4UU9B

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
ALTQPASVSGSPGQSITISCTGTSSDIGGSKYVSWYQQHPGKAPKLIIFDVNRRPSGLSNRFSASKSGNTASLTISGLQAEDEADYYCTSYHPTKTILFGGGTKLTVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MEDI7814
total genus 24
structure length 109
sequence length 109
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uu9B00
1RJCA 3SE3A 3VFGH 1ZA6B 5CD5C 1B9ZA 5JO5A 3PG2A 1FLRL 2AW2A 1EH9A 1RHHB 3PQYE 4JQXA 4S1QH 3DURB 4JFXA 4XVTH 4UZGA 2W65A 2XQBL 1RZIB 2VDLL 4BH8B 4PRBB 4N9GB 3L6FB 1AXSA 4L5FH 1G0XA 4FZEH 1IGML 3QULB 1DBKH 1BEYH 3O3BB 2EC9U 4N90E 3ARGA 5JXAH 1KLGB 1RSFA 5MEOA 4EDXB 2BY1A 4X7SL 5KSBF 1T5WA 4TYUA 4NKDA 2PYEB 2FSEB 2IF7A 3KJ4C 4GAFB 3VRLE 1SYSB 3EJZC 3QWQB 4C54A 4I3SH 4PPTA 1EUTA 4XP9L 2EDOA 2MQ3A 3W11C 3RVTD 2VWEE 2HJFB 3ARRA 2ZUTA 1T1YB 4Y5VA 1S7XA 1RZIA 5DRNA 2BCKB 3T4AB 2ZSWB 1EHLL 5GXBB 4MQTB 4PJXA 3B83A 3U7WH 3OR6A 1U8OA 5C9JA 3SDDA 2BY2A 3VXRB 5H94A 4MMZC 3ZE1E 2RFXB 3L3KB 4YHPB 1EEYA 4KHXH 2L7JA 1XF3B 3HZYB 2OJZH 4G8GA 2HH0L 4PLKC 3WN5C 5J1TC 2IFFH 3QWRD 4H26A 3AB0C 3SO5A 2XV6B 4TVPD 5JHLL 4ZUTA 3MNWA 4FFWC 1QLRB 5CEYB 1MVUB 1AGCA 1DBAH 5GRVL 3FOMB 3GMOA 4JFZH 2PTVA 4OCWL 4ZTPL 2APFA 5MEPB 4MAYD 3W2DH 2Z31C 3BYYA 3MBEC 5IW1B 2A1WH 3LS4L 3VWKD 5DGQA 4E42A 4FFVD 3MV8E 1H3VA 1P9MC 2GFBA 4XBPB 5CCKL 4JO4L 2X4NA 5DQJA 2ZNWA 2FD6L 2FIRT 2X5PA 5F3HA 4EJ1C 3I85A 1ZHNA 1I3UA 1PZUB 2MPAH 3T2QA 1XR8B 3RWIA 1ADQH 4UAOB 3SQOH 3TPUA 2MKLC 3ULVL 3GMMB 1RAMA 2VSCA 5ALCH 2HVKB 3OAYH 3WD5L 5DD6A 2VZTA 4OFYA 5JMRA 1KENL 3Q1SH 3V0AC 5ITBL 2OMNA 2CJUH 1WAAA 3T0EB 4GXUN 4LSTH 3ORJA 3H9SD 4ERSH 4MJIA 1EVTC 4NHUB 1HHIB 3PQYD 2DWDA 2FNBA 3EZJB 1UZ6E 4JG0H 