4UU9B

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
ALTQPASVSGSPGQSITISCTGTSSDIGGSKYVSWYQQHPGKAPKLIIFDVNRRPSGLSNRFSASKSGNTASLTISGLQAEDEADYYCTSYHPTKTILFGGGTKLTVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI7814
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 109
sequence length 109
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uu9B00
5HYSA 1KENH 3K1DA 3X14A 1XF4A 1UB5A 1UCTA 1K8IB 4HLZG 2AJSH 1OAYH 4X7SH 3THML 3S7GA 2A73B 4HGWA 3MOBH 1T2XA 3RHWK 3B83A 2XWBA 3MNVA 3KPPB 3TVMC 3EHBD 5E8OA 5D2LE 5GSRB 2DQFB 3D2UA 1NBYB 2XZAL 3DVIA 3OAYH 1KULA 1KB9K 5LG1A 3G04B 3MRGA 1NGYA 5IHLB 4JFZL 4XZUB 5LJYH 3BAEH 2XTLA 3MRKB 1FFPA 1A6WL 2YUXA 3ARVA 5I1EH 1ZA3A 5DD6B 3NOIA 3T2NL 3ULSA 2ESVD 4ZDHB 3DX9A 3V4UH 1LQSR 1UB6A 4N90D 4J1UB 4R3SA 1JHKH 3VGAC 5DFVD 2CDEA 3OV6A 4UB0L 1U93A 3V4PH 2VL5B 1YECH 3KYMB 1B0GB 2B7DT 3FO2A 1JGVL 1JPST 4WHCA 4EDWL 1U8JA 1TMCB 1YMMA 3MV7D 3V7AG 3LS4H 2DI9A 3PIQA 1AQKH 1YQVH 4B0MM 3M17B 1NCTA 1QFHA 1CXIA 2UZYB 1OP3H 1JIBA 5D2NB 4R4BA 2EE3A 3RI5F 1PLGH 3KVQA 3G5XA 3WO3B 2DAVA 5T1KB 1F4WH 5KSAA 5H8DA 3C09C 4XP9L 1KTDA 4U1IA 3GEWB 2XICA 1MCBA 2YBRA 1S7WB 4C4KO 1A6TA 4OJFH 2JJTC 1I1AD 3IS1X 1X44A 4KHXH 3WE6B 4F7MB 1C5BH 3AY4C 4MB3A 4PS4L 1FV1B 3BP6A 3HB3D 4E41E 3PGFH 1YYLL 3CCHA 1T4KB 2GIYA 1J87A 1T0MA 4RFEB 1G6RH 1HH6A 2P5EB 5GS3A 3S3PA 3MCG1 1IGJA 3RJQB 4KJQC 2E6JA 3IB4A 5EFIA 1Z3GH 1UWXK 3WSQH 4O2CA 4ODSL 3VRIA 5TE7H 3OB0K 2GJ6A 3SDXE 5D93B 2NLJA 5F44A 4G9DA 1ULVA 1FG9C 4TTDC 4ODXB 3QG7H 1IC5H 3GMPA 4Y89A 3HUJE 4Y4FB 3BPCB 5HYSG 3CX5K 1F2XK 1MH5B 3VG0H 2A6KA 1EGJL 3GUTB 1YNTB 1MAJA 4HEME 4NNXA 1TENA 3GSXB 4KC3B 1MCWW 3V6ZA 3LD8B 5H94B 1CICA 3NVQA 1QHPA 4KMTH 3ARFB 4C58B 4XXDB 2BK8A 1IKFH 2YD8A 4NM4L 1CZ8L 3QRGL 3MNZB 2CMRL 4CADA 4OM1L 4PJ5A 5DD3H 2FJFA 2RFXB 1VEPA 5DFVC 2PYED 3KYNB 4Y5VC 3SKNB 1CL7L 3R06A 2X5PA 4NRYA 2VO5A 3IFOA 4JDTH 1JGLH 3EIFA 3PHOB 3FTGB 3ULSB 3ARDA 1I3UA 1MFNA 4CN4A 2NYYD 3HPLB 3SE3A 5FGSA 5BZWA 4FQJH 3VXUD 1UM4L 4GAYB 4YHIB 4OIIL 1I9EA 3J7HA 3FN9A 1CTOA 2AQ2A 3EO1A 3CC5A 3EYSL 3FO2B 2GW5A 1T66C 2YR3A 4P9MH 1ZLWK 2OZ4L 3MV8D 4P57A 1BD2A 2KZWA 3QWRD 5ACLA 5I15H 4P5MA 4DTGL 1G7LB 3VGBA 3EUUA 3DETC 2F5AL 1RUMH 3ROOA 5KSAB 4DZ8A 3SBWA 3I2CH 3C8KB 5KS9E 1RFDH 1G9NC 1K8DA 3VWKD 4LOUD 4BH7A 2HFTA 3MRIA 1HHIA 1N0XH 2NY4B 3UC0H 2O5XH 4TYUA 4X8XA 3BE1H 1T7ZA 2ZKHL 1DVFD 4X4XB 4NN6C 4Z7OF 4H25A 2EDYA 2W9DL 1R3HA 4KQ3H 1CLZH 2AQ1A 4MNQE 5C9KA 1FNLA 3LCYA 1HEZA 4PTTA 1QBBA 4NGHH 4JJ5B 4GQ9H 1CDCA 5KSUA 1N6QL 3MCLL 1IGJB 4OV6F 3AM8A 1Q8MA 5D7JA 4LIQL 4KZDL 3LKRA 5F7KC 1BMGA 2GJ6B 2YD5A 4DVRL 4K71C 4QY8A 3QUYA 2Y07L 2CRMA 2IAMA 5ICZB 5FKAB 5TFSH 1K9TA 1OP5K 3LB6D 4XVSH 3VI3F 4R9HA 2OL3A 1KPVA 1MRFL 1F45A 4GRMB 3UTSD 4ZOEA 4MHHI 3DUHA 4JPWH 5GGRA 1KV3A 5FHBH 3IU4H 4JZNB 5I66A 4G9FA 2WIIB 1I8LA 4HW6A 1CYGA 3C60A 1NGZA 3O3UN 3T65B 5I1GL 4Q6YA 1GIGH 1J8KA 4YBHA 1VENA 3PGDA 4FFZH 4U1KA 1I7UB 2NYYC 3L3OB 4JFPA 4DW2H 4ALAL 1BBJB 2FJFB 2GY5A 4LNVA 5KVGH 5FV1L 4ZUSA 2MCPL 3RRQA 4JFDD 3HC4L 1ZLSL 3EO0A 5DHVH 1XCQB 4WEUD 5E70A 2NY5C 2ZG3A 4NIKB 3P4NA 4XRCA 5IQ9B 3MJ7A 3BDBA 1RZJL 5EBWA 4CW1A 3WNPA 5F8QC 5FKPA 5BZWB 4QHNB 4IRSA 1A3LL 1S9WA 1ZEAL 1ZHBA 2FH6A 4MB5A 4M1DH 5HD8D 3W0WE 1BGXH 2RB8A 1SJVA 1T80A 1GAFL 4OGAD 2F53E 2UWEA 4YXLH 1OGAD 3D18B 4Y8AA 2PKDA 5FO8A 3B8YA 3MREB 4P2RE 4XTRC 2HJLB 4I2XA 4Z7UE 4P57B 3H3PH 1BD2B 1Z6JT 1NAKH 1HHGB 3HZVB 2YUVA 2J5LB 4P5MB 2XFXB 4W4OA 4XWOD 5C2BH 1UG9A 1DQJB 3BZDA 3OJ2C 1WCBB 3B9KA 1SVCP 1G7JB 3OKYA 1FYTE 1GC1H 4YK4C 1EBPA 3WN5B 2DM2A 1K8DB 1FGVL 4BH7B 1YEGL 4N0UB 5E6IA 1CF8L 1HHIB 4R7NA 4OF6A 3T3PF 4XNMB 2GSIB 3MUGB 4MVBC 1UXWB 1PW3A 4FXKB 3UMTA 1NL0H 4Z76B 3D39B 3P4MB 2QLVB 3TT3H 5BJTA 1AGEB 4BKLA 3T0XA 5FA4B 5FDYA 1HEZB 2P45B 1N5YL 3EDDA 5KSUB 1I1RA 3LB6C 4Z5RA 5I1CH 1BZ9A 2PTTA 4KTEH 3ULUD 4JQIH 3QEHB 1B88A 4AM0A 5T3XE 2Q76A 3LKOA 1MRCL 5LCVH 2WP3O 2QL1A 1JTTA 1OAUL 1DBMH 3SDAC 3A6CH 1INEH 2XXCB 4OCYH 3QUKA 3QUYB 4CVXB 4WVRA 1F8TL 4KMLB 4GUPA 3DTXB 4K3DL 1MHHA 4KI5D 1MCOH 3P9LA 3L3IA 2E9IA 1OB1B 3HFMH 4UILL 5DJYB 4MXWH 2H9GB 3DIFB 2H6PA 5GGRB 3BP5A 1WITA 3NIGE 5J0BA 1NGPH 3BWAA 4G9FB 5BRZA 1CXKA 2UWEF 3VGGA 3U46A 1R5WB 5C0CD 6CGTA 5GRZA 5HY9A 4G80A 2G60H 3A67L 2A6IA 2XI9A 3RWIA 1HN1A 3VXOA 1UH2A 3C6SA 5CGTA 4WNQA 4BSVA 4R2GD 2WQRA 5HD8C 1NC2B 3BVNA 4MJID 5FV2A 4ZUSB 2X09A 4OGAC 4S2SB 2F8XC 4MD0B 4L4VE 4HKJA 5AD0A 4RRPA 5T3ZH 3WHE0 1ACYL 2Q86B 4ZS6D 4XRCB 3MJ7B 2W60A 5JPNA 5CIPH 5IB3A 5EBMA 2OXHA 4RMUA 5FKPB 1ZHBB 3B9VA 3SKJL 3H0TB 3QNZB 2UWEB 5JLZB 5EDXA 2CIIB 1U92B 2CKBB 1S9XA 5LBSL 3QIBB 4LLAA 4UUJA 3N9GH 4PJFA 3ZSTA 5FYJL 1AIFA 1ADQL 5CEXA 4OCRH 1WBZB 1M6OB 3TVMA 1ZGLB 2VSCA 2OI9C 5EN2B 1P5UA 3QH3A 1QRNA 3IJHA 4JN1H 4PJEE 4LLMA 1HXYA 3NZHL 3OAYK 3D85D 4MB4A 4U0RB 3QHZH 2VIRB 2DQGH 1KTLA 3K8MA 4M7LT 3Q3GA 3O2VH 1AO7A 5F6IC 3DRTA 3UYRH 4NKDB 3BKJH 2Z0BA 3R0NA 5EG6C 3MRMA 2YN5A 4OF7A 2A9NL 2XYCA 4JFEB 4PRHA 4U6XA 3P4OB 4MJ6B 3Q5OA 1LP9F 3AS1A 3BUTA 4ZPVB 4QLRA 5TDNA 5DJAA 3RBGA 4FFYH 1JK8A 3IETA 5GJTH 1BZ9B 4U7SA 3K74B 4AM0B 