4UU9B

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
b'ALTQPASVSGSPGQSITISCTGTSSDIGGSKYVSWYQQHPGKAPKLIIFDVNRRPSGLSNRFSASKSGNTASLTISGLQAEDEADYYCTSYHPTKTILFGGGTKLTVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI7814
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 109
sequence length 109
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uu9B00
3RUGB 3SQBA 3DX8B 2Z0BA 1ZS8B 5FGCE 4U6YB 1ETZA 3IDJA 3ZL4H 4JQVC 4NQEE 4QRQB 5AYUH 1EAPA 4V1DA 3U30C 1H3UA 4P9HC 5DQDL 1AHWC 3CVHA 2E9JA 1SJXA 4MMXC 4DGYH 3E3QC 4JFEB 3QPQC 4LFHD 3ARXA 3B5HA 4FZ8H 1ZGLP 2W65A 5DMGC 5KTEL 4NZUH 3RNKA 2YUWA 3D85A 2PYEB 3PWJA 4G6MH 4Y4FC 3RVTC 4UTAL 4PJEF 1S9VA 4PP1D 2AJZA 2X1XR 3TNMB 4Y2OA 4L8SC 3RI5F 4B53A 4D9QE 1XCQB 4OLXL 2DM2A 1KTKE 2VWEC 5GZND 2MCPH 1FSKB 5EZJB 4HJJL 3GSVA 3WFDH 4M1GH 4GXUN 4HK0A 3PQYE 2YD1A 1WT5C 3ZDYE 2NY3D 4ZQKB 3UYRH 2MPAH 4ZFGL 5IQ9A 1YEIH 5KSBE 3STZB 2KQNA 2OL3A 2ZOLB 5D1XA 1O7SA 3LZFL 3VRJB 2VERN 2H32A 1IGYA 4DZ8B 5HYSA 3G08B 1U92A 2ZSVA 3HC0B 4K07A 4U2ZA 3BDYL 1UWEL 2H2SC 1IAKA 2A74B 5HJ3A 1I8IB 5HYSG 1ZEAH 1NDGB 1XF3B 2AQ2A 1BF8A 1U8JB 3O6MH 1IGML 1IGIL 2NY1C 4GMTL 3U0TB 4HMCA 3CX2A 4X5XA 3BPCB 3CX5K 5IMLA 3GIVA 3OXSB 3TN0D 2H6PB 2GITB 4ERSH 4R90H 1N3NB 5DRXA 2J4WL 2FEEI 3RI5K 3LQZB 3T08A 4Y1AB 4HBCL 2Y36L 1ZHLA 1N2RA 4XCYA 5IVOA 5BS0E 4HFUH 4FG6D 3MRBA 3TWCH 2V7HA 5ERWA 4HQQH 1F58H 1MFDL 4P2OA 1CLZH 3I84A 1A1NB 2ZUTA 4NO5A 4Y2DA 1KJ3L 4QTIH 4HT1H 5GGVH 2B2XH 3Q6GH 2VDRL 4TSCL 3FONA 5HVHB 5I1IL 4DGVH 1XCTA 4UILH 4L1HA 5D2LB 2F74B 1G1CA 2D7NA 3T2NH 1FNLA 1X7QB 3QUXB 4CUCA 3RWHA 1JPTL 4XXDB 3P0VH 3QCVH 1RURL 4P2YA 1PQZB 4WU7A 3VGBA 3H3BC 4GW1B 1AGEA 4OI7A 2AABL 5FUOH 5IMMB 1DEEB 4O9HH 1MSPA 2JF1A 3S7GA 3WFBL 4QRPA 1AXSB 1OAXL 3P4MB 3D18A 2N7AA 4YEFA 3VA2C 5IQ7L 3D69B 3HPJA 4JRXE 3MLXH 4R7DB 4UT6H 4PJXB 4LK4A 4OLYL 2VDQH 2GK0A 1U41A 1KJ2H 3KJ4C 1CTNA 2BNRA 3I2CL 4APQB 3QEQD 2DQJH 5AAMA 3EJYD 2EIZB 1NGYA 3DJ9A 5TE7H 4Y4KB 4U1NA 1FYTB 2WNGA 5BZWB 3NCJL 5IG7A 1OGAD 4F3FA 1KBGH 2G75A 2CDGA 2RB8A 3WMSA 4ORGB 4TOYH 4JE4B 3DMMC 3D39B 1A6UL 4JG1H 1BFVL 2E6JA 2YBRB 3FO9B 5C0BD 4C57C 2GFBB 4P4KC 4GQ9L 5ISZA 1IILE 5DJ2B 1K8DA 2XZCL 3OB0K 2YXMA 3QZWA 3QUKA 3QZWG 2NX5E 3IKKA 4LKXB 5EIIB 3KXFB 3TFKD 3MLUH 1C5CL 5ECJE 3DO7A 3WFHB 2DQHH 3ZHKA 4MNGB 3OKMB 1CFTB 4ZS7H 2BOBB 1QLEH 4LVHC 2GQHA 3V0WH 5CMAB 1GC1H 4PJDF 1EJ6A 3I02B 2VABA 3VFTB 3RKPA 4RA0C 3O0RL 1B6DA 4EVNA 2PTTB 4HWBA 2CKBA 5E03A 1FNHA 3KPRE 3PF2A 3V4VH 3O9WA 4LDEB 5IB1A 5KSAD 1INEH 1BM3H 1MJUH 4HV8B 5DRNB 1Z6JT 4JM2A 4S1DC 1CL7H 2EZ0D 3GM8A 2E6PA 1BP3B 1UGNA 4KTEH 4HJGB 1U8MB 2UV3A 1URLA 1X5YA 1BIIA 3DURB 2CUMA 3QDMA 3TBVA 5KVFL 1C16A 2EO1A 1G6RH 3NIDF 4L4JA 3KYOA 4TPRH 1TTFA 4CMMA 1Q72L 3ZE2E 3GJFH 3G5VA 1I9IL 1Z9MA 4OCRL 3UDWC 1ZVSB 4KJYA 3HNSH 4Z6AT 4PRID 5T33H 1KELL 2R1YA 2PYFB 5DJZB 2J6EL 3O4OC 2IGFH 4NJAH 1BOGB 4W6XB 4DKEL 1G7IB 4G9DA 3BZFA 1A1MA 3FKUS 5D5MB 5EORL 3SCMC 4Z95H 3CU1A 4GQPH 5B38A 1VERA 5LG1A 1BMGA 5GHWH 4PJ8B 2BNQA 5MHSD 3QIBA 1P4IL 5ALCH 4LDLB 3W0WE 1OT1A 4NQDA 1E4KC 1WZMA 1BQHA 4Z7VB 1EA9C 2L0DA 1CQKA 4NC0B 5HSFA 1WCBA 3ES6B 4YZFF 4PB9H 1CDIA 4W4OA 3E6FB 5E6IC 5SX5K 2IALA 3REWB 3NACH 4I18A 3WIIL 2WBWB 2ITDB 4B5EA 1IEBA 4GAJH 4JO4H 3VWKA 2VOTA 1N4XH 3MUZ1 5C3TA 1HH6B 1SJHA 3SDXB 1TCMA 1CZ8L 3GSWA 4LHUB 4EDXA 2V2TA 3VFRA 1CBVL 2C1OB 1X5FA 1MNUH 3BO8B 3OKLB 1OAYH 3PIQB 5GGTH 3ZKQD 1PSKL 3P30L 5DK0A 5I73B 2WUBH 4PJHA 1JYNA 5FUZL 5E8NA 2FATH 1DQJA 3VWJB 4J3XA 1F4YL 3K81A 2HFGH 1MPAL 1BFOA 3QEHA 1RJYB 4LHQB 2NY6B 3W82A 1CFQB 2WWKT 3BIAX 3L7EA 3MYJA 3OWEA 2D7MA 3TCXA 2VXTH 3ZYOA 4UIMB 4WUUD 3UAJC 4NRZB 3W39A 5K9QI 2ZNWA 4WWID 1RHHB 3HE6B 5D7KD 3RVVD 1RJZB 4Z7WF 1P7HL 2AKRB 5CZXD 1VFMA 5TDOA 5LGJB 2HTLC 4RGNB 2VLRB 1UH3A 4LSSL 5LKNA 3TESA 4PTUB 4P5TB 4QXGH 3MROA 2XQYK 3BN9D 3O6KH 5H94B 4PRHB 1NCDL 2PO6B 4DGIH 4OCXH 4KZEH 2ADJA 1OARH 2IAMC 3O4LE 3D87B 2X5PA 3CH1B 4QNPE 5D70H 4MJ2A 4PJ9A 4D9LH 4E0RA 5B39B 2IBZY 1WV7T 4BM7A 3T0AA 3QUZC 1UWXH 4HUWA 1MLBB 4ONFL 1AP2A 2XTJD 2ZG1A 5HYEA 3WDJA 1R0AL 3D25A 3G6AA 4XCEB 1F45A 4MAUL 1V8HA 5DVLA 1JPFA 2YD9A 4MWFB 4HIJB 3TZVB 4CN4A 3KG5A 4BELD 3MRHB 4Y19D 1VA9A 2GTZA 2XNAB 2JJSA 5GRVK 5FB8A 4LVOC 2DM7A 4P49A 3MLRH 3NPSC 1S3KL 3VXUD 5BRZE 4XT1C 3HZKA 5K9JL 1IC7H 4M02A 1JFQL 2ZKHL 1MWAA 4IBLT 5I66B 4G42B 4IRJC 4KMLB 4LF3B 4MA3B 5JDSA 4XPTL 3HG1B 4X6EB 1U95B 1X5LA 4HUUB 5GS0C 1WICA 2B1AH 4NKMB 3QDGE 4BH7B 3JWOC 1NAML 1NC4B 1ORQA 5IROC 3HNVL 3EOYG 3VXNA 3VJ6A 5CEZE 2FB4H 2LTQB 1AXIB 2COQA 5AEAA 3V2AR 2Z31A 1SVCP 2DWEB 4ACPA 3IDGB 2UZYB 3CFEB 3G6DH 4JDVA 4P9MH 5JA9A 1DDHB 4RBPK 1FL5A 4RNRA 3MACL 2X05A 2QADC 3AS2A 4U3XA 1O5DT 4H88L 2EIDA 2DQDH 3QPQD 1YYML 4JRYB 4FQXB 4M1DL 5DMGD 3WLBA 1BBJA 4UOW1 3E8UH 1FNGB 5EU7E 5ANMB 5C07B 5E08H 3BUTA 2YA0A 1J9CT 1NKRA 2XN9B 4QRSA 1L7TL 1D6VL 4OLWL 5JHDD 2G5RA 2CUIA 3P4OB 1A6WL 5EFIA 3ULVF 3TO2A 3B9VA 4HCRL 4EN3A 2P5EB 3MRPB 4NWUH 4OZHA 1W72H 3T0EE 2HWZH 2XTLA 1RULL 3QQ4A 4MA8L 2YMXH 3QWRD 1KCSH 2X4SA 2Z91A 4HKZB 2R29L 4OLVH 3DGCR 1JN6A 4P59L 4F7CA 5F89A 1DBKH 