3OKLA 5JW3L 2B4CL 5LBSH 3QEGL 3QO0B 3OF6D 4MDIB 1NDGB 3MRIA 3BYTA 2JB6B 3T0EC 5IB3B 3QFJA 1IM9B 3U0WH 1LP9A 2VKXA 4YGVA 2VZUA 5C0NC 4ELMF 5CGYC 3ULVF 3B9KD 4PRHA 3BHBA 3P0VH 4U05A 4WVRA 4XNUL 3MGTB 2KKQA 3MCKA 1Q94A 4OCWH 3DXAB 3LDBC 3ULUC 4ONHB 1A4JA 4XPAL 3I9GL 3WJJA 4NUJB 1GCFA 1CFBA 3QZWB 4YR6B 5TF1H 2CKBA 1CF8H 3OJMB 5I8OH 1T3FB 1C12A 4YZFF 4PJ5B 4HJJH 3V7AE 3TCLB 4QRRB 2IGFH 5GGRB 2YA0A 1AKJB 1FGVH 2BSSA 3IFLH 3TT1L 3QEUB 1IRAY 1RU9H 4N1CA 4Q9RH 2WANA 1J0JA 1G0DA 4X7EC 4NQSB 5IB5B 3OR6B 4K9EL 5EC2A 5J56B 2YPLD 1UCBH 4MNGE 4ERSL 1GAFH 2QJDA 3OKOB 3MRBA 5LWYL 3T1WA 4W6YB 1PY9A 1X5ZA 1ZV5A 4KI5D 4KJYB 4O2CA 4P9HH 3TF7C 1H3PH 2A9NH 1MWAL 4Z5RA 5D7JC 2FYYA 3MFFB 4NIKB 3QISA 3MLSL 4P46C 3GJEB 3MV7E 5L9DH 4RZCB 1KELL 4KJQC 1YY8A 5EFIB 1Q9LA 2QL1A 1HKLH 1OD7A 1NSNL 3TNMA 4G6ML 5CSBA 4MD5B 5GJSL 4Y1AB 1JWMB 3ZE2F 3DMMC 3OAZH 4FQXB 5E9DE 5C0JA 1U8QA 1ZTXL 4YIQA 4DTGH 4MJ6A 4QO1A 1EJOL 1NUNB 1BBJB 4KK6D 1VENA 1D5IL 2VRAA 3ARBC 4CL7A 5HHVL 3H7LA 4P5KB 2DWDB 5T5NG 4HUXA 3UTSB 3MR9A 2J8HA 2C3XA 1BIHA 2VERN 2ORBL 4JRYE 4FNLH 5DMGC 1XIWD 2B2XH 4HK3J 2F5BH 4OLXH 4OLUH 2G5RA 1F6AA 4FQ2H 1FNSL 3IVKA 1P84K 4DK3A 4XVSL 1UB5B 1ZT7B 1JGLH 3SBWA 1P6AB 5EH1A 3TPUB 3DYOA 3FRPG 3B5GA 4HSQA 2X1PA 4JHAL 3TBVA 4AEIH 4CBPA 1MH5A 3S37L 1M05A 4Z0XB 2J2ZA 3Q6GL 2CR6A 1IILE 4F33A 3G6JA 3CDGB 3GKWL 1QD0A 1IZJA 5EO9B 5FGBC 1I1FB 3KPNA 4YUEL 4HUUA 4O9HL 4PJBA 1HDMA 3W5NA 4X6CB 1U8IB 1KCKA 1F8TH 3C5SB 4CUCA 2B1AL 3HFMH 2ED7A 3MYJB 3GGWA 2GIYA 3MJ8A 3BVNA 1FIGH 4GSDH 5K9OB 3L95A 3MRCB 3M1BB 5IESH 5EN2B 4RGND 5J1SC 5CS7A 4TVPE 2J1KA 4JB9L 4XXDA 3MR9B 4M43L 5JNYB 1YJDC 5GRXG 4UTAL 3QRGL 4LHQB 2FZ3B 3IXAB 1K2DA 