1NLBH 1T7WA 3CX2A 5I0ZA 3ETBF 1OP3K 3LKOB 2NY6C 3O8XD 5MEOA 1LWRA 5FB8A 5MEQA 1I8IB 2YUWA 2D4DA 1ZLUH 3MLRH 2NPLX 4RFOL 3SE4C 4OM0H 3FB8A 1BFTA 1YA5A 1Q1JH 2UYLB 4GUPB 4HH9A 5HPMB 1MHHB 1TZHB 2C1OA 4AIZA 1G7HA 4OLUH 4YPJA 2ID5A 2DQCL 2JJTA 4K07A 1G6RB 4X6DA 4FMFA 4E5XB 4W6WB 3AY4A 3BP5B 3K81A 2IQ9L 1NKOA 2E6QA 4I0PD 3H9ZA 5B21A 4RQQA 5K9JH 5I8KL 1YY8A 3SJVB 5C09B 1LP9B 4CBPA 1EEYB 2EZ0D 5DGRA 5BMFL 1B4JH 4F37F 1BLNA 3TH4T 5J13C 3O11A 1GHFL 1T1YA 3GHEL 4PJFF 4U6HA 3O3DB 3VXOB 4Q9QH 5L6YL 1JNLH 2BRRL 2GTZB 4NO5B 4ZXBB 4LF3A 1YEDA 4OQTL 4RRPG 3H9YA 3P73A 4UT6L 1CDGA 3O0RH 1L0QA 2FL5B 4F15B 3F62A 4LSUL 1CR9H 1QFOA 1A6ZB 4G6FD 5JPNB 1I7RA 1OLLA 4FTVB 1YPZF 4QRQA 3VA6A 2D9CA 1UH4A 2IALA 4NPYB 5IGXL 4QHLA 3I6GA 5D1XB 3MACH 4EXKA 4F7PB 3HLAA 3QP3A 1UWEH 4NRXA 3FFDB 2AJ3B 1JPGA 3DSNA 1P7HL 1T7XA 3LEXB 3BSZH 3JTSB 5F1SA 4ONHB 3W39B 3QDGE 3TJEH 2MMXA 2EC8A 3IDGA 4PJFB 5CEXB 2ESVA 5FIEA 4PPTA 3TVMB 1BZ7B 1NBVL 3QH3B 3IJHB 4P2QE 2AGJL 2NY5L 3P0YL 4F37K 2BNQA 4MNQD 1KB5A 4Y5VA 3VXRB 1QNZL 5I1IH 1X5GA 5DURD 2PO6B 4HUXB 4QHMA 2MJWA 2ITCB 4QT5A 4XNQB 1JWSA 1PAMA 4Y5XC 1YPZB 5EIVA 1AO7B 4X6DF 3PNWA 1IM9D 3MV9A 4D9QD 3N85H 2CRZA 3IDYC 3MODH 4XVJH 5IMMB 3QWQB 5D6CB 3QO1A 1A4KA 2P1YA 4W4NA 4Q0XL 5E8NB 4L1HA 1F5WA 5DJAB 4TSBH 2GKIA 3GHBL 1UJ3C 2GSGA 4GSDH 2A6JA 5J1TC 5C0IB 3QA3A 7FABH 2IAND 3W5NA 4HS3A 1QSVA 3MLYL 4NSKA 4MX7A 1AI1H 2WBWB 3KNBA 5D71L 4C4KT 4Z6AT 5TE4L 4I0PC 4OZ4B 1F97A 3FB8B 2ZUXA 2EICA 1Q72L 3EOBA 4RIRB 3F12B 4K8RD 4DGIL 4RMTA 4X6DB 4YHLL 1K3ZA 2W9EL 1KJVB 4OLYH 3LN4A 3U6RB 4YJZL 2R0KH 5CD3B 2R4RH 3M8OH 4NBYB 2CUMA 2IFFL 4QXTB 1YZZA 3O3AB 2W9LA 3ARRA 1VFBA 5ILTL 4PJHE 4ZNEA 3ZMRA 1C08A 3OJMB 4U1HB 3OAUH 1ZHLB 4XH2A 3PDOA 5J8OA 3MGTB 3WS3B 2R1YA 3W0WD 5J4MA 4RGNE 2ICES 3FHQA 1B6DA 3KLDA 2VXQL 4P99A 2DQIH 1LHZA 1UQSB 2X10A 3STBA 3VJ6A 2YD9A 1FIGL 1MCPL 1KFAH 3GSWA 4D3CH 3RIAF 2XRAL 1I7RB 5I6XB 4QRQB 4HK0B 3VXNA 1T20A 2E9WA 1H0DA 4G7YL 3E8UH 4TUJA 4OZGE 5DRZB 3B8SA 5FAAA 4ZSOE 5HVHC 1KPUA 3FONB 3DVNA 4HBCH 1E4XH 1RI8A 4YGVA 5EUOF 3AXLA 4I1NB 2PYEA 1JPGB 1C16A 3GSVA 3I9GL 4OGYL 3KS0J 3IDGB 5B3NA 1OSZA 1QSEA 3NFPA 5DQJA 1JWMB 2ESVB 1MIMH 2J12B 3ESUF 4Y16C 4L8CB 5B8CB 4CMMB 4P0DA 4NQEE 2FX7H 3TJHC 4LKCA 4Y5VB 4JFXB 4PFEA 3UZEA 1D9KC 2ZUVA 3HI6L 2F74B 4HFWA 4X7EC 1JWSB 5T3XD 4CDHA 3MV7B 3MLSL 3VRJA 3QWRA 4LVOB 3S37H 4XCYA 2R39A 3DMMD 2AEQL 5I1DB 4PJAA 5EUOB 3RIAK 1XT5A 4I77L 5I2IA 3H6JA 4XBEL 2E7MA 3GBML 4P3CL 4LLDB 2A6JB 3V7MA 4TNWF 4BSWA 5EO0B 1G7PB 3RVWD 2UZIL 1I1AB 3QEUB 3BOVA 3FFCD 5IIEA 4NCC1 1LO0H 1UA6H 4NSKB 4MX7B 5F1KC 2JB6B 4JCMA 3HR5A 2I5YH 3HE7D 3BGFC 2EO1A 2VXVH 4FQLL 3T0BA 4X4MA 4PJIE 1INQA 4LHUD 3ZKXB 3SDYL 3RA7H 3QQ9C 1W72A 3UJIH 3VXME 1MIEL 4YE4L 4TVPH 5JW4R 2ATKA 3WHE1 1J88A 5FM5M 1UM5H 1TIUA 4EVNB 1FE8L 2FJHB 4Z95L 3CNKA 3WEXA 3MLPA 4K3EH 1E4JA 1RJZA 4LRNH 4LPXA 5ID0A 4GW4A 5ESQA 2GT9A 3HHRB 5T1DL 4HDIA 4TRPL 3UTSA 3CMGA 3MR9B 3O45A 5HDBF 1KEGH 4NC0B 3SDAA 1IZKA 2H2PD 3TH2T 5IBUB 5I1JH 2IEPA 1QYGH 2DOCA 3IF1B 1CCZA 1OAQH 5EU6E 2VE6B 4XCNA 2ZG1A 1OVZA 1WZLA 1KPUB 5GSVA 3RL2A 2RQ8A 3UJTL 5C0ND 5IT2H 4YGVB 1N5AA 3QQ3A 1FVCB 4JFDA 4HSQA 1A1MA 3S6CA 5DUML 5EORL 1OSZB 3UBXA 3MOAL 4WW1A 5EO1A 3VXUB 1A64A 1A1OB 4WY7L 3DMMC 2CLVA 1VA9A 1RVFL 3PHQA 4P5KA 4YAQB 1OGAA 4LAQL 4J3WA 2QJDA 3RU8H 4EUPA 1LEIB 4OI7A 1GGCL 1M7DA 5FYKL 3MV8B 1EEUA 4HS8L 1DUYB 3VRJB 3QUMA 2VDLH 2FX9H 4X83A 2J8UE 3WYRA 2V7HA 2VKXA 1X6NA 3G6JF 1RSFA 5I2IB 4ZTPH 3QNYB 3LEYH 5CCKH 4KDVA 1FYHB 4NDMB 1TVBB 5FK9B 3VWKB 5D9SB 2HT3D 2DLEA 1OY3B 3EDEA 4L8SC 3TO4D 3TWCH 5IIEB 4PB9L 5AG8A 5I9QB 5I16A 1YEIL 4AEHL 1JL8A 5IBLD 1MWAL 3IDXH 1DVFB 3NAAL 2J7LA 2R15A 2R2BB 1XIWC 5GGTH 4K8RH 4ZUUA 3Q6GL 5F8RC 4MS8D 5K9QG 3K4ZA 5ITFA 1MJ8H 4WWID 5L2JA 4MNHB 3N1QC 1NGWB 3VGEA 4BQBA 5DVNA 1DL7H 4NQDB 3GIVB 5IMKB 3BH9A 1A5FL 3GK8L 1IT9H 2ATKB 4Q9CA 5I71B 4LCYA 4ZAKD 3G6JB 5CEZE 3UO1H 2QADD 1N8ZA 5IV2A 3FT3B 1MJJA 2WP3T 4RSVA 1RJZB 5ID0B 4LCCC 3VXSD 3DBXB 5D7LE 5D1QD 1JZ8A 5DD1H 4UT9H 4WUUD 5D2LA 4UAOB 1LEKA 1YYML 3UTSB 4LL9A 1ZLUK 2PW1B 1MREH 3KWWA 4DFHA 1Z2KA 2FGWL 2VQUA 3EJYC 5C0NC 1N64L 4TTGA 5F3BA 3SE4A 1NDMB 2QKIB 3QDGD 3T1WA 3ME0A 2FSEA 1UADC 5F96L 1AHWB 4AEEA 4APQD 4Z7VE 3FO9B 2J1KA 2B4CL 1IQDA 5B39G 2EIZB 2NMSA 4P2QD 4L9LC 1FNSL 3UTTD 4L5FL 3THMH 5E08L 4QRUA 3FRUA 4YQXH 2DLIA 2BVEA 4HGMA 4JFDB 25C8L 4DUXA 4EDXA 5KSBE 2XZAH 3ZE1F 4ONGH 2R0LL 5IG7B 4B41A 3UBXG 1RZ7L 2JCCE 1P7KA 2XNAB 4JFZH 1NUDA 5EO1B 1ZXQA 2G9HA 2VXUL 1A6WH 3BIKA 3T2NH 2CLVB 4M6AA 4DGYL 1OGAB 3BPNB 4R97C 5DTFB 3IVKB 2OK0L 2ZNWA 4EUPB 1OT1A 4UB0H 1UZ6E 1NGQL 4FQ1H 5EPMA 3ULUF 2EDWA 5ENWA 1JGVH 4E41A 1AGFA 1OGTA 5IM7B 4FFWD 3S98A 4NOBA 5DI8A 5IMOA 1URLA 4ZQKB 5TDOB 3K4DA 3WNLA 5I73C 4FQHB 3D85A 3EOTL 1FFNA 4ZUTA 4KI5F 1BJ8A 4S0TD 1T83C 1TQCC 4YDLB 3SDXA 4UNTA 3PV6B 2EC9T 4LHQB 4ZYKA 5DFWH 4ACPA 5C6WH 3BQUD 2EE6A 4ERSH 4FG6C 1S5HA 3HUJA 2QADC 4MDIB 1KT2B 3FN0L 4PGCA 4JFHE 2NX5E 3TNMB 3GMMB 1D5IL 4Y5XA 1XH3A 5ETUA 5ITFB 2BOBB 5D1QC 3OG4B 3VRLF 2DD8L 5F1OB 2R8SL 5GS1B 1X7QB 1IGYA 2KDGA 4OAWA 