3CPLB 5E00A 2HFFB 3VFVA 4OLUL 2GJ6D 4JREC 1K4DA 3GMOA 3VXMB 3N50A 4PV8B 3WNPA 2I24N 4E5XA 2RQ8A 5HGHA 5FKPA 5FK9A 2H2SD 2ZZUT 5D8JH 1Q8MA 5L2JB 2ICWI 1BX2A 1MVUA 2R0ZL 1UM6H 3AMLA 3Q5YA 5C0GB 1D9KB 4YXLH 1HHJA 2R15A 5GRXG 4OUUA 1P1ZA 5KANG 1UC6A 3IVKA 1I9JL 1WC7B 3DXAD 2VZTA 3PWPB 4D9RE 1D5BA 3L5HA 4PRPE 1IL1A 1VEPA 1U8NA 5DJ0B 2VLJA 4NNXA 3C6LC 4KAQL 2J88H 3S8WA 3FN9A 4HX1B 2X4QA 3I50L 1QG3A 5DRWA 2EDBA 4Q0XL 4K3GA 1G0DA 2O26U 2YPKA 4R4FH 3RGVA 3B6SB 3Q48A 3IRZA 1S7VA 4GRLC 5I75C 1G7HB 2ARJQ 1NCAH 1S7WB 1YEGL 5C7XL 4QRUB 2EDEA 2EIEA 4N1HB 4C83A 4IOIB 4HPYH 5E4EC 4K2UL 4FTVA 1OP5K 3SHSA 1DFBL 3RU8H 4M8VA 4S1SH 1T7YA 1YMMD 4LPWA 3DUUA 4KQ3L 3SJVA 4JFDE 4JO3L 2V5MA 1UACH 3BRFA 1EHLL 2VXQH 3KPSA 1BVLB 2NY2C 1E27B 4D0BA 5ID1A 2GW5A 1SY6L 5GRVL 4G80A 5D9SA 1NEZA 2XWBA 1MCKA 2EYTA 1FL3A 2Y9RT 4MJ5A 1PYWB 1F6FB 1G9NL 1MI5D 3T65B 4G9FD 2EEBA 3HRPA 3MA7B 4KHXL 4KY1H 5IF0B 1NEZG 1IAIM 1R5IA 2PNDA 3DETC 4XBEH 2P7TB 1AH1A 5HYQB 2DL2A 2X9XA 3WCYA 4CVUA 3ALXA 3QRGL 2IADB 1RIVL 5SV3A 5IB2B 2OSLA 2NX5B 5EOCJ 4XVJL 3G5ZA 5I2IB 1IM9A 4ZFZB 4G3YH 3RY4A 1AY1L 1J0KA 5EBMA 2OJEA 2IPKA 2IQAA 5SWQA 3P11L 3CCHB 4UNUA 4YX2H 2IBBA 1OWRM 4LKCA 3DMMD 1ETZB 3DWTA 3IDJB 1UZ8A 2ZUQB 3CDCA 1EAPB 3QXAA 3CVHB 4NP4L 1FL6A 1HNGA 4OB5L 4PLJC 2W65B 5F7HA 1K9TA 1XF4A 5HDOA 4FFYL 3RNKB 3D85B 4MD0A 4O2EA 5H37G 2YSSB 4PFEA 1S9VB 2C1PA 3L3IA 2AJZB 4LAQH 4ZOBA 1OB1B 4AK1A 1HIML 3RAJH 4BZ2L 3MLZL 1CK0H 3KPQA 4NWTH 3S3SA 3WXWL 3L1OH 4BA8A 3GSVB 4HK0B 1EHNA 1GGBL 4HWEL 4XX1G 2PW1A 5IQ9B 3VMOA 1NFDE 5I1DA 3PL6D 2OL3B 4IRZH 1VPOL 4NQSB 1BZ9A 5D1XB 4IOFC 1BQSA 4S1DD 5T1LA 2H32B 1IGYB 2CRYA 5TF1H 2EDXA 2R69H 5HYSB 1NEUA 3C5JA 1U92B 2ZSVB 4QNPF 1J1PH 5HJ3B 1A0QL 4XNXH 4LRNL 4NBYB 3WFZA 4R0LA 3WXVH 3MOBL 2CD0A 2D7TH 2AP2A 3IU4L 3QUXC 5IHLB 4HK3J 4X5XB 3LH2L 1YPZF 1PX4A 2X44D 2O93L 2FZ3A 5IMLB 5DJ8A 3HNTH 1RJLA 3WNKA 1VEMA 2DLIA 3FZUD 3ZDXE 5F96L 1KPRA 1ZHLB 1F97A 1N2RB 4JFZL 3SCMD 4XCYB 3ULVL 2ED8A 3MRBB 2V7HB 3K4DA 2I07A 3ME0A 4LLDA 5C08A 1EGJA 2EDDA 4P2OB 3D0VB 2YD4A 3DECA 4CMHC 4NO5B 4Y2DB 5GJSH 1AGCA 1YNLH 4Q6IA 5TE4H 5KVGH 1A6VH 4APQC 3BSZH 1HCFX 1XCTB 2KL6A 5GGQL 1KCUL 3RIFK 2W38A 5BVPL 3N9GL 3PWUA 1HQRA 1NBVH 3MV9D 4LSPH 3G5YB 2AEWA 3BKYH 4QF1A 1U8QA 3BKML 2VZ1A 3K0WA 1HE7A 1E4XL 3RWHB 2E7LC 5EWIH 4ZFFA 5I1GH 4WU7B 3ILPB 2WM0A 3BQUB 4ZSOE 1FIEA 1AGEB 1NFKA 2HJFA 4QRPB 4YPJA 5DVOA 4PIRF 3UTSA 3DO3A 5T3XE 3LQAC 2R8SH 3V4PL 1N64L 3HI5H 3AB0B 3BEVA 3IDXL 2VQ1A 3H7LA 1H0DB 1KSRA 3ZT5A 1CF8H 5GS0H 1B0RA 3GMQA 2BNRB 2QQLL 3JWOH 3FRUA 4BFBD 2B1HL 4GRWE 1OHQA 4XBGA 3MRIA 1ACYL 1MCRA 4FFWD 4I2XE 1EEYA 3OL2A 3UAJD 4Z7NF 1NGYB 2L4OA 2IC2A 2XXCB 4U1NB 1S7UA 4OCLC 3AU1B 5IG7B 3B4NA 4F3FB 2G75B 2APFA 2CDGB 5K9KA 4P3CH 3W81A 3MCKA 4DAGH 3ROLA 3VA6A 2I9TA 4LCCA 1NDMA 2LAGB 4WTWA 5ISZB 3U82B 1QSFA 1S9WB 3R8QA 2EXYC 5DMIH 1K8DB 2IAMD 4KKBC 1A4KA 2R2BA 3RA7L 2BDNL 3QZWB 4GLRH 5F6HI 3VXRD 3QUKB 3QUZD 2DQFA 4ZD3L 4CBPA 3S34L 4G7YH 1OSPH 4BZ1L 1I85A 1MLCA 1GAFH 4UOW0 3QDGB 3DO7B 3RZWA 1DVFA 3BKJH 1YNKH 3CH8A 1I3GL 4OZGE 4XVSL 1R3HA 3BZ4A 5BCAA 2P8LA 1OAUL 1OPGL 3SGKC 3BDYH 2DLFH 2VABB 1QBML 4N0UE 5C6TL 1DQTA 3G9VA 4POZC 2CKBB 5JPMA 2HLAA 1HQ4A 2WP3T 1U36A 1MEXH 5F8RC 2UWEA 5C9KA 3O9WB 4HKXA 2ZUSA 4JM2B 3KYMB 4ZTPH 2OM5A 1BQLL 4LSRL 1NAKL 4GBXA 3ZDZE 3GDBA 3LAFA 3TGXA 4RX4A 4ONGL 1BIIB 5CHNA 3RVWC 1NSNH 3QDMB 1MHPL 2Y36H 3TBVB 1C16B 1GOGA 4TULL 4FQPA 3KYOB 5GS0D 1AR2A 3L3GA 3S88H 1KGCE 4CMMB 3HAEA 3NFNB 3PDOB 3SO3B 3E6HA 3G5VB 2RFXA 4ZPVA 3X3FH 1FZKA 4X0KA 3QFJD 4KJYB 1VHPA 1CIDA 4O58L 4KHTH 4G9DB 2AK4A 3BZFB 2W91A 1F13A 2QADD 2GKIA 4LBEA 5HGBA 4WO4C 2Y25A 5B38B 3QULB 5SWZD 5DHYB 3IAQA 5I73C 2UUDH 3VWJC 2BNQB 5EZIL 3QIBB 1RZ7H 1WISA 4NQDB 4DFIA 1ZT1A 1CU4H 5SX4I 5HHQA 1BQHB 3TT1L 4QXWA 3JVGA 1KOAA 1LNUA 1QSED 1WCBB 4PJFA 5DO2D 1S78C 2IH1A 1EFXA 4HH8A 5GRJL 4LARL 4RGNC 2IALB 3WN5A 3O81A 4I18B 4JDTL 1IC4L 3UX9B 1IEBB 4XXCC 5CGTA 3VWKB 1KT2A 1TJIH 2XA8H 3RWFA 1P7QD 2DKSA 1SJHB 3GSWB 3OAUH 2V2TB 3VFRB 2B4CL 4D8PA 4XAWH 3NCJH 2BY0A 1N6UA 3W5MA 1A7RH 3LIZL 3K4ZA 4UBDC 1VB9A 5DK0B 5E8NB 1DQJB 4EDWL 3K46A 1UKQA 3CD4A 4X5LA 3U7WL 3QEHB 2WK2A 5DUPL 3H9SA 5SWSD 1MREL 3L7EB 3MYJB 2P48B 1JZ8A 4KDWA 3W39B 1RZKH 1MJ8H 1NCNA 5I8OL 2VC2L 2AK1L 3SE3A 5TDOB 1YEFL 3RTQA 1F4WH 4MAYA 4YDLC 2VO5A 3KS0H 1BLNB 5J11C 2F19L 1UADC 3C6LD 3MROB 2AEQL 4YNYA 5L0QC 1FV1A 1RUKL 2ADJB 2VDPH 1AR1D 4K7PY 4GRLD 4MXWH 4OZFA 3RUGF 4PJ9B 1N5YH 4E0RB 4PRDA 2X1OA 3MA9L 4P0DA 4NUGH 1C5DA 3BWUC 1AP2B 1FJ1A 2LTQC 3D25B 3BKCH 4ODTL 2GTWA 2GCYA 1JPFB 3NCCB 3OGOE 3LVEA 3N0PB 4KDTA 1IBGH 4GAFB 4FZEH 5C0AA 2NY2D 4WRLA 2AXFA 1B4JH 5FB8B 2QSCH 2R2HA 3IKCA 4JFED 3W2DH 4FQXC 2MWCA 3RDTA 5KBNC 3HZKB 4WW2C 1FO0L 2ZG2A 3GUTB 1MWAB 5C0CB 1BVZA 1U8OA 3CK0L 3O6FA 4Q74A 4BKLA 2DM3A 5JDSB 1MH5A 2OZ4H 4G6KL 4XWGH 4NBZB 1A6PA 4LCWA 3WJLC 1NLDL 4JPIA 1RUAL 4K7FA 4X9GA 3VXSE 3VGAB 3RX5A 1ORQB 3VXNB 5IB5A 4G6FB 2YK1H 4U1GB 3VJ6B 1F4AA 1M05A 1VFOA 4FQIL 1EHXA 2XYCA 2Z31B 4JFFA 3TBTA 1RMFL 3LKPA 4JDVB 4ODVH 3EOTL 1LEIA 1FL5B 4RNRB 4OQ1A 2FCBA 