4UTWC

Structural characterisation of nane, mannac6p c2 epimerase, from clostridium perfingens
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
229
structure length
229
Chain Sequence
GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Clostridium Perfringens N-Acetylmannosamine-6-Phosphate 2-Epimerase Essential for the Sialic Acid Salvage Pathway
pubmed doi rcsb
source organism Clostridium perfringens str. 13
molecule tags Isomerase
molecule keywords PUTATIVE N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE
total genus 84
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2014-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4utwC00
2YZRA 4WD0A 3OVPA 1T96A 1KA9F 4AF0A 3KRZA 2YFNA 4RLIA 2H8XA 4UFIA 2OCZA 2Z0IA 3TH6A 2E6AA 5AHIA 1GJPA 3TFXA 1W3IA 1TRIA 3LV5A 1TSIA 3FJ6A 5EL1A 2VXNA 2NLIA 3GLCA 3ATZA 1JR1A 3CIWA 4UTJA 3L2IA 1O95A 4JDBA 1BEUA 4NZFA 4JN6A 1R30A 1Z44A 3W7GA 1AMKA 4IX0A 1OF8A 3USBA 1CX9A 4CLMA 3NG3A 2ZRZA 1EB3A 1DHPA 2Y63A 5A8GA 1N7KA 3KHJA 3MHUA 2VFHA 1QFEA 3M41A 5IBXC 5KTLA 5J5DA 4IPIA 3SSJA 2C0AA 1PS9A 4K7YA 1O5XA 3P67A 1ZHAA 4Y90A 4GE8A 1P0KA 2B7QA 4FNUA 3V1PA 1OFBA 3P5ZA 4KKXA 3W1NA 3P8JA 3W85A 4G1KA 3W6YA 1OFDA 4IGHA 3WJYA 3MHGA 1X8FA 4HNTA 5K3VA 2OX1A 3G1FA 3TUUA 4ZQNA 1WV2A 4CNOA 2JBMA 1IXQA 1XBYA 2BLEA 2CLOA 2E6DA 3G1XA 1G4EA 1H63A 3P61A 3DFSA 3I7QA 4PL1A 2QAFA 4UMAA 1TTJA 2RKXA 3MHFA 4JTSA 2V81A 4WXYA 4UFJA 2PRHA 1NF0A 2QDHA 3O6CA 5EBUA 3TC7A 1LROA 1J4EA 1KV5A 1MZHA 1OFRA 3BV4A 1L6YA 2QUTA 4AWTA 1FDYA 2VEMA 4K38A 1OX5A 4A29A 2FDSA 3IVUA 1KV8A 3HF3A 4UNKA 3W71A 2CU0A 5AYZA 3BARA 3KXQA 4IMFA 2ZZ1A 4QISA 1H7NA 1KTBA 4ADTA 1ALDA 3QH2A 3WK3A 4XWUA 1F74A 1GVRA 2QR6A 1KBIA 1IIGA 4YWIA 1DBTA 1M5WA 4DO5A 1SSGA 3N34A 2XN2A 4O17A 4XBSA 4AWSA 3ZR4A 4DPPA 1XDMA 4GWEA 4WOQA 2X2GA 1XM3A 4OE7A 1DKWA 5AHNA 5E0KA 2G95A 2QCLA 3GIYA 3RLVA 2AAMA 3NQGA 1QPRA 1Y0EA 1TTQA 1RD5A 1B4KA 3Q94A 1VCVA 3KVMA 1ICPA 1VLWA 4RCXA 4N6FA 4BI6A 3FJLA 4PFMA 1JRBA 1VR6A 3M5VA 2NX9A 3UY7A 4LVFA 4X9SA 1ME9A 3E12A 4OV4A 3PM6A 5F2MA 5FEPA 3SFKA 1GYLA 3WJWA 2VEPA 4QNEA 1VZWA 1B4EA 1BWKA 4LS1A 4CCDA 1EUAA 1ZAJA 3N3MA 1ZAIA 2GQ8A 4OHQA 4POCA 3G3DA 3OEXA 5I3HA 2DZXA 3LHTA 4AXKA 3BGJA 1LCOA 1B3OA 4O1CA 1VCGA 3G1YA 4O28A 1B9BA 4MUZA 4O13A 1XUUA 3TR2A 4WXZA 4Z0JA 3DKJA 3R12A 4MY8A 4JICA 3AO0A 3M5XA 4S2CA 1K7XA 3D0CA 2E6FA 5KSWA 2V2HA 4NT0A 4NJGA 1LLZA 1NVMA 4Z1AA 3W9ZA 3T40A 2J88A 3SJ3A 4UUIA 1GTEA 3STGA 3C2RA 6ALDA 2CLIA 3LRLA 3DXIA 2CLEA 1MEWA 1NEYA 4LTSA 5FF7A 3Q58A 3DAQA 1C9DA 3IIVA 2ABAA 1W5PA 1JUBA 3MBFA 3GKFA 3L5MA 4GUFA 4JNMA 3S1VA 3A22A 4RXGA 4ADSA 1RV8A 3K30A 4AH7A 4MFEA 4UTHA 3SR7A 3JR2A 2NX3A 2CW6A 3C2EA 3UZJA 3L0GA 3F1QA 1J2WA 2BZNA 4HNUA 1VLIA 4LT9A 3BLEA 5C54A 3U2OA 2GQAA 3LTYA 3NPVA 4Y8FA 3BW4A 1KM4A 4ZVJA 3LHVA 2P0OA 2V5LA 1OFEA 4HSNA 1WA3A 4O4WA 1TB3A 1VHCA 3GB6A 3P84A 1YTDA 4HN4A 3N9SA 2V5BA 1F76A 4NXKA 3W22A 2WV8A 5HUOA 3VCRA 4ONVA 3THQA 3N2XA 1AW2A 4MJMA 1XC4A 2Y7DA 4UTTA 3BGGA 3FKKA 2TYSA 3RFAA 2EHHA 3TV8A 3GXTA 3OIXA 3TKFA 4LOCA 2JKAA 5KZMA 2TMDA 1KM1A 1Q3NA 3EWWA 1LZOA 4YXGA 4M6QA 2QF7A 1XFBA 1W56A 4CNPA 2ZQ0A 3W7RA 4O50A 4NVTA 2X1TA 1MEIA 5I3IA 2PRMA 5AYYA 1C29A 5SWUA 1W3TA 1W3NA 1EWEA 1FDZA 3PR2A 1AW5A 3SGUA 3L67A 1G4TA 4DF0A 1QWGA 3O6DA 5HR7A 3NQDA 2RDUA 2GVGA 1TJRA 4E38A 3PAJA 1T8XA 4Y9AA 3W1RA 2OMAA 2ATSA 1ZCOA 1TYGA 4ALDA 1ME8A 4GUJA 1HUVA 1TREA 4FX6M 3N9RA 1H7OA 3BLIA 3C52A 2HS6A 5KMYA 1C8VA 1LOQA 3ZWTA 4O8RA 2DP3A 1YDVA 2E5BA 4P61A 5CGQA 3DH7A 5LZLA 2E68A 2A21A 2J24A 3LI0A 1KLYA 4JTUA 3GNNA 3WJZA 1KM5A 4MZYA 5AHMA 4ZZ9A 3QPZA 4RZ5A 2XN0A 3C56A 3OVQA 3W2NA 4NUWA 2JKEA 3BW3A 5LNWA 3S42A 1ZNNA 1YTEA 4FNTA 3A21A 5C2XA 3ABSA 2JGQA 1G67A 2X1UA 1X7FA 3C0JA 2P10A 4DQWA 2A4AA 2ZA1A 2NZLA 1TQXA 1SW3A 3B03A 1YADA 4IJBA 1H7RA 3KVKA 4N4QA 1GZGA 4FO4A 1DL3A 3E9AA 3LRKA 3F03K 3L0NA 4AMAA 2A6NA 2Y62A 3W74A 3GAKA 3QMSA 5HJLA 3NR0A 3DFNA 2GJNA 3CM4A 5CKSA 3UPWA 3VNDA 5HR6A 3UWZA 1ZJIA 1H62A 3W7NA 4RR4A 4MIMA 1XDLA 3GDLA 3LHYA 5KZEA 1SR9A 4BF9A 2VEKA 4JTLA 1JRCA 3IIOA 1ME7A 2C15A 1SW7A 3NPUA 2XN1A 4FNPA 4LUIA 1H61A 3C6CA 5CSRA 1EA0A 1WAUA 5CPOA 3U8GA 3GVGA 1X6UA 1FDJA 1R47A 3DU0A 4UCGA 3G22A 3CLMA 3LLFA 3LXAA 1IXOA 2GUUA 3LBMA 4OBTA 2LLEA 3B0PA 3W7IA 2YYTA 4DBEA 3IEBA 3CEUA 4UTWC 3P81A 1NFBA 4N6EA 1UB3A 4L4MA 1GEQA 1KFJA 3STCA 5G1TA 1QDSA 1X1ZA 3F4WA 4QQ3A 3KRUA 3M7WA 3EWXA 3W1XA 1LBFA 3V75A 2WKJA 5DXYA 5D2WA 4XUGA 4K39A 2FB3A 2NUXA 3LDVA 1QO5A 4I7VA 4HPJA 1GG1A 3DHDA 4DBDA 1NAL1 1GVSA 4EVZA 3JS3A 2F84A 4RZ6A 2CZFA 4GUHA 3WJXA 3ABOA 2FPTA 1L2UA 5FEWA 1Z42A 5DY2A 3HGJA 2WOQA 2RDWA 1THFD 1DVJA 1RZMA 3NQVA 2QDGA 4ZQOA 3I68A 4H6KA 3S5OA 5D2VA 3QYQA 2QKFA 1G69A 2WQPA 4JX4A 3W87A 1SO5A 4ZQPA 3GR7A 3IIZA 3MJYA 4DXVA 3SECA 3B06A 1IIHA 4IQLA 2C16A 3LTSA 5C5YA 2VEIA 3UWYA 4UFMA 5HNRA 4ICNA 4AWUA 1QPNA 3GKAA 3W7KA 5KINA 2Q3RA 4RZ4A 5L9FA 4PEKA 2Z2UA 2OZ0A 1F7BA 2E6YA 4NX0A 3W7EA 3W7HA 1H5YA 4IXXA 1TPVA 3NNTA 4ZQRA 4UTKA 1UBSA 4IX2A 3VI2A 3S5ZA 1OYBA 1JUEA 1I2NA 2H6RA 2A7PA 5AC7A 3S1WA 4LNYA 3T44A 1O5KA 3UWVA 2C19A 3GAYA 3DFTA 1I45A 5AHFA 4LWWA 2R94A 