1JGDA 5CEXA 4OZ4A 3TN0C 2EXWD 1DBJL 3QR2A 3KPRE 3WIHL 1MCRA 3CVIL 2P8PA 4X4XA 5I6XC 5I17A 2A9ML 2Y72A 5I16A 1NGWB 4ODTH 4EUPA 5DUPL 2IANA 5GGUB 5EFIA 4I0PB 3R1GL 2W38A 3H3KA 4G42A 4O02H 4OFVA 4I0KA 3BX7C 3KPSE 1IAKA 3A6CH 3O4OB 3GKWH 4C4KO 2YWZA 4JVUA 2ID5A 1S9WB 1KXQE 3AFLA 4MCYA 4HIHA 1FFPB 3BZ4B 1MHPL 3TFKC 1AKJD 2HVJA 1OF2A 1IM3A 3PJSB 1MCDA 3KR3L 3O2VL 4ZYKA 3V7MA 5ACZB 1WT5A 2R1YA 5M95B 1L4IA 2UVEA 2OZ4A 3RX7A 3GJFA 3GGWB 1PKOA 4L4VB 4JKPL 3O4LB 2X1XR 1TCRB 4F57H 2J6EA 4P57A 3V6FA 1B2WH 4EUPB 4URTB 4PRPE 4XNQA 4YDLB 1QLFB 3RWEA 1T21B 5BW7C 4JPWH 2YK1L 3VGAB 4WFEE 1T1WA 4CW1B 4KRMB 3IS0X 1T1XA 5TE7H 4Q0XH 1MI5E 4A6YH 1UACH 3IDYC 1ZKAA 4ODSH 3WDJA 1GOHA 1JTTA 1UT9A 1KF9B 1J9CT 4PRPB 2DMCA 5C09A 4FQIH 4I3RL 3WFCL 4ODVL 2EE9A 1ND0A 4Z0XA 3RHWF 1U3HA 2Q76A 4GXUM 4W81A 1F3JB 1JPGA 1XAUA 4NQEE 4JRXB 4JRYD 5FHBL 3WLWC 4POZC 3PGDA 1PY4A 1BBDL 1VPOH 5JOPD 1Z3GH 3QIUC 3G6DL 3IDYB 2DKSA 2R69H 5B8CA 3P77B 2Q6WB 2JF1A 4NWTH 1G9EA 2Q3AA 3WIHH 2DLIA 4HJGA 3GBNH 2EDYA 2G75B 3HNSH 4YDIH 3LD8C 5F71A 5EBMA 5EU6B 5ADOH 1UXWA 4LHUG 4PP2A 2Q8BL 1NCWH 3SDYH 1FVEA 4AG4L 1QSFA 2VLME 3QUZD 1QFWI 1YN6A 2QR0B 5I1AA 3L3IA 1YYML 4XWGL 3UTZA 4M48L 3WE6B 1JCKA 2GSIA 1MJ7L 4QHMA 1G7LA 2FO4A 4XI5C 3BP4A 1F6AB 1T6VN 4J3VA 1M4KA 2YUWA 2QSTA 4U33A 3G08A 3L3GA 4EKXA 5L0QC 3HC3H 2PXYD 3KYKL 4HUVA 3TJEL 3RZWA 3PXHA 2WNGA 1A7RL 5DJXA 5J1AB 5CD3B 3OXRA 4WO4C 3QDMB 1SY6H 3FT3B 3VXNA 3BKML 1EO5A 3MTRA 2OQJA 2OK0H 4XBEH 3D39A 1D9KB 3C09C 3I6LE 1OAQH 2HG5B 1NBYA 2FHFA 4K7PL 5IJKC 4P59H 4OFYD 4L4TE 4PJHA 1E6JH 5DUMH 2VQ1A 2NPLX 2YRLA 2R0KL 1OLLA 5HY9B 2GYSA 4F2MA 2G5BB 1OSZB 2GTZB 4FTVE 4Q9CA 5F7MC 2BSSB 3BO8B 