2NY0B 5HDBE 4CU7A 3NGBB 4PYGA 2VN4A 1JV5A 1PKQE 4PGCA 3EO0A 3WLBB 1BBJB 1A8JH 3AFLA 5J6GB 3HHRB 5AZEL 2EE2A 5JOEA 4QRSB 2VKXA 3RWGB 1JK8B 1JVKA 2IBZX 4MJ6A 3K2UH 4FMFA 5B3NA 5EU5A 5C70A 5TQ2L 2FD6H 3TO2B 3F62A 3BUYA 5JIPA 2JJTA 1NMBH 4EN3B 1X5KA 4OZHB 2F5BH 2VH5H 3QQ4B 3HI6H 2X4SB 2Z91B 3STLA 1JN6B 1ZGLM 1HDMA 3FQXA 2CPCA 4YHKL 4F7CB 5F89B 5E00B 1A6TA 1UZ6E 3VFVB 3DARA 3LQAH 1ZLVH 4IOFD 5D2LF 1VACA 2FLRT 2F58H 1K4DB 3GMOB 4MB4A 3HFML 4RDQF 4FMKA 1CICC 2E8ZA 1G0XA 4E5XB 5HGHB 5FKPB 5FK9B 1T7VA 2VLME 2FJFA 4CVXA 3OKDA 3VFSA 4LMQI 5JW5A 1OT2A 1YZZA 1MVUB 5FYKE 4O4YH 5EA0L 2J8UA 3QUXD 2ESVE 3OB0H 4XBPA 4PJGA 1S7RA 2V17L 2ZCKH 3NFPA 1P1ZB 4OUUB 3IVKB 2YD2A 4OZGF 3SDAC 5GIRA 2HTKC 5D1QC 4PJXF 4YBLB 1D5BB 1XGQA 1AJ7H 5C9JA 5EU6A 1G0YR 4HH9A 4LFHG 1U8NB 1I8KA 4HXBL 2VLJB 1S7SA 3LKRA 3U9PL 2X4QB 2GAZA 1VGKA 4XGZA 3MODL 4MAUH 5DRWB 1KXVC 2YPKB 1E6JH 1CGWA 3RGVB 3V5HA 4HF5L 3O2DH 1S7VB 3I6GA 4APQD 1NMAH 4YHZL 2IPTH 3QQ3A 3OKYA 2FSEA 3WUWA 1CIUA 3GBNH 1Z9SA 4HG4J 1MHCA 4C83B 1A3LL 3Q1SL 4J6RL 1FYTD 3HLAA 4U0QB 1Z3GL 5L6YL 1KC5L 4NIKB 3DUUB 5E24E 3SJVB 2I26N 4YQXL 1LP9E 3ARFA 5CIPH 3D39D 2V7NA 2ZUQC 4N0YL 1YEHL 4I9WD 5IMKA 2W9LA 2YPVH 4D0BB 1FFOA 5ID1B 1KB9J 2Z4QA 3Q6FA 1N6VA 4G80B 3DTXA 1NEZB 3ULUE 2EYTB 3KPNA 1FL3B 4MJ5B 1B4RA 4HEPG 1IFHH 4OD1L 1NAMH 1TITA 5FM5M 2FH6A 2FBOJ 1R5IB 4L8CB 3GHEL 5KVEH 5F7EH 1JYVA 5LCVL 3O3DA 4ELKA 1NMCB 5IVZA 1JGUH 2W0PA 1I8LA 3MTRA 3LQMA 1IC5L 4DN3L 3KXFD 1WJ3A 1WGOA 4LPVA 3MLSL 1FGNL 3KLAA 2AQ1A 1YYMH 2OSLB 4OCSH 3G5ZB 1IM9B 4HPOH 1A3RH 3BRGC 3QXVA 3LMJL 1ONQA 2VR9A 1D6EA 4C4KT 3FAXA 2OJEB 2IPKB 2IQAB 1MIML 5SWQB 4G6JL 3H3PL 4QGTA 3ROOA 4LKCB 3T3PE 1UZ8B 1LILA 1ODAA 3G5XA 4Y8DC 4E41A 3QXAB 3NZHH 3S37X 1FL6B 3GJEA 1DQMH 2EXYD 4FQJH 4MX7A 3SE9H 4DKFH 1A7PL 2RR3A 3CU7A 4MD0B 4QKXB 2C1PB 3L3IB 2AXGA 5GS1A 1CG9B 3WEXA 4NKOA 1UT9A 2AJUL 2WWKO 4C56A 4WEUD 5I1HH 2VDML 2QKIA 2VZVA 5F9OH 2Q7NA 4PJIE 5D5MF 1PDKA 3KPQB 2FO1A 1LO4L 3BYYA 3QA3A 4PBVC 4ZAKC 5HHMB 1MQKH 2BY1A 5F21B 2YPLE 5KVDH 4KK5C 5IEKA 5FGBC 1DSFL 4POZD 3FOLA 4N9GA 4Z7VF 4WY7L 2PW1B 4H26A 4V2CB 3P73A 5F88A 5I1DB 4PJ8D 3QEQA 1BZ9B 1DBML 4HUVA 4MQTB 5ETUA 5T1LB 3F58L 4OFDA 3ZMRA 3AS1A 3NFSH 1FC2D 2H1PL 1T83C 3C5JB 4P4RA 5I6XC 1P4LA 3EDKA 2X1QA 2OQJB 4KJWC 2EEDA 3UC0H 4X9IA 1BJ1H 1K8IA 4R0LB 3MRQB 2A6DA 4V1DE 3CXHK 4AL8H 3RRQA 5EN2A 3SDXF 5E7BA 1A7QH 3L5JA 2FZ3B 3WIHA 5TFSL 4PGJA 3MLTA 5DJ8B 4JZJA 3AMKA 3BQUC 5E2UH 1RJLB 5DHVB 1XAUA 2GT9A 4XP5L 3LS5H 4XPBL 5F9JA 2QHLA 1VADA 1KPRB 2BFVL 1FLRH 4Y5VA 4F33A 1JNNL 2VUYA 1F3DJ 2VIRB 2E9IA 1T0MA 5J1SC 2I07B 3KHOA 5C08B 3VWJD 3OX8A 4HAFA 4IJ3B 5EZOH 4K3DL 5C6PB 4UINH 3IFLH 4Q6IB 2ICES 1IJ9A 4DVBB 1ORSA 5T1DH 2EE6A 3T4YA 4C55A 2AJXL 1E6OL 4JANB 2OP4L 3HMXL 4PTTA 1HQRB 1S78D 4QF1B 1U8QB 1GZQA 4AEHH 4RGND 4J3VA 2VLRD 5DJAA 3NIGF 3VCLB 4ZFFB 3RBGA 5T1MA 4XPAL 1F4XH 4F58H 2PO6D 2HJFB 1JWUB 3GZKA 3DX6A 4PY8J 4DUXA 5HDBF 2WLZA 4XC3L 5D72H 5FYKU 1YN7A 4MYWB 5I15L 1KJ2A 3UTSB 4UBDD 2FHFA 3WFCH 3EYOA 5IGXH 3BEVB 2VQ1B 1I9RH 5IHUL 1B0RB 3GMQB 4U7MA 3DVNA 3FRUB 3MV7E 5DJXA 4HIXH 4XBGB 3MRIB 1ADQH 1QYGH 1EEYB 5M7QA 3IETB 4RMVA 1RIHH 1UH2A 4RAUA 4R3SA 4OCNC 1S7UB 3EO1A 1K5NA 1CXIA 4NN7C 1QFWH 5IR1A 5K9KB 4BJLA 4MQ7A 4AEFA 3EYFA 2GHWB 5KSVA 1E4XI 2VYRE 3MCKB 2O5ZH 4RAVA 1KCVL 3ROLB 1HIMH 4JG0L 3O9WC 2KKQA 4LCCB 2I9TB 2F54A 3IRPX 3I6LD 3SKJL 1ZSDA 1QSFB 5HHXL 1D5ZA 1DANT 5HDLA 2Q7YA 1DBJL 3WKML 5JXAH 4HWEH 4MCYA 4UTBH 3BN3B 1BIHA 3GK8H 4G6AC 2N7BA 2DQFB 3MZTA 4RFOL 1F90H 2BVOA 1NC4D 4D9QD 5FHAH 4OD3H 1MLCB 2EYRA 1AC0A 2O5YH 4M6NL 3WE6B 1DVFB 1QO3A 1ZLWK 3QUML 2NTFA 1C7TA 2DLTA 3BZ4B 4JM4L 1XGTB 1IQWH 5AWNH 4X9BA 3UPCA 5GGUB 3MJGX 1CLOH 4NGHL 3T0EC 4QHUA 4MNHA 2RGSA 4UU9A 1EJOL 2HLAB 5FM8A 4JRYD 4FQXD 2UWEB 2Q8AL 4HKXB 2DM4A 4N90D 5FCUL 4WUUA 3VRIA 1G6RA 1CE1H 3VD5A 4GBXB 5CHNB 1QSZA 3GJFA 2CR6A 1R3LB 2IEPA 3L3GB 4PJCE 3N85H 2P5WE 2VAJA 3NCEB 2CLVB 3HAEB 3OTTA 3SKUD 4X7FC 4NRYA 5DJYA 3TJEL 3E6HB 4QT5A 4F8TA 2RFXB 2P5ED 1QPXA 4ZPVB 4P23A 1UM4L 5DD5H 1FZKB 1MAKA 5DEZA 4X0KB 3D48R 2FX9H 2E7BA 5EOQH 5HD8C 2AK4B 4M7KL 5D7JC 3UJJH 1J5OH 4Z7QF 4XP9L 1JYWA 4LBEB 5HGBB 5I1EH 1Q1JL 12E8H 1HI6B 4FP8H 1BGXH 1A7OL 1CFBA 5H2BA 1BBDH 4L3CA 4HKBA 2AERT 1YEEH 2YD7A 2HN7B 3JV6B 1ZT1B 5L9DH 5HHQB 2DQCL 3BW9A 2JTDA 4JKWA 1LNUB 4JRWA 4PJFB 4IDLA 3AVEA 25C8H 2IH1B 1EFXB 4PP2A 2N1KA 4J8RA 3PWPD 1JHKL 4EI5C 3VD4A 2QBWA 3ARDC 3WN5B 1NCBL 4PUBL 2FH8A 3ZE1F 1RJCA 5HHOB 5GGTA 1KT2B 2E27L 3RWFB 1H9VA 1A02N 1QRNE 4M00A 4D8PB 3BPLC 3CVIL 1CXEA 3QCTH 4OF8A 2JCCE 1A5FH 4OQTL 4JRXD 2BSTB 3MRNA 4LLAA 4BUHA 4U6XA 1B0WA 2XIDA 5F7KC 3H9SB 3UO1L 3JTTA 3QCUH 5CCKL 3QRFM 4EJ1C 2BC4A 4LCIH 4JQVA 3R0NA 1A1OA 1NH6A 4OIAA 3Q3GA 5ALBH 1G9ML 3ISWA 3SDAD 5GISH 2HTKD 2ZCLL 5D1QD 5FM4A 3RTQB 1UYWH 4FQLL 2JJSC 3HB3C 4NO0D 4DQOH 3NAAH 4Y4FA 4XI5C 2H32H 5TQ0H 1Z0NA 5E56A 4DEPB 4WDIA 1YECH 4KK9C 4YNYB 2F8OA 2FLBT 4M62L 1OAZH 4D3CL 1BEYL 1I3GH 4OZ4A 1FV1B 4L8SA 5ICZA 2KDGA 4M48H 5FGSA 5TH2A 1W8OA 3MXWL 4WFFE 4OZFB 1KTRL 3KLDA 3QG7L 3OSKA 1FVCA 1CS6A 2NX5D 2Y07L 