2X4QA 1U8PA 2F8VA 2IG2L 1J0YA 3GBNL 4ODSH 43C9A 4APQC 1UJ3A 4PJ9D 2J6EL 4MQ7A 3JVGC 4DN4L 1E0OB 1ED3A 1OCWL 4XP4L 5BV7L 4LGRB 5M94B 4I0PA 3DX6B 5LKNA 2DF3A 5GJSL 1EGJH 5C0CB 3TPUB 4AK1A 2V5YA 1BQHA 2NTFA 5D7KD 4L3CA 32C2A 5HGHB 5E24E 3BMVA 1UENA 1E28A 2E7HA 4NQED 4Y0GA 4R2GB 5I8CA 3GFUA 1IEAB 4MJIB 2X4OB 2NZ9D 4H0GA 4NM4H 4ENEC 3QRGH 1EO5A 1WAAF 2BOCA 3EGSB 4NJAL 2DIBA 2CMRH 4OM1H 2EDBA 4JANA 5B38B 2CIKB 1CL7H 4XMKL 2Q8BL 5T1MB 4G8FB 4J3SA 3OKDB 1U8KB 1FNEB 2ZCHL 1LK3L 1U8IB 4M8QA 3SGDH 3ARGD 4HUWB 3BP7A 4QOKE 5GRVL 4ZUWA 1MCCA 5E8EA 4FFWC 5IJKC 1UM4H 5KAQF 5KS9A 5I75B 3HUJF 4OIIH 5E1HB 2ZCKL 5F88A 5E2UH 5BVPL 5IFJA 4JY4B 3EYSH 3TZVD 3JWNC 3TBSB 4CVZB 1ORSB 4RAVA 2OZ4H 1OGTB 4FXLA 3ARBD 3RAJL 1I1FA 4KVNH 4MNQA 5DI8B 5IMOB 1U8LA 4X0KB 1EBAA 1FVDA 5JQ6H 3OHXA 1CFTB 3G5YB 3OZ9H 2YPKA 2OJEA 2F5AH 4RGNC 4Y16A 2DQJL 3UCRA 2W91A 3TCLA 1N59A 2LTQC 4PV8B 2Q3AA 1KJ3H 5I1KL 5CP7A 1MOEA 2ZKHH 3HUJB 3I75B 3IKKA 3U4BL 4P9HL 4LNRA 2G5RA 3BP4B 4YR6B 1QD0A 2W9DH 4OZFH 2X70A 4UQ2A 1P2CB 3RWEA 1NLDL 2V17L 4KPHH 1N6QH 3O8XB 1IGYB 1WWBX 3MCLH 3X13B 1U8PB 2R9HD 5EU6D 4LIQH 1EFXD 4KZDH 1RZKC 5CS7A 3DURA 4NQTA 4DVRH 3MLVH 2Y07H 4F33A 5DWUL 5JIIA 5DHXB 4NFDA 2ORBH 4G6JL 1ED3B 3MRRB 1V8HA 4D9RD 3GDBA 4MYWB 1MRFH 3IFNL 3PUCA 1BQHG 4I3SL 3HE6D 3QNXB 4N0FB 2AJYL 3LV3A 4NN7C 3I50L 3PWUA 5D1ZD 1I1YB 4I0CC 3W0WA 4UT7L 1T3FA 3WFEL 3SO3C 5I1GH 2F53A 1CDIA 4MA8H 4X5XA 3WIHA 4PBWD 1G7MA 3ARGC 3QULB 5HHME 4P2RA 4ALAH 5BXFA 4LK4A 4Z7UA 3T2QA 4PJ8B 1FJ1B 3AC0A 4JANB 3HC4H 5I17A 4G6FB 5CJQL 4YH6A 4WTZA 1D5ZA 5J12C 2W0FB 5GZND 1OTTD 5LGHH 1UACL 1KB9J 1XGTA 4JB9L 1RZJH 2ZZUT 3RKDD 5DA4A 4FABL 4OD3L 4HG4K 1I9RL 1FYTA 1A3QA 5FGCE 2Z9TA 1ZEAH 1QZ1A 3C5JA 3RBSA 4HWBA 4M61B 4CNIA 1GAFH 4XC3H 3WNMA 2WINA 2PUQT 4MLSA 1J1XL 5IFJB 5GGSA 1WFUA 1LNUB 4GMSL 1M05B 1OTSC 4YNYA 1E27A 1PJ9A 3BWUC 2Q1EA 3SO5A 5EZIL 3LRSA 5CHNB 4DJMA 1DUZA 3BESR 1X5AA 5DURB 4HBQA 4M43L 4NO0D 1ZA6A 5FCSH 4HX1A 1BJ1H 3GSNB 3MRPB 2FATL 1BVKB 3NCEB 3TCLB 3PGCB 4Y19E 1D6VL 4WW2F 1FGVH 1IM9B 2IF7A 3BUYA 5HGDB 1S7XB 2Y36L 3DMMA 1YEGH 4KU1A 4PLKC 1CF8H 3VFUA 3ZYZA 5IVZA 3ULVL 2CGRH 3EKCA 1J18A 4YZFE 2ZOLB 1GL4B 5D7LD 1P5VA 1JTPA 4CDGC 5SWZE 1MRDH 4J4PD 1QBLL 2AK4E 3L95A 2IANB 1HINL 2F54E 2I60L 1F6AA 2BCKA 4CUCA 2FLRT 5D7SL 4K3GA 3MLWL 1RU9L 3AU1B 3VMNA 2MHAA 1KJ2L 3K7UA 4JPVH 4LASL 1QLFA 1MRCH 3MJ9A 3MMEB 1OAUH 3WLWD 3DURB 2BHZA 1TZGL 3D25B 3DSFL 4L8SA 1F8TH 3PQYD 4K3DH 1F02I 4WW2B 1QHOA 3LY6A 2ZNXA 1KGCE 4L4VA 3X11A 2NY1D 1XIWA 4UILH 1UWGH 3L3GA 4GXUM 5F7DA 3CX5J 5SX5H 1DANU 3F58L 1TXKA 2VLJD 1FFOA 2G75B 5DJZA 5DMKA 4GAGL 5GZNC 4TVSa 1CFQA 1BVLA 1OTTC 1MI5E 2BNUB 2C3VB 1A9BA 3EJZC 1QLRB 4LLWB 4LLYA 4YEEA 2E27L 1H3WM 3J8F7 5J1AA 5DC9B 1FLTX 1C5CL 3B5GA 3QAZC 4EI5C 3RY5A 4LCCA 1XF5B 4WTZG 4X6CF 1G9EA 2RBLA 2VLRD 4LP5A 1EEQA 4JFFB 1HHHA 1ACYH 4PJEA 1RIHL 1RD6A 4W68A 5BS0D 2I27N 5AAWA 3AB0B 1FSKC 3C5JB 3O4LD 5E2VL 3RKPA 4NP4L 3MZGB 3SKJH 3MLXL 4Q2ZA 5AG9A 3L3HB 1FFRA 1BFVL 4K9EC 3E6FA 1G0XA 5LBSH 5C7XH 4L9LA 4P48A 3FQXA 2GUOB 5DVLA 1FCGA 1PKOA 3HAEA 4RFNC 1KB5H 5FYJH 1ZLVK 1ADQH 3WKML 2HVKA 4LGPB 4MAYD 4JFHD 1XGYL 3NZHH 3LN5A 4X6CB 3B4NA 5DQ9A 1B0RB 3VXPA 1UKTA 4JO3H 3HCVB 1NC4A 4OD1H 3DMMB 5KG9B 2YWZA 4X5LA 2BVTA 4BJLA 4NZRL 3IU3A 2AQ3A 1DE4A 4KJYA 3U2SA 3WLWC 2A9NH 1LMKA 2RJMA 3SCMD 2V2XB 3DV4A 4I9WD 1QOKA 1T1ZA 5EU3A 4QF1A 2BCKB 3EFFA 3FFCB 4M4PA 3BZFA 4KV5E 2H1PL 3C5ZC 3Q6FA 4DKFL 3FT2B 1QLEL 4YXHL 4YHZL 3HE7B 1CD8A 2HTKD 2NY1C 4LPTA 4X98A 2JIXD 3ELAT 1OW0C 5E5RB 3STZA 1S9VA 1G9NH 2IH3A 5K9QI 3LQAC 2AKRA 4RFOH 5DRWA 4LHUB 5C0RL 4C83A 4K7PL 4OUOA 5HI4D 5KBNC 1T83A 5DEFB 5DLML 5EZLB 2DQCH 2A9ML 4LPWA 3UTOA 4X7TB 2D4FA 5A3ID 5HVWA 2HA1A 5J11C 3OB8A 2HFFB 5GRJL 2DDQL 1S7VB 1DLHA 5I8KH 5T1LD 3CZFA 5D1QA 5CMAA 5DRNA 1X5YA 5BMFH 1DQDH 1FG2B 1JN6A 1KPRB 3LRHA 1GHFH 3UTPD 4U1LB 1X5KA 1FHGA 4OZIF 3QDGA 5L6YH 1MUJA 2ZUQC 2BRRH 3DNKA 1QSFE 4APQA 4P3WA 1P53A 3LZFL 4AEIL 3EZ8A 4OQTH 4HMCA 4TN9A 2H8PA 1CLOL 4UT6H 1Q9WA 3JVGA 3ARSA 2AV1B 4P2QA 4LSUH 3BRDA 4PGDA 4QRTB 4CMHC 1ROWA 2FHFA 1DQQA 1XGQB 1YDPA 1NMBL 1ZAGA 4JVPA 2BSRA 3CXHJ 4R90L 5EC1B 4JLRA 1JV5B 1ORQB 2P5WE 3SQOL 3KPRE 2CXKA 2WNGA 3F7RA 3E6FB 4LFHD 5EO9A 5INCA 4KXZH 4L9LB 2P46B 3HAEG 5DMIL 1DP0A 4AENA 5TE6L 1IEBA 3NCBB 4ZUVA 4JR9L 4KWUA 4U6YA 3CFEB 4LLVA 4X9GA 3MNWA 4OZIB 4LRIC 1NBVH 2F19L 1N7ML 3EYOA 2AGJH 2NY5H 2WIMA 3P0YH 4LBEA 4M5ZL 2O5ZL 5MEPA 5ACMA 1QNZH 3CSYB 1HNFA 3SCMC 4CAGA 4YC2C 2OCFD 4NWTL 4JVWA 2AV7B 5SX4H 5HTSA 4P59L 3DX8A 3HC3L 5IJKA 3IU3B 5CGYC 1LK2A 3LKPA 4U1MB 1ZHKA 4H5SA 3U79A 4Q0XH 2ITDA 1HKLH 3QRFM 2W38A 5EOCL 3RWCA 4OUUA 3UAJD 5EU3B 5HI4C 3TO4B 1D7FA 1YN6B 3GHBH 3TEUA 3BZFB 5L8LB 2P8LB 2V2TB 3MLYH 1U9KA 4PJHA 5GRWA 3U9UB 5KSVB 5CZVL 5TE4H 4QNPF 4UU9B 5E9DD 2FCBA 1Q72H 3CU1A 5L8KB 2W65A 4OZFB 4DGIH 1Y0LA 5HHMD 3TYFB 4ZG1A 3V52L 4BM7A 2P48B 4YHLH 4ZAKB 2W9EH 5D6DC 1HILA 1WVZA 2Z91B 4NBZB 4N5EC 5C71A 3U36A 5IB4A 2VDML 1A6VL 2IFFH 1DLHB 1FN4B 5CSZA 5EOTB 4TUOB 3VXSB 4OLXH 2OP4L 2VDQL 4OZGA 5D1QB 5ADOL 5ILTH 4ZSOA 4R0LB 4XNZC 