2NY3C 4PJCB 3CMGA 2F5AL 2ZUXA 4X7DC 3SJVD 3MLZH 1Q9OB 1KUMA 2CJUL 2GSGA 3W0WD 4ETQB 1A6VH 4XP1L 1F4YL 4ODWB 2RFXA 3L3KA 3QYCA 1G7LB 3RWJB 3U0PA 1T66D 1XF2A 2HT2D 3VFVB 4Z7NE 4WW2F 3TH4T 2VE6A 3ULVH 3OXSA 1NEZB 4RMQA 4YE4L 1UXSA 5ESQB 5CEZL 4EOWL 3UO1H 5I8CA 3QIBA 4FXKB 1BEYL 5GS2D 4MD0B 2BHYA 1HN1A 3E8UH 5HYJE 2EZ0C 2EKSA 4M48H 4Y1AE 5KSUB 1EBPA 2ZCHH 4GBXB 1LO3L 3DHJA 4Y0GA 1SEQH 1RIUH 2PN5A 1Q0YH 4K7PH 1IEAA 1DUYB 5HVHC 4CN4A 1N3NB 4WI4A 1J1XL 3DVNA 5B21A 5AG9A 3VFTB 3GMNA 1XR9B 3QDGA 5CAYB 5TDNA 5GRJL 3PGDB 3RP1A 1LNUB 5BW7A 5B39G 1B90A 1MIEH 2FL5A 1ZSDB 2NY5L 3U30C 4JAMB 1RUQH 1Y18A 1RUAL 4UT9L 3B2VH 5DC4B 5F7KC 5CGMA 1E27A 1F11A 3KHOA 2BC4B 2Y4SA 7FABL 2VZOA 5T33H 4NKIH 1KB5A 4LHUB 1N0XL 2D7MA 3BI9X 1EJ6A 4NFCA 3GMQB 5GSRA 5A40E 4FQHA 3LKPA 3IF1A 3GI8H 1Y0LA 3X3GH 5EO1B 2Q7YA 4ZXBB 4MLIA 2C4XA 3WDHA 5IBUG 5DEFA 1RVFL 4ZO7A 2X4SB 2X42A 1CBVH 5IW6B 4TSBL 1JFQH 2HKFH 3JWNC 4K94L 4PJXE 4KGJA 4AEEA 3GBML 4HKJB 1WIUA 4DUWA 5D7IF 3QG6A 4IRZL 4X4YA 2LABA 5J6HA 4HLZH 1ZHLA 2BCKA 3T4AA 3W81A 4BZYA 5J12C 3DYPA 5I1CL 3MO1A 3FJTA 3HPLB 5ENWB 4WY7H 4M6NH 4YHPA 5J0BA 4XP9H 1K85A 4NBZB 4NQXB 5C0AD 5JIPA 4ZFZA 3S3JA 3B2VL 1QTYT 3MLTB 5L2KA 5D72L 3SOBL 2X70B 5HHMD 2W9EL 4Z7QE 4RMUA 2CMRH 1P7QB 4YQXL 1SJEB 4YX2H 5TQ0L 3QDMD 3HNVL 1Q0XL 2EH7H 2R0WH 3VXME 4Y19D 2W65B 5CUSH 1MVUA 1AY1L 4R4ND 5FGBA 1RHHA 1P4BH 4FTVD 3T77A 3U2SA 2VE6B 3DO3A 2YHGA 1V7NL 3CX5K 1J1PL 3WS3B 1TQCC 4KDTC 3ARFD 4GLRH 3WDIA 3T3PE 5HHXL 2MMXA 4OZHE 1PAMA 3U7YL 2C4FT 3H7BA 3C60A 5JTWA 4JVWA 5KVEH 4KKBC 3QCUH 1XFPA 3BD3A 2GSGB 2ICES 2W60B 5ICYB 2DQUL 2MQCA 4OIBA 2A0LC 2YPVL 1JGLL 3OZ9L 4PRDB 2PCPA 4M61A 2BERA 4XNXL 4GQ9L 