3IAPA 1K6QL 4POYA 3SO5A 1WT5A 5EUOA 2YN5A 1TQCC 4O00A 3QWRA 1CCZA 2Z8SA 4U1GC 1C5DB 4KU1A 1FJ1B 3GRWL 2EDQA 4OTXH 4QOKA 2CJUL 2VL4A 2GCYB 1S5HA 2ZUYA 2GJ6A 1CFNA 1JZ4A 5C0AB 5GGSY 3RY6C 3CFCH 5HHNA 2R56L 1PVHA 2NY0C 2R2HB 3IKCB 3NGBC 1PZUB 4MMZC 4R4BA 4X9HA 2UZIH 1FH5L 1RUPL 3RDTB 2AI0L 1X6LA 1MCSA 1INDL 1RZJC 2E5EA 3S37L 4N8VA 1U8LB 5JQ6H 1U8OB 4LL9A 3D85D 4KKNA 1WBZA 2EDRA 3O6FB 3TYGL 4BKLB 5AZ2L 2VL5A 4N8VG 1N5AA 4L5FH 1S7QA 1MH5B 2CXKA 4NM8H 4M5ZH 4PD4J 2W9EH 5KS9A 4LCWB 4OLEA 4X4XA 3O2WL 1CGSL 4I4WA 4K7FB 1I1RA 4U6TA 3RIAF 3OZ9L 2RCSL 5IB5B 4D0CA 5CFHA 15C8H 1M05B 5K9QG 1F8TH 3KLHC 1RUQH 3CXDH 4JFFB 4I0KA 1RIUH 3TBTB 3LKPB 2X2YA 5CUSL 5IT2L 4Z0BL 2IPUG 1LEIB 6CGTA 1VFAA 5D1XD 2AEPL 1GGUA 1FE8H 3GIZL 4YUEH 5JHLH 2A73A 4PGCB 1I1AC 3EO0B 1JRHH 4R26H 4ELMA 2AJSH 4KXZH 3WHXB 2AEIT 1J18A 1JGVL 2BERA 3MNWA 1TZGL 4M6OL 4JB9L 3O11A 2OBGA 1HINL 1W72A 2XPGA 5EU5B 2W9DL 5ESVA 3LHPH 4G9FA 3WD5H 3BUYB 1KJVB 4XP1H 4YBLC 4EOWH 2ARJB 1IT9H 3RWEB 1RZGA 5E70A 2RIKA 1KNOA 2A1WH 4XCFL 2IQ9L 3STLB 3FQXB 4X4ZA 1UCBL 1S7XA 2OXHA 1A6TB 3LCYA 4NO2B 4P2OD 5I30H 1VACB 5GRYA 4Y2DD 1A14L 1CGXA 1DN0A 5HDQH 5MEOA 4GKZA 1QBBA 1D5IL 5BZDA 2FJFB 4GKOA 3DSFL 4CVXB 1H5BC 3OKDB 1L0YA 1IZJA 2DAVA 3G6JB 4KJWD 3VFSB 5B3JE 2FECL 3D3VE 5F93C 5JW5B 1NLBH 4F7TA 5CEZH 4F80A 1QEWA 2J8UB 2LE9A 4HK3N 4DTGH 4PJGB 1QNZL 1S7RB 3NFPB 4LQ1A 4P4KA 2HG5A 4WIQA 4HWBH 2CKBH 1LDSA 5GIRB 1AXTL 2UVFA 1NCWL 3BQUD 4NM4H 1XGQB 5C9JB 2DMCA 3NA9H 5J12B 3LRHA 1M4KA 5EU6B 2BHZA 1I8KB 1S7SB 4YE4H 1U6AL 1I1CA 2WP3O 2GAZB 1VGKB 4XGZB 2RJMA 1KB5B 1OGTB 4ODTH 3SOBH 3ULSB 3V5HB 1QTYT 4WI7A 2ERJB 4MNQE 4FQCL 4X6CA 3HMWL 3I6GB 2BNRD 3RX8A 1KV3A 1U0QA 3LS4H 1ZHBA 2FSEB 4P2RE 1MHCB 4N68A 2R0WL 3QPXH 1M7IA 4E9LA 3CLFH 3Q5OA 2X4RB 4QTHA 1MVFA 2GUOA 3MV8A 4OF0A 3ARFB 3ALWA 5IMKB 1FFOB 2Z4QB 3Q6FB 1F5WA 3DTXB 4MA7L 3B3IA 3KPNB 5ISZD 4OGYL 1EX0A 2P47B 5T3ZE 5BRZD 2F53A 3D5OF 2XG4A 3DRTA 1B2WH 4A2LA 5GSVA 4ELKB 5D7IB 5IVZB 4JVUA 1HXMA 5C0EA 3THML 1FBIH 4KKCD 3UDWA 2H3NA 3OKOA 4KRMB 2LVEA 5DD0L 3DRQA 1BJMA 3QDGD 1W0YT 1GGCL 2HVKB 1YEDA 4OIBA 4FQQB 5J13B 1A9BB 1YQVL 5CEZD 3HCVB 1HKFA 3SCMA 1D6EB 4OI8A 2IH3B 3P0YH 2F15A 1SYVA 3EO9H 4JM2F 3VD7A 4DW2L 1T2QL 1YEKH 4WEBH 3ROOB 5GS2H 3HUJA 4HGKC 1P4BH 4FQ1H 3QWOA 1HH9A 1E4KA 1GL4B 2E8YA 3G5XB 3O9WD 4E41B 5E8EA 8FABA 4GAGH 3QQNA 3NVQA 3GJEB 4FTVE 1E4JA 1ZT7A 4HD9A 1N7ML 4YDKL 1FFNA 3TEUA 5E5UB 5E6IA 2Q87A 3FHAA 1NCUA 4PLKD 2NZ9D 2HP4A 5TGBA 3KPSE 4YFEA 1U8IA 2AXGB 5TDPA 4LIQL 2FEDC 4G6AD 1Z5LA 5GS1B 3WEXB 4NKOB 2YD8A 1HYRC 1YDPA 4MJIA 4C56B 1QHOA 4R2GB 2QKIB 1Z9OA 1EHAA 4G7VL 4KFZC 2P5WB 1VGEH 3QA3B 1T04A 3FMGL 2A9MH 2CK0H 1PG7X 2EDFA 3TT3H 2FHCA 4X6BB 4EIZC 4R8WL 5KW9L 3K74B 3MLWL 4KVNL 5IEKB 5CLWA 4JY5H 1MY5A 3QIWA 4IDJH 3MGTA 3FOLB 5CBAA 4N9GB 2ENYA 3OGCA 4X7SL 4H26B 5F88B 3P73B 2OL3L 3E1F1 2BNQD 3QIBD 4HUVB 4ZO6A 5ETUB 3V52H 2W60A 2ZUXA 4NQDD 3H42L 1CQYA 4P4RB 1C5BH 3MXVL 1P4LB 3IJHA 1CFVL 4I3SL 1M71A 1KCRL 1K8IB 2ATKA 35C8L 2A6DB 2ADIA 3MODH 3MUJA 3PHQA 3VFPA 5EN2B 3QWQB 2O5XH 1T66D 5EPMA 4JFQA 2DQEL 3MLTB 1XGYL 4PJHF 2IAMA 3VWKD 2GT9B 2NXZC 4L3EE 3K1KC 4G8GE 1XGRA 1VADB 3LPGA 5GJTH 5GS2D 3P77A 4X6DE 4Y5VB 5E2VL 3V6ZA 4F33B 1RY7B 5CJOL 1HSAA 1V5JA 2YUZA 1T0MB 3WJJC 1KC5H 4MXVF 3ZZ1A 1DBBL 1Z2KA 4XCCL 4JHAH 3V7AE 4HUXA 2FR4A 4DN4H 4ZS6C 5DD3H 1ORSB 1SEQL 3T4YB 3QSKB 3QIUA 4JGUA 4WI9A 4PTTB 2WBJC 4DVRL 2YD3A 4OZIE 4MVBC 1GZQB 4TTDC 1G7MA 1PG7H 1HHKA 5TE6L 5CBEA 5DK2B 3ARDD 3TBSA 5DJAB 3B2VL 4LSQH 5HI5D 4IRJA 4NHCH 4JPVL 5T1MB 2DTSA 4GXUM 1TZHA 3BI9X 3NMEA 3EYVA 1RZJH 3RY5A 4FHBD 1DLFH 3DX6B 5IB3A 2R0LH 2QJDA 2FGWL 2Q8BL 1YN7B 5F8QC 3E0GA 3ARBB 4R4ND 1MFEH 4EBQL 4PJ9D 3EYOB 1XZ0A 2DI9A 4URTB 3QFJA 2BJML 1WAAA 3MOAL 5DJXB 5ACMA 4BFEA 3AREB 5DD1L 1HSBA 4WGVB 4RAUB 3GSNH 1AO7E 3EO1B 4XC1H 3UJTL 1GOHA 5IR1B 4MQ7B 2JJWA 3EYFB 3HB3D 4JFXA 5KSVB 4KK6D 5DYOA 1MRFH 3UP1A 4HULB 4RAVB 4HJ0C 4XI5D 1UEMA 3FB6A 2F54B 4KK9D 1ZT4A 3NIFE 1ZSDB 3KAAA 1QSEA 4KVCL 5C0CD 1EUTA 3GHBL 1D5ZB 3LY6A 5BMFL 2Q7YB 4Z7OE 4FQHA 4PGEA 5DSCA 4AG4H 3AY4C 1MCOL 1UWGH 4J3OC 4MCYB 1OCWL 5D7LE 3S36H 1UKSA 3LKNA 3DV4A 2P43B 2BVOB 3DUSA 2QV2A 1T3FB 4G6FD 2QEJA 2NY4B 2EYRB 4U0RB 4X80H 1P7QA 4MCZA 1HHIA 1RVFL 3M45A 1QO3B 2NTFB 2XZAL 2YZ8A 3ZSTA 1CDCA 5E2WL 1CDHA 2HT3C 4MNHB 4UU9B 2JLLA 2NY0D 2YKLH 5HI3C 4ODHH 1NC2D 1OTSC 2Q76A 1RV6X 4KROB 3ZE0F 5LGHL 2OK0H 5T3XH 5C0RH 5DURB 2ZSWA 3WBDA 2EECA 2HT4D 4WUUB 1G6RB 4RFNC 1V7NL 3NCYP 5GRUH 3DGGA 2OTPA 1ZAGA 4GRWH 2YRPA 4LU5H 3JVGC 4OZHF 3GJFB 1AC6A 4K7PL 4G5ZL 1AE6L 3CSYA 4YGAB 4ZNEE 4ZO9A 3RVUC 4XMLL 5DJYB 4YHPA 4FFVC 3C6LA 3RP1A 4QT5B 4EN3D 4P23B 5GZOC 1EEUA 4I0PA 4WFGD 3RJQB 2HRLA 3OJDA 5ITFA 4Q58C 3WO3B 4IOSD 5DWUL 4JZNA 1A7NL 1MAML 1MCEA 1AQDA 3DI2B 3UEZA 5H2BB 4L3CB 2KH2B 4HKBB 2XTJB 2VISA 1DBAL 1BAFH 2BHUA 1BWMA 1RK0A 4XPAH 5EU3A 4PPTA 5E6YA 1KENL 2E7CA 4QRQA 4F8QA 5F6IC 1EO7A 2D03L 1KIQA 4QYOB 5DUML 4PP2B 4JFEA 3SE3C 3QDJE 4J8RB 4K8RL 3V6OE 3HC3H 3R1GH 2I60H 4ISVA 4HS8L 2VDLH 5IFJA 1EO5A 3I6KA 4NNPH 2A0LC 3ULUC 3LEYL 1FIGL 4Q9BA 