4WUUB 4X8JB 5I76B 4L1DA 3L9RA 3ILPA 3O6FC 3TN0C 2XZQH 3DRQA 3CXDL 4WWKC 1BFOA 2WUCL 3QDGB 1Y6MR 2R1XA 4ELKB 5EIIA 1KCLA 4QCIA 3HG1E 3NCJH 4APQB 2VXQH 5I19L 5JW4Q 1A1NB 3QDJE 3U0PA 5EH1A 3T3ME 1YMHA 1DLFL 4PRAA 3OJDB 2H32A 4PGDB 1MCPH 1FIGH 3UTTB 4NQEA 2XRAH 2Z4QA 2A83A 1DQQB 4E9LA 2ADFH 1I1CA 3D69B 4YBQC 3ZKSD 4FZEL 2IH1A 1YEHL 4JLRB 1LE5B 3KYOA 1D5BB 4N5UA 3M1BA 1FO0L 4Y19D 5I30H 3I9GH 1Q9LB 4OGYH 5I1LA 1AFVL 2PYFB 3EAKA 3U30C 2NXYD 3ARGA 4PJHF 4XAKD 2MWCA 3MV11 4AH2B 5SWZD 2VABB 4NQVA 4LBEB 4F80A 4KDTC 1ND0B 4R26L 1MCQA 3DWTA 3H7BA 2JJVA 1KXVC 3BHBB 3UAJC 3QI9D 3HI6H 3GSUA 1X4XA 3QFDA 1GVIA 3V8OA 3QDAA 4D2NA 2D7OA 3CDCA 4Z18A 2HTLC 3MLSH 4XGZA 4DAGL 2AEQH 4PJIA 5CGMA 5K9KA 2BHUA 4Y2OA 1ZHKB 4L4JA 1NAML 3VXMA 3CD4A 3WNNA 3RWCB 4OZGF 1CT8B 4OUUB 4U1GC 4XBEH 3GBMH 4L3EE 4P3CH 3MRBB 4OFVA 1SEQL 5E5MA 3AAZA 5C0FA 3ES6A 2IPTH 4PJHB 2UZIH 1SYVB 1VSCA 4B50A 5JTWA 1RK1B 2DWEA 5ERWB 2VC2L 3BQUB 4F3FB 5IVXE 1RJYA 2UVFA 1Q9KB 2X4UB 3LAFA 1DBAL 4LEXL 4M62L 4FQLH 1MI5D 1RQ5A 3U7YL 4G7VL 1AGDA 1YN7B 4OCSL 2W65B 1MY7A 1Y0LB 5CKAA 3SDYH 1CDUA 1YUHB 2IBZY 2BC4A 1BZQK 3HMXA 4BZ1L 5EU6A 4PY7B 1IGTA 4OD2B 4BFEA 3Q1SL 4NQCD 5C8JB 3S3SA 4JFQB 4PJ9B 3KPLA 1FE8H 4KK6D 5CSZB 3ROLB 4OZGB 5AUMB 4HIHA 1BF2A 4M48L 3ZKQD 5KZCB 3OQ3B 4GLRI 2BSTB 2OQJA 3BO8A 4TRPH 2R1XB 1NANH 3ARED 3VGDA 3JZ7A 4QCIB 4CJ0A 1XGPA 3T77A 4P46B 1FZMA 5F93C 2ZSWA 4F7TA 4P3DA 1BOGB 1S9YA 1X4ZA 3B9DA 4GRLC 2WAHA 4JGMA 2EECA 4NQEB 1D5XB 2YA0A 5GPRA 2A83B 2VUYA 3F7YB 1LD9A 1BREA 3DGGB 4PJIF 3UJTH 1MVFA 5SX5K 4QRPD 3IAGC 1NJ9A 2BZDA 2X4RA 4MLIA 2JJSC 4OTXH 1JF5A 4S0SD 3VXTA 2J8UA 2GK0B 2VLMD 5DUMH 4NC1E 5EORH 5I1LB 3NABL 4PREA 1BX2B 1HHJA 1A22B 3V2AR 2COQA 4NQUA 5ICYA 3VFOA 3MOAH 2CLRB 4UV7L 2A6DA 4WY7H 1GGIL 1DEEA 4EI5A 3X12A 3QPQD 4XBPB 5J6GB 1S3KL 2KBGA 3O4OB 3H7BB 5MI0C 2CPCA 3NACL 4LAQH 1GH7A 2DLTA 5D2NE 1FBIL 2I25N 1MHCA 3TZVB 3QFDB 2FYYA 5GS2D 5FYKH 4HS8H 2DMCA 1HQRA 1TCMA 3ARBB 4P4KC 1G1CA 5DJ8A 3VFWA 3OKLB 4YDJB 1R5VA 4HMEA 4PJIB 3RX7A 2XKNB 4AEFA 1VFAB 2FZ3B 4NO0A 5E03A 4QHUB 1DANT 3UTQB 2DM7A 4JAMB 3VH8A 1KNOB 1Z9MA 3AAZB 4LSQL 1KENL 1F00I 1NAMA 2X4TA 2RGSA 4KUZH 4PB9H 4UTBL 2P5EE 1XF1A 1J8HD 1YEIH 4AEHH 4DFIA 1J0ZA 4WENB 2BVYA 2GCYB 1MWAH 3IDMB 3V0AC 3NAAH 2P42B 3FAXA 5D7LA 5FM4A 1FVEA 4KK6C 4X5WA 3Q6GH 1AGDB 5DJ2A 3MRNB 3DO7B 1CVRA 4HUMB 3BW9A 4LARL 5F1IB 3FHAA 4IIQB 3VFPA 4ZFGL 2RR3A 1QSFD 3MLZL 4LPVA 3TBTB 1HH9B 1EFXB 4JKPL 4JG1L 4Z7VA 1WJ3A 3AREC 1A5FH 3GK8H 4AJ0A 3KPLB 4PTUA 1TVHB 4HIHB 2NR6D 2DI8A 3C5ZA 4LVEA 1QR4A 3D3VB 4HMDA 5E99L 4WFHE 1YYMH 2CR3A 5KSBA 1OW0A 3HE6B 2YSSB 2P5WD 1XEDA 3OKKA 4JQVC 3T77B 2FGWH 2C4XA 1N64H 3RNKA 5D1ZB 5DJCA 5F96H 4JG0L 1WISA 4AT6A 4D0BA 4EN3D 3C6LC 2B4CH 1E6JL 2F58L 2H26A 3ALXA 1QUNA 1T1XA 3JV6A 1FNSH 1WTGT 2CDGA 3KDMA 1LD9B 4EI6A 5IEKB 5E08H 1FZKB 5F7EL 3PF2A 3FAWA 3SGKC 1VGKA 5IK3B 3ZYIA 3QPQC 4OIAA 25C8H 4L29B 2WBJC 3ZTNL 3L5HA 4D0DA 1NFIA 2R0LH 3O3BB 2YRPA 4PREB 1HWGB 1PZUB 3VFOB 5CFHA 3NPZB 1QP1A 3P0VH 2VXUH 3DUSA 1K4DA 4HEPG 4KJPC 2ZJSL 3X12B 1HYSD 5FGRA 4DGYH 5IOPA 1MQKL 2OK0H 4CN6A 3HS0B 2BVOA 4NN5B 1NGQH 4ZFZB 5JXAL 3WSQL 1QFWI 5EWIH 5HDLA 2IADB 4HIEA 1MFEH 3W9DB 1R5VB 4MAYA 2NX5A 1NEZA 4B7IA 3KPNA 4GG6F 3QG7L 1IC5L 1HOCA 3EOTH 3VH8B 3BJLA 2C7UA 1SYSA 2D03L 2X4TB 4LRIA 2R23A 1WK0A 4I18C 5F7YC 3KYKL 2VZTA 4O2FB 1CFBA 4E42B 3FO1A 2AXGA 1KJMA 3MLTA 5EU4A 2HN7A 3SCMA 3CFDA 2H3NA 4KRPB 4P23C 5J89A 2XY1A 4EQ3A 3FN0H 2B5IB 1FRGL 1MQ8A 3CVHL 1D5IH 3GSOA 2R0ZL 2QSQA 2DD8H 3OKMB 4OLZL 2R2EA 5DD3L 5HI3C 2R8SH 2D31A 3QQNA 1VPOL 1VERA 4FN0A 2IG2H 4GG6B 1JGLL 2ERJB 3GBNH 2R2CA 4PRBB 4NJ9H 3PQYB 4Z7OE 4GMTL 5FYLE 2J6EH 4OFIA 4UDUA 1M7IB 3OKEA 2EXYD 2ADGA 2NY1B 3BXNA 3L7EA 1H15A 1OCWH 4XP4H 3PG2A 4K7PY 1WIOA 1QKZL 2QHRH 4WIQA 3RZCD 3RNKB 4WO4D 4PR5A 3SY0A 1N3NA 5GJSH 1I3VA 1F3DJ 1MLBA 2VLJB 2XV6B 4G5ZL 4RGMB 1BQUA 4I3RH 5A2LH 4QOKA 2KQNA 3JXAA 1A2YA 1A6AA 4NKMB 1GSMA 4ETQA 5EUKA 3BPLC 2NCMA 2CDGB 5J11B 4U3CA 5D6DA 2V7NB 3GKZA 4PJCE 2FECL 3VI3E 2HVJA 1UVQB 2YEZA 4Q6IC 3P77B 4NJAH 4E0RA 2VLRB 1AY1L 3GZKA 4JDVB 1NFIB 3WDIA 4WI6A 1AKJD 3O6FA 4XAWL 2B8OT 2GTWB 4XMKH 1CU4L 4NT6B 3TN0A 2P7TA 5BS0B 2Q8BH 4AIXA 4FXGA 4WFEE 4XMLL 1DDHB 3ARWA 1H3GA 3O4LB 5FYJU 2ZCHH 3I02A 1KIRB 1LK3H 3D5OF 3IJYA 1I4FA 3KPSD 5TH2B 5E7BA 4M3JA 4L3ED 4WI2A 1XF2B 1S5IL 4QGYA 2ZCKH 5TPWL 3OX8A 3CH1A 4X6BB 3PE9A 5BVPH 3MFFA 4OSUL 1HZHL 2I9TA 2Z31B 1NEZG 1N4XL 2BX5A 3MQIA 1NDGA 4MAYB 5JIHA 1LO3L 4G6AC 4IS6B 5T5FL 4R4ND 4HIIB 4YLQT 4N0UE 3RAJH 1ZS8A 5HVGB 2EDTA 1JGDB 3QHTC 1BOYA 4WU5B 2YOCA 5GS0C 3D39E 5D5ME 2WLYA 2H2SD 1SYSB 5JOFB 2DQJH 3WLBB 5DMGD 2ARJB 4JPWL 1ZE3C 1CFSA 2PCPB 2GITB 4KDTA 3FO1B 5I1KH 4PYGA 3BGAA 1KJMB 2NZIA 4BH8B 3SCMB 5DJDB 4ZFOL 3O6LL 3U4BH 4HZAA 4P9HH 2G2RA 5FEBA 5JHLL 1C7TA 8FABA 2DQUL 4YIQA 4DW2L 3N1MC 1NLDH 1MNUL 4PB0L 2R2EB 2JIXB 2V17H 1BM3L 3HN3A 5DUBA 4LSTL 4WI4A 1INDL 4MD5B 3Q5TA 3T3PE 3NGBB 2GFBA 3MCKA 3FOMA 5M95B 1FORL 1PG7L 4KK9D 2F9BT 1JVKA 1WWCA 1RHHA 5DWUH 3FQUA 3EYQC 3BXNB 3K3QA 2EO9A 3L7EB 3FB6B 4G6JH 4NO3B 5DDHA 5A2FA 