3EX6A 3M44A 4M7SA 4R33A 5EA9A 5FF0A 4NNAA 1K8ZA 1MSSA 1PHQA 3E0IA 3W86A 2PCQA 4UR8A 3FKRA 1IXPA 1FWNA 2ZFAA 2WJZA 4HNNA 1JJKA 3UPBA 1KM2A 3DI1A 4HIBA 4UFLA 5LKYA 1LLWA 1R2SA 3EB2A 2E1DA 3PBWA 3HGOA 1G7VA 1HTIA 1FCUA 3L5AA 5BNKA 1ADOA 2ZZ4A 4BI5A 4X22A 3H55A 1GTHA 5BMWA 3G18A 2DZWA 4AEOA 1H50A 4P2VA 3T4CA 1TV8A 2EF9A 2C6QA 1JULA 2V9DA 2A7NA 2Y7EA 1SO4A 4Q33A 4CNNA 2IQTA 1XKYA 3TAKA 2C18A 1JCNA 2VELA 4JTKA 4QSHA 4WJEA 4LS0A 3ABRA 3F4NA 5L6UA 3IIXA 3PUEA 4QITA 1NSJA 2PURA 1OX4B 2YW3A 2Y70A 2H8ZA 2O7QA 2GVLA 4WQ6A 5D32A 3GNDA 3T78A 3W7JA 1FY6A 1TPB1 4HKPA 3JRKA 2QJHA 4U4MA 4IOTA 4BR1A 3SZ8A 2G96A 1ZFJA 4FNSA 3CIXA 2Y88A 5HULA 3M9YA 2Y85A 4E2DA 4WZHA 1A50A 3G24A 4IMDA 5CPNA 5DN1A 3Q37A 3WK2A 1BTMA 2FB2A 4FX7A 1W8SA 4OWGA 2B7NA 4BWLC 1DJQA 3KAOA 1FXQA 3GR8A 3W7CA 4RV8A 2I14A 3TROA 4WOZA 5TIMA 4EWND 5LHFA 2RH9A 3W1LA 3PBUA 3I65A 1KTCA 1O94A 1P4CA 5EMUA 3OBKA 3QRHA 2DU2A 4NJIA 1JQXA 1G4PA 4UC5A 3O1NA 3PUOA 2I1OA 2C13A 1W5QA 3T55A 4L4LA 5FI8A 5DCDA 2ZRUA 3BPWA 3TFCA 5DY3A 1OF6A 3P80A 1D3HA 4XTIA 3PUDA 3HIJA 1JUKA 3GYEA 4AHPA 3TIMA 4QM1A 5D37A 1QCWA 3RU6A 1CI1A 4A3UA 4C1KA 3AJXA 3IRDA 3MP5A 3DZ1A 3N73A 3W84A 2CZEA 3QQ1A 5HMSA 1SW0A 3S5YA 2B0MA 1O4UA 1A53A 1RR2A 4XKYA 1OFAA 2BWGA 3MP4A 4O15A 1W37A 3FFSA 1VC4A 4YMZA 3DFQA 1K02A 3TXVA 3NM3A 2YYUA 2H90A 2WO5A 3EXTA 1VCFA 5F2LA 1HL2A 1T0OA 5CPLA 4GNJA 1KLZA 4LV9A 3NPWA 3M5YA 2W79A 3QSRA 1ZY9A 1KM3A 3PF3A 4O0ZA 5I3KA 5AHEA 4OU1A 1R46A 3W70A 2NX1A 4DO6A 2FTPA 4CQ8A 4LW7A 2NV2A 2A6LA 5CZ0A 1DQWA 4O10A 4M19A 5D2XA 5BMXA 4O1BA 3R2GA 4AHQA 3UY8A 4K7VA 2CZDA 4C1LA 3RK8A 1TJPA 3LCFA 3BG5A 5EYWA 5HQEA 3FS2A 4MJZA 1OFPA 1ZENA 5D2YA 1OX4A 1SFJA 1DJNA 3DBPA 1Q6RA 4JX6A 5D09A 3UNDA 1J5TA 1OYAA 3B8DA 2ZDRA 4Z1DA 4X3ZA 3VE9A 4IMEA 1EP3A 2WPBA 2E5DA 3QFEA 4LC8A 3EWUA 4WY0A 5CSSA 3RF9A 1ICQA 1S5WA 3EWZA 1MO0A 3TC6A 3VE7A 1ZALA 3UXDA 4JEQA 2KZHA 4TX9A 5CPMA 4O12A 5FESA 1FWSA 1PIIA 1F2JA 3E49A 1KFBA 2FQIA 1PV8A 3W73A 3W88A 2J9ZA 5ABTA 4AVFA 2DZVA 3NQAA 1M7OA 4LVAA 2B7PA 2WNQA 1FCVA 2E09A 3IGSA 2PRLA 3UWWA 1QMLA 1UJPA 3S8HA 5AYXA 4FB7A 2ISVA 3H53A 4BK9A 3GDRA 3G0XA 3FOKA 4RX0A 2NWRA 5BW6A 1K7EA 4MLRA 4JTTA 1F05A 4AAJA 3E02A 1LTDA 1H1ZA 3NQEA 3PS7A 4A22A 3HG3A 5AC6A 5MHBA 4JTEA 2Z6IA 3S5NA 1Q6OA 1FCQA 4O53A 3NM1A 3NQMA 2QCDB 3W2JA 1OVDA 2X30A 4GBUA 4NX5A 4GXMA 4MVAA 3LLDA 3PY2A 3NZ1A 3GK0A 5K2ZA 2ZZ6A 2DORA 2CLFA 3EX4A 1BKSA 3M47A 4FNRA 1D9EA 3LBCA 1W54A 4R7JA 3L9CA 4MY1A 4O18A 4KFNA 3W7LA 1FQ0A 2YFOA 1SPQA 3STFA 3Q2DA 1KBJA 3NGJA 4GUIA 2Q8ZA 4O14A 2NXGA 3CWOX 4IMCA 2TPSA 2ZBTA 2WNZA 4FHAA 2VFGA 3DI0A 2ALDA 2GQ9A 1GWJA 4M7TA 3EWYA 2J9XA 5DBUA 1EEPA 1TCDA 1XL9A 2ZZ2A 3FYPA 1E51A 1I4NA 2ZTJA 4LY8A 3NL5A 1WOBA 4YLWA 3QW3A 3ANYA 4NNCA 3HG4A 4ADUA 3W72A 5U4NA 3QSTA 1HO4A 3GDMA 4JIPA 3LGEA 2ZZ5A 2CFFA 1QOQA 2VKZG 3MBDA 3C3NA 5FEZA 4DF2A 3QMRA 4NNBA 3BW2A 4O52A 3NXFA 4FIQA 4RK8A 3LCXA 2VFDA 3H54A 3P7YA 3KVJA 3LTPA 2JK2A 5E1QA 3B0UX 3HOJA 3INPA 3HGSA 3NVTA 5I3GA 3QW4B 3P74A 2WSRA 3YPIA 2CLLA 3DENA 3PWAA 4FIRA 3S0CA 4O1DA 3UZ5A 1UUOA 2C1HA 1XBZA 3UXAA 5I3FA 1H7PA 1N55A 1KFLA 1H7WA 4UTUA 3QM3A 3TMLA 4B5NA 3NL3A 1P1XA 3NQ8A 1SSDA 5AB3A 3W7DA 3BG9A 3PG8A 2V2CA 1F6PA 2TRSA 4WY0B 3TJXA 1WXJA 2GVJA 1I8JA 4UTIA 1CW2A 1K3UA 4K36A 2ZA2A 1MXSA 4FF7A 3VFLA 3MI3A 3I7RA 3W1TA 3E96A 5DXXA 3NEVA 3TNOA 1W5MA 5GVJA 4OGZA 1TPEA 3MYPA 3C2FA 1UASA 1KW1A 1FWTA 2R8WA 5HWNA 2WNNA 1LBLA 3PVFA 4UMBA 3N2MA 5C6MA 3UQNA 1S5TA 3O16A 5G2WA 4UFHA 4N9DA 2X1SA 2QAPA 4UTWA 4DEFA 2QJGA 1I2PA 1XCFA 1L6SA 1GT8A 1UCWA 2G5WA 3S1UA 5E93A 5AOUA 1TV7A 3W83A 2YX0A 1JCMP 1VS1A 4O0KA 1VH7A 4N9BA 3CHVA 5H91A 4X2RA 1PL9A 3SW6A 1KFKA 1GVFA 3FLUA 3OVRA 3P5YA 2V82A 1YTKA 1PE1A 1LRNA 3P62A 1VYRA 4R53A 5CZSA 3P60A 3MI6A 2H3BA 2Z6JA 4Y6GA 5F2IA 4S1FA 2A1YA 4LRSA 4MPQA 1AK5A 2ZZ3A 3A5VA 3WJSA 1DQXA 1YDNA 4IMGA 4M5PA 4Z0SA 1G4SA 4JYDA 3FIGA 3TDFA 2Y7FA 3UD6A 5BRBA 4HSOA 1AG1O 3L66A 3O8AA 3LCGA 3CB8A 3O06A 3G0SA 4PCFA 1OYCA 3MWAA 5FF2A 3R8RA 1IXNA 4YCOA 5K7JA 1GVOA 1N8FA 3PG9A 4AHOA 2J9YA 3MYOA 4JTIA 4K8EA 1KTNA 5LSMA 1SUXA 1K03A 3A23A 2GOUA 3M16A 3QJAA 4IUOA 3B04A 5KZDA 2QCCA 4JTGA 4N9CA 2J27A 3ZS4A 2OT1A 2YDAA 3UWUA 3L65A 4Q4KA 3BK0A 1F73A 3FYOA 2AQWA 4LRTA 4CQ9A 4N4PA 1VGAA 3MI2A 3IIPA 2YXGA 2QEZA 3DFOA 3PSWA 2HTMA 3HPZA 1LRQA 5D04C 4PODA 4LUJA 5HWJA 1I2OA 5G4WA 5CZJA 3QMTA 2VFEA 1OHLA 1EUNA 2A85A 3L68A 1TQJA 4LVGA 5TBOA 5FF4A 4UTLA 1EP2A 4O11A 5D33A 2R91A 4TIMA 1I2RA 5CG7A 3CU2A 3LCWA 3PBYA 3LCIA 3ZFHA 1TMHA 3LCLA 2RFGA 3R89A 4EOUA 5LHEA 1NF7A 1OX6A 1ONRA 2BXVA 3TJLA 4I7UA 5FF3A 3IGUA 5FEXA 1TPUA 2NUYA 1LOLA 5F4XA 5DCEA 4LS2A 4KWWA 5HINA 3EX1A 3PSVA 3EWBX 1FBAA 4O57A 4HT3A 4MLJA 4M6PA 2RDTA 3NQ7A 1FX6A 3G8RA 4LC6A 3TAOA 4EIVA 5D02A 3NPXA 1EPXA 1RVGA 2DZPA 4JR5A 3L0KA 1P5BA 4A2SA 1WOAA 3GZ3A 5G4EA 2NUWA 3STEA 3TW6A 2Q3OA 1YDOA 3RLUA 3LHUA 3B4UA 1FUYA 1YXYA 1VRDA 2A5HA 4MZ1A 4JYFA 2UV8G 2FIQA 3B05A 4I7WA 3TU9A 2TSYA 2P1FA 1QAPA 2ISSA 5K9CA 1PHWA 3DGRA 1B57A 4K6AA 3HG5A 4MOZA 4QAIA 3NDOA 3NQCA 4MFDA 1SO6A 1OFQA 3EX2A 4KWVA 3BO9A 1M6JA 2Y61A 3PULA 1KM0A 3LI1A 5J5RA 3B0VC 4GFSA 2OT0A 3TQVA 1RPXA 