5EIVA 5HVWA 4J3WA 4CU6A 4OCWL 3MRNB 5T3XD 5EUKA 4U6XB 3MLYL 4M7LT 4Z7UE 3JTTB 1BECA 2FX8H 4X7CC 4X5WB 2BC4B 2LU4A 3L3DA 5ITBL 1A1OB 1YEJH 3STZA 3U30B 2F9BT 2R23A 4X7EC 3SJVD 3MUGB 3Q3GB 1FGVL 4YWGH 1U8HA 3VRJA 5D6CA 5EOCL 2GJJA 5FXCH 4DZ8A 3GO1L 5FYJE 1WZ1H 1UA6L 1Y0LA 1KYOJ 4PJBA 3EBAA 5L88L 1LO0L 1V7MH 2OR9H 3NTCL 3AROA 3BD5A 4Y4FB 1GOFA 1IEAA 1WEJH 3MGOA 3RDTC 4WDIB 1U8JA 4M6NH 5HYJE 1BQUA 3O3BB 1KPVB 3KJ6H 4L8SB 3T2QA 3U0TA 5ICZB 4JN1L 3O6FC 5TH2B 2GEEA 1HKLL 4JFHE 1KCLA 3Q2CA 3OXSA 1DP0A 3IJYA 5DUBA 4UIKL 3P9WB 3U2SB 1NJ9A 2YWZA 1FVCB 3QHFL 1UXSA 3B8SA 1EBPA 1IM9D 5EUOB 3KR3L 1FDLL 3DHJA 5J0BA 5DHVH 5FUCE 4NQCE 5KZCB 4M93B 4QOKB 4UOJA 1SYSA 5HY9B 3CSGA 1S5HB 1JGDA 5J89A 1CFNB 4H8WL 4PS4L 4WFHD 3GBLA 5FO9A 5AAWA 4JO2H 3ARSA 4ZTOH 1EGJH 5HHNB 4RSVA 4RWYH 4R4BB 1KFAH 2J6EA 1FNFA 2DLGA 2Y5EA 2F74A 4N8VB 1MWAL 4RQQA 2NY1B 1MRCH 3O3EB 2A77H 2CSPA 3IS0X 3QUXA 1FVEA 1WBZB 2BRRL 2P8PA 2V9QA 3EKCA 1QLRB 4XXDA 1S7QB 4ESKA 3BAEH 1WWCA 3X14A 1ZTXL 1MCQA 3T3MF 5B4MC 1MELA 5KS9B 4X4XB 1SJVA 3IGAA 4WNQA 1JE6A 4I4WB 1ITBB 5HYFA 1OM3L 4MS8C 4DK3A 4D0CB 5HHMD 2AVGA 2VE6A 1OVZA 2XICA 3MNZA 2QQKH 3GI8L 1E4WH 1IGCH 2R1XA 2XRAL 4G43A 4OCYL 2JELH 4OIIL 5CJ8A 5DT1H 4APQA 1VFAB 1LK3H 5AYQA 1JZ3A 2XQBL 2Q86A 5IVXA 2WUCL 1DLHA 5CP7A 5T1LD 1EMTL 5HHVH 2A73B 5C2BL 2CGRH 4ELMB 3MLVH 5DMKA 3KNBA 3L5WA 4M6AA 5IFHH 3QEGH 2E7LA 3RBSA 5CD3A 1RUMH 2M26A 1Y6MR 1CXKA 2FEDD 4RFEA 5IESH 5K9OA 2MFNA 2G5BA 3MNWB 3F7YB 4LEXH 1JF1A 4L9LC 2YBRA 3O11B 1LO3L 3FO9A 2XPGB 3LN9A 4YAQB 2Y6SC 4G9FB 2I25N 4HLJA 1EAJA 5IBTL 4WTXA 4U1SA 4P57B 3EHBC 1JTTA 4PJAE 1RZGB 1DE4A 2X1PA 1KNOB 4UT9L 5MP6L 2NW2A 2PCPA 4JHWH 1DQDL 1S7XB 4LKXA 5C08D 3OJMB 1JPST 4ZOAA 4Q9RH 3Q5TA 5E8DH 2ERJC 3A6BH 3BOVA 1PEWA 4PJ7E 5F7NC 1Q0XH 3C60C 2X9WA 5BV7L 2QQNH 5FYLL 5MEOB 3T8XA 2BSSA 4F15C 4S1RL 3EDJA 4YK4C 3K7UA 4PJ5E 5CMAA 4YDIH 5BZDB 3DUHA 2VDNL 2GI7A 2PTTA 3P9MA 5T3ZL 4F7TB 2ZCHH 1GGIH 3MRMB 5JOPE 1QEWB 5I1CH 1DUZA 2R4SL 3MXWH 2BVQB 3QO1B 4IMLB 3DBXB 4LSVH 4P4KB 1SBBA 3PXHA 2HG5B 4HV8A 3PGFH 2JKXA 3EYSL 2EC9U 3PE9A 1F00I 2OMNA 2OXGA 3JV0A 2NXZD 4ZXBA 3EW3B 4DUWA 3NABL 4U6VH 4JKPL 5C0FA 3VFGH 3O2DA 4NN6B 1UM5L 4NN5B 5I19L 4R7NA 3HI1A 2ENSA 4KUZL 4K3EL 5LQBL 4K55A 4X6CB 3X3GH 4LVNC 4ZS6D 1ZHBB 2VLKE 1MQ8A 4QXUH 2AI0H 2HKHL 2OJZH 4U33A 1G7JA 4YXHH 5J13C 4WCYL 5D93C 5CIPA 5C92A 4MVBD 5I74C 1JZ7A 1M7IB 1EBAA 3I9GH 4TTDD 4BQ6A 5IHZA 2FECI 1W2KT 4KQ4L 5AZ2H 4QTHB 2ICCA 3MV8B 1WLHA 2GUOB 2F5AL 4TNVK 1NAMA 3UTTA 3QT2A 2DIAA 5D2NE 4XNUH 5D7SL 5LWYL 2DJSA 4GG6E 5IFAH 4DJMA 2EC9T 4OLZH 4GH7B 4MDJA 1CGSH 4CNIA 3B3IB 3GKWL 1WWBX 1QSFD 3ZTNH 2YC1A 1WFNA 3UTQA 2F53B 2EDTA 1QBLL 4W68A 3DRTB 4TYUA 3BRDA 5GSVB 4KI5C 3ZKNC 5J57B 1ZA3A 1C08A 1HXMB 5C0EB 3L5XL 2CMRL 5FYJU 3SN6N 4JPWL 5GGRY 4K23H 2H3NB 3U4AA 2VXUL 3OKOB 1IGJA 5FYKH 4TUOB 1N6QH 3KS0J 4R2GC 3DRQB 3O4OB 4U05A 4HBQA 4HC1L 2HMIC 1DVFD 1HH6A 3VXSD 5AG8A 1A7BA 5CWSA 4O2CA 2UWEF 3S35X 2WWMC 4WO4A 3BO8A 1AGFB 1VFUA 1SYVB 3CFKA 2LV4A 2UVEA 1JGVH 5I1JL 3LDBB 4HJ0D 4PJEE 4HCRA 2MQCA 1MJ7L 3QWOB 1HH9B 4LSUL 2APWA 1HINH 4JQIL 8FABB 5IW6A 3IFOA 4UIMA 1ZT7B 4XRCB 4AEIL 5EO0A 5E6IB 4KRPB 4BQ8A 4XMPH 1BF2A 3QBTB 5TGBB 1KLGA 5TDPB 4QXTA 1Z5LB 4DOHE 5F7UA 1JCKA 1YDPB 2P4AB 3EFDL 2BXYA 4MJIB 4P99A 4XXCA 1GYAA 4HIEA 4TSAL 5ICXA 1J1XL 3QJFA 4P2QB 3FCTA 4GFTB 1T04B 1ZHNA 4TSBH 2C7UA 2IFGA 2AK4D 3ULUH 2HT3D 3QIWB 3MGTB 3BT2H 2VR4A 5CBAB 4HGMA 4NZTL 1Y18A 1A2YA 3OGCB 4PJFF 1UEYA 3WFEL 3I85A 3TPUA 1AXTH 4JFYA 3MCG1 4R96B 3R8BB 4I3RL 2XQYG 4HSQA 5JR1H 3JZ7A 5EB9A 3IJHB 1LDPL 2R0KH 2AGJL 1M71B 4YLQT 2ATKB 2UZXB 4NZJA 3S9DB 2ADIB 3MJ9L 3S35H 1EFXD 1X9QA 3PHQB 4K94C 4UI2A 3VFPB 5H35A 4NQEA 5FYKD 2CRIA 4JFPA 2YN3A 5IEHA 6FABH 5GZOD 3WHE0 5EPMB 4JFQB 4LRIC 4G8IA 1Q9LA 1PLGL 5HHOD 3C08L 3MRCA 2IAMB 4UT7H 4K3JH 4LASL 1ZOXA 3TYFA 1XGRB 1AI1L 1KN2H 4OJFL 3P77B 3V6ZB 1Z9LA 3ARBC 1HSAB 4NKMA 3IU3A 4XVTH 2EO9A 2FBJH 2V2WA 1HZHH 4FN0A 4J23A 4HUXB 2DIBA 2Y06L 3H9SD 5D71H 1MFAL 3V9FA 4Y16A 1XGPA 3QIUB 3CLEH 3PQYA 4UV7L 3AREC 3UBXI 1LMKA 5T5FH 4LVOB 3L7FA 5IM7B 3QEQE 3HR5A 3NPSB 1G7MB 3VDAA 1HHKB 5KSBA 4HG4K 4LPTA 4ZO7A 5CBEB 3TBSB 5ABDE 1N0XH 3VE0A 4S1QH 4WW2A 4XPGH 3BPOB 1FNGA 1MCPL 3DYMA 2AXJA 3LRGA 4IRJB 2ED9A 1OGAE 43CAA 2A0LD 4XPFH 3EYVB 4NNYA 3VFMA 3ULUD 2DQIL 4W81A 5IB3B 1F3DH 3MGAA 1J0HA 3L3HA 1A64A 1KB9K 3FO0H 5F7LB 2E3VA 5JMRA 5C0BE 4BYHA 3NN8A 3TV3H 1XZ0B 3K80A 2P5EA 3LKQA 5EIQA 4F57L 1WTLA 5CJQL 1EO8H 2Z35A 3ARRA 3TCLA 2NY4C 1S8DA 2B0SL 4U0RC 3VG0L 3VW3H 2CDEA 1HSBB 3CPLA 4NOBA 3SE8L 1F2QA 3HZMA 4WENB 5BS0A 1J8HE 1SBSL 3JV4A 2XOTA 2EH7H 5DYOB 2NY5C 4QRRE 4OF6A 3FTGA 5I1KL 1D5XA 2DTMH 2HRPL 2NR6C 3RDTD 4PBXA 3S3JA 3FB6B 1ZT4B 3D6GA 2C3XA 4KPHH 3FFDA 3U1SH 3BD3A 3D9AH 1QSEB 1AD0A 5FHBH 1IQDA 3O6FD 1JHLH 4FQHB 3ZT6A 3VI3F 1H3WM 3MCLH 1WC7A 4PJDE 1DL7H 4LMQE 1NCCH 4FS0A 5JW4R 3MJ7A 3RHWF 4H8WC 5DZOA 3GBMH 3LKNB 3DV4B 1MFCL 3DUSB 2EE3A 4F7EA 4LLMA 1T4KA 4XP4L 4P23C 3OG6B 1P7QB 4MCZB 5CLTA 1HHIB 4Z8FH 1YA5A 1G9EA 5L7XH 4H20H 4JFFD 1LO2L 4JR9H 3CSPA 3VXOA 2YPLD 1CFVH 