4QKXB 4ORGB 5DEGA 2DIJA 1A3RL 4ODHL 3IFNH 4PR5B 4I3SH 4NO2A 5T1LB 2OJZL 4WHYG 2AJYH 5BO1L 4V2BA 3IFPA 4F57L 4J12A 1A6AB 3I50H 5IF0A 1XFPA 3F8UB 1T22A 3D48R 3M45A 4UT7H 3WFEH 4N1HB 4PGEA 2HVJB 5HPOA 1CGUA 2CDFA 4DGVL 4GH7B 1R0AL 4WGWB 1BWMA 2X89A 1RUAL 1OWRM 1A6PA 1ZSDA 5HGAA 4RDQG 5T1KD 4KK5D 1HQ4A 5CJQH 4X99B 4YHPB 4HCRL 5D96C 1NL0L 1UACH 3I02B 4JB9H 4L8DB 4ZOBA 3JUZA 4FABH 4OD3H 4R4NC 1I9RH 1GYAA 4JDZA 1U3HD 3BEVA 4GRLA 4Y19A 2X9WA 2ZUTA 2OTUA 3T4AB 3HAEH 1JZ2A 1J1XH 3PHSA 2H2SC 4H88L 4Y2DB 4GMSH 2I9TB 5LCVL 2YRZA 1A7PL 1QFPA 4I48A 5SWZA 3VWJC 2AK4A 4OCYL 5EZIH 4HQQL 2JJSA 4KKNA 2F54A 4KROB 3V5HB 3MA9L 4M43H 4D8PB 3VI4F 1L9MA 1TLKA 2LVCA 3CJJA 4JFEE 4XNYL 5HHVL 4H20L 1L6XA 3W5MA 1VADA 1Y6NR 5D4QA 2FATH 3QQ4A 3S8WA 2XTJD 4BA8A 1MCHA 2I07A 2KZ1B 2Y36H 2OBGA 2DJUA 3ULVH 1PQZA 1JZ6A 1H8OA 3BD3A 3V0VB 4HFUL 2HT4D 2FEDD 5BZDB 1QBLH 1EPFA 5C0JA 1QFUL 4N9GA 1J5OH 3ARFD 4PRPE 4P4KA 1HINH 2LABA 3ARZA 3RQ3A 2I60H 2VAAB 4U0QB 5CINH 1RAMA 5D7SH 3AGVA 3KG5A 1IAII 3MLWH 1RU9H 5SWQA 2GFBB 1KJ2H 1DBJL 3MCKB 5H37G 5IB5B 4LASH 4NC2B 1MWAB 2V5SA 2AAVA 4NC1C 1MI5A 5E9DB 5JZ7D 5DC0A 1K5NA 1RHHB 1TZGH 3SJVE 5C09E 3DSFH 1LP9E 4GXUN 5HHMB 3FQUB 3CUPA 3MRDA 5DDHB 4J3TA 3QHFH 5DEGB 3SN6N 4M4RA 3L6FA 4LVHB 4NO2B 5D2NC 5JORB 4V1DE 3MRQB 4FS0A 4M93B 4G6KH 3AROA 1QG3A 4Y4KB 2ZP0T 3IFPB 2XIDA 4U7KA 3WFHA 4WI3A 2Z93B 3F58H 5DC4B 3BKYL 1F4XL 1S7SA 5KOMC 2V2WB 1MCWM 1T5XB 3BN9C 4GAGH 3AREA 5DF0A 3VFTB 4WHTB 3MV01 4FTVE 4GRWH 4POZD 3QEQD 5C0GA 2E27H 4FQCH 2R2HB 1C5CH 5A16A 1DBBL 3LKQB 1W8OA 1UZ8B 1ZSDB 2BVPA 3IDNB 1FL5A 4X7DC 5LWYL 2XZCL 1RIHH 3RUGF 3TIEA 4JQVA 2XWJB 1F42A 4OFPA 1U3JA 5MHSE 4JDZB 1KCRH 4A6YA 5E2VH 2FRGP 4NP4H 3MLXH 3C6LA 4GKZB 3RWGA 5D93C 3VXRE 1OF2A 4XNXL 1KLGB 1BFVH 3NFNB 3T4YB 3FB7B 3KLAB 3S96A 1Z5LA 2NXYB 2XN9B 2VB5A 3IDJA 4LCUB 3MBED 1P9MC 3OR7A 1YPZE 3SGKA 3WKMH 4OM0L 2WSKA 4BELD 5JXED 1Q1JL 4I8DA 3FN3A 1HSBB 1XGYH 1P6AB 2HT4C 3QI9B 4BZ2L 3BZEA 3X3FL 5CWSA 3LD8C 1ONQB 3ARFC 3QQ4B 5IMLA 1P6FA 3RUGB 3O2DA 5K9JL 3NZ8A 4KVCL 4NZRH 1MY5A 1DZBA 4MNGE 1R3LA 3WFDL 4DKEL 5C92A 3V6FA 1RUPL 2VLKD 2G5BB 2A74A 3OG6B 1JNJA 5DS8B 2YMXH 2JJUA 3O2WL 5BOPA 4BZYA 3ECBA 5FM8A 2H1PH 3T0WA 4DKFH 4OGXL 3G5ZB 1QLEH 5INDA 5DZOA 4YXHH 5FCUL 3GJFH 3O41A 5F9JB 5GGVL 1CR9L 4J8RA 3OR6B 4K7PH 3MRDB 4I18A 1F6FB 1QSFA 4O58L 3TCXA 3F65A 5DLMH 4U6TA 4B7LA 4NQCB 3AVEA 2A9MH 3L6FB 3BSZL 1JRHL 3QDMB 3GRWA 1OAXH 2QTEA 1KCKA 4J2XA 4P23A 1PSKL 1WBYB 2DDQH 2X4NA 4KKLD 1U58B 4WFED 3BJ91 1S7SB 4YEFA 5CP3A 3UZVB 4F7CB 2ZSVA 2NY4C 2P5WA 1RZ8A 3KPRA 3E1F1 4G6ML 2DYPD 4U6VL 4U1NB 3KHOA 2H32H 5A16B 5BV7B 3VFVA 1EO7A 1IZJA 4KV5F 2OR9L 3WD5L 3ISWA 3LZFH 4AEIH 4UDTB 3SOBL 2PW2A 3AFLA 3T09A 2VTFA 2YXMA 4KY1L 4U33A 1K2DB 2I24N 5C0AB 3QJFA 1GPOL 4QRPB 5MERA 5L8JB 4MA3B 4A6YB 1AR1D 1RIVL 2BNRD 4N90E 1NMBH 4ODBD 4M7JL 4G8IB 3TGXA 7FABL 1TZIA 3RWGB 1AQDA 4HG4J 1U95A 3SQOH 4PRDA 4O4YL 3RVUD 4HUUA 4RNRA 35C8L 1EVTC 4PJBF 1A9EB 5DYOB 4KKAC 5TE6H 5FYKU 4JR9H 2ICWB 4PLJD 2F5BL 3OR7B 5DSCA 3MV7E 1YJDC 5HYEA 5C6TL 4Q6IA 3I6KA 2F19H 4XP5L 1N7MH 3GKWL 3EOAA 1BIIA 4M5ZH 2OTWB 1X5JA 2O5ZH 3FB5B 1XGRB 4KUCD 4KXZI 5EUOE 3WL9B 3WJLC 4N0CD 3G6AA 1KC5L 1SY6A 1ZWIA 3GI9L 4NWTH 5EZJA 1U8NB 3C9NA 3M8OL 5GRVK 1V7NL 2QQKL 3BGMB 4LEOA 2YD4A 4P59H 3HC3H 3DXAD 4MHHG 5FO9A 3EYVA 3TBVA 4Z0XA 3DV6B 1U8QA 1ZVSB 5ELIA 3NTCL 4JN2A 5EOCH 2ADJA 4ZS7L 5SX4I 2AW2A 4PJBB 2X05A 1J8HB 4G8GD 4MCYB 2CR6A 1EEZB 3V5KB 4JO2L 2HG5B 1EHLH 2XG5A 3G5VB 4LCWB 4J8RB 1G7IA 5LGJA 5B4MD 5CZVH 1W0YT 1DQML 3T08A 2DMKA 2QHLA 2GHWB 1L9NA 3HMXH 3RWFB 4HBCL 3IDIB 3FQWA 1FP5A 4WV1B 5T5NG 3IGAA 5IB1A 3QDJA 3GB7A 4UOJA 4UQ3B 2J5LC 1UKQA 4G8EA 3QZWB 4PGZA 4HWZA 4XB7A 2VDMH 1A6VH 1G9MC 4OLVL 5KVDL 4WU7B 3P4LA 1IGML 2OP4H 4XVTL 5ADOH 1R3KA 3WN5C 1ZT1B 4NCC2 2WWMD 2J88L 4JO4L 1ZHNA 1C5DA 1ZT7A 1RZ8B 3L5XL 3V5DA 3CXDH 4QWWC 5I74B 3WDJA 1P7QD 5EBGA 1D3CA 3MYJA 4MA1B 1YEKL 3RVTC 2X4SB 4H1LA 5FECB 4EN3B 4IJ3B 1DLFH 1WC7B 4ODWA 1CIUA 2A0LD 3IXAB 4O51A 5KTEL 5E2WL 1TNMA 2YHGA 4NRZA 3VXUE 4FZEH 5E6YA 5HDBE 3BIBX 1YEHH 1NQBA 4HS6A 4CJ1A 3RWJB 4GS7B 4K94C 5L2KD 4N0CC 1FO0H 5IHZB 3U4EA 4PV9B 2BVUA 3HRPA 4R4FH 2ZWLT 3CDGB 2UVEA 1AFVH 3MV8E 4CU8A 1MF2L 3I6KB 4DK6A 4L3EA 3V6BR 1JF1B 1F3RB 4HIJA 3ULVF 2XOTA 4PRPD 4R26H 4RWHA 1P1ZB 3RA7L 1BQLH 4I4WA 1ZWIB 1ES0A 2FIKA 2LVEA 3H9SD 3MRCB 4HJ0D 1NH6A 2M2DA 3KPQB 5IVXA 3IKCB 5C0BD 3B3IB 1F4HA 1WCQA 3P0GB 5DUPL 1EJ6A 2X9XA 3JWDL 4CU7A 3UXFA 3EYVB 3VFMB 4NKIL 4DAGH 4M1CD 4MJ2A 1S7QA 5C09D 1NAMH 1MCEA 1OTUD 5H35A 3SGEH 3VWJA 5IMMA 1JHTB 1PKQB 4J3OC 4F8TA 4V1DD 1S78C 3LHPL 4NQDE 1JYWA 1ZANL 1V3MA 2CO7B 3TC9A 1K8IA 1TVDA 3G6JE 1DBAH 2VMFA 2E6PA 3QIBC 4LEXH 3L3DB 2A73A 3U7YH 4G7VH 3LKSB 4FTVD 4OCSH 5IT2L 4NQXB 3KPPA 5D1XD 2VAJA 2Y5TB 5GSRA 3D0LB 4BZ1H 2DQFA 1NBYA 1WBXB 4XWGL 3KPTA 3Q1SH 4QRRB 3G04A 1KJ2B 4HK3N 4XZUA 1S9KC 4U0RC 2FIRT 1F90L 3MRKA 3T0DA 3RPIA 5CJ5A 5DD6A 4M48H 4ZDHA 1ZHNB 1C5DB 1T03L 1S8DB 4J1UA 1Z0NA 4GG8B 3RZCB 4WO4B 3PXJA 4H1LG 4ZFFB 3MYJB 4RAHA 3EZJB 2VL5A 3QXDB 2PO6D 3AMLA 3KYMA 2HJFA 4AG4H 