4WW1B 2QHRL 4RWYL 4PFEA 1A9EB 2YD4A 1NAMB 4RNRA 1KXVC 1URLA 3LB6C 3MQIA 4JHWH 4CMHC 3NIGF 4X5XB 3V4UL 2VTFA 3SGKA 1R3JB 5IR1B 5BZWB 4N0UA 2K3TA 5FO7A 2CRMA 4JR9L 4OCLC 2B4CH 4HKXB 5LBSL 2XYCA 3DMMA 3MSPA 5FKPB 1W72B 2KQNA 1LO0L 1RZGA 2YD6A 2CUMA 4PJEE 1S7UA 1WFOA 3ZTNL 1LE5B 3EYVA 4Q9RL 4BZ1L 5I66A 3N1PC 1KIPB 1UJ3C 5FYKE 2BXYA 4K8RC 5L88H 5DFWH 3SHSA 3FB8A 1T2QH 1G9NC 4XAKD 4YFLI 4MA3A 1JWUA 4OV6F 5E6IB 3EDFA 1WLHA 3D3VD 5TQ0H 1Q0XH 2O5YH 1JI2A 4F9LC 4GG6B 4WI7A 3QUXC 1JK8B 3U4EB 1KTDA 4YHYB 1I8LC 3UBXA 1CD9B 3EOAA 1QFUL 4WU7B 3MJ6A 1UWXH 1JZ4A 3LPGA 3GM8A 4NQDA 4FG6D 5E6IC 2YRPA 3AU1B 4IMLA 1PSKH 1RU9L 5FCUH 3RWFA 2GHWB 3A67H 4DGYL 5IKCA 1CLOL 1YEEL 2ZG3A 2YPKA 4Z7VE 3VXSB 5FB8A 4BA8A 1X9QA 4DOHE 3EJZD 1NSNH 3LKNA 2RCSL 5JOFB 4UIMA 1QYGL 1B0RB 3C8HA 4CRPA 2C3VB 2EEAA 2XZCH 4NCC2 4Z7WA 2YD1A 1AQKH 3S88H 1MRCH 3PWLA 4PIRF 1SBSH 4X6DF 5DMKA 4GG6A 2NW2B 1U0QA 2DQGH 4OIIL 4Z78B 2F74A 1DN0A 3ABZA 3L7FB 2XY2A 3IJSA 2OYPA 4KVCH 4LSUL 4NGHL 1L6XA 3WNOA 2ZWLT 1NBVL 1IQDA 5K9KB 1TVBA 2EICA 2VKWA 2XTJB 3LOWA 1QKZL 1S9VB 3KYAA 4HXAL 4JDZB 3VD3A 3DJ9A 1T1XB 3OF6A 4P2YA 4Z6AT 5HYQB 1BVKA 2YKLH 3T65B 1NBYB 1UENA 3W39A 1CZ8H 1DLFL 4QXUL 2FH6A 1OAKH 1NFDB 5HTSA 4FQIL 2HA1A 4KXZH 4Y4KD 4PJGA 2AJSH 3ARGD 2Y36L 1AO7B 4QOKE 4UQ3B 5E2WL 4Z7WF 4HIEA 1A22B 1RZ7H 3WXVL 3BPLC 4WEBL 2DIAA 1RZFH 3PF2A 1X4ZA 5GGTL 4PJ9A 1JJUA 3EO1A 4GW1A 3T2NH 3MRQA 3ARFA 3QUYD 5B39A 4ZUWA 1WFTA 5JPMA 1A3RH 1NDMA 4MYWB 4FQCH 3QO1A 1EJOH 3RVTC 2AJ3B 4PBXA 3VJ6B 5JA8B 3NAAH 4JG1H 4NNYA 4D9LH 3BDYL 5IJVA 3RPKA 4Y4FC 2ZKHL 5E1AA 1F3RB 3BP7B 4PV9A 4R4NC 4QCIA 3RU8L 2YD8A 3IDMB 2NY2B 5KSVA 4L3EE 1H8OA 1ROWA 4PS4H 2H3NB 