1U2HA 1UM6H 2WQRA 5D1ZB 5HDBF 3LKNB 4L8SB 4NRYB 4TUOA 4WWKC 5DRNB 3GSNA 2FX8H 4ENED 2PYFA 4U0RB 1KB5H 4FOMA 1NAKH 3FT3A 3WN5B 2IANE 4LKXB 4JRYE 4P5TD 2VABA 1QBAA 1J5OH 2Z91A 3UYRL 5D6CA 1NFIB 2F54E 3DGGB 4G7VH 3SCMB 4NZUH 3IB4A 3IFOA 4OGZA 1J11A 1EO8H 4F9PC 1MHPH 5DVNA 3S5LG 5J0BA 5IROA 5T1DH 4JM2A 5GRYA 1WZMA 5E8DL 4PJFE 1CR9L 4PJ7E 2PW1B 4AM0A 3LQZA 3QSKB 1WAAF 4QXTA 3EYFB 2YEZA 5D2LE 1CFTA 5ESQB 1S7VB 2HJKB 5TH2B 4PIRF 4MD0A 1OHQA 2P8MB 2Y23A 2B2XL 3EYOA 4S1QL 4FQJH 4P5KB 1HSAA 4OCNC 4OFYD 2BJMH 2V5SA 3TBTA 3BPOB 3DHMA 5LCVH 1YEKH 5EOQL 1RSFA 3TNMB 3ZTNL 1ETZB 3MUY1 3DRQA 1TQBC 1OQXA 5TJWK 3JV0A 2HTKD 2PW2B 4UTAH 4NC1E 3VXRE 4UILL 5DD5L 4KJQD 1FL5A 2AV7B 5I1CL 1CGSH 1U92B 1S8DB 3JUZA 4HV8A 4ZSOE 2P7TA 5JIIA 1NCBH 2QLVB 3G6JB 1VACA 5C9JA 1RUQH 4XPBH 2JJSA 5KVEH 4MZ2A 3SDDA 3AB0B 4RWHA 3S36X 4X98B 4POZC 1CD1A 5JUEL 3INUL 5E7FA 3MX0A 5I18L 2FB4L 5TQ2L 5EU6D 1QBLH 1SEQH 3ZE1E 1L9NA 3KYOA 4KMTH 4WI2A 4GG8A 1BD2A 3ARVA 3ARFC 4Q2ZA 1CZ8L 4NFDA 1DBAH 3LB6C 4QTIH 5SX5H 4GG6B 1IGTA 1LO3L 4HX1B 5KW9H 1GH7A 2D31A 1G7LB 5D2LF 2AXGA 4ZOAA 3Q48A 3SPVB 4KKCC 1EH9A 3O6FC 4M8QA 5LBSL 1Z0MA 3WNLA 4R4BA 3EOYG 4P2QB 2R0KH 4B7IA 3G08A 4HLZH 2DKSA 3P4NB 4M6OH 2JJSC 3RL2A 3ARFA 4MB3A 4IMKA 2ATPA 4UTAL 1PLGH 4BKLA 1I3RB 5IVXF 4CGTA 1DQQB 2BSRB 2PYEE 4H0HB 1E4JA 3ARFB 1KCRH 4LOUC 4Y4FC 5EU7C 1VACB 2P48B 1KACB 4HGWB 1OCWH 5D2NA 5IFJA 2RCSL 1HOCA 3ZT5A 2B2XH 3B5TA 43CAB 4OQ1A 1KLGA 1FFQA 4LEOA 5IHUL 4XGZB 5DYOB 4PY7A 4O51B 1YNKL 3B2UC 5F1IA 2DLTA 4YWGH 1MLCA 1CD0A 2D0GA 4YBLC 1FCGA 1OGTA 5KOVC 1CXKA 4NN7B 4MA8H 4D0BB 1GGIL 2ESVD 4O51A 2X4SB 5D5MA 2EEDA 2VQ1A 1WIUA 1F2QA 