1B3JA 1YUHA 4JRXA 3EYUL 1CICA 3RFZC 1KB5H 1WITA 2YUVA 3DLQR 3NIDE 1NL0L 3LD8C 4PRIE 2Q76B 1BOYA 1QKZH 4IOIA 4HFWA 5BW7A 1Q0YH 2ZSWB 2CR3A 3QH3A 3MRGA 1IAIH 3OAZH 5IBLC 1JUFB 3OMZA 2OX5A 1NBZA 4KZDL 2IG2L 3DGGB 1FC1A 3BVNA 3SDAA 4CDGC 5MHSE 1ZANH 5D1QA 5B4MD 1T89C 4WW1A 3T2PA 4WUKL 4NO0A 3CSYB 4OM1L 4OUOA 3T65A 4YHPB 4IHOB 3T0WA 1CD8A 4OFVA 3ESVF 5LXGL 4I0PB 2FL5A 2VRAA 3OPZH 3OJDB 3DI3B 2GK2A 5ITFB 1HILA 5INCA 3T09A 1K4CA 5I75B 1CD0A 1YC8A 3HZVB 5IB2A 4YZFE 2DIJA 4JZNB 2NX5A 1AQDB 3C2AL 4LSTH 5E4EB 3MMEA 2J8UF 3KYKH 4NQUA 4PJGF 5FYJL 1NUGA 2C3GA 3WSQL 2VISB 4NKIL 3BISA 1RK0B 1KF9B 4JPVH 3CCHA 4TVPL 5EU3B 4M03A 9CGTA 1FNSH 3K1DA 4KMTH 1P9MC 2XWJA 4BQBA 2EH8L 1XT5A 2NY2B 1AFVH 4IRSC 1KIQB 2Y6SD 4I13B 1LEKA 2A2QT 3TVMB 3SDCA 2WIMA 1IRAY 1WVZA 4PG2A 4J2XA 1P6FA 2UYLA 4M9PA 2BY2A 4ISVB 5EU6D 1T1ZA 3EHBD 3WIFA 5D7KE 5IFJB 3MOAH 2YSSA 1FPTH 3BWAA 4AQ1B 3I6KB 4A6YL 1BJ1J 3PXJA 1OB1A 2A6IA 5IB4A 3JWNC 32C2A 3C60D 4Z7WE 1J8KA 1SQ2N 2N4IA 5EUKB 5I18H 1XR8A 1TENA 4GMSL 3MBXL 5CILH 5KAQG 4F7MA 4EQ3A 3L3DB 4M93C 2DKUA 1UJ3C 1LO5A 5CJXC 3QG6A 4KGJA 2R23B 5HPOA 4NQSA 3BE1H 1U8HB 2IFFH 5D6CB 1MIEL 2Z9TA 3ARFD 2G9HA 1A3QA 1O0VA 1AIFA 1Y0LB 4PJBB 3W0WA 1IEAB 3MGOB 5INDA 4PREA 3HPLA 1JNLH 4I77H 5DMJB 4Y19E 5LBSL 1ZWIA 3PP4L 4TVSa 4JN2A 3VXUE 4TQEH 5E2WH 1U42A 3IJYB 5DUBB 1U58A 1NJ9B 4ZAKA 3CMOL 1UXSB 1F6AB 3WIHH 5FGBA 4B0MM 2ARWA 4JJHA 5L8JB 1V3KA 1WIOA 1PY4A 4ALAH 1IKFH 1SYSB 2R4RL 1QFUL 3D0VA 1JGDB 4GXVL 3IFNH 3BMWA 3WKNA 4ORZC 2W0KA 4KI5F 3SGEI 4AY0A 4K7PH 1T83A 5HTSA 4E41D 5FO9B 1MFBH 1TQBB 2H45A 1CE6A 4GAYA 3A67L 3MRJA 1MRDL 4LLUA 3RL2A 3GMPA 3G5YA 4RQQB 4KI5D 2PUQT 3ZKND 1B88A 5E4IA 4TRPH 2ZUWA 1FVEB 2P8PB 1CLYH 4XMKL 4ZNCD 3F7QA 4K94H 3ILPA 4XNZB 2Z8WC 2D4FA 3X14B 3BQUA 4C56D 3X13A 4R2GD 1A7NH 1MAMH 2MKWA 3O3AA 2P5WD 4HZLA 2HMID 1TVHA 3IGAB 4WNQB 4NZRL 4RMTA 2HKFH 5K59F 2WWMD 1OP3H 4XNQA 2IMNA 3S5LA 2VE6B 5JHDE 3SPVA 1F6LL 4O2FB 1NGQH 2NTSP 3MNZB 2PXYA 4XPHL 2VDOH 5CZVL 3O4LA 4CMHB 1H0DA 3S5LG 1RFDL 2R1XB 4G43B 3TA3A 3GFUA 2DYPD 2Q86B 2FX7L 5IVXB 1OAQL 1DLHB 3C6SA 4PG9A 5CP7B 5CJBA 5HBBA 1QZ1A 3ULVE 1TETH 1ZLSL 2EKJA 3AU1A 1M7XA 1TFHA 3VU2A 5DMKB 5KJRL 3KNBB 1JWMA 3L5WB 5DI8A 2GJ6E 3LEVH 5CD3B 2V2XA 4AJ0A 4WHDA 4LGSB 4PR5A 4RFEB 3QFDA 5K9OB 2G5BB 4ODSH 4J1UA 2A38A 3CC5A 1JF1B 2ZP0T 2LFGA 3EOBB 5L2KE 3L3JB 2A9NH 2DD8L 3REVA 4POUB 4FXGB 1S9WA 5DRZB 2DDQL 5JORA 2ADFH 5BRZA 4D0DA 1INQA 3B9DA 3TH3T 2FWOA 4U1SB 3BGMA 2AJYH 1JYXA 5GPRA 1DE4B 1RPQA 2HT2C 3DXAE 2NW2B 2PCPB 1CR9H 1VENA 3B43A 4YHLH 3B9KC 4NN6C 4NN5C 2C3WA 4M6ML 2BVTA 2WV3A 3ARYA 3QDGA 4MB5A 3T8XB 2BSSB 4K71B 3OKEA 2NY7H 1KEMH 3DSNA 3P9MB 4AMKL 1FAIL 1ZKAA 3UTOA 4XNYH 1NANI 4LSDA 1DUZB 1HHGA 2WIIA 3FQRA 1SM3L 1W0WB 2NY5H 3KYMA 1R3IL 3S6CA 3U36A 5BO1L 3KPPA 4ZXBB 3QUYC 5DR5L 1YMME 3UJIH 2DQGL 3OHXA 1IMHC 4TN9A 4UQ2A 5C0FB 4ZYKB 5MENE 3ARBD 1F4HA 3QNYB 3NFNA 3PDOA 1OLZA 4UV4L 4R7NB 3HI1B 1MI5E 4JPKH 4H8WH 4NT6A 5CGYD 3F65A 3T0EA 3ZKMC 3ARED 2X42A 3K2MC 1H3PL 2HH0L 1G7JB 4G8EA 5CIPB 1GIGL 5IHZB 3QULA 5DHYA 3OAYH 4N9OB 2BRRH 5DGQA 2DN7A 1P84J 4KTDH 1Q9KA 4GSDH 3VDBA 3U4BL 2I9LA 1NAMB 3LDBC 3UTTB 2ZJSL 2J5LB 1YQ2A 2F54D 4MDJB 4CNIB 4QRRB 4RGOH 2PN5A 2YC1B 3O2VL 4JY6A 2FIRT 3UTQB 1YN6A 2V5RA 3O6LL 4HKJA 5EH1A 5CINH 4KRPC 4UB0H 1WWAX 1ZA3B 4ZO8A 1C08B 3JBG7 1CT8B 2ZPKL 5JUEL 1IGJB 4CL7A 3BIKA 2WLYA 5E99H 2NY4D 2QHRH 5I71C 1ITCA 5D7JA 4RISH 5CWSB 4O2CB 1S5IH 3ZL4L 4DKDC 1TPXC 4YFLF 4PD4K 4WO4B 5AYUL 4L4TE 4LLWA 3CFKB 3QIWC 2OYPA 3WS6C 4DGYL 2YD6A 1ZVYA 4FZ8L 3BGFC 3HRZA 3OQ3B 4KROD 5I8KH 4NZUL 5E9DE 1FAKT 5DURD 5IW6B 5E2TH 3IFOB 4G6ML 4FABH 4PYHA 3MBEA 1ACZA 4QGYA 1RI8A 1MCLA 2DMBA 5EO0B 1RAMA 3T4AB 3L95B 3ZKXC 4EI5A 2AJVH 5MP6H 3ARDA 3UXFA 3GKZA 4JFDA 4P9HH 3VGEA 1KLGB 1BLNA 4QXTB 2MCPL 5AG9A 3BESR 4M1GL 4P23D 4HIEB 5ICXB 4M43H 3RWJA 1JGLH 3QJFB 3UYRL 4L4VE 2MPAL 4O5LH 3FCTB 1ZHNB 2C7UB 1RU9H 3BH8A 4ODUA 4Z77A 4KRNA 2VXSH 2ORBH 3T0BA 1Y18B 1A2YB 4P5KB 3MR9A 5H8DA 4IEFB 1YPZE 1ZEAL 3TPUB 3LOWA 4JFYB 5IBLD 5GQBA 4TUKH 3FHQA 5TDNA 3VFOA 1KN4H 3QIUC 3TH4T 1BVKA 4XNMA 5FGCB 4Q9QL 4YDLB 3DVIA 1HCVA 1UQSB 5H35B 3R0MA 3V7MA 4ERSL 5J11B 4NQEB 2X40A 4R90L 4JFPB 5IEHB 1UENA 2FIKA 5L0QB 1NUNB 1CVSC 3BPOC 4U7SA 5D4QA 3GUTA 3MV9E 3FT3B 4G8IB 5C0CA 1Q9LB 5IWLC 3KPMB 3GMMA 2K1MA 4OFKA 3MRCB 4HFUL 3FO1A 3TWCL 3TYFB 3RWDB 1UXWA 5DLMH 1F58L 3H3KA 5B22A 5A2JH 1CLZL 1BREA 2VXVH 5C86A 4HT1L 3IU3B 1F42A 2B2XL 3Q6GL 5GGVL 1XIWA 5M95B 3TM6A 2V2WB 4L29A 5HXMA 4UILL 4HUKB 5LWYH 3V4UH 3HR6A 4YHMH 3SDYH 4Y16B 1QQDA 3T2NL 1XGPB 3WO4B 3PQYB 3RY6A 3P0VL 3QCVL 4M7LH 1JMXA 2NQCA 3L7FB 5FUCC 3HR5B 2XWTB 1NC2A 1NFDA 5FUOL 3NH7H 5KSBB 3B83A 3VE0B 2HFEA 4WW2B 4QHKI 5J6GA 2BVPA 2E7MA 4M5YH 4Y4FD 3RVTD 43CAB 4NNYB 3VFMB 3MLXL 4UT6L 1DQLH 5LJYH 2X89A 3W9EA 3RWGA 4XP6H 1JK8A 3CFIC 3PWLA 2VDQL 5FM5O 5EUOF 4Z7NE 4LGRB 3MNVB 3L3HB 3SBWC 1KJ2L 1QR1A 3ORJA 5GRZA 2DQJL 4NKDB 2NNAA 3NN8B 5AUMA 5DJCA 5B21A 3LKQB 4FNLH 5TE7L 3BX7C 3GSNA 1JHTA 2DLEA 3GI9H 1UG9A 2Z35B 3TCLB 1KBGL 3VXRE 1S8DB 5KZCD 4YXKH 2CDEB 4QOKD 1L9MA 