2BVQB 1WIOA 4OSUL 5C0AB 5D5ME 5GRWA 3RIAK 1S5HB 3AREC 4NQDB 3VD5A 1GOFA 2VC2H 5IMOA 1MCFA 4KH2A 4YHNB 3GSNL 1UB6A 1FZJB 4FQXD 4R9HA 3FO2B 3VW3L 4KY1L 1EFXA 3C5ZD 4BUGA 5D6DA 1JI1A 5DI8A 2CLVB 3IFPB 3N1QC 1XT5A 5JHDA 3LMJH 3VGBA 4PLNC 4LVNB 2A74A 1I1AD 4OM0H 3AREB 4MAYC 3V4PH 3S96A 4Y2DC 4NHCH 4UDUB 5IEHA 3GSWA 5F6HJ 1CT8B 3DARA 5DGRA 1ES0B 1MI5D 5HHPB 5KSBB 2D7PA 3KPSA 2BNQE 1ZGLA 3JTTB 4HZLA 3EOBA 4G6FB 3HMWH 5DTFB 3H9ZA 3WKMH 1NGWA 1HHHA 5E6ZA 4LF3A 5GS0L 3Q5YA 4H8WH 1JK8A 3CVHL 4GRWF 3UXFA 4MNHA 1S9WA 1MREL 4L9LC 5SX5H 4IIQA 1NCUA 4X6FA 1H5BC 2BDNL 3HE7C 2C7UB 3QDHA 1B0WA 3ARGC 3PGFH 5C0BA 4OF5A 1KTRL 4M02A 3QUXD 1TQCB 1UZ8A 1JTOA 5AYUH 1TVHB 1D5MA 3M17A 4XCYB 5KSAC 4JDTH 1OAZL 2ICEA 4FXGB 4EBQL 4O4YL 4ELKB 4M4RA 1R0AH 4NQUA 3MJ8B 2ARJQ 2CUIA 3V0WL 2ADGA 3IXAA 1MHEA 2VDPH 4XPHH 3QCTL 5CSZB 2VLLB 3MZTA 1TCMA 2O93L 5EWIL 5C0CA 3ZHDA 2VITB 3VRIB 2ZCKH 2HMIC 2APWA 4F80A 2NZ9C 3MCG1 1YUHA 1KC5H 5FK9A 1KGCD 4NKOB 3CSYA 5JORB 1FFPA 3BZ4A 2Y23A 5HDBE 1FNEB 2R56L 1V05A 3SE4C 4Y16B 4X6CA 5IGXL 1YN7B 4XBGB 1XF2B 5C86A 3TN0B 1EZVX 1OP5K 1FO0A 3OAUH 1JPSL 5E5MB 2E8YA 3X14B 4KI1A 5FV2A 4X4XB 2UWEA 2NNAB 5F96H 3IU4H 3WNPA 3CMOH 1YMHA 4PJ7F 1S9XA 2CDGB 1WFUA 1O7SA 3LZFH 3LN4B 5FUZL 5I76A 1AP2A 3FB5A 2VIRB 1ZOXA 1U91B 2DQFB 3JTSA 5C9KA 5EU6D 4OZIF 5D72H 2HKHL 4S1SH 1OAQL 4GKSB 2WLYA 2ZUQB 4ZNEE 1OT2A 4HG4K 5T1KD 4DUVA 1OP9A 4G5ZH 4R90L 1G7PB 4YHYC 5TDNB 3OKEB 1BWWA 1MHHA 4U7MA 4B41A 2DF3A 3BIAX 4MXQD 1SBBA 2JB6A 4J3TA 4OCMC 1K3ZA 5DJDA 4BZ2H 3PWVB 3K1KC 4HKBB 5CEZE 1MCNA 3RPIA 4IRSC 4DKEH 5C08E 4RGMC 3H42L 1KEMH 1HINH 3F7RA 2G2RB 1AO7D 2PW2B 1KV3A 1YJDH 1U8QB 5I1IL 2CDEA 5LXGL 1WZKA 4IOIB 