1UVQA 2CKBB 3EYVA 3HE6C 3VFUA 2AJVH 3H2WA 3BEVB 4YK4C 2A9NL 4OKVA 3JWNC 1XT5A 2VLME 4H5SB 4XPFL 3MRKB 1YC7A 1BBJB 2Z8RA 1PJ9A 2C4XA 2IALA 1NLBH 3ARPA 4ZO9A 3JV4B 1EHAA 5I2IB 3IDYC 2GSGA 3EO1B 3V4PH 5H94A 4YHMH 3QUYB 5E5MA 1YEIL 2VDKL 1CICD 1QFPA 1VADA 2HT2D 3L6FB 1HQRB 3I9GH 4JQIH 4AEHL 4KFZC 3QDGB 4OFDA 2NY3C 1UCBL 1HNGA 1L7IL 2R2HA 4KQ4L 5C08D 4PJ5D 3MROB 5F3HB 4KHXH 4F8QA 1K5NA 5MERA 1F00I 2AGJL 4IRJB 2R69L 1FORH 3RA7L 4JPIA 3OKEA 4H20H 4NZRL 1CDHA 2B8OT 1KEGH 1QSFA 3V5HA 1XR9A 1OWRM 4K8RD 4FFYH 4JZJA 2WSKA 5BXFB 1IC5L 3A6BL 1AGFB 3BSZL 4MWFB 1PW3A 3G6AA 4Y2DC 2EDKA 5JHLL 1MY5A 2UWEA 4HJJH 1KTLB 2CRMA 2OI9C 3SDXE 3B43A 5JIHA 4MDJB 5T3ZL 4I3SL 3GNML 3OAYH 3S4SA 5JHDB 4MDJA 3VFMA 5C92A 4HDIB 5HJ3A 4PLNC 1WISA 2V5RA 3K8MA 1S3KH 4HDIA 3CZFB 5BVPL 3EYUL 1GGUA 2RIKA 5CIPH 1Z5LB 3FT4A 3TBWB 4JPWL 2NW2B 5SWZA 5KN5B 4XCCH 4PJEE 1UB5B 1MCLA 2BNQE 4RQQB 1RU9H 5BOPA 4U7SA 3MACL 3HC3H 5BRZD 4H0IA 4UOJA 3T04D 2NY1D 3CAFA 5A2KH 3EYUH 2FWOB 3CU7A 1Q9KB 5DT1H 3C60B 2CGRL 2HJLB 5TE7L 1QKZL 4NM4L 4QCIB 5HYJE 1FZMA 3RVTD 1SYVB 4ALAH 3GBNH 4E41A 4E41E 3K8LA 4BM7A 3IFNH 4JKMA 2ARJA 4TTDC 4OZIF 2FO1A 4E0RA 2VXSL 1HDMB 2EE9A 3F62A 3T8XA 1ZHNB 2HH0L 3P30L 4KAQH 4KY1H 3V0WL 4Y4FA 4FQXB 1V7MH 1PYWB 3QXAA 5CINH 4M7LT 3EFFA 3T65A 2GSIB 4XC3L 1JF1A 4DUXA 2D7TH 1LHZA 2BSSA 1SQ2N 3O6LL 3L3DB 4CU6A 3PDOA 4L9LA 2UUDK 3TJEH 4A6YA 2NXZD 1RMFL 2JKXA 4JGJA 5E70A 3V7AG 3QUML 5F70A 3WFHB 3VRJA 2P43B 4N0RA 4MA3A 3ZE0F 3WHXA 1FNAA 2DBJA 3TBYA 4IBLT 2AERT 3QNXB 2WNGA 3V6BR 2EC9U 4OD3H 3HNVH 1KTKE 2C7UB 4P23B 5IMKA 1ZVHA 4RMUA 3V5KA 2VDML 4MJ4A 3M8OH 4EI6A 2DTML 1D5MA 2H32A 3WHE1 