2IPUK 5DK0B 4IMLB 3MRHB 1JPFB 1CE6B 3S34L 3M17A 3ILQC 1YEJL 5D2NA 4ODVL 1F13A 4HS6B 2YD6A 3E3QE 2VZ3A 5EBLB 5L7XL 3QDHA 4Z7WF 3TWCL 1AKJB 5T1KA 4XCEA 4RZCB 3S3JA 4HJ0C 1S7WA 2QQQA 3NABH 3WE6A 1OM3L 3KPSB 1LDPL 2CRIA 2Y1VA 2HAZA 1FV1A 3DROB 3IS0X 2V5RA 1GGIH 4M1CC 1Z9SA 1S3KH 3VG9B 1GZPB 2P5EA 3NACH 1DL7L 1OTUC 3DHJA 1FBIH 4RX4D 3ZE1E 2APFA 3QFJE 1QTYT 4JZJC 3BDXA 4J3XA 1GGUA 1RY7B 3DI3B 1T6VN 1IL1B 5DK2B 1IC1A 4ZXBC 1S7QB 3CK0L 1OP9A 5DD1L 4UT9L 3TO2B 4JFOA 2P24B 4Z7WB 2VKWA 1BVZA 4IHOB 4F15C 2DICA 3ZE0F 5FYLL 4NHUB 2NXZB 1MH5A 3P30L 1P9MA 2AJUL 4LSQH 3ULUE 3GUTA 4UTBH 5D1XC 1YNTA 4Y5YB 1RIUH 3GSXA 2I9LB 3PWVB 1HK6A 2D7NA 3LKNB 4AYFA 1BEYL 3EYFA 5CILL 5H94A 3QUXD 1QVOB 5JUEL 5FUZL 3ARFA 5A40E 4XXDA 3QJHB 3FZUC 5KW9L 4KI5E 4YQXL 4LARH 1IILE 3MUY1 5IJVB 4DCQB 4ZFGH 1HSAB 4OI8A 3MNZA 3DHMA 3MLZH 4JKPH 5HJ3A 4JG1H 2RFXA 4JRYB 4ONGL 3KYNA 5DRXB 1C8PA 1CN4A 3V4VL 3SKNA 3GJFB 2PO6C 5C0CE 2K7QA 3QIUB 5DVOA 3RPIB 3PHOA 1SQ2N 3FTGA 2R0WL 4NZTL 4KRNA 2ATPB 3HPLA 1CGYA 43CAB 5CD5C 2ARWA 3QUZD 1U36A 5E99H 4GAYA 3GJFK 1N2RB 4LLQB 3FQTB 3VRLE 3IDUA 3VXQB 4PLNC 4UTAL 1UC6A 4YHIA 2FEEI 3EW3B 2BY0A 1A0QL 4FQ1L 5C3TA 4MJIE 4GFTB 2BP3A 2HJFB 4JG0H 4QYOB 1E6JH 2F58H 3GSRB 5C9JB 5ISZB 2B1HL 1NGXA 1G7LA 5JNYB 5C08D 3EYUL 3QEQA 3CFJA 4KK8D 5F7EH 5FFLA 4XCEB 2IPKB 3C8KA 3ZTNH 1PBYA 2BSED 4L4TE 3HZKB 3FOLB 3QIWD 1NFDF 4ERSL 2VZOA 2R4SL 1U3HB 4X4XA 2MOVA 2ZJSH 1FAKT 1GOHA 1FDLL 1MQKH 2YD1A 1WAAE 1T2JA 1JGEB 4JJ5A 2HT2D 2FB4L 1C7SA 1ITBB 5IP4A 5JXAH 1J1PL 2PN5A 3G08B 1FZJB 1JMZA 1PYWB 2OL3L 1G0YR 5ICZA 4JFOB 3PWNB 5FKAA 4K23L 4NUJA 4WEBL 1YY9D 5JPMA 2DQEL 5DVMA 5I6XC 2XTJB 3IYLW 4GRMA 2D03H 4JPIB 1NFDB 3EHBC 3OPZL 3JUYA 2NY2D 4DVBB 1MELA 4OZHF 4JZNA 3KYKH 4PJ7F 1JFQL 2WIIA 1CXHA 3WJLA 5K9OB 4ELMF 3EYFB 3PWLB 1FL3A 4FRWA 3T65A 4LHJB 1FRGH 2XPGB 3CVHH 1AGCB 2R0ZH 1I7UA 5B8CC 3L3OA 1JYNA 4TOYL 15C8L 1BBJA 2WANA 4OLZH 3KS0H 5HJ3B 5DD5L 4GKSB 3VCLB 4YO0A 1DN2A 1JZ3A 3CAFA 1XCQA 1VPOH 4Q7DA 3PWPB 4S1DD 4TVPE 4PJCA 4UNVA 5IQ9A 5HYJB 4GMTH 1IFHL 3DLQR 5T3ZD 2VN4A 1AD9A 5CKGA 2EDXA 4NNPL 4LVOC 4QHNA 2CKBL 2N4IA 5B22A 4OZHB 4PJ7B 5A2JH 3SKMB 1KN4L 5E2UL 1YNLL 1QKZH 3D18A 2H41A 4ELMB 3HRZB 3NBNA 3MREA 1R3IL 2HJLA 4G5ZH 1DN0B 2HFGL 1GC1C 3HZVA 4IRJB 1HHGA 4KVNL 1I1AC 3Q5YA 3F7VA 2AJZB 1NGXB 2XFXA 5D72L 5JQ6L 3QIWC 3QEQB 2DYPA 3CFJB 1DQJA 3OZ9L 3TLRA 1WCBA 4ZD3L 3N1PC 3WCYA 5C0EA 1G7JA 3HB3C 4NNYB 5DGQA 3MBXL 2HH0L 2VZVA 4WDIA 2AK1L 1U8MB 4JCLA 3WN5A 1A21A 1AY1H 2HT2C 3ZKXC 5J7CC 1KJ3L 2ED9A 4N0UA 4XAWH 3P2TA 5IWLC 4XNMA 1CU4H 2GSIA 3MUGA 3KXFD 4XP6L 1UXWA 4XMLH 4HWNA 4FXKA 1CDYA 4Z76A 3D39A 3P4MA 5D5MA 2E8YA 1AGEA 3HPJB 5FA4A 2XWTA 1S5IH 2OYPA 2ICWI 4KPHL 4WHDA 3T1FB 3QEHA 1FO0B 5TPWH 4O2EB 3MBEB 4QXGH 3ZDYF 1XR8B 2V9QA 4NQDD 4OSUH 1HZHH 1N4XH 1H5BB 1U8HB 2PR4L 1N6VA 4D9QE 3FCTB 1LO3H 3MLVL 5T5FH 1T7VA 2Q7YB 2L7UA 1QQDA 4H8WL 4CVXA 3RVXD 4HUVA 3MXWL 4NUJB 3DTXA 4OF3A 5HI5D 4PJCF 2ORBL 4JKLA 5JPMB 3S36X 4ONOA 2SEBB 1O7VA 4YFDB 1OB1A 5DJYA 1UJTA 5DR5L 2H9GA 2IANE 3DIFA 5I8EA 1VACA 1KTRL 3EOYG 3LPWA 1R24B 4P2YA 1R5WA 4HD9A 1M71B 2VLKB 4L8BB 1FL3B 2FHBA 2BVQB 2KUTA 1C1EL 4JY6A 4S1QL 4R8WL 3O6LH 4MA8L 5JHLH 4WCYL 1Q94B 5C3LD 2DQUH 4XVUD 3CFIC 1HCFX 4QTHB 1MNUH 4PB0H 1NC2A 1BM3H 1AC6A 4S2SA 4Q74A 4LSTH 1INDH 2YC1B 4MD0A 4YO0B 3VFRB 3AS3A 4MSWB 3CMOL 5KVMC 3BFOA 1J05B 3U0TA 1QO3A 2NY0D 1NMCB 4PJCB 2Q86A 5LGHL 1FORH 3CXHK 1PG7H 3CLEL 3MJ8B 4XMPH 1AD9B 1KOAA 3O6KL 2DKMA 1MLCA 3H0TA 5D5MF 3QNZA 4XC3L 1PY9A 5FGBC 3VDCA 5JLZA 2CIIA 1U92A 1A3RH 4ODHH 2CKBA 4P2CG 3QIBA 2OJZH 5CJXC 3VWKC 5BO1H 4LOUC 4F57H 1IC7H 1WWWX 1WBZA 1M6OA 4HAFA 1ZGLA 3F7VB 3HZMB 5EN2A 5I9QC 5I1HL 4DZBA 4JFFE 4YDVB 4WJ5B 2DYPB 2E7LC 5E4IA 1DVFC 3MZTA 4DGVH 2Z8VC 1MJ7L 5C0EB 4KUCF 1R0AH 1JHLL 4WDIB 1TTFA 2VR4A 3QFJD 4I3GA 2VIRA 2CUIA 1RUAH 1KCSL 1T21B 2CSPA 2CGRL 5EZOL 4Z77B 3C5SB 4NKDA 1LO5A 4HCRH 1A14L 5ID1A 1KIPB 4GOSA 2BNRB 5D5MB 5I71C 2Q87A 1MRDL 2VXSL 4JFEA 2VDPL 1A7NL 3P4OA 4MJ6A 4U1JB 3RVXC 2XWTB 4ZPVA 4MCZB 1HIML 5C0DB 1MJUL 3LDBB 4MQSB 3V8CA 4X6CE 4UAOC 4OB5L 4H88H 1CLCA 4JPVL 4JHZA 1FH5L 3I3EA 5HHNA 3WUWB 1I8IA 1A7PH 2FX8L 3N0PB 3ORJA 5IHUL 1QQDB 2VYRE 4HQQH 4PRPA 1AHWC 5FOBB 4HUVB 2UYLA 5ALCL 5HPMA 3MA9H 1TZHA 3CZJA 1KXQE 4XNYH 3ARQA 5HHVH 3O2DH 4H20H 1G6RA 4E5XA 1UWGL 5EOQL 1PX3A 4XVUC 5I8EB 1VACB 3FFCE 3DXAB 3OSKA 5J56B 2AEIT 2W0PA 5D8JL 1P69B 3SJVA 5C09A 1LP9A 1EEYA 3OWEA 4OCWL 4JY6B 4PJDF 4HFUH 4G8GB 4JZJA 3O3DA 2Y06L 3NIFF 5D70H 3GI8L 1QFUH 2FJGA 2BMKB 1ETZB 4V1DA 2GTZA 4NO5A 3E3QC 4ZXBA 2MQ3A 2OTPA 5E8PA 3TH3T 3BPNC 5HHQB 3U0TB 1QO3B 1DBJH 3BD4A 2FL5A 2X1WL 4FZ8L 4LSDA 5JW3L 1A6ZA 5TQ2L 2Z8WC 4FTVA 4EOWL 3MA7B 4KKBD 4NPYA 4QRSB 1EUUA 1JI2A 5IW6B 5D1XA 2HFEB 2JK5B 1MLCB 4F7PA 4XWOC 3FFDA 2AJ3A 4FNLL 4Z8FL 3LEXA 1ERNA 1CXFA 3JTSA 4X6FB 4YFLI 5C7XL 4L4TD 4ONHA 3W39A 3VU2A 4PJDB 2OSLB 1KB5L 3FT4B 3K80A 1BZ7A 1TTGA 2Q6WB 1RPQA 1F4XH 3BKYH 3JWOC 4DZBB 2VZSA 4JJHA 4YDLC 1P7QB 2GQHA 3FO0L 3S5LB 4B53A 1T04B 3VXRA 4WI7A 2BHYA 2PO6A 2IQAB 4HUXA 4JO3L 4XBGB 4OD1L 1DBBH 3PP4L 1I9JL 