1KFCA 1LRTA 2R14A 1H60A 4S2BA 5C55A 4JXCA 4QIUA 3R5EA 4WUIA 4UIOA 3SIZA 2YCEA 3TMQA 3TSDA 4H4IA 1QOPA 1KFEA 3R13A 1VQTA 2V8ZA 3LM7A 3W07A 2FLIA 1EP1A 3LRMA 1QPOA 3U6WA 3EKZA 1DV7A 2QUUA 3KRSA 1I2QA 2D73A 3CPRA 4HNVA 3C8FA 4TU1A 4IPJA 3UWQA 1FXPA 4O54A 3S1XA 3QEZA 2ZRYA 2BTMA 2O7SA 4UTTC 4ZQCA 4ZL1A 1O60A 1OK4A 5AFDA 3GDTA 5LNVA 5H2ZA 1XUZA 5AC8A 3EXSA 3M6YA 4TMCA 3SI9A 3M5ZA 3W7MA 3C4UA 3LCHA 1WDWA 3DFPA 2HMCA 3P82A 4FNQA 3W7PA 1IGSA 5G2HA 1S5VA 1LP6A 3TSBA 1TTPA 3G3MA 3CWNA 3KVLA 4JS3A 3W2KA 2ZA3A 4Y96A 2ATMA 1TO3A 1W31A 4PH6A 3SY5A 3LOTA 3P8IA 2CLHA 4BWLA 1GG0A 1BWLA 1JVNA 5IM51 1L6WA 4FXRA 1FCBA 1PVNA 1SZGA 2ZTKA 4ML9A 4FEZA 3W1AA 2ZRVA 1Z41A 1F5ZA 3IVSA 1WYIA 3G8EA 1QPQA 1U83A 1GQNA 1SZEA 3C61A 4DPQA 3KFTA 2Y7GA 5LGZA 2W0UA 2ZRXA 3LXCA 1EIXA 4CCEA 4M6VA 4RJEA 3GDKA 3W3OA 3NQFA 4N9EA 1JQVA 3LB0A 1OJXA 3LV6A 1TPC1 5EY5A 4MYAA 3MO7A 2AGKA 2QCGA 1YXDA 3CT7A 1HO1A 2V0TA 3IVTA 3M43A 3TA6A 4NU7A 3O6YX 5DELA 2V2DA 3M1ZA 4QNWA 4CQAA 3MP3A 3GX9A 4QJ1A 2A2IA 3W23A 4IXHA 4ZQMA 4FXSA 3VKJA 4K37A 1DOSA 1L9WA 4JTHA 3WK0A 2QCMA 3THAA 5F1UA 4Z1BA 5AHLA 5A5WA 2ZCGA 3NO5A 4NJHA 3HMJG 4PTNA 1LM1A 3EX3A 3MUXA 1YLVA 1UUMA 2H3DA 1V5XA 2JKPA 4AF0B 1AW1A 1TRDA 3CC1A 4BI7A 4FX8A 2ABBA 2ZZ7A 4R34A 1QR7A 4U28A 4RXFA 2QJIA 1Q6QA 2E77A 1H7XA 1TIMA 5I3JA 5F4WA 1TPDA 3FEMA 4O19A 3LERA 1LDCA 3CEPA 5F2GA 4XZ9A 2PE4A 4Z1CA 3HO8A 3QQ0A 1W0MA 2BSLA 1TPFA 5LNSA 4UTMA 3W2MA 4PC8A 1GOXA 3W75A 3EXRA 2WSQA 3NL2A 4ZMGA 1G7UA 1Z48A 2QCDA 1GVQA 3DKLA 3W1MA 3G0UA 4MY9A 4UR7A 1P0NA 3A24A 1SFLA 3MMTA 1JCYA 5HWMA 2QUVA 4OV9A 1ZAHA 5CZTA 1SZFA 1EWDA 3T7VA 2B7OA 3I6RA 3WFAA 1V7YA 5K9XA 4KFOA 1VJIA 2I9EA 3NA8A 5U7SA 1S3HA 3LXBA 4ORIA 2HS8A 3NOEA 3UYCA 1PCWA 2C14A 3TSMA 3G1AA 1X1OA 1VYPX 5G5IA 3QF0A 2FFCA 4GRSA 5K4ZA 4OQVA 3IGXA 3O05A 1K8XA 3TXZA 3G1VA 3O07A 5G2IA 5D05A 4JY8A 1WQ5A 4PA8A 2Z1BA 2X16A 4ORMA 1PCKA 3HGRA 1RQHA 2DZUA 3O63A 3LX9A 5DBTA 3NQ6A 4JX5A 4O16A 4WY0F 5K9DA 1T99A 2A7RA 5AN7A 2QCNA 2EPHA 4UFKA 2EAWA 3RMJA 3HB9A 1XBXA 1YXCA 3ATYA 4NJJA 1OK6A 2DZSA 1XI3A 4N02A 3PB2A 4LU0A 3TK7A 3TX9A 4NQ1A 2QCEA 4O1AA 3NYZA 4AB4A 5G1YA 3L21A 4CCCA 1YPFA 1R2RA 3NQ2A 4RKAA 2YPIA 1SQ7A 1AL7A 4Z08A 4KFPA 3G1HA 3NZRA 1TPH1 1H51A 3PBVA 7TIMA 5KITA 2VFIA 3IV3A 4JTFA 3W2LA 5BOOA 1WBJA 3HQ1A 2DJLA 4NJKA 3BVJA 3GXNA 1DORA 1LBMA 4TR9A 2DJXA 2J6XA 1EX5A 3LHWA 2YGYA 3W2UA 1A5BA 1LORA 3ABQA 2Y6ZA 3KOFA 1GPWA 5D03A 3HJZA 3W76A 2G97A 2F7FA 2NV1A 2ZRWA 2C3ZA 3BLFA 5HUPA 4E0CA 5LNUA 4JTJA 4I9AA 4UMCA 4GJ1A 3W1UA 3NL6A 5EKYA 4PL2A 4EF9A 1HFBA 3N14A 2PC4A 1M7PA 2Y89A 3ELFA 5LGXA 1XXXA 4UXDA 3TCEA 1OG0A 1K8YA 1YYAA 3RNDA 3CQ0A 3C2VA 2FPVA 4YCPA 4HHPA 4JIQA 4D2JA 2GPTA 5D2TA 3QPYA 1XBVA 3EKLA 4LVBA 3CTLA 1K7FA 1VYSX 4MZ8A 4XKYB 3SGZA 6TIMA 1FWRA 2DZTA 2W6RA 3A9IA 4NXSA 4EF8A 5T26A 2CLKA 1U5JA 2NXHA 2ZYFA 1A5CA 3MW7A 1TV5A 3LHZA 1IF2A 5DCBA 3W7QA 4K8HA 1OABA 4JGDA 8TIMA 1A5AA 2VENA 2YW4A 1F6KA 1HG3A 2QCFA 1WX0A 3L5LA 1JCXA 2GJLA 3ZWSA 1QO2A 2FPYA 1YPIA 4TMBA 4IWWA 3C2OA 4GC4A 3HPSA 4XTDA 2NWSA 2BX7A 5D38A 3HBLA 2RHGA 3BG3A 5D30A 2E5CA 1VHNA 1TTIA 3I7SA 1W5OA 5F1VA 2ISWA 4JYEA 3W1QA 1RQBA 1WBHA 2YSWA 5LNRA 3S6DA 4UNLA 1LOSA 3NAVA 1Q6LA 1ICSA 5DLCA 4DF1A 3W7OA 3QZEA 3PB0A 4Q32A 4WX2A 1W1ZA 2Q8LA 2CWNA 2XFWA 4XBKA 2VFFA 4LV4A 4HPXA 3TQ0A 2QCHA 4OT7A 1VPXA 1SU5A 4A21A 1A5SA 3G1DA 4JY9A 3G1SA 4N2YA 2WSYA 2B4GA 1GYNA 3TQKA 5TQLA 3W1PA 3O15A 4DO4A 2OJPA 1ML1A 4TO8A 4GUGA 4MYXA 2JGYA 4E2BA 4NZJA 1Q45A 2X1RA 3M0ZA 2A0NA 1JCLA 3EEGA 3OG3A 3TW7A 2EKCA 1LYXA 3OHIA 4BFAA 5IBXA 4W9TA 4JDYA 3KX6A 5K4XA 3OA3A 1W5NA 1D3GA 3PC0A 1QNVA 3N19B 1TPWA 4J9JA 3FA5A 2FJKA 2CZ5A 3HG2A 3DHFA 2HSAA 3GXPA 4JD4A 1SZNA 4O4VA 1KM6A 1G6CA 1RQEA 2YR1A 1OFOA 3WK1A 4YL2A 4MKNA 4DELA 2EGZA 2CLMA 4LVDA 2VOMA 3QC3A 3S9YA 2VC6A 2V30A 3HPXA 1SO3A 5EPDA 1R2TA 1H1YA 1MEHA 2NXIA 1FWWA 4H3DA 1JCJA 3A5FA 5F4SA 4A2RA 1AL8A 3TE9A 4XQ6A
chains in the Genus database with same CATH superfamily
1TV2A 4FLOA 4DVOA 2XWDA 1T96A 4AZ7A 3B0YA 1EC7A 1EZWA 2H8XA 3U3HA 3HFTA 2OZ8A 1TRIA 3ZJ8A 1V02A 1TSIA 3DN5A 2VXNA 4AVNA 2Z1WA 3GLCA 2FVKA 4UTJA 3U2EA 2ZVRA 4P7NA 1Z44A 1GZJA 1AMKA 1UBPC 3IUDA 3NG3A 2ZRZA 4PTVA 1CLXA 1JYNA 3PP7A 5I09A 2PAJA 4GA8A 2VFHA 3QTGA 3NJ3A 4MTVA 3GR4A 4IPIA 4K7YA 1O5XA 4Y90A 3AU2A 2VCAA 4GE8A 1HL8A 1A5OC 1O12A 3ITVA 1A4MA 4G1KA 4IGHA 1OD0A 4E4PA 3AAMA 3AIRA 5K3VA 3G1FA 4DJDD 2NVAA 3V18A 4DLMA 4HZMA 1XBYA 2CBIA 5C9RA 1WP6A 4DZHA 4UQEA 2QAFA 4BQ2A 4JTSA 2V81A 4UFJA 2QDHA 3TC7A 1KV5A 1MZHA 3BV4A 1V3IA 4RDWA 3H70A 1FDYA 3TYBA 5JUVA 1GK8A 3IVUA 1HGWA 4UNKA 1EJUC 2ZZ1A 1DJWA 1F3EA 4I8DA 3QH2A 1GVRA 1V3LA 2JEQA 1KBIA 4PMXA 3V7PA 4YWIA 1PPIA 4KEZA 4HYRA 2GSHA 3ZT5A 3WQ6A 2GL5A 2XN2A 4J5NA 2P5NA 1H4PA 4O17A 4XBSA 2E25A 4GWEA 4WOQA 1KRMA 2X2GA 3N6QA 4EPKA 1DKWA 1PO9A 2G95A 1M03A 3RLVA 1J18A 3L7RA 3VOIA 1TTQA 1WZLA 3R11A 2QIWA 3WQCA 4XD4A 3AHZA 3KVMA 1CTNA 4GO9A 1U2YA 1NFGA 1VLWA 4WGHA 2NQ5A 4D6DA 1VBRA 2ZC8A 3ID7A 3NXLA 1XSJA 2NX9A 2DUZA 4ZTXA 1QNOA 4TVDA 3QKZA 4OV4A 5F2MA 5FSDC 1PIFA 3PJTA 3SFKA 4CU7A 1PAMA 1VKFA 4FOJA 1VZWA 1B4EA 2DSKA 4CCDA 1EUAA 1ZAJA 4QQUA 