4PD4K 4ZUVA 1E6OL 5GSRA 3FT2A 3SE3C 1NBQA 2R69H 3RA7H 1A2YB 4DW2L 3RTQA 3CX2A 3GK8H 4ENEC 2HG5A 4W4NA 5H2BB 2YXFA 2XZZA 3EZJB 1QFWH 4RGOL 1T5XA 1Z6JT 2ZSWA 3VFOB 5DZNA 3MBED 2VB5A 3FOMA 1Q0YH 4Y16B 5ADPL 4MJ6B 1SJVA 3C08H 5HHMD 3RVXD 3OSKA 2IAND 4LLWA 3FB8B 2E9JA 1KELL 1FNHA 2NR6D 1D5IL 1D5ZB 5HY9A 2VXUH 2ICEB 3IFPB 1VFBB 4FQXD 5CJQH 3L9RB 4O2EA 1NGQL 3FQRA 2CDFA 1HWGB 5T3XL 3WHXB 4LCUA 1RZFH 1YMMB 1CLOL 2WIIA 5IOPA 4NKIH 1IQWH 1UKQA 1I8LC 4YX2H 3ABZA 1ACYL 1MREH 4WI9A 2NQCA 4UT9H 2X05A 4ZFFA 4G6AD 4ZFGL 4JO3L 3QIWB 2CQVA 4JKKA 1QNZL 4C57C 4P57B 2AK4B 12E8L 1I9IL 4EDXB 1EGJH 4I2XB 2Z92A 1NCNA 1QFWL 1TPXB 4RGOH 5B8CA 4FG6C 5BRZB 1ZOXA 1GC1C 1YQVH 3VD4A 4F57H 4EDWL 3MLWL 3NGBC 5CGYC 3QRFM 5MENA 1Q0XH 3BKCL 1D5XB 1CDJA 5CP7B 4HCRH 1HN1A 5M95B 1SY6L 3WLWC 2SEBB 3IDNA 4Y4KA 5HDQH 2QQKL 1BQHG 3RGVB 1BX2B 4YFLF 1LQSR 2FEEI 1UQSA 5BW7C 5EU4B 3QCTL 2A6IB 1XR8A 3UBXG 4I77L 4UDTB 4DTGH 5HSFA 1YEJH 3HE7C 3MXWL 1ZANH 2MTPA 3EYOB 2F5AL 3CFKB 3MJ7A 5DD6A 5F7WC 1WF5A 1IKFL 4W4OC 2XYCA 2G5BB 2XG4A 4KJPC 5E5RB 4TSBL 1J1PH 4N0UB 1U8MB 1SYSB 2R8SH 2AQ1A 4PJ5A 2JCCE 3RGVC 4F58L 4RZCA 1NAMA 1CE1L 3DROB 1A3LL 4Y4KC 3HI5L 4I0CC 5C9JB 5IESH 3HCVA 2VXTH 4IRZH 5BW7A 4Q9CA 1H3WM 1MJ8H 3NZ8A 4YQXH 3MOBL 2JJWA 2DQDL 1RQ5A 4MNQA 5F89A 3NACL 1RZKC 1A3LH 5T5NF 3U0WL 1F13A 4LSTL 4PJXB 1J8HE 4GKSA 3IAPA 4X6DE 5CS7A 1RVFL 2IH3A 4J8RA 4HKJB 4HMDA 5B8CC 4NP4H 1YUHB 2CR6A 2BMKA 1RUML 4JB9L 5ID1A 1LE9A 4NO5A 1A6UH 4JJHA 2K9UA 1YUHA 2ESVE 1J9CT 2D9QB 1C5DA 3GMMA 3KPOB 5EZLB 4LEXH 1IGIL 2G5BA 1O0VA 4XC1H 5K9KB 2WP3T 4E5XB 4FTVD 3DUSA 2X1WL 2CR3A 1BEYH 1RZ8B 1AR2A 1UWGL 3V4VH 4R9HA 3KPRA 