2ITCA 4XNQA 3ULUC 1YPZA 4I5BB 5IFHL 1HXMB 1I3GL 5LWYH 1IM3B 1LO5B 5GS1C 5ID1B 2XZCH 5D6CA 2NQCA 5E8NA 1S7RB 4OZIE 4OI9A 5L2KB 1U91B 4KI5C 3FRPA 5C0IA 4YBLB 4BFIB 4XNXH 3LRGA 5HHNB 4UIMB 3B2VL 4MNGA 1G9NL 2EDOA 3O81A 3WIFB 4OZ4A 4PRPB 4IMKC 4RIRA 3H9SB 2X7LB 3F12A 1GZQB 4BZ2H 3X3FH 2RIKA 5C0BB 1KJVA 5C6PB 5EC2A 3U6RA 4FFVD 4R2GC 2EXWD 5CD3A 2IGFL 4QXTA 4F9PC 3O3AA 4KVCH 4TVPD 1Q0XL 1DQDL 2C1PA 4U1HA 1ZHLA 3TIDB 3WFDH 2X1PA 4ZS6C 9CGTA 4DKEH 4IBLT 3MGTA 4JZJB 3WS3A 1RUPH 2FJGB 2E7BA 1DEDA 5DO2D 2GJZB 4V1DB 3TNNA 3O2WH 2EC9U 1S7UB 2CQVA 5GS0H 4OGXH 3RL1A 5E8PB 1UQSA 5FCUH 5I75C 1AXSB 4PJ8D 5GGVH 2OS7A 4XI5D 4HK0A 1KLUB 4M9PA 1PG7X 5E00B 5ICXA 3VXSE 5B3JF 5DRZA 2VISB 3FONA 4WUUE 3CVHB 4Q97A 4U1SB 2D7TH 4O58H 2Y7QB 4OBRA 3CSBA 3D2UD 2Z92B 1JRHH 4TUKL 1EERB 5EU7E 1PSKH 1CG9A 3UDWC 1JYXA 1JWMA 4QGTA 4L8CA 4QNPE 5B8CA 4CMMA 2CLZB 3TV3L 4BYHA 4HK3J 3UTTE 2O5YL 5CJOL 2DLHA 4JFXA 1JTOA 1TDQA 4G6MH 3BH8B 4U6VH 2F74A 3WD5H 4PJXF 2OR9H 3UJJL 3MTRA 3MV7A 3SOBH 4HGKC 1L7TL 1EVUA 2EYTA 1A7BA 3GMRA 4BUHA 4KY1H 3O8XC 5I1DA 3S4SB 1E4WL 5EUOA 3AMKA 4F2MB 3PV7A 4KZEL 1GPOH 1HKLL 5ACZA 1RIVH 3FRPG 1WQVT 4OCNC 1CVSC 2L0DA 4LLDA 4OFDA 4M7JH 3BT2H 2FBOJ 3UP1A 5EO0A 1G7PA 5F6HJ 4O4YH 1LE9A 1I1AA 3QEUA 1I7ZA 4DEPB 3BEWA 1J11A 3ZDZF 3VDBA 4MQTB 1X5IA 35C8H 2ICEB 3QIWA 3CSGA 4MNGB 2AS5M 2JB6A 4FFVC 2C3HA 1D5MB 2F5BH 1U8OB 1W72L 4OT1L 5C6TH 1I7TB 2EDQA 4XP5H 2EZ0C 3GKWH 4DKAA 4PJXB 2YPLD 2DKUA 1PVHA 1KC5H 5IWLA 1OAKL 3GI9H 1FAIL 4UINL 3GM0A 5EC2B 3VDAA 4JVUA 1UT9A 4EVNA 1V7NH 2QQKH 2FJHA 4OF5A 4OLXL 1PX4A 4N9OB 2C1PB 3QCVL 4PJ8C 3RIFF 2AJXL 1G84A 4NHCL 2XZQL 4XI5C 2NW3B 1U41A 3NTCH 3OKNA 4ZS7H 3MR9A 3TNNB 4XPHL 3NCJL 2JE8A 4MA7H 2IMNA 3RL1B 3QPXL 3IF1A 4JO2H 4HLZH 4PRNB 3QUXB 3NIDF 2VE6A 1CGXA 5SWSD 1CICD 3REVB 1DQMH 1Z9LA 4JFFD 2ADFL 4JFYB 2GY7B 5ICXB 4ZFOB 4S11A 4Q58C 1PEZA 4ODTL 1IGFL 4PY8J 3QWOB 1FVCA 3JBG7 2R69L 4PJ5D 1HNGA 2FHCA 2OMBA 5I30L 4YX2L 1CG9B 4RBPH 1CDJA 5DHVB 5D7KE 4PIRF 3ZLQC 2E8ZA 4OLVH 5KVDH 1ZT4B 1EAPB 1IGMH 3ARDD 4XVTH 3QUZB 3VXUA 1A1OA 2A38A 3DI2B 1LEGB 2AI0H 3HI5L 3GBLA 4L3AA 2J88H 4JO4H 3K4AA 3RIFK 3L5XH 4YAQA 3QUML 4EIZC 2FWOB 1FZOB 5BVJB 1YEKH 3ZKMD 1LEIA 5CBEB 2FO4B 2W59A 5LQBL 3MV8A 1GGYA 1DUYA 1RZGB 2CUHA 2EYTB 2DS4A 3VA2C 5KTEH 3GMRB 4F58L 1MVUB 5C08B 2V6HA 5FGBA 5E2WH 3W81A 1JZ4A 4M7ZB 3QNYA 5ACZB 2YS4A 5CJXA 4JRWA 4NDMA 2Y9RT 1TVBA 5FK9A 3VWKA 5D9SA 4K8RC 1UM6L 2IPTL 4I0KA 1LE9B 1I7ZB 3BEWB 2DTSA 3L7FB 2YUZA 3QIWB 4HJJL 4WW2C 4LSVL 5LAXB 2E7LA 1DVFA 2K9UA 2R2BA 1UWXH 4RCAA 3ULUL 3DX7A 1MF2H 3JSSA 2ADIB 5FYJE 2C4FU 5HYQB 4MNHA 1NGWA 5JO5B 2WUBL 5C07B 4NQDA 1R3JB 3GIVA 5IMKA 4PP2B 5D7JD 2BDNL 1SEBA 5DUPH 2EYSA 3G6JA 3VFSB 4YXKL 2XQYK 3JWDH 3FT3A 5HDQL 2IAMD 4NKIH 4PG2C 3T2OA 4TPRH 1U3YA 3UPCA 3DBXA 1NFKA 4IOIA 1T89C 3RNQB 4PJGF 3OKNB 5D7IE 3HC0A 4L9DA 4ONFL 2PW1A 5IBUG 2NY2B 1D6EB 5ANME 1N26A 4HWUA 3AB0C 4XC1L 1NDMA 2QKIA 1EZVY 5KJRL 1AHWA 3LHPH 3FO9A 3ZYJA 3C60D 1ZANH 3LSOB 5IR1B 2EIZA 4JZOA 3SDCD 1EHAA 1JNHB 2YK1L 3CLFL 4D9RE 3D3VE 3NN8A 3ZHDA 3WIIL 4OTXL 4KMQA 4HV8A 4KFZC 2NY7L 4XWGH 5IG7A 5DXWA 2XNAA 3N06B 4Y4HB 1T0NA 4PJGB 1F90H 4EBQL 4JREB 5CIPB 4IRSD 3U0WL 4CL7A 1T03H 3HMWL 4ZOCA 1KG0A 4O5LL 2OM5A 3U1SL 1MCLA 5DTFA 3IVKA 4OGZA 2P43B 1PY4A 1V3LA 4LPYA 2XA3A 3RVWC 3JV4B 3ZYOA 2LU4A 3KPMB 2DJ4A 1HI6A 5IM7A 3VFGL 2DWDB 3S34H 5HHPB 2CD0A 3HE7C 4ZQKA 5TDOA 3TFKD 1B4RA 1YEJH 3B9KD 4FQHA 3DVGB 1A8JH 4ODVH 3JTTA 4YDKL 3QFJA 4S1RL 2O93L 5L7XH 4KUZL 5ESVB 5K59F 3KXFB 5J6HB 3H42L 2JB5H 1CD1A 4CN1A 1UFUA 3PV6A 2ZPKL 1X5HA 3DX7B 1OM3H 1LDPH 3GNML 4MDIA 1KT2A 2NTSP 3TNMA 3GMMA 2C26A 4MWFB 2BOBA 5GGUB 1NCBL 3BZ4B 2EIEA 5GS1A 1X7QA 2DQDL 2D2OA 2H2PC 2ICWJ 1SEBB 4BUGA 2EYSB 3C2SA 3KJ6L 2NY3B 1JUFB 4JQXC 3CK0H 1NBZA 3PJSB 4IOIB 3OXRA 3SDCC 3HC0B 2IC2A 3REWB 5FYLH 3DYPA 1XF3B 3TBWA 3P30H 2AJUH 3RVVD 4BFGA 5KN5B 3DX6A 2VDOH 3H3BC 3EBAA 3NPSB 4IMKA 5BRZD 3TPUA 5C0CA 1CIDA 3T2PA 3K2MC 3U7AA 1TPXB 5HGHA 2AERT 4JZOB 3SPVB 1BEYH 5CILH 4GG6E 4K55A 5T33L 5JUEH 5FUZH 3PQYE 3PP3H 5KW9H 1IEAA 2HLFD 2X4OA 4MJIA 4RAUA 4F9PA 3NN8B 1J0JA 4HV8B 3EGSA 2QR0A 1Y18B 3IXTB 2NY0B 4IRZL 4WTWA 5B38A 1VKXA 3H2WA 3V4VH 5I0DA 2CIKA 4YHOL 5TJWK 1EXUB 4UV4L 5T1MA 1T0NB 4G8FA 2ED8A 3VD9A 3ARTA 3OKDA 3SKOB 4Z78A 1DR9A 2WWKO 3P0VL 1U8KA 2VLJE 1FNEA 1KSRA 2W0LA 1U8IA 2R0WH 4NZTH 4HUWA 1B2WL 3E6HB 2RAMA 4NFCA 7CGTA 1KG0B 2JJWA 4EUPG 4UTAH 3TFKC 2LV4A 4HZLB 4L4TA 1NBQA 1I8KB 1A0QH 1AGBB 4HJGB 3R4DA 4N8VB 4LKXB 2HT3C 2VOTA 4JY4A 5EWIL 3TO4C 1MFEL 4MD4B 5E2JA 2VLRE 3F7PC 3TBSA 4CVZA 1ORSA 5DD0L 5IBLC 1HI6B 2X4PA 3S37X 1QRND 5GRXG 4X0KA 2B1HH 5BS0E 1WAAA 2CKNA 2PF6A 3EYUH 1CFTA 3G5YA 3O4LE 3JTTB 3VD3A 4MS8C 3UDWA 3QFJB 2DB8A 4GBXD 3QSKB 3VFNB 5JDSB 2P8PB 1DTUA 3OGOE 4GW5B 3QO0A 1CD1B 4Y1AE 4PV8A 4I13B 2FH8A 3VE0B 1FNGB 3MUZ1 2K1MA 4ZAKC 4DQOL 2R4SH 4PRHD 3S35L 3I75A 2Q7NA 3NFSH 3BP4A 4NKOB 4YR6A 1F11B 1FDLH 5F89B 5CEYB 1P2CA 4R0LC 1CTNA 5CBAB 5MENE 3O8XA 2FB4H 4EJ1C 1WTLA 3X13A 5IROC 4TULL 3RVVC 4ZO9A 1VFMA 1J1PH 5EU7C 3IFLL 1RUKL 4NJ9L 2QQNH 4UOW0 5JW5B 