4BY3A 1W17A 2OO0A 4OHQA 2VR2A 3G3DA 1X1NA 1LL6A 2QVHA 2R1NA 3LHTA 1LCOA 4F4RA 1VCGA 4MUZA 3VX0A 3KBMA 3TR2A 2PDWA 4K1WA 3R1ZA 2B81A 4MY8A 4JICA 1Z7AA 4S2CA 1B3WA 1XIDA 5KSWA 3WQ5A 1JPDX 1TKKA 1LLZA 3PNZA 4Z1AA 4LXFA 4PEEA 2I5QA 1GTEA 4UUIA 3C2RA 3UWEA 1FWEC 3DXIA 2HE5A 5FF7A 3Q58A 3DAQA 1SJAA 1DWFM 1QBAA 2Z1SA 1B0IA 3L5MA 4Q8WA 3A22A 4IJCA 4TV6A 4PSRA 1QNQA 3MC5A 4JNZA 2D3LA 2NLYA 1ITCA 2CW6A 2XFRA 3F1QA 4HNUA 3BLEA 1RY8A 1CZ1A 3BW4A 2YA0A 5HK4A 4O4WA 4BF7A 3II1A 3UR5A 1VHCA 3GB6A 3A4JA 4HN4A 4HCLA 3N9SA 1H0GA 1F76A 4W5UA 2GUBA 3W22A 2WV8A 2OFJA 3UGVA 2J47A 4DB7A 3THQA 3N2XA 4MJMA 2CXEA 3WBYA 4FA3A 5BXPA 1T8QA 1XC4A 2Y7DA 3FKKA 3GXTA 3CUHA 4LOCA 3H26A 4YTRA 2XZ9A 2YXOA 4LUYA 1WXYA 3EWWA 4F79A 2PWGA 4YXGA 4W8LA 1XFBA 1W56A 4O50A 4DAIA 2X1TA 3CH0A 1IZKA 4FK9A 5SWUA 2YDQA 1EWEA 3PR2A 4J3TA 5HR7A 1VENA 4LALA 1DWGM 4Y9AA 2MANA 4MF4A 3DG3A 1E15A 1ZCOA 4JIHA 2FHBA 4GUJA 3WMSA 3GG8A 1UOKA 4D8AA 3N9RA 1V8EA 3IAPA 1LOQA 4E4FA 2BY0A 3RR1A 3ZWTA 1HKVA 1Q6CA 2DUAA 4DBSA 4WEVX 3WL1A 4P61A 4A05A 1EYEA 1VBGA 4HTYA 4JTUA 1JAKA 5AHMA 2YL6A 3QPZA 1IE7C 4G2DA 4KCUA 1OC5A 3AMGA 3BW3A 2PD9A 9XIAA 3UA3A 1YTEA 1YE6A 5C2XA 2JGQA 1OSEA 2Z00A 2PDPA 5JU6A 4DQWA 2P10A 1UWIA 4QDMA 1TUXA 3IJ8A 1UKPA 1YADA 1H7RA 3AMLA 4DJEA 3ZVHA 3F03K 3B4YA 3W74A 3TVAA 1TX2A 1LF1A 3NR0A 3CM4A 5CKSA 3UPWA 3CHEA 1NELA 1YPXA 1ZJIA 2C71A 3SJNA 1SR9A 5C0QA 2VEKA 3IIOA 2FJUB 2OSXA 2RJGA 4R3UA 1DE5A 4M81A 1B90A 3O2LA 4FLSA 3QR0A 2BHUA 2Z1KA 3BXWA 4DWDA 5A8PA 2HVMA 4RNFA 3CZJA 1TVLA 2IXVA 3Q4DA 3GNPA 3CLMA 1JI2A 4PMNA 3H2MA 3LBMA 4OBTA 3B0PA 4B2DD 3SN4A 3L4TA 3W7IA 3A13A 4V1XA 2C79A 3P81A 1UB3A 1GEQA 1QTWA 3STCA 3HM7A 2R1MA 1W3HA 1QDSA 4XZLX 4MB4A 1WKDA 4JBRA 4MDPA 2O4MA 2NQJA 1EH9A 1IV8A 2WKJA 5DXYA 1N82A 4XUGA 4I7VA 4HPJA 1GG1A 1W2VA 1GVSA 4EVZA 3JS3A 4CN6A 3P3BA 2F84A 4UZUA 4E8DA 4RZ6A 4XO6A 4GUHA 3LGGA 3ABOA 5FEWA 1Z42A 5M1TA 2WOQA 2QDGA 3S5OA 5E0CA 2Y1HA 3MSGA 1G69A 3VC5A 5REQA 3WUFA 5HAOA 3IIZA 2BASA 2WC3A 3VCNA 2F6KA 1ECEA 4DJFA 4UFMA 1WDQA 4GI8A 5KINA 2Q3RA 1XWYA 4RZ4A 5L9FA 1V6YA 4PEKA 2FH6A 2A3LA 2Z2UA 1N8IA 1H5YA 2HXUA 4AG0A 4ZQRA 4S3FA 3VI2A 1OYBA 2NSOA 1JUEA 4EANA 5AC7A 4ICMA 1UD5A 2PWEA 2PBGA 5HOSA 4HA1A 4IGNA 3WMCA 4DLFA 2PMQA 3U4AA 5ENLA 2G3IA 4H1ZA 3TYZA 3CAVA 3SY1A 3GAYA 3BAKA 1SGJA 1TWWA 4BQ5A 3M44A 2ACRA 5FF0A 2J77A 3NDZA 3VGBA 2VRJA 3HTWA 2GWNA 4O0QA 4UR8A 1U33A 2ACQA 2WMJA 2ZFAA 3FA3A 3ZM8A 2WJZA 3E74A 5TF0A 4NZ4A 3TQPA 2QXWA 3QHNA 1S5MA 1XDJA 6PTDA 2D0FA 1M1BA 2ZZ4A 4BI5A 1MXGA 3G18A 4P2VA 1J79A 3T4CA 1TV8A 4PUJA 4FAMA 2C6QA 1Z6KA 1F3TA 2V69A 1M9HA 2EO7A 2V9DA 2A7NA 2Y7EA 4EPEC 4CNNA 2IQTA 4WKFA 2XH7A 4QSFA 2VELA 3EKGA 3OB8A 3N2OA 3UCQA 3JU2A 4ZFMA 4CGTA 1EJWC 1NWRA 4GYFA 2AMXA 1JFXA 2ACSA 2O7QA 4XVDA 2NSXA 4WQ6A 3GNDA 1XLHA 3SAZA 3H2OA 1TPB1 1NQKA 4HKPA 2QJHA 2G96A 4LX4A 4MAZA 1QOXA 2Y88A 3M9YA 1A50A 1FHDA 1F3XA 3AQUA 1J6PA 3AWNA 5DN1A 3Q37A 4OIFA 3CUJA 4AVOA 3GR8A 3TLLA 3LM3A 4RV8A 2I14A 4WOZA 4PZVA 3CMGA 2RH9A 3PBUA 1M3UA 4LAUA 5EMUA 3QRHA 3VNLA 4G7FA 1ISWA 2DU2A 1GZ1A 3ZSTA 3E5BA 4PSPA 1E0WA 2QGHA 4U2YA 1VBJA 4IFRA 4PE8A 4L4LA 5FI8A 5DCDA 1YRRA 9XIMA 1FWBC 3VKDA 2ZRUA 3SRDA 3TFCA 3S2NA 3UVAA 3EYPA 3P80A 1R3YA 4XTIA 1DP0A 4QM1A 4PRTA 3W27A 3B9NA 5A6MA 3QOKA 4C1KA 3DZ1A 3N73A 3ARPA 3SY8A 2CZEA 1SW0A 4AD2A 5BXTA 4C7GA 4L7ZA 1RR2A 3B40A 2V3FA 2RGLA 3DECA 3MP4A 3FFSA 2P3EA 4B3KA 3DFQA 3RPTA 3OBAA 2PDNA 3R58A 4AD1A 1VCFA 3UBPC 1HL2A 4W4QA 1HVXA 4GNJA 3WQFA 1KLZA 3NPWA 3QSRA 4IIGA 3PF3A 4GY7A 4JHMA 1VFSA 3POCA 4X60A 3W70A 1R46A 1QI3A 1ZQ5A 2NX1A 4KCWA 4RE4A 4F0KA 3KLKA 4YTUA 1BXCA 1DQWA 4YVVA 2Y8UA 1TA3A 2D20A 5D2XA 4XAZA 4XBJA 3SUVA 5HMDA 1XLIA 1IT0A 2CZDA 1W9DM 2UBPC 1UWTA 1TJPA 3G1RA 4RDZA 1QJWA 1P6CA 3FS2A 4NL1A 2BGNE 1OFPA 5CSYA 3RCNA 4JX6A 3UNDA 2FKPA 3W28A 4ZO6A 1EJSC 4HMDA 5CSSA 4WY0A 1HN1A 4PMJA 3K8MA 1MO0A 1GKRA 3E0WA 4CN1A 5A8OA 5I03A 3UXDA 3A12A 5LYRA 1XQLA 4O12A 3L4XA 4IMAA 3GU1A 2XGIA 4DYEA 3W88A 2C91A 3ARTA 2DZVA 3CQJA 3NQAA 1JEZA 2EQDA 3UVIA 4L64A 5FA5A 2AMGA 1QMLA 3UR2A 3AHXA 5AYXA 4FB7A 2ISVA 4AIBA 2GQ3A 3G0XA 1XH1A 4MLRA 4OUEA 1UG6A 4C6PA 1QWKA 4N7QA 1GHSA 3HG3A 4KMQA 2DDXA 4JTEA 2Z6IA 3S5NA 1HKWA 4JFSA 2X30A 4GBUA 1VFHA 3LLDA 3H7UA 5CGTA 1CB2A 3KOXA 1A5KC 2DORA 3M46A 4ES4A 1UWQA 1UH3A 1OGGA 5CC7A 1GNXA 4HSHA 2B31A 2DH2A 2CEQA 2TPSA 2ZBTA 2WNZA 4FHAA 4ERIA 1NTHA 2DV0A 2ALDA 5CJNA 3CZEA 4C65A 4NY2A 5DBUA 3ZSSA 2D24A 1WOBA 3URBA 2BY3A 3V16A 4M56A 3ANYA 3PWGA 4CCZA 1F3WA 3BOLA 1DTUA 2HK0A 2YLAA 3W72A 1A3XA 2WVVA 1HO4A 3E0LA 3T07A 3AXMA 3KWSA 1E1CA 1KXTA 2JIWA 1QOQA 3OU8A 3MBDA 1S3TC 4EPDC 3BW2A 4PB3A 2J13A 5I77A 3NXFA 1TCMA 2VFDA 2Q71A 3H54A 3VD3A 1PIGA 2GJXA 4AUBA 1HKJA 5A94A 1UIOA 3LS9A 3FAXA 3YPIA 4XX6A 4FIRA 3RR4A 2E8YA 4W89A 4PB4A 1R85A 3UXAA 1IYXA 3GNOA 5MKGA 3RPMA 3QM3A 3BLLA 3TMLA 3NL3A 1TUFA 2XUCA 4LSBA 3GDBA 1NDWA 3BG9A 5CG0A 2TRSA 1CDGA 2PSNA 4UTIA 1CW2A 1K3UA 5H8PA 1MXSA 3OQ8A 2G3JA 4IFKA 4IISA 4CUCA 3I7RA 1FWFC 1W5MA 3TN3A 1HNYA 5GVJA 2BG5A 1E0VA 1TPEA 3MYPA 3C2FA 3PFRA 2HISA 5HQMA 4Q4PA 1RSCA 1XIFA 4LEQA 1XYFA 1XRTA 3PVFA 4UMBA 3UQNA 5G2WA 5ECUA 4CVWA 