4JHWH 4DWHA 1MFEL 4RAUA 3I6KA 3WIHH 2H26A 3SDXB 3MMEB 1Q9WB 4XVTL 5TGBA 2IPKB 3PV7A 3SN6N 4M6MH 3HUJF 3V6ZB 5IW3A 1JYNA 1PG7X 3D3VD 1I4FB 2H1PH 6FABH 2VC2H 2Q8AH 5L2KB 3ARFD 1B3JA 1CXHA 5K9JH 2NY3B 2C3GA 2W9EL 4Z77B 2CLRB 4JFFB 4BH7B 2OBGA 3Q5OA 2H3NB 1G7HA 3PIQB 4GW4A 4G5ZH 1SY6H 4OZGE 3QDHA 1RZ7L 2FX7H 4Y5XC 3DYPA 3MTRA 3T0DA 1A1NB 1BZQK 4J1UB 5JIKA 3AU1B 1MPAL 4WUKH 3QUXB 4QY8B 4FFVD 2Q87A 2I25N 3F12B 1BF2A 2FEEL 1PBYA 1X5KA 4HUKB 2EE3A 4UIKL 5DJ0A 2AS5M 3CC5B 5DA0B 2D7MA 1KIQA 2XKUA 1LNUB 4OQTA 5B22A 2VUYA 4L3CB 5FKPB 4XXCC 2FLBT 4ZPVB 1AI1H 2H6PB 3PUCA 2BSED 3VXRA 5BZDB 4OBRA 5IVOA 2R9HD 1INQB 1LP9F 2BOCB 5I1IH 1MIMH 4NM8H 3DVFA 5D1XC 2D4FA 4A6YH 2BVUA 5EN2A 2BHUA 2UVEA 1JPST 5E7BA 2Y07L 4Z76B 1VGKA 2AXHA 2NY0D 3DX6B 4HSQA 2VMFA 3IDXL 4U1HA 1G1YA 3VCLA 4K7PY 1HHHB 3BZ4A 3ZKMC 5GXBB 2BNQD 3T0EB 1CFSB 3OL2A 2G60H 4LCCC 4LGSB 4Y5YB 2F8XC 3IS1X 3D85A 1FSKC 4XHQA 2XNAB 1IZJA 2OMNA 1N0LA 3SCMD 4W70A 5D7KE 4EVNB 1FAIH 2O5ZH 4XPHH 3D6GA 4QRUB 2NW3B 5C6TH 5FUZL 1U8KB 3QI9A 4RDQG 4XP4L 1QEWA 2AEIT 3QJHB 1KCRL 5C2BH 3UJIL 3IJSB 5T1MA 1QTYT 3IFLH 1PLGL 3AREC 3LKQA 5CJXC 5EBGA 2WUCL 1A7PL 2OTWA 4B53A 4XNMB 1FE8H 4JRYD 5GJTH 5IGXL 2YD1A 5E1AB 5GSVB 3HI6H 4FQXC 5D7IE 2A6KA 3U0TA 3TJHC 4RMTA 4KGLA 3CDYA 1T2QH 5CAYB 1FL5B 2AV7A 4R90H 5FUZH 5IHUH 4N9OB 4OCYL 3WFCH 1A64A 4P5TB 2VUOA 4TYUA 2JELL 4WFHE 4BQ9A 4O9HH 5EZOH 1IFHH 5J6HA 3MV9A 1ZHBB 5KSVB 2JJTA 4P3CH 2F8OA 3HLAA 3VFGH 2G60L 5JZ7D 1FZJB 4GW5A 2ILLA 4U05A 3H3KA 5DTFA 4K7PX 4YUEL 1ZWIB 1KJ2L 3RU8L 4JFPA 3G04B 4G80B 1JV5B 1MOEA 1MLBA 1RULL 5DD5H 1PGRB 3V5DB 3SQBA 4WHYH 5GZNC 4EI5A 1WICA 1CDIA 5DJXB 5FO7