2OI9C 4TOYL 4P46C 4YHIA 3HZMB 1ZA6A 5BOPA 4JG1L 5BS0B 3RL1A 5FOJA 1FFQA 1GHFH 3JV4B 1I1AA 3IF1B 1T6VN 1RZFH 3IFPB 1X5ZA 1FZJB 3FTGB 1D5XB 4JO1H 4Y4HB 2IANE 4EUPH 3FFDB 5KS9F 5ACZA 2NY1D 1AD0B 43C9A 1IQDB 1A6AB 1TIUA 3AM8C 2Y1VA 1DTUA 1MCNA 3MLUL 1C1EH 2G60L 1EFQA 3MJ7B 3X12A 2DQHL 1I8MA 4OGXH 2BSED 4ZS7L 1QLEL 4ZSOA 3V0WL 1GC1L 2XZQH 4F7EB 4LLMB 1T4KB 4I3GA 5DVNA 4I0PC 4GW5A 4OV6F 4MQXC 3VXOB 4OF5A 4OT1H 4ELMF 1YUHB 4JRXB 3FT4A 2YD5A 1CICB 3FN3A 1BM3L 1MJUL 4BSVA 3QFJE 1CL7L 2VAAA 1H5BA 2WANA 4KTEL 4HFWB 4JY4A 1G84A 4I2XA 3QH3B 3MRGB 1G6RL 2XG5A 4KGLA 1FORH 3FRPG 5ADOL 1I3RA 3D2UB 4TPRL 5SWZE 3U7YH 1NBZB 2ILLA 3LV3A 1L6XA 3BVNB 3SDAB 5D1QB 3CFDA 5F9DC 1U2HA 3PNWA 4WW1B 3WUZA 1MHHA 4NO0B 2EIBA 3HNSL 2BNUA 4N0CC 1RK1A 4RMUA 5JW3H 5T33L 3QI9C 1NGWA 3TVMC 5L8KB 4PB0H 2IGFL 4NJAL 3VGFA 2Y72A 3ILQC 5A2IH 3HMXA 4L8CA 4XZUB 3VI4F 4AIOA 2FL5B 2DWDA 5BQ7B 4Z95L 3SGDI 1H3TA 5IV2A 1HILB 5INCB 5GHWL 1K4CB 1G6VK 3FQUA 5ALCL 3P9LA 4LQFL 5E2JA 3RKDC 2HLFC 5F1OB 3C8DA 1I75A 1MCBA 3MMEB 2WMPA 5E6ZA 3BZEA 1MCPH 2KQMA 2VNCA 1GPOH 1LHZA 1FZOB 4PB9L 1JPSH 5FIEA 1AQKH 3PABB 1JI2A 1BD2E 2PR4H 3I3BA 3HE7C 2XWJB 1YY9C 3UROR 4N0UA 5DA4A 2JB5H 3QHZH 3NACL 1P69B 4P4KD 4M4PA 1LEKB 5SWSE 3KPRB 1BFSA 4GAJL 3SDCB 4JO4L 3FN0H 2W92A 3QR2A 3S4SA 1N4XL 1FFPA 2UYLB 5I1AA 1T1ZB 4X6CF 3WIFB 2DQUH 3NPZB 3M8OH 1MNUL 1OAKH 3S4SG 1OAYL 5GGTL 2HT2D 3BWAB 5KN5A 1NUDA 3L3KA 4WHYG 2WUBL 3MRRB 4MA1C 2FATL 1CG9A 4ZUUA 3OJ2C 3I3DA 2HFGL 2A6IB 5IB4B 32C2B 1TVBA 4U1MA 1U3YA 7FABH 1XR8B 1NGPH 4ZFOL 2X4OA 2VXTL 2WSKA 3U7AA 1P5VA 2EYSA 1ED3A 4F7MB 1T1YA 1TJHH 1LO5B 3FQNA 3QG6B 4PP1C 5JOFA 4N8CH 3MV8D 1J1OH 4QXGL 3O6KL 4AT6A 2G9HB 1NUFA 2AAVA 3RQ3A 4DGIL 5I0ZA 3RUGE 4XB8A 1AIFB 3JWDL 4OCXL 1TJGH 4KZEL 2MNUA 5F9AC 1TQBC 3FB5B 3QUMA 3W0WB 1OARL 2OQJA 3WNLA 2F53D 4XB7A 5INDB 5EC2B 3SGDH 4PREB 3MRQA 3HPLB 5D70L 2NY3C 4D9LL 1OY3B 3RZCA 1ZWIB 4JFEE 2DLHA 3VMNA 4JN2B 5B8CB 5C6WH 5IJVA 4XNZC 4I8DA 1U58B 5DHVA 4AEEA 1WTGT 4ZAKB 2PYEE 3ZKMD 3HUJF 4OF3A 5IW3A 3A6CH 3TBWA 2VIRA 5IKCA 5I8CA 3MLRL 4Q9CA 2I5YH 4MHHI 2D7QA 2APTA 2HJLA 4DVBA 4YR6A 3TN0C 1IC7L 2NPLX 1F11A 3SY0A 3ZLQC 5I6XB 2DQTH 1CE6B 4GAYB 4M7JH 4HUMB 3MRJB 4LLUB 4JANA 3RL2B 4NSKA 2DJ4A 3GMPB 3QXUA 4DZBA 3VGGA 1IEHA 1MJJA 1ES0A 5E6ID 4KRPD 3INUL 2Z93A 2B1AL 2F8VA 2FO4A 3GSXB 4W6WB 3VCLA 3DYOA 3HC4H 5A3IC 2Z92A 5CEYA 4MJID 3X13B 2FB4L 3E2HB 5IW1A 3O3AB 4HZLB 1JWUA 3B8YA 1TVHB 3O8XC 4X4ME 4P2QD 4XNQB 5FYJH 3G6DL 3WSQH 1L7IL 4P9ML 2XACC 2Z8RA 3S5LB 3SPVB 1JF5A 3WJJA 1R3KA 4N0RA 2PXYB 3QIWD 1FQ9C 2VITA 4Y5YC 2DQDL 3O4LB 5F7DA 5FDWA 4LLYA 5F3BA 5DQDH 3E8UL 5DZLA 3TA3B 4LDOB 1KIRA 3KHQA 5E08L 4NC1E 4Y1AE 3C6SB 4PG9B 3IETA 2WBJA 4S10A 2P49B 5KTEH 4K71C 1YY8A 3B9EA 4IIQA 1JWMB 2HTLD 5DI8B 4UTAH 4OQTA 4LHUG 2V2XB 5EZLA 3U46B 1RZ8A 4PR5B 3QFDB 3V6BR 4J1UB 2MOVA 7CGTA 4JDZA 3CC5B 1G7QA 4NWUL 4OLXH 1W72L 2HWZL 4HIIA 3REVB 4KI1A 4U1JA 1EXUA 5D2LE 3BYTA 1QFPA 1KCSL 5JORB 4D0DB 5BRZB 4OLVL 1L9NA 1INQB 2FWOB 2EDKA 4HJJH 4ZXBC 1DBKL 3BGMB 4OAWA 5F9WB 1H15B 4ZFGH 5A2KH 3LZFH 3VD3A 5E8OA 3WL9A 5ID0A 3QQ9C 4KH2A 5D8JL 3WE6A 3VXSA 2Q3ZA 1XGTA 3W11C 2YRLA 4PJXE 4YXLL 3OKEB 3QIUD 4NN7B 5HGAA 1UWEH 5GGUA 3SKOA 4ETQA 4XVUC 3GGWA 4TNWF 4Y8AA 1IGMH 1IGIH 2WINA 5LBSH 4GMTH 1RZIA 2WIIB 1HHGB 3FQRB 3FFCE 3VXTA 1FYTE 1PKQA 4IRJD 2J88L 2WQRA 3U36B 2J5LC 3GRWA 3KPPB 3KYAA 2J4WH 3OHXB 4R4FL 3AY4A 4HBCH 4UQ2B 1R3LA 1R5WB 1WAAF 3D39E 5GSRA 2AJ3A 2CLVA 3VFNA 1NCAL 1WK0A 1MFDH 1QFUH 1VKXA 3RPIA 1KJ3H 4HPYL 4NT6B 4CVZA 1MCJA 1FO0B 1P2CA 2VDRH 1DJSA 4TSCH 3RU8L 5I1IH 1LE9B 3T0EB 1YJDL 1T2XA 1UACL 2P8MB 3QAZC 4G8EB 2VXQL 3KXFE 4NQCD 1HI6A 2JB6A 3T0VA 2GYSA 3U4EA 1JPTH 3HTLX 1Q9KB 4OKVB 4MNGE 4MDIA 1RURH 2I9LB 3JV6A 3B2UC 2HN7A 4WJ5A 4KY1L 4AIXA 2FJHA 2AABH 5FAAA 3WFBH 3KYNA 1CI5A 4XBEL 1X44A 4JY6B 1OAXH 1YN6B 4HKJB 3OKNA 5IQ7H 1NFIA 5CKAA 1RD6A 2ESVA 3F5WB 4OLYH 4NFCA 3VG9B 4RMSA 1JTPA 1DR9A 2R39A 3I2CH 4G3YL 4OI9A 5HHOA 5JO5A 3BIKB 4PRPB 1TZIA 5DTFA 1UJTA 3PWVA 5DVKA 4YX2L 5D7JB 4PGDA 1JIBA 4XTRC 2DMKA 2ID5A 4U1IA 1RQ5A 4HEME 4LLWB 2BSTA 5FV2A 4LCYA 1JPGA 3BMVA 3N1GC 3PDGA 3QXWA 1A6UH 3ZTJG 3HRZB 5KSUA 1BFVH 3N1MC 2D9CA 4HAGA 2DD8H 4GQ9H 1YYLL 4NCC1 1T80A 5D5ME 4XAKE 3MBEB 2DBLL 3PV7A 1WFTA 4LAQL 2XZCH 5IUSA 4J3SA 2RAMA 3RAJL 4EI5B 2V5TA 3ZHDA 4OKDA 3ARDB 4JFDB 1CK0L 5E7FA 1U2CA 1LP9A 4NWTL 4Z7VE 2W0LA 3NCYS 3L1OL 1L4IA 4ZPTA 3CXHJ 1C5CH 1ND0A 3P4LA 2XZZA 3RWJB 4I0PD 4F9PC 5JDJA 3BPLB 4MQXD 1W0VA 3IDNA 3BH8B 4IRZL 4ODUB 3RVVC 4Z77B 1B0GA 3O0RH 5CZXC 5KG9A 2D4DA 5TF1L 2R69L 4BK4A 5SX4H 3SDXE 4Z18A 1G9NC 1J1PL 3MR9B 1OQXA 4XNXL 1R5VA 3JV5A 5BO1H 2FGZA 5TDNB 3WXVL 3VFOB 4Y16C 1AKJA 1E28A 5JW4M 5JXEC 4S11A 3WO4C 3QXDB 1BVKB 5KVFH 2CQVA 1DQQA 4XNMB 5T1KA 3EAKA 4WTZG 4N0CD 4IMKA 1Q72H 4OV5A 3HNTL 3QI9D 3TVMD 5J6HA 1I9IH 3ILQD 2FIKB 4OCRH 1I7ZB 1U8LA 5ESQA 3DETD 1KELH 3GMMB 4WGWB 3AUVA 4DKEH 2J6EH 3FO1B 2IJ0C 1PEZA 4RGNE 2VLRE 1UXWB 2UUDK 5J3HC 2J12B 3D0LA 3EDEA 3GMNA 5EORH 4BK5A 2VSCA 5GJSL 5TE4L 5KVGL 3RKDD 1A6VL 2HLFD 4PRHE 3BSZL 1TQCB 1XIWB 4L29B 5FV1L 