3R25A 1KCLA 3WDJA 4ZB2A 3WD0A 3L23A 4D8LA 2CZVA 3QKEA 3E0FA 3KW3A 4H41A 3S1UA 4F3HA 2Z24A 3CL8A 5A8MA 3W83A 1JCMP 1VS1A 1VH7A 2JFEX 3UNTA 3QV8A 2CHOA 1KFKA 1GVFA 4C6FA 3VAVA 4Y6GA 1CECA 2NQZA 3VGHA 4URIA 4B3LA 3WJSA 3TA9A 3VUPA 1DQXA 3H21A 1YDNA 3TZNA 4Z0SA 1VJZA 5IDZA 1S46A 4FF5A 3VUSA 3L66A 3CB8A 4PCFA 4HPNA 1BHGA 3R8RA 3RJYA 3SBFA 2I7GA 4AQLA 3WH5A 4GPNA 1P48A 2WKLA 3PZOA 4H9XA 4JQ3A 5LSMA 5E70A 1SUXA 3EDDA 4X0VA 4IUOA 3B04A 4QEHA 4N9CA 2J27A 3RMEA 3L65A 3BK0A 3OQEA 2UWFA 1MZRA 3PUGA 2AQWA 3MI2A 4JTQA 1ZZMA 2YXGA 3FVMA 3DFOA 4RNJA 1W91A 3K2GA 4LUJA 5CLWA 4LF2A 2VFEA 4BF5A 4LVGA 2O4QA 3UFYA 4UTLA 2FTYA 4ZSTA 4TIMA 3MA8A 1YHTA 5CG7A 4LAZA 1XPGA 2ZXDA 1R9ZA 2Z7KA 3ZFHA 3LCLA 1BGAA 1HKKA 2RFGA 3UJRA 1V6UA 5AY7A 2F61A 1FWDC 5C71A 1C90A 3WMBA 5G1MA 3R43A 1MRQA 2BXVA 3TJLA 3UEQA 3BMWA 4UB9A 3R8HA 2CETA 3CV7A 2NUYA 2V5CA 4YPJA 3KLLA 1BD0A 4ZO7A 3PSVA 2W9MA 4O57A 4DM1A 1AUSL 3NQ7A 1RJQA 3G8RA 2OVLA 4LC6A 4ECLA 5D02A 2O9RA 5LIKX 3NPXA 1EPXA 5BOFA 1TWDA 1VJSA 1NDYA 3AHTA 3APGA 3GZ3A 1PX3A 1GQLA 3TW6A 2Q3OA 4RNIA 3LHUA 1FUYA 1VRDA 2A5HA 2NW0A 1EX1A 4DYKA 2JIEA 1FHLA 2UV8G 4I7WA 1J12A 2P1FA 1QAPA 2HXTA 2ISSA 3BZGA 3DFYA 1RAKA 3UJEA 3BLKA 1FP9A 3F2CA 3HG5A 4QLKA 4EXQA 3ITYA 4H6RA 1SO6A 4KWVA 2R1KA 1RP8A 5FJTA 2J74A 1JZ4A 3RM9A 1US0A 2OT0A 4YVXA 2J78A 1BVWA 3QY6A 1TR9A 1RPXA 4KF1A 1E43A 2OOFA 2YL8A 3GHSA 1W1VA 2Q09A 4I6VA 2JE8A 1CGYA 6XIAA 1XV8A 1EQCA 4NIRA 1J5SA 2ZX8A 1SYTA 3TSDA 5D4YA 3BJFA 2XVGA 4Z1YA 1K9DA 3R13A 4A8IA 3SCRA 1ZCCA 2FLIA 2FHFA 3APYA 5GJPA 1WB0A 7CGTA 3U6WA 1GPFA 4UOJA 1UH2A 2OGYA 3UF9A 2D73A 4Z2GA 4L6HA 3SEPA 2O7SA 4ZL1A 5JIWA 1OK4A 3LSCA 5LNVA 1XUZA 1MDRA 4YYCA 3M6YA 3SI9A 3UGRA 3W7MA 1UWAA 1NARA 3PBMA 2GZXA 1ECQA 2PTDA 1WDWA 5G2HA 2DW6A 4HHMA 2XJ7A 1UUQA 2ATMA 1W31A 3LG3A 1BRLB 3WSUA 1XLEA 3SY5A 1WKFA 1TWSA 3P8IA 2CLHA 1GG0A 3MMWA 1BWLA 1BG4A 1E5NA 3U5YA 1YBQB 2QW5A 3WENA 4H00A 1RBOB 2ZRVA 1F5ZA 1UW9A 4MWAE 5A6LA 5C9WA 2WK2A 2DSWA 4J3WA 4S3EA 4DPQA 1CPUA 4H8HA 2P50A 3WF4A 3WF0A 1ZBVA 3ARRA 3BLOA 3LXCA 3PTDA 4CCEA 1G9HA 3W3OA 8RUCA 3LB0A 1D8WA 3LV6A 3IANA 2F6XA 5CCZA 3WELA 5EY5A 3S46A 1TJ0A 5DT5A 3CT7A 4AD4A 1HO1A 2V0TA 3TA6A 2FGZA 3P93A 3F2BA 2V2DA 1ZBKA 4QJ1A 1OCBA 4CD7A 4Q8PA 3MV01 5HPOA 2PWVA 4ZQMA 2Q8XA 3BSGA 3VGGA 5RUBA 3WK0A 2OEKA 4OECA 4L4PA 1MUMA 3EOUA 3E2QA 4Y9PA 5M3WA 5AHLA 5A5WA 2AL2A 5MKGB 3T2PA 2WC7A 1LM1A 3EX3A 1YLVA 3A4XA 2QV5A 3EEZA 4JCMA 2XH0A 2EPLX 1AW1A 3CC1A 2ABBA 2F8QA 2ZZ7A 4R34A 1KFWA 3URAA 4YU1A 4ZXLA 1Q6DA 4D6JA 1HJXA 1W9PA 4I8YA 3FEMA 1LWHA 3CEPA 3SCOA 1E70M 1PSCA 4XZ9A 3HO8A 2UY5A 4B5UA 1ZPTA 4UTMA 5EFDA 1TZZA 3W75A 3EXRA 1RLCL 4ZMGA 4QCFA 1Z48A 1FKWA 1X7IA 4NILA 1X38A 2X40A 2FZBA 5FL0A 3W1MA 3H6OA 3W25A 3EA2A 5D9PA 2MNRA 4OV9A 3F4DA 2DPEA 3T7VA 3I6RA 4C6OA 1Q7MA 2FZNA 1UP2A 2XIIA 1JPHA 1S3HA 5JXQA 1CGTA 2HS8A 3NOEA 1F8IA 1ISVA 4JQ4A 4MNLA 1X96A 1X1OA 3WUGA 4PMYA 5CPQA 4HGXA 5K4ZA 4OQVA 3IGXA 1A5MC 1HX0A 4GVHA 1XS2A 2CBJA 3M0HA 5D05A 1BSIA 1WQ5A 3FV9A 3LD5A 4UWMA 1PCKA 4GIAA 3O63A 1X6NA 3LX9A 3ZJ7A 3N13A 4HK5A 7PTDA 3NQ6A 1VBUA 4PMVA 1R5YA 4WY0F 3DERA 1T99A 1M7JA 2EPHA 3IJ7A 3TC3A 2D69A 3R8GA 3RMJA 3HB9A 2ZUWA 4LYQA 2ZUTA 3VCCA 1WDDA 3TK7A 4NQ1A 2QCEA 4PN2A 4CCCA 1XIBA 1YPFA 2VC7A 1R2RA 1RP9A 4RKAA 4BCEA 1AL7A 1GJUA 2XISA 4JKLA 4JHOA 1GGOA 1XD1A 3QHOA 2QV4A 2XGBA 3G1HA 2XHYA 1TPH1 3PBVA 3W2LA 3LSBA 4NJKA 1X98A 3BVJA 1DORA 1LBMA 1LLOA 1LT7A 2YGYA 3W2UA 1A5BA 5E09A 2IQDA 2Y6ZA 3HJZA 1P0EA 1QHOA 4HOXA 2PWDA 2NV1A 4MUPA 3ZT6A 1HJWA 4H9YA 4E0CA 4I9AA 4UMCA 2QPUA 3W1UA 4S3CA 3T9PA 3WLTA 2OYLA 5EKYA 4EF9A 4B90A 2WANA 4H7CA 1Z69A 1XXXA 1F07A 4UXDA 4IT1A 2ASHA 4B92A 1UC5A 1OG0A 3VOCA 3CQ0A 5CXPA 3GH4A 4MG4A 4IM4A 3I3BA 4JIQA 4GQRA 3EZ4A 3WLOA 2GPTA 5D2TA 1S2TA 3BAYA 3CTLA 1VYSX 4AZCA 2DGAA 1J93A 1FWRA 1P7TA 3OO2A 6REQB 1U5JA 1A5CA 1NH6A 1ITUA 4A3RA 3MW7A 4BQ3A 4BJHA 5H1WA 1A0DA 4K8HA 1W1PA 4DAFA 2YW4A 1F6KA 1WX0A 1PKMA 1JCXA 1S38A 2GJLA 2HVOA 1HT6A 4S39A 4MWAB 2QF8A 2QVNA 3E0VA 4GC4A 5FJUA 2P53A 3ITXA 4XTDA 1JD7A 2NWSA 1E6SM 5D38A 1UKSA 4PMQA 5GQBA 3NO3A 1TTIA 1DJYA 1UR3M 1RQBA 4JTDA 4UNLA 1LOSA 4LANA 3W7OA 1C9WA 3QZEA 3POHA 1SJCA 1W1ZA 1O1ZA 1Q7QA 4WK9A 3H4XA 2BHYA 1EF2A 4IG2B 4XAGA 3UG3A 1SU5A 4A21A 4CEUC 3G1SA 2YKKA 3U2CA 4LAMA 2B4GA 3ARQA 1PB0A 4IIEA 4NRRA 1I6NA 3O15A 3AU6A 2OJPA 4IQJA 3COTA 1ML1A 4TO8A 3G6LA 3RLGA 5T8GA 1XHGA 1I1WA 2G3NA 2O92A 1LUCA 4Y9OA 2A0NA 5JVLA 1E4NA 2IPWA 1OCNA 2E9LA 4GKLA 3PC0A 1QNVA 3EWCA 3GU2A 2FJKA 3UU0A 4C5ZA 1WKYA 2O9OA 2WVTA 3ES7A 1SZNA 2QIIA 1KM6A 1EBHA 1RQEA 2QJJA 4W8BA 5C2GA 1W1A1 3L4VA 3URNA 1KGWA 4GI6A 3QC3A 4N0RA 4GJIA 1LL7A 1XYMA 3WD2A 1H1YA 3T4WA 3B8UA 1TV4A 4UQAA 2FYMA 4PGLA 1FWWA 4H3DA 1WZAA 2UY4A 1NP0A 1UHVA 3A5FA 5F4SA 4F66A 3NQBA 1YNPA 3SUSA 1IT8A 3V5OA 4I9JA 1EZ2A 7TAAA 2C8NA 5LXXA 4AF0A 4GKTA 2YFNA 4RLIA 5DT7A 2REQA 1U1JA 2Z0IA 3TH6A 1PYFA 4D1IA 1U5HA 1B2YA 3PZMA 3VDCA 3LV5A 4MKSA 4C6LA 1O5QA 1Q66A 2NLIA 2NVDA 4FALA 1MQPA 3ATZA 4QJ5B 3DUGA 3XIMA 4LFYA 1ENUA 1R30A 4ZXOA 3W7GA 3ANVA 1OF8A 2DSUA 4BHYA 4U2ZA 2GGHA 3DYPA 4XSLA 1UR1A 3KHJA 3MHUA 4KCVA 3MB9A 3M41A 5IBXC 2XDFA 