2HLAB 2OL3H 1Z9OA 1NBZB 4K23H 3OXRB 4DOHB 1VESA 4WEBH 5GGQL 4I9WE 3INUH 5KZCD 3MRRA 2L7JA 2DQEH 1OAZL 1F3JB 1TNNA 3OXSB 1YNKH 3TBWB 2QHRL 5HHOE 4NZUL 4ZNCD 2FGZA 3QXVA 3OPZH 1P4LA 3QNXA 4HIXL 4N0FA 1UH3A 4P46D 4I3RL 1JFQH 2P8MB 3WIHL 1I1YA 2B20A 4CGTA 4KJQD 4QEGA 2QV2A 4OCXH 2DL2A 5SV4A 4MXVF 4RAUB 5H2BA 2LU7A 2UY6A 4TOYH 2ICCA 3QULA 15C8H 1RZJC 2QR0B 5B38G 1J12A 1R5IB 4PJ8A 5DD5H 5E0QA 2EDKA 1FJ1A 1VKXB 4TTDD 3R8QA 2D0GA 3MLUL 1RK0B 4MJ5B 2W0FA 5FF6B 2VDRL 4Z78B 1MCRA 4HWBL 1MAML 4HC1A 4XX1E 4ODUB 1IFHH 4EKXA 3UTPE 5JA8B 4NNPH 1WZMA 2CKBH 4ZO7A 4XCFL 3NCYS 4M61A 4L4TB 5GIRA 1KN4H 1YC7A 1YNLH 4GBXC 1LNUA 1KUMA 1HDMB 1M05A 1QFWL 1R3IH 2XY2A 4MGXA 5L88L 2HFGH 2X4PB 4W6YB 5JQHC 2VLLB 2BSSB 4U2ZA 5CHNA 3K8LA 5T3XL 1KN2L 3NCFB 2BNQD 5D72H 2GAZA 3BQUC 1XGUB 4C56B 5FYJD 4RBPK 4R96B 4ZD3H 4RMRA 3MBXH 4Z7NF 5DHYB 2HH0H 3GSNA 3MRPA 1BVKA 2AK1H 3PGCA 4LMQE 3QO0B 4W70A 1IM9A 5HGDA 1KELL 1S7XA 1RUQH 4X9BA 3MO1B 4PYHA 1ZGLM 3MV9D 3RTQB 5KAQG 2PXYB 5K33A 2FECI 4AY0A 2ZOLA 4XP6H 2DBLL 3ZDXF 4ZPTB 2D0FA 1FLRH 4PJ9C 1WIPA 5I18L 1T66D 2VDKL 1CQYA 2IANA 4H26B 1DFBL 3MJ9L 5CUSL 1Q38A 1OARL 1H3UA 1CLYL 1CFNA 4YGAB 3AU1A 1H8SA 4R6UA 3DETD 3R0MA 2E7CA 4LLUB 3MMEA 3P11L 2Z35B 4RA0C 2PR4H 4OV5B 4X7FC 4P46C 5FYKE 1IRAY 5GGTA 4H8WH 1VHPA 2MKWA 2YPLA 2FR4A 3D25A 3D9AL 1V05A 3MXWH 1UXSB 1F4YL 3T8XB 4HKXB 3ZT6A 4WW2A 3RP1A 3D3VD 3RZWA 4P2OB 3OGCB 4GKNB 1WZKA 2NZ9C 4QHKJ 5I1AB 3GJEA 5DR5H 3L3JB 5F3HA 3BISA 1P4LB 4D9LL 4ORZC 1CD9B 2G75A 1C12B 1R6VA 1C1EH 4S1QH 4R8WH 1O7SA 3RI5K 5E9DE 3VI4E 5HYSB 1WEJH 5H2BB 2BNUA 2C3VA 4WCYH 4XNUH 3X14B 1QLRA 1XF4B 3NMEA 4LLWA 1UB5B 2DRUA 2RHEA 4PG2A 4LVNB 1JP5A 1XF5A 3O4OC 5SWSA 3CMOH 2JF1A 3FKUS 2VXTL 1T89A 4HGWB 4JFFA 3ZE2F 3TZVC 3CLEH 2XWBB 3MNVB 3W82A 5E8OB 3ARBC 3C8HA 3D2UB 4UZGA 3O6KH 3B43A 3MRGB 5ITBH 5JHDE 5GIRB 1NGYB 3L3HA 3VD7A 5J06A 1FFPB 2C4FT 4M1GL 1ZA3B 1NCDL 1QSED 3WFBL 2GUOA 5E5UB 4HKZA 3DX9B 1UB6B 4R3SB 1JBJA 4JHBA 2CDEB 2GAZB 3X3GL 5I1HH 1U93B 4GJTB 1G7QA 5HHXL 1MJ7H 4X6CA 1B0RA 4NBXB 1JHLH 1HWHB 3HCVA 3WKNA 1U8JB 1YMMB 1ZKAA 3PIQB 5KG9A 3O9WD 1KCSH 3ARYA 4OF8A 4IIQC 5EZOH 2VUOA 2DQHL 3BDYH 3MGAA 2R9HC 4R4BB 4XAKE 2XN9E 1A14H 3G5XB 2B0SH 1IQWL 2VXSH 2VDPH 1SMAA 2IBBA 1A7NH 4XTRD 2V2XA 4KRPD 1J5OL 4EZMA 1KTDB 4U1IB 1HIMH 2YBRB 3FFCA 3FQNA 2VNCA 1MJUH 5CINL 1A6TB 2PTUA 5IW1A 1YEEH 3FT2A 1CFNB 3HE7A 4OB5H 3BP6B 5F9WB 1FH5H 2EIDA 3HE6C 5IW3A 3CCHB 3RUGE 2FX8H 1NUNB 5IHUH 5TDPA 1T0MB 3QXAA 2YPLB 4LHUA 2FR4B 1HH6B 5D1ZC 5ALCH 2OR7A 2WK2A 4TSCL 3QHFL 5DEFA 2Q20A 4MVBD 5EZLA 5EFIB 2OXGA 4O2CB 3VRIB 3GJEB 4X7TA 5F3HB 3VGFA 5EOQH 2HFFA 4G6KL 2NLJB 5EULV 4G9DB 1S7VA 5D8JH 5FM5O 2N7BA 3R1GL 2YD7A 3MSPA 3GMPB 3OTTA 1FG2A 4OCWH 1KPRA 1BFSA 2X6MA 4U1LA 3RKDC 2A6KB 2Y06H 3GI8H 3SDAD 1J0KA 4NNXB 4FQCL 2DTML 1T7YA 3V6ZB 4JQXA 4NQCE 2JLLA 1JZ7A 1EGJA 5SWSB 1CICB 3QDME 2AV1A 1YC8A 2D3VA 3SDCA 4FZ8H 1I8MA 4QRTA 5JW3H 4NN5C 5TQ2H 4P49A 4EOWH 4HPYL 4MDJA 1XGQA 5EOCJ 1RZIA 4YHYC 1KCRL 4CADB 4PJ5B 5CSGA 3RGVD 2WM0A 5EC1A 1JV5A 4LQFL 3R06B 4NRYB 3IFOB 1ORQA 4FNLH 2DI7A 4HXBL 4Z8FH 1IGCL 3GM8A 4Y1AD 3ARDB 3PP3K 4HKZB 3PABA 1X5LA 3CFEA 3O9WC 4J6RL 4OZIA 2Z31D 3T0AA 2Z8SA 2GYSA 3FO0H 1G7QB 1PEWA 2UUDH 2M1KA 4J4PC 5C0AE 3TPKA 3EO1B 3CC5B 4QRPE 1TQBB 3CSYA 3MRJA 2WMPA 4KRPC 2RCSL 5MEND 1I75A 3PP4H 1I9JH 2B5IC 4RMWA 1MFBL 4NWUL 1N6UA 2ENSA 2AV7A 2VLME 5F72S 4UOW1 5IFHH 5CLWA 3S88L 4Q9BA 1I3GH 1V7MH 2EDHA 3WFZA 2OZ4A 5E95B 5IQ7H 1RMFL 3PXHA 1RZFL 4YUEL 5I8OH 1KIUA 4U1MA 1AXTL 3ROOB 4DZ8B 4M6ML 2ERJC 3W2DL 3TO4A 1YN6A 2YMXL 1WFNA 3FQNB 4HULB 3MRIB 5HHOD 5IW1B 2P8LA 3D6GA 2CH8A 2V2TA 5JOPD 1RULH 3I84A 1IAIL 4HWEL 2APBA 3U9UA 3B2VH 5KSVA 4H25B 4KTDL 1R3HB 4LHUG 5BOZG 4JRXE 5TDPB 3U82B 3QXAB 4UU9A 4PTTB 1W0WA 3TA3D 2E3VA 4RGMC 4OZFA 2V9RA 2XQBH 5D7JB 3I6LE 3TYFA 3L5IA 1EZVX 3LKRB 1OAXL 4ZAKA 2X9YA 1F3DH 2Z91A 4PJBE 4QY8B 2J2ZA 1J8HE 4EQ2A 3MFGB 3MX0A 3MRFA 2IAMB 2JKXA 2IGFH 3EDFA 1FN4A 5EOTA 4TUOA 3VXSA 1EA9C 3LVEA 1Q0XH 4R0LA 4WUUA 4X8JA 5I76A 3WXWH 1RZKL 2OL3B 4LCWE 1KPVB 2XKUA 5GHWL 1II4E 2NY6D 5IROA 3IT8D 2JELL 4ELKA 5I66B 3RWHA 2VH5L 5L0QB 1M7XA 3RGVC 3RY6C 2VITA 1A1NA 2DL9A 1KYOJ 3C60B 1NGZB 3OJDA 2P44B 4M6OL 4HKBA 1OT2A 1OQOA 2X40A 3SDCB 1I8MB 1K4CA 3UTTA 3PGDB 5EIQA 3DGCR 1K3IA 4U1KB 4FP8L 4M9OA 4JFPB 4MDJB 3V0WL 1RZIB 1GRWA 2E5EA 2Z31C 3BPOB 3D69A 4MAYC 2AP2A 1LE5A 5HYIA 1D5BA 3EO0B 2LE9A 2WLZA 3L5WA 3P4NB 4TUKH 5AZEL 1CE1L 1Q9LA 4KHTL 4CVWA 5EBWB 4CW1B 4HPOL 3IAQA 3PABB 4Y2DD 2PYFA 3KR3L 1S9WB 4IRSB 1ZMYA 1WZ1L 3TV3H 3WNOA 4AH2A 2VABA 1JRHI 2WWKT 1ND0A 1CWVA 2O5YH 5CJOH 5FO8B 1KCUL 4KROD 2AABL 3MRJB 3G9VA 3BHBA 1IAKA 4M6NL 5E94A 4I2XB 2Y23A 2VR5A 2YD3A 3ARXA 3UJJH 1WWAX 1Y6KR 4Z7QF 4C57C 5DZLA 2M26A 4E41D 1L7TH 2HTKC 5EB9A 5FYKD 1P4IH 3B9KB 3KAAA 1DBKL 1E4WH 5LXGL 1FPTL 4KZEH 2XZZA 4GBXA 3NGBC 2R1WA 3GMNA 1CT8A 3MRBA 12E8H 1ZTXH 3TA3C 5E6IB 4R7NB 1AD0A 5F7MC 1SYVA 1RK1A 1EHLL 4PP1D 5ERWA 5A3IC 3BQUA 5BJTB 4F3FA 1Q9KA 2X4UA 4BKLB 4GAJL 1W72H 1I9IL 1LGVA 4OT1H 3HMXL 1W0WB 3C08H 4Z5RB 4OZFG 2PTTB 1YN7A 3LIZL 2Q76B