5JW4Q 4PJIA 1P4IH 3LKOA 1TNMA 3NIGE 2NZIA 1NBVL 3HKFA 5A43C 3BKYL 1XEDA 3QNZA 1OW0A 1QQDB 4JQXC 2H2PC 3HE7D 2YPLA 1FCGA 4PJBF 4KV5F 1KXTB 1Q9OB 2BK8A 4Z78A 5EWIL 5I1GL 3SKMA 4UUJA 1NC2B 4PLJD 1NFDB 5D6DC 2HFEB 2LU3A 3EYQC 4LLQB 3WIIH 2BVPB 4Y0GA 4Y4HC 3WHXA 3F7RA 1HNFA 2R8SL 3W9EB 1CZ8H 3HI5L 2M2DA 4NQVA 3PWLB 3DNKA 1CBVH 4UZGA 3QP3A 1CF8L 5GS0L 4GRMA 1QR1B 1PSKH 3P30H 3JWOL 5FUZH 3I6LE 2GSGA 2NNAB 1F4YH 5AUMB 1KJVA 2ARJA 5DJCB 1MPAH 1DZBA 4HWZA 5A2LH 4QWWC 3BJLA 3GSNB 4AM0A 3JWDC 1JHTB 3RWEA 2X4NA 2VSDA 5J06A 2D0FA 4NFBA 3HG1E 1EIBA 5E8PA 1NBQA 4P3CL 4NO2A 3PJSA 5IVNA 4YHIB 2OR8A 1ZA6B 4DAGL 1H8NA 4OFIA 3RL1B 1I1AB 2J1KA 4LSSH 1R3JA 1NGXA 2D31A 5DMIL 3MJ6A 3G6JA 1NCDH 5BW7C 3EIFA 5ACZB 1FP5A 3H0TA 4YHYC 43C9B 4L9LA 3ULVC 1IKNC 4JRYE 5C09E 4PY7A 2X4PA 1S9YA 4G7YL 1OSPL 4NYLA 4JVWA 4N90E 5FF6B 2X09A 5ANME 1MFNA 2V9RA 1GAFL 5C07E 3X12B 1I8MB 3BKJL 3UZVB 1YNKL 1EH9A 4KKLC 3FL7A 4ONFH 5DFWH 2XN9E 3UBXA 4ZSOB 2DLFL 2CLRA 1R0AH 4MZ2A 1MOEA 5CZKA 5IVXF 1KB5A 1OGTA 4GW5B 3UBXG 4YBHA 3V0VA 3ULSA 1MEXL 4Y89A 1WZLA 3C60A 1CWVA 2P5EE 4Q9QH 3FT4B 4NZDA 2K7PA 4OF7A 4BSVB 4ZTPL 4QHLA 2VAAB 5F7WC 1H5BB 1S3KH 3L9RA 3GNML 1J88A 5K9JH 4N0FA 3MV7A 4JY4B 4WI2A 4GRWB 1NSNL 1JFQH 2ZKHH 4I2XB 3NCMA 1I3RB 3MUY1 3S88L 2X4RA 4Y5XA 3VXME 3LV3B 5J1TC 3QISA 4HIHA 1N59A 5A3ID 4XPTH 3CFDB 3PNWB 4KK8C 3X3FL 1MHHB 1NQBA 4Z7QE 3O8XD 2BNUB 1RK1B 1NGWB 5LVEA 3SDCC 3HNVH 4KHTL 2DI7A 4PG2C 1VESA 5D7IA 2DWDB 3MV11 4JZOA 2ZWLT 3PWPE 5IV2B 3CNKA 3FQUB 1Q94A 3H6JA 3MACH 2B5IB 1RZ7L 1U93B 4I1NB 4H88H 3P9LB 1CU4L 4M1DH 3KPLA 2HVKA 3AS0A 1CL7I 1CD9B 4FQQA 1A9BA 3HCVA 3BZEB 2IH3A 4YFLI 2V6HA 1T1WB 1W8NA 2GIYA 4OZGB 4ZUSA 3ZE1E 4ZG1A 4LPCA 1QD0A 3VXQA 2MQ0A 1L7TH 1D6VH 3O45A 4OLWH 4N0UB 3MRDB 3EZJB 1A6WH 5SX5H 1TDQA 2A6JA 1AGBA 2CLZA 4HCRH 1TJIL 1XFPA 5A1AA 2XA8L 3S4SB 4KKBD 1CLCA 1G7PA 3FFCB 4ZXBD 1FFPB 1M6OA 3OAUL 4U49A 1RULH 5I1AB 4XAWL 4MA8H 2D9QB 1ZLVK 1A7RL 5BVJB 1WQVT 2R29H 5KN5B 3L3KB 4P59H 3B5GA 1F3JA 4ZUUB 5A2FA 4OLUH 3QQ9D 4PJCA 3MZGB 2P5WA 1TVBB 3U9UA 4U1MB 1AD9B 2FRGP 5B8CC 3W11D 2X4OB 2K7QA 1A22B 2B8OT 4X6BA 1RZKL 4XVUD 1MJ8L 3W5NA 1JMZA 2R0ZH 2EYSB 2OLDA 1ED3B 1T1YB 3NCFB 1ZXQA 1F4WL 3FQNB 1V05A 5JOFB 4LLVA 1I9JH 2DYPA 1AGDA 1J8HD 3JUZA 3UTTD 4AT6B 2G60H 2PETA 4E42A 3ZYZA 4QRRD 1PJ9A 3RVWD 3QUMB 2VDPL 4KAQH 4CRPA 4NKQB 4QCIA 3DYPA 4MXWL 3I50H 1YJDC 3T1FB 3F7PC 3T2OA 4Q0XH 1N5YL 2FJGA 4CKVX 3GSQA 3RZCB 3SDDC 4LCUA 3PL6C 3QEUA 5IJVB 3LSOA 4NUGL 5F1NB 3OF6A 1YEGH 5C7XH 3E2HC 3BKCL 4H1LA 2D7PA 1DUYA 4K2UH 4LIQE 1IBGL 4WO4D 3S97C 1DFBH 4FZEL 3TBWB 4H1LG 1QRNA 5FA4A 5IKCB 5ADOH 2HA1A 1B4JL 3WNMA 4KQ3H 2QSCL 2PXYC 4JO3H 2J3SA 5I8CB 2EKSA 4X9FA 4EI6A 3W2DL 1EHLH 3B2UD 3UTZB 2JCCA 5M94B 2HJLB 1SY6H 3TA3C 4YR6B 1KTDA 3SY0B 1F11B 2HJKA 1G9NH 5DK3A 1EEZB 3UPAA 4KHXH 4CADA 3FZUC 4NSKB 4DZBB 2OZ4L 1MJJB 1ES0B 2B4CC 4XWGL 5DS8A 2Z93B 5DK2A 4HMDA 3LPFA 2FO4B 5EDXA 3MRKB 3QRGH 1RIVH 3CDGA 4JAMA 4LRIA 2YK1L 2Z92B 5CEYB 5B38G 2OTWA 2NXZB 1L0XA 4LQFH 5IW1B 4DKAA 4XVJH 4P3WA 3IXAA 4GKSA 4S0SD 3RPKA 1AY1H 4XTRD 1LWRA 3ARBA 4ODVL 4ONOA 4RMQA 1BQHG 2ICEA 3P11H 4K9EL 3JUYA 4M7ZB 3V8OA 5F9WC 1R3KB 2VITB 5F7DB 5FDWB 4J7RA 4LLYB 4RBPH 5F3BB 1KIRB 4NP4H 4BUGA 2M8XA 3AREA 4OB5H 2WBJB 3PP3K 3MO1A 1YY8B 1PX3A 4MB3A 3TBYA 3MRFA 4FFYH 3IT8D 1JGEA 4IIQB 3K2UL 4WU5A 2P24A 3C5ZA 5EZLB 1RZ8B 2FD6L 4J12A 4NQED 2GSIA 1NMBL 4JDZB 1CFSB 3J7HA 3T04D 4DFHA 1G7QB 2R2EA 2F5BL 4BZ2H 4HIIB 4U1JB 1EUUA 1EXUB 2VH5L 3CUPA 3MLZH 3HI6L 3WXWH 4FFWC 1OL0A 5EU7C 4M4RA 3CJJA 4PGZA 3LQAL 4OAWB 2W59A 1GGBH 5I76A 2F58L 3SE4C 5FA3A 4O51A 2W0FA 4OSUL 1VPOH 4QRPE 1T3FA 4JFOA 2NXYB 3X11B 3ZDYF 5E8OB 3WL9B 5ID0B 5FOBA 3VXSB 3JWDH 5KSBF 1ZV5A 4Y16D 5JXED 4WW2F 4O4YL 1CGYA 2EDJA 5HGAB 3SKOB 2E9BA 3PQYD 1A0QH 2CIIA 2ZCKL 4LRNH 4ETQB 5ACLA 2P42B 3GGWB 5AD0B 5C8JA 2BNRE 1U3HA 3MOBH 5JA8B 3OR6A 3IB4A 2WINB 3IU4H 1AJ7L 1RZIB 3LH2H 4H25A 3VXTB 4QRTA 4YHNA 3H7BA 1CXLA 2ED7A 5IJKA 1PKQB 3TO4C 4C58B 1M7DA 1B9ZA 1X4YA 5F96H 5J3HD 2Y5TA 1E6JL 4XHQA 2B39A 4WFEE 4F7PA 5J8OA 4JFZH 3ULVH 3O2DL 3PHOA 5GSRB 1LVEA 3U83A 4GJTB 1CXFA 1NMAL 2AJ3B 5D1ZC 3VFNB 2IPTL 3WS3A 4X4YA 1VKXB 5ISZE 3GBNL 4UAOC 3P40A 3RPIB 3VG9C 4HW6A 4CVZB 1HWHB 1P2CB 1FHGA 2H2PD 5GGQH 1KCUH 5BVPH 1A6ZA 3N9GH 1OP5H 5HVFB 1EZVX 3BKMH 4LOUC 5BS0D 3I3EA 3INUH 2YPVL 1E4XH 2JB6B 2YEZA 4KC3B 3ZHLA 3U4EB 4BSJA 2P44B 1FLTX 3EYQD 4MDIB 1IFHL 4HMEA 4WJ5B 4UQ3A 4RFNB 2FJHB 4Y4HD 5KVEL 3KYNB 5F7EL 1JGUL 1H3GA 1T89A 3MBEC 1U3JA 3D3VA 1L7IH 5E5MA 4QYOA 3OKNB 1T22A 1NFIB 2X10A 1I1FA 3V4PH 1N64H 2ESVB 4U6HA 3IDXH 4OCSL 5C09B 5IBUG 3DROB 4QWWD 4HPOL 2QQLH 2DKMA 1A3RL 3T77A 3LN5A 1B6UA 2B1HH 5JO5B 1ACYH 3QDME 1TZIB 5DTFB 5C1MB 2KZWA 3PWVB 3QYCA 1T0NA 4QHNA 4PGDB 1KTLA 3FB7A 3C09B 4U1IB 5DO2C 3QDHA 1MHEB 2YA2A 4UNTA 1H8SA 1CICD 3NZHL 3EGSA 4LCYB 4RMWA 1JPGB 2WAHA 2H41A 4MNQA 3U6RB 1DQML 4FQJL 4U1LB 2BX5A 5KSUB 5ESAA 3SE9L 5ICYA 1HOCA 4GUPA 4DKFL 4X5WA 4MD5A 4P2RA 1P9MA 3W9DA 3D2UD 5F6IB 4IRSA 3ULVD 3MUGA 4HXAL 2FYYB 3RA7H 4GS7C 2BDNH 2BNQE 4Q97A 5IIEB 5I1HL 5F9OL 4NQDE