1NWSA 1ZL1A 4IIHA 1ZHAA 4Z42C 2GVEA 3V1PA 3P5ZA 1S2AA 2XVLA 1JPMA 3MJMA 3GHUA 2J7DA 3MHGA 4G9PA 2OX1A 4ZQNA 1DHKA 2AGTA 4JCLA 1IXQA 5G4HC 1UWUA 2BLEA 2E6DA 2PDIA 3G1XA 4NYYA 2J7FA 1G4EA 4QE1A 3DFSA 1WZMA 3I7QA 4Z2IA 2RKXA 3MHFA 2I56A 2Q6ZA 2Y5SA 3DESA 4WXYA 4FZIA 1NF0A 1L6YA 2Z27A 3DDMA 4H8NA 3K4AA 1BQGA 2FDSA 3VM7A 3GFZA 4XSMA 5AYZA 3BARA 3KXQA 4IMFA 1H7NA 2QNEA 3UG4A 1JD9A 4ADTA 1ALDA 4XWUA 2QR6A 1CLKA 1IIGA 2OQYA 1DBTA 1MUWA 3E2VA 1CXIA 3UP8A 4GCXA 3ZR4A 4DPPA 3ICJA 1XM3A 4OE7A 1RXOB 3B8WA 3KL0A 2GDVA 5GJMA 4RZBA 3RO6A 3SFWA 1JDEA 2QCLA 1QI0A 1JZ2A 3D3AA 4GVIA 2VX6A 4I5UA 1Y0EA 3D47A 1XYLA 3Q94A 3NZQA 1VCVA 2XYLA 4A3HA 5IHSA 4L1XA 1SFTA 4KPLA 2VX4A 4N6FA 3FJLA 4GQGA 3M5VA 3UY7A 4RPQA 3XISA 1RH9A 1UA7A 1NWUA 4LVFA 2PDLA 1ME9A 1IEIA 3B3DA 1BYCA 2Y24A 1GYLA 2WJEA 2VEPA 2Z28A 3GSMA 1MXDA 1OGBA 3T42A 4LS1A 5JQ9A 1US2A 2GQ8A 5CQ1A 4J3ZA 3BGJA 3NYDA 4GIEA 1B3OA 4O1CA 1GJWA 3PZVA 4O13A 1XUUA 5B7ZA 3SDOA 3R12A 4IZGA 3CHDA 3AO0A 1K7XA 1FRBA 2V2HA 3UESA 3OHMB 4NJGA 1XKJA 3QR1A 2QQ6A 6ALDA 1GCYA 2WAGA 4Y9MA 1PTGA 2CLIA 1MEWA 1NEYA 2Z1VA 4LTSA 1C9DA 3PHAA 2A3BA 1B9ZA 3D6NA 1W5PA 3WDRA 3OZOA 3GKFA 4QGCA 1DWHM 4GUFA 2PD5A 3A4AA 3DHPA 3S1VA 2WMHA 1NM9A 3K30A 4AH7A 2EJ1A 4UTHA 3SR7A 3CUXA 1DQUA 4C6MA 4JIIX 1TVNA 1HJSA 1JZ6A 1W8GA 4HYVA 3CMJA 1I60A 1OIFA 3S6OA 2QYGA 3ABZA 2Z1XA 3BQ6A 4CQBA 4EK7A 1S1RA 3UR7A 5FKYA 3NPVA 1L8PA 1ZLPA 3MSDA 4ZVJA 3S47A 4PMZA 3LHVA 2P0OA 2V5LA 1OFEA 1UD4A 2WZTA 2OQLA 4QP0A 4D71A 3MUY1 2D23A 3E38A 2EPNA 4B16A 1US3A 2V5BA 4J4KA 8A3HA 1DWIM 4Q22A 3OLIA 4ONVA 3CK5A 3T0DA 3ZYZA 5BYWA 3BGGA 1GOMA 1CIUA 2PF8A 3OIXA 3B8VA 1JYVA 1M01A 1Q3NA 1RY0A 4M6QA 2QF7A 4CNPA 2ZQ0A 3IPWA 2G37A 1MEIA 4GYKA 5I3IA 3R4IA 5AYYA 3EOEA 4I5XA 1QWGA 4WRHA 4E38A 3QV9A 1T8XA 3W1RA 2ATSA 3MUCA 3S6TA 4ALDA 1KWKA 1Q7ZA 4FX6M 2P8BA 3VKAA 3C52A 2HS6A 4L56A 5KMYA 5PTDA 4GQ0A 1YDVA 2Y8KA 4GXPA 3DH7A 5I6SA 2J24A 2E40A 3LI0A 1KLYA 3SUTA 1NU5A 2ZX7A 1MW1A 1E9ZB 2QUNA 3K4DA 2XN0A 4GQBA 3OVQA 1TMLA 3ZVHB 2JKEA 4LUTB 5LNWA 4MDOA 3S42A 1G67A 1FWCC 2X1UA 4B3ZA 4HCDA 2PPGA 4R5EA 3WLNA 1SW3A 3B03A 1G94A 1GZGA 1DL3A 3TYAA 3TEVA 3L0NA 1ZP3A 4RDVA 2G50A 2GSJA 1A3WA 2A6NA 3GAKA 3AUJA 3AIBA 4ZSUA 3LA4A 2BOEX 4E4UA 1XIIA 4A8RA 8XIMA 4DWSB 3QLDA 5DANA 1JPIA 2BNJA 4RR4A 3CPUA 4MIMA 3H2CA 1G0CA 4BF9A 3GUGA 4JTLA 5J04A 4P5UA 3PZNA 1SW7A 1W1B1 3F4VA 5AVHA 1XRVA 3EA3A 1J01A 3MV11 3WNMA 2E9MA 1YE4A 3PPHA 4LUIA 3GYCA 1H61A 3NGFA 3C6CA 2R82A 4AZCB 1RVKA 5CPOA 3U8GA 2NT0A 2PDGA 3DYMA 1FDJA 2VZSA 4UCGA 1G01A 2BBFA 2JF7A 4JL1A 2HDJA 3VKKA 1NFBA 3IWPA 1V93A 4L4MA 2DT0A 5BOEA 4IPNB 3KRUA 1XP3A 1CT5A 3WF3A 3GG7A 2BGSA 3M7WA 1LBFA 1IEVA 4Z2HA 4XISA 4AZIA 4W7WA 2PUZA 3IARA 3LDVA 1QO5A 1XCXA 3OJGA 4H7VA 6A3HA 3VOGA 3H22A 4CD6A 1MNSA 5DY2A 2RDWA 1RZMA 2CKRA 1ZUAX 3NQVA 3I68A 4H6KA 3R0KA 4TX6A 1U30A 1MI3A 1CGUA 3VTRA 2WQPA 4CNTA 6ENLA 4GH3A 1TG7A 5FJJA 1IIHA 1PX8A 2C16A 4S3GA 1TJ2A 2VEIA 3FAWA 3UWYA 3A6OA 1ZBWA 4KS0A 4AWUA 2F38A 3W7KA 4XZWA 1F7BA 2E6YA 2FVLA 4NX0A 4AXNA 4AY8A 5JBDA 3W7HA 4HU0A 3T2OA 3S83A 1UBSA 4IX2A 3WDPP 3S5ZA 4W88A 1T6MA 3E2SA 2H6RA 3S1WA 2W27A 3KCLA 2C19A 1Q13A 1DJXA 3AZTA 3KP0A 1VFFA 4M7SA 3VMOA 5EA9A 1W1YA 1DTNA 1K8ZA 1PHQA 1XIHA 4GABA 1H41A 4P8WA 1IXPA 1FWNA 4QROA 1P0DA 4MB5A 5I78A 2FVMA 3P6LA 4HIBA 1V0KA 2NT1A 3EB2A 2E1DA 4C60A 3HGOA 1G7VA 3SGGA 1OQFA 3L5AA 2D2HA 1XRSA 2G8ZA 2DZWA 4AEOA 1H50A 3IRSA 3SIMA 2PTXA 1JULA 4H2CA 3KOYA 3LPPA 1XC6A 1PJ9A 4IH3A 1MYRA 4JTKA 4QSHA 4LS0A 4IF2A 1OWQA 1E9YB 3JZUA 3PUEA 1C8QA 1V6WA 1OX4B 4GO8A 3LMZA 2YW3A 2H8ZA 4V2XA 1F6YA 3KRBA 2I9UA 2J4GA 4P7OA 1KKOA 4D1JA 5E5CA 4U4MA 4BR1A 4AIEA 3KE0A 2OLHA 3DG6A 2VZTA 2IPJA 3WK2A 1BTMA 4FX7A 2HBXA 2WMIA 3SQSA 5D8WA 1DJQA 4JQAA 4IL2A 4TVUA 1QUMA 1R0MA 2HV5A 2D2GA 4L9YA 1YBQA 1MWOA 5TIMA 3CL6A 4KIRA 5LHFA 4CU8A 3W1LA 1KTCA 3VABA 4XAPA 1CWYA 4GK8A 5JBEA 4MKVA 3EOOA 1JQXA 4UC5A 3O1NA 1JGMA 4AW7A 2XVPA 1OF6A 2IW0A 3RJXA 3HIJA 2QJMA 2ALRA 3TIMA 3F5LA 6XIMA 5D37A 4GBDA 3AJXA 3W84A 1PZ1A 4WDXA 1DE6A 2OXNA 1PX4A 3BAIA 3BZJA 5J8LA 2D2OA 4NSBA 4XKYA 1AQHA 1RJRA 2BWGA 2DVUA 4O15A 1W37A 4E6MA 1VC4A 1ODUA 3R6IA 1NP2A 2OLAA 3TXVA 2WO5A 3H2AA 4CNUA 2X7WA 1T0OA 1TVPA 5IDIA 4M6UA 1EJTC 5FIPA 3RLHA 2BDQA 4OU1A 1UR4A 1XH0A 1JNDA 4W86A 1PZ2A 2X09A 1KCKA 1QHZA 4P7RA 3U4FA 5CZ0A 1UIPA 1FHVA 1XGDA 4M19A 2PDKA 3R2GA 4AHQA 1C8YA 4AD3A 3PZIA 1V02E 3RK8A 3LCFA 2D0GA 1CXFA 5HQEA 3EB3A 1XLFA 1QK0A 3KCOA 1DJNA 2WJDA 4AMCA 5I24A 1Q6RA 2W63A 5D09A 1ISZA 1S5NA 3B8DA 5A2BA 1AH0A 1PZ3A 2ZDRA 4Z1DA 4X3ZA 1NOWA 4IMEA 2J79A 1EP3A 2WPBA 3QFEA 4NG3A 4LBRA 4XD3A 3RF9A 2AAAA 3LPOA 4WJXA 3CAWA 3W4RA 2CWXA 4JEQA 2KZHA 2FMOA 2F2HA 3M64A 4TX9A 5I3DA 1EC8A 3E49A 1M41A 4V15A 5BU6A 1F9CA 3WBEA 5ABTA 4AVFA 1YMYA 4JKKA 1M7OA 4NI8A 4ZGYA 1FCVA 2E09A 3PFMA 3RG6A 2CESA 3H53A 1E0TA 3GDRA 4RX0A 4JTCA 1K7EA 4AAJA 1R7AA 4RPPA 3NQEA 3KS5A 3A3XA 2VD8A 1V6VA 2VQTA 4O53A 1OVDA 4KWUA 4NX5A 4GXMA 5A6TC 3NZ1A 3SCTA 3AXIA 3VILA 3LLXA 5K2ZA 2ZZ6A 4ENLA 4GISA 1D7FA 3M47A 3RAOA 1D9EA 4MY1A 3VIGA 3KHDA 2YFOA 4HHHA 3RPDA 3WLHA 4GUIA 4IMCA 4QG8A 1HGYA 3AHVA 3DI0A 3H4GA 5T91A 3B97A 2GQ9A 2ZDSA 1GWJA 4PBEA 3TTEA 3VA8A 3EWYA 3GG1A 2YDRA 1EEPA 1TCDA 1XL9A 3S2CA 1J0KA 4AX6A 3VYLA 5EMJA 2Z25A 1GKPA 1AJZA 3PJUA 2PODA 5CJMA 3M0XA 3HG4A 3NO1A 4NYUA 5U4NA 5BROA 1ELSA 3QSTA 2OU4A 5HNTA 2J7HA 1K77A 1E3XA 4JIPA 2CFFA 3HQPA 1SFSA 2ZWYA 4CN4A 3C3NA 3FDGA 3UXKA 3VOJA 3GBDA 3AS0A 1H09A 3VKBA 3LCXA 3N6JA 2XH2A 2Z29A 1TWIA 5E1QA 4EXBA 1XLGA 2D3NA 3INPA 3HGSA 2GVYA 4PUEA 3QW4B 1OM0A 1UKOA 2CLLA 3DENA 3PWAA 3NVDA 2C1HA 1UD2A 1K8CA 1N55A 3ZR5A 1KFLA 1H7WA 4UTUA 4B5NA 2VCCA 3T8QA 1P1XA 1R3WA 2PDFA 4AY7A 4IGSA 2JALA 4U10A 2V2CA 1F6PA 3W02A 2TODA 1EYWA 4LBSA 3TJXA 2DIKA 1I8JA 4XKMA 5I02A 4K36A 4FF7A 4N42A 1B1YA 4GLEA 3M6DA 3QPEA 3TNOA 5A1AA 2Z2BA 2X7VA 1UASA 2R8WA 3WF1A 3N2MA 3VIIA 1S5TA 4UTWA 3ME3A 4C1NB 1XCFA 1GT8A 1UCWA 1EPVA 2G5WA 4JZ5A 1XIJA 4OTKA 2I5GA 3PPCA 3O9NA 2VUNA 4WF7A 3QC0A 3SW6A 4Z2JA 3PZTA 2CKSA 3NFUA 3NURA 5CZSA 1E4IA 3EDKA 3MI6A 2H3BA 3ZQ9A 4E5TA 4D8ZA 4NI3A 4U3AA 3VNYA 4MPQA 2ZZ3A 4L9XA 1VIZA 3MQTA 3JZEA 4IMGA 2V5DA 4AD0A 3VIFA 2Y7FA 4HSOA 2FMNA 3G0SA 3LNMA 2W5FA 5TNVA 5K7JA 1N8FA 3GNXA 3PG9A 1HJQA 3MYOA 5LIXX 1MVYA 2ZUNA 3MSYA 4JTIA 3I6EA 4DZAA 2XM1A 4ZTYA 1VD6A 3VD7A 2GOUA 1PTDA 1IEWA 1QW9A 2GWGA 2V5KA 5KZDA 2QCCA 1I9CB 2YDAA 3UWUA 4Q4KA 1ZTVA 3VIOA 1E0XA 4JN7A 3Q65A 3BQ5A 3FYOA 2GDUA 4TTGA 4LRTA 1DXEA 1VGAA 3IIPA 2WCAA 5FACA 2QEZA 1OIMA 1VEPA 5AYBA 1NIUA 1E73M 2ZVIA 3PSWA 2HTMA 3HPZA 5D04C 3GBEA 4Z2LA 3O6AA 5CZJA 4QG9A 1OHLA 4XIMA 1Q4NX 3L68A 3N4AA 4Q4MA 2R91A 1H1NA 3GWQA 3CU2A 3LCWA 3ONBA 4HMNA 2RJHA 3LCIA 1ONWA 3FDKA 1LQ2A 1TMHA 1DJHA 4EOUA 1RHCA 3T81A 3V0TA 3DGBA 1NF7A 3AJ7A 5EGRA 3AI0A 1KQYA 4I7UA 1E6RA 5A3HA 1JXKA 5FF3A 4GOAA 5FEXA 1K70A 3EX1A 4DN1A 2ZUSA 3T8LA 3TN5A 1FBAA 1FWHC 4HT3A 3VNJA 4GH1A 4M6PA 4K1GA 3L2MA 2HPIA 1AQFA 1W3LA 2DZPA 4MJ2A 3WBAA 1X97A 4A2SA 5G4EA 1AD1A 3GU9A 4IPLA 3STEA 1BXNA 1YDOA 3RLUA 2FZMA 2FDMA 3PJXA 1VRXA 5HMFA 4C5YA 3RUBL 4MZ1A 2PLJA 3PN8A 1C8XA 3B05A 3EOLA 2TSYA 5GJNA 4H9VA 1PHWA 4H19A 3V5FA 1B57A 4MOZA 4AYGA 3NSMA 4W7UA 1AZ2A 3NDOA 2OWXA 4MFDA 1OFQA 2I57A 1TZ9A 3BO9A 3GXIA 3DHUA 4YHGA 1M6JA 3O7UA 3AXXA 4PBFA 2WZIA 2QJNA 4GFSA 4ZOEA 4WKAA 1XQKA 3K1DA 1FHUA 1KFCA 1V08A 2AL1A 1BYDA 3NSNA 3R5EA 3FHQA 4XO7A 4WUIA 2OO6A 3SIZA 4H4IA 1QVBA 1KFEA 1QOPA 4M29A 1VQTA 2V8ZA 5HDRA 2YB1A 4PCTA 3V0UA 3KEHA 1EP1A 3LRMA 2C7FA 5IRPA 2O56A 4Q8UA 2IXUA 1I2QA 1Q5MA 3QEZA 2ZRYA 3WYZA 5GNZA 2WZMA 3RM8A 1R3TA 5AFDA 3GDTA 4JIEA 3GZAA 4OBRA 1AZ1A 2VZVA 3DFPA 3P82A 1IGSA 1V0NA 2C1GA 3TSBA 3RU8X 1TTPA 3TR9A 3MDUA 1VFUA 3CWNA 4JS3A 3CGTA 2XH4A 1JZ5A 4PH6A 2MUCA 2FZDA 3GXDA 1GUVA 3LOTA 5JBFA 1E0UA 1J10A 2J75A 3WD4A 4BWLA 2BOFX 3WQ8A 1R3VA 5IM51 1FFRA 2J7BA 4FXRA 4ACYA 1SZGA 2ZTKA 3LEPA 3AALA 3BAWA 4YNGA 4UOQA 3W1AA 5A95A 3CQKA 1CXLA 3W38A 3TWBA 2G4FA 3W0KA 3REQB 2XIJA 3IVSA 3HZ3A 1WYIA 2UZ9A 4B9YA 1SZEA 1PBGA 3KDOA 2AKMA 3VZXA 3B8SA 1GVIA 4M6VA 4RJEA 3ZXWA 3S5SA 3NQFA 4N9EA 1JQVA 3LPFA 3TJ4A 3WNPA 5HJYA 2CCRA 3L4UA 4R7OA 3M0VA 2WBGA 4GY1A 1YXDA 3IVTA 3M43A 2VM8A 2DT3A 3M1ZA 2ZXAA 3ZJKA 2WKGA 1V51A 4IXHA 4D72A 3I4KA 1WDPA 3AIVA 3Q45A 4PMOA 2WB5A 3VKJA 1RCQA 1L9WA 4JTHA 3NZPA 1D8CA 3THAA 1V3JA 1ITXA 2ZCGA 4HA4A 3NO5A 2FH8A 4M82A 1TX0A 4FX8A 5KZ6A 2E77A 2I5IA 1U22A 5XIMA 5BZAA 1TIMA 3GY1A 3RCYA 5GNYA 4DBWA 1TPDA 1LDCA 3PZQA 2DW7A 3QV7A 3QQ0A 1UPMB 1W0MA 2BSLA 2XFYA 5AZ1A 3WNLA 1R38A 3W2MA 4PC8A 2WSQA 1M68A 3MVIA 1G7UA 1K6AA 3AMDA 3H2EA 3QXBA 4MY9A 4UR7A 3A24A 1JCYA 2G41A 5HNUA 5CZTA 1IR1A 4US6A 4UQCA 1V7YA 3WFAA 1VJIA 2H9AA 3LXBA 1UWSA 3TSMA 3CUFA 3VVGA 1VYPX 5G5IA 4L80A 2HRWA 2FFCA 3FNDA 1VF8A 2P8CA 2CBUA 4ILSA 3G1VA 3O07A 3VZZA 4AZ5A 3MPGA 2Z1BA 1QNRA 1Y65A 4GG9A 2X16A 4A6GA 4JKMA 3HGRA 1RQHA 3N2TA 2PGEA 4MB1A 5K9DA 5AN7A 4JHZA 1O1HA 4UFKA 1B31A 4C7DA 2EAWA 2ZUUA 1XBXA 2ZWZA 4Q7NA 3ATYA 3GTHA 2DZSA 3U0HA 3AIEA 2INZA 3PB2A 4TV5A 3CUZA 3SO7A 3C5QA 3WLPA 1B3YA 4O1AA 3NYZA 3SCQA 2PZNA 3P0WA 3WD3A 3L21A 3GO2A 2YPIA 1SQ7A 1E4MM 2DH3A 3QLLA 3W81A 2KX9A 4KGLA 2UY2A 1WDSA 1H51A 5KITA 2VFIA 3IV3A 4TR9A 2DJXA 2J6XA 3VGFA 5CGMA 2NV9A 1ZGDA 1LORA 4FLRA 1VPYA 1GPWA 4B5TA 2OYKA 2G97A 1ONEA 2I17A 2F7FA 3GUWA 4XD6A 3K13A 5HUPA 4JTJA 4WCJA 5A69A 4HP5A 5KETA 2VNCA 2WM1A 3A3HA 4S3AA 3N14A 5HBFA 5LA2A 2Y89A 3M0MA 4XUYA 1ZBCA 3Q67A 3TTSA 1V3KA 4UTFA 1W32A 2YB4A 1XBVA 4MADA 1K7FA 1T5AA 3PPGA 3LYEA 4M24A 4PUNA 4GZIA 1E1CB 4V28A 2W6RA 4NXSA 4EF8A 5T26A 4S38A 3VU2A 4JIRA 4X63A 3R10A 2J8TA 3MZ2A 5CLTA 4QX4A 4XZNX 4EP8C 3LHZA 5DCBA 3W7QA 4D6IA 4REQA 2DZBA 3T1GA 1DIKA 1A5AA 3ENLA 1ZSXA 5EFFA 2OEMA 2FPYA 1PWMA 3UXLA 3M07A 1T40A 3H12A 5GNXA 2CHNA 3GIPA 3VMNA 3HPSA 1WO2A 2RHGA 2DZAA 1V3MA 5D30A 3ARZA 4J3VA 2R1LA 1VHNA 1RD6A 3I7SA 2ISWA 1KRBC 1NWTA 4O1EA 1BSLA 1WBHA 2R24A 3SCVA 3S6DA 4U31A 1V6TA 5DLCA 4DF1A 3AZSA 3H4WA 3PB0A 1UD6A 4L6DA 2IS7A 1HQTA 3K1GA 4AEFA 3OG2A 3MKVA 2DUXA 2O9TA 2DVTA 4OT7A 1VPXA 1A5SA 4JY9A 4QDPA 1GYNA 3H8AA 3ZOAA 4DZ5A 5TQLA 4DO4A 2EKGA 4GUGA 4MYXA 1FOBA 1W9BM 2FZ9A 2X42A 3RRAA 4QG6A 3OG3A 2EKCA 1QT1A 4OKDA 3OHIA 4IIDA 1Y7VA 4KETA 5K4XA 1W5NA 3OA3A 1D3GA 3FA5A 3HG2A 3W24A 5FJIA 2HSAA 3WNNA 2VWTA 3WK1A 1G6CA 2VVSA 1OFOA 5EB8A 4MKNA 2CLMA 1IWPA 5EBAA 2VOMA 2Y0FA 4XVEA 5BWFA 2V30A 2VEGA 3JVAA 3UZZA 3RRXA 1MEHA 1MFUA 4UOZA 3WG6A 1MUCA 2NXIA 3E1F1 4PRRA 1F4HA 4HMEA 1I75A 2FGLA 3KS6A 4KH2A 3V5CA 1TFVA 1KA9F 4I9MA 2XVNA 1S1PA 4UFIA 4XK2A 2OCZA 4L65A 3BJTA 2BVYA 3BUVA 3FJ6A 5EL1A 1DEDA 2EPMX 1O95A 4JDBA 4NZFA 4G7EA 4KEVA 4GI4A 4ACZA 5E9AA 3CB3A 3USBA 1CX9A 1WCGA 1UD8A 3HA1A 3A9BA 4RUBA 3U2ZA 1OC6A 4F9JA 3O3RA 1N7KA 4IQDA 4JTRA 1BLIA 3V4BA 2OOGA 1E6ZA 3WMLA 3SSJA 2J7GA 3TTQA 2C0AA 1PS9A 3P67A 3UJSA 1OFBA 4KKXA 3QTPA 1FWAC 3ARWA 3W6YA 1OFDA 1F8MA 2P3ZA 3TUUA 1WV2A 1RALA 4CNOA 2JBMA 3QFWA 3TN6A 1KXVA 1BF2A 3S4TA 3P61A 4PL1A 4UMAA 2IMRA 1TTJA 1Q6EA 3VM5A 3AXKA 3OVGA 4ZB5A 3USZA 1KR0A 3O6CA 1G1YA 1LROA 2ZXQA 4LCSA 4QDWA 4NHVA 2VEMA 1OX5A 4A29A 3WCZA 1OCJA 3T05A 1KV8A 2E4TA 2VUYA 2HBVA 3HF3A 2VT0A 3GHRA 4QISA 1KTBA 3WK3A 3N4FA 2VWSA 4X9YA 2PDYA 2PS2A 1M5WA 1KBLA 4DO5A 3THUA 3LGDA 4PMUA 5I7GA 1SSGA 1E6XM 3WFZA 1MNZA 3P0XA 1XDMA 2PDMA 3N6HA 4IG2A 1XYBA 3GIYA 1J2BA 2OTDA 3GG0A 3NQGA 1QPRA 1LG1A 3WF2A 1UP0A 3ARUA 1QNPA 8XIAA 1KO0A 4BQ4A 1B54A 1ICPA 2YL9A 4RCXA 4BI6A 5T9CE 1JRBA 3WIJA 1OG6A 2HE8A 2YA2A 4X9SA 1SZRA 4MM1A 3E12A 5FEPA 3WJWA 3QGVA 2VDHA 4AIOA 1BWKA 4JN8A 3OBEA 4B5WA 3OGSA 4E3TA 2GGEA 5I3HA 2DZXA 4AXKA 3NCOA 4Q7IA 1JG9A 3G1YA 4O28A 1B9BA 1M04A 4W93A 4WXZA 3ZMRA 3DKJA 4H6QA 3K4WA 3L4YA 4PCSA 2Z4GA 2VJXA 4D6EA 3M5XA 4EACA 1SR0A 2EG7A 4ZODA 1JZ3A 6REQA 1M65A 1NVMA 3VOHA 3W9ZA 3T40A 1ZP4A 4FPSA 3LRLA 2CLEA 4Q6JA 1UR8A 4WR3A 1J0ZA 4GX8A 3TONA 3MBFA 3GC4A 3CS2A 5AKQA 2HZGA 1QI5A 3UETA 4ADSA 4O1FA 4MFEA 3LBOA 1EJRC 1XFCA 5CAHA 3JR2A 1J0JA 4LJ3A 2NX3A 3C2EA 1BF6A 1VLIA 1YNYA 3MDWA 1UQZA 3LTYA 3HV9A 3ZO9A 4YTSA 3EAUA 3HU7A 5A6SA 4DY1A 5FL1A 2HWGA 2YXXA 1DJIA 3WQVA 2IQ0A 2WWDA 4ERGA 3AFBA 1ZS2A 2TYSA 2EHHA 1TMQA 3TV8A 3TKFA 2JKAA 2TMDA 1KM1A 4G8TA 2OWCA 6TAAA 5MF5A 2Q02A 3EDFA 4NVTA 2HNHA 1C29A 2J62A 4UNIA 1K4HA 1AW5A 1G4TA 4DF0A 3PK7A 3O6DA 3CV2A 3EB4A 3NQDA 2RDUA 2GVGA 1TJRA 3PAJA 1FVPA 1XLCA 4W7VA 2EPKX 3RILA 1E6PA 1TYGA 2OR2A 3KBSA 1ME8A 1HUVA 1TREA 3PAOA 3S3GA 1GKQA 1H7OA 2PF0A 2PDBA 1C8VA 1C7TA 3FXGA 4O8RA 3WQPA 2DP3A 4HZ7A 1F61A 1RPKA 2E5BA 1E72M 3W00A 4DNHA 3GNNA 3WJZA 4LY4A 5A6BA 3C56A 2QDEA 2YA1A 2YOCA 4NUWA 5E9XA 1ZNNA 2BHZA 4FNTA 1W9UA 1R9XA 2G0WA 3ABSA 7ODCA 1EDGA 4KRZA 3C0JA 2ZA1A 3UCDA 4F8XA 4AFYA 4R9XA 3CAQA 3CT2A 2NZLA 2VVNA 3MWCA 4WGXA 1FWGC 3U7VA 2G4JA 2PGRA 3E9AA 3LRKA 1D2KA 4AMAA 1XSIA 4MNKA 1O6IA 3B9EA 2Y62A 1HW6A 3QMSA 2E1WA 5HJLA 4CQCA 5BCAA 3DFNA 5FOOA 2GJNA 3DIPA 1IZJA 4M8UA 3VNDA 3TYEA 3UWZA 3WH8A 1Q85A 1H62A 3W7NA 3LHYA 1TE6A 4KWSA 1ME7A 1WE5A 4WDTA 2C15A 2XN1A 4MWAC 3CQIA 3AYVA 4J35A 4FNPA 4RNHA 4GJJA 3A4WA 4LQ1A 1EA0A 1B3XA 1CEOA 2VTFA 1H2JA 3D3FA 3GVGA 3DC0A 4ZENA 4WVXA 1YEYA 5M17A 3SQMA 3WH6A 1R47A 1J0YA 3BMVA 1IXOA 4Q4SA 1BTCA 2GUUA 4G1NA 5CAKA 1GOQA 2YYTA 5C9ZA 4DBEA 3CEUA 1GW9A 3CO4A 9CGTA 3IUHA 5G1TA 1ZB5A 1YDYA 1X1ZA 4EE9A 1XD0A 3WDHA 1KR1A 3EWXA 4KRTA 3V75A 2GUYA 2XPKA 5D2WA 5AVNA 4DJEC 1W3KA 1UROA 1A80A 4NRSA 2VP8A 4F9DA 1CLVA 1NAL1 3WLJA 3FY1A 2OSWA 2PA6A 2CZFA 4EKJA 5A6BD 3WJXA 2FPTA 1L2UA 1VEOA 1Q8AA 4DUOA 1UMYA 2PGFA 3OZMA 3N3TA 1X8CA 5D2VA 1DWJM 3WLRA 3N9KA 3QYQA 2QKFA 2BS9A 4JX4A 2YDSA 3W87A 2NVCA 4ZQPA 1B3ZA 3VGDA 1EOMA 3MJYA 3SECA 4IQLA 3LTSA 5C5YA 3URQA 4PRWA 4ICNA 1QPNA 2VHLA 2YCIX 3MUZ1 3GKAA 4MNJA 3AHYA 2BXYA 4IXXA 1HP5A 4ZEPA 2YCKX 2X41A 4UTKA 3M0YA 1MW0A 4DWSD 4XB3A 2J8GA 2OSYA 5IOBA 1R3RA 4WIWA 2A7PA 4QJ3B 4PMRA 4U3CA 4LNYA 2VEFA 2VCBA 4YYFA 5DQPA 3VXGA 4JFTA 4HOZA 1L2QA 4A3YA 4HU4A 1O5KA 3HQOA 3ITLA 1VEMA 1I45A 2PC8A 3EWDA 2ESCA 4LNCA 3EPOA 3AS3A 3E0IA 2PCQA 4A3QA 4LB4A 4HNOA 3GVRA 4AU0A 3FKRA 3A3WA 1PTAA 1PKNA 3GW3A 1EHAA 4NZ5A 1KM2A 4S3JA 4UFLA 1QHPA 5LKYA 3OGRA 1HTIA 1FCUA 1ADOA 3H55A 5BMWA 1IGWA 2PTZA 3EPMA 1OC7A 1AJ2A 3GQYA 4XZIA 1BYAA 2EF9A 4V1YA 4C7FA 5AC4A 4PTWA 4Q33A 3VZYA 3B9OA 4H6EA 4PMDA 1QI4A 4UR9A 4WJEA 3ABRA 3F4NA 1DJGA 2DIEA 1NSJA 2PDUA 1Z32X 4D6CA 5CBIA 1PKLA 3QGAC 4IICA 1Q6GA 4W87A 2VC9A 3ARSA 3RITA 4D6GA 4IOTA 3MCMA 4G6CA 1YIXA 3AC0A 3CIXA 2E28A 5HULA 2Y85A 3GHTA 4WZHA 3G24A 1BG9A 4UQDA 1KD0A 5CPNA 4OWGA 2B7NA 1EO5A 4BWLC 3C0SA 3VOFA 1FXQA 2VX7A 2GJXB 2DSZA 2OELA 2VDGA 4AZHA 1DXFA 4C6QA 4EWND 3WO8A 4DJED 3I65A 1O94A 4L9ZA 3T0BA 4Q8TA 5H6HA 3SURA 2GGIA 1G4PA 4FP1A 4B5SA 3AMCA 3JUGA 5A6AA 5TD4A 1W5QA 3T55A 4DZIA 4DUWA 2G3FA 5DY3A 3MU7A 4TVCA 2D22A 4WSHA 4HZ6A 4AYSA 4HYWA 3PUDA 3QHMA 3GNRA 3LMYA 4A3UA 1S2WA 4R85A 3MP5A 2F2KA 3KTCA 1Z9AA 3QQ1A 4E2VA 3I4EA 3S5YA 1A53A 4KEUA 1JDAA 5DRCA 4J2MA 1PZ0A 1PDZA 4O8AA 2PFHA 3AISA 3ZLHA 3EXTA 4G7EB 4C90A 3PTQA 5F2LA 2XFFA 5CPLA 3ALGA 4GYJA 2RGMA 4LV9A 3M5YA 4HB7A 1LT8A 1ZY9A 4DBUA 1KM3A 3WNOA 1OT1A 3H23A 3WUEA 4DO6A 2A6LA 5DMMA 4F0LA 2WZEA 5IFTA 1KWGA 3WDIA 4C1LA 3IK4A 2W66A 3FW6A 2PLCA 3BG5A 5EYWA 1Q2SA 5D2YA 3M0LA 1OX4A 4FOKA 3MMDA 3BGAA 4C6BA 3K46A 3VFCA 1UPPA 3B0XA 4GGBA 1EHNA 3LQGA 4DO7A 2VR4A 3VE9A 3AIWA 4C6IA 4QFUA 4LC8A 3EWZA 3CLWA 5E0FA 3E2RA 2ZICA 3QBUA 2E0PA 2GGJA 1GOKA 5CPMA 5FESA 1FWSA 5D9NA 1F2JA 1KFBA 1PV8A 3AXHA 3AIUA 2OZ3A 4GD0A 4AZGA 4JOMA 4AEEA 2B7PA 2VZOA