4Y4FD 2FWOA 3IDGB 4I18C 2BY3A 3MUHL 4KK6C 5ANMB 3GUTA 4UILH 1INQA 3FZUC 4NO0B 3QIUB 1T03H 4MWFB 2CO6B 1MOEA 3KLAB 3UO1L 1L7TL 3IFLL 3TN0D 2E7BA 1AKJA 4XMPH 3MBEA 3DHMA 3AY4A 3S5LA 4U1KB 4EIZC 2CPCA 4L3CB 3WXWH 1FNAA 1BJMA 3BO8A 3EHBD 3SCMA 4QNPF 3GMLA 1F58L 3CFEA 1OARL 5C6TH 4TOYH 5EBLB 2X40A 3MV9D 2QKIA 3OAZK 2XKUA 4PREB 1MLBA 2P5WD 4YZFE 2UZIH 5A2FA 1FFQA 1FBIL 3AS2A 3WN5A 2E9JA 5IB1A 4ALAL 2J4WH 3MLVL 1WC7B 3KVQA 3ALWA 5F7WC 4MD5A 4Z9KB 4R8WL 4ZUTB 2IWGA 5TPWH 2EDHA 4JFED 3BQUA 2YBRA 4YK4B 4F7EA 4K23L 5DD0H 3O8XC 5I18L 3L5JA 3TJHD 4FQ1H 4HBQA 1G6RH 3TO2B 4HUVB 35C8L 3O45B 5H37G 2C26A 2UWEB 3ZKQD 3KPTA 3THMH 3FKUS 2DLFL 5CMAB 2V9QA 3MRFB 1LO2L 2YOCA 4M1DL 4WHYH 1OAXH 4N8CL 1IM9D 3SCMB 2VUYA 3BN9C 2VR9A 1T1YA 5I73C 1OCWH 3TEUA 1BVZA 5ALBL 4J6RL 3REWB 3VWJB 2EDTA 2HT4C 1EBAA 3PE9A 2CKNA 3MUJA 2F15A 3JSSA 1JPFA 3B9EA 3GBMH 2DOCA 5ISZB 4IRSD 5D6CB 2D31A 1CLYH 3MRFA 2NTFB 2HFFA 1YEIH 3TFKD 3BKYL 1KN4H 3TZVB 2F19H 5C7XH 4P49A 5I1JH 2WBJB 4NWTL 3MC0A 4U4BA 2JIXA 4H25B 1FNFA 3PWPB 5CEXB 2VR4A 1CFNA 3MRIB 3FQNB 1JYVA 2C1OA 3KPOB 4TNWF 1LK2A 4X5WB 1II4E 1ZHBA 3KPQB 3L1OL 2KBGA 4LCWB 1A7NL 4RFEA 3LN4A 3VI3F 5I76B 3BGMA 5E00A 1YYMH 1JN6B 2CMRL 5DJZA 3OB8A 4UB0H 3GMRA 1A5FL 2Y7QA 1CL7L 1DBJH 4HS6B 4NQED 5JIIA 1LO5A 4P23A 4J3SA 3SKUD 2QKIB 4UDUA 4YBLC 4IRJA 2V7HB 5IWLC 4GQ9H 1YQVH 3DBXA 3K8KA 4M00A 5D96B 2DB8A 2QSVA 4AQ1B 4KKCC 2FH8A 4RIRB 4JRXE 4NQEB 3MBEB 3OG6B 3BN3B 3QIUD 5F88A 3QQ4B 3HR6A 1H3WM 4LSTL 5TQ2L 3IS1X 4GW5A 2I9TB 3HS0A 3CCHB 3GSRA 2H6PB 5F8QC 5KG9B 3OKYA 1XH3B 3MUGB 4ZFZB 3MROA 5I8OL 3O6ML 4NQVA 4U1NB 4WUKH 5D7SL 4LKXB 1JRHI 2XNAA 1T22B 3CZFA 1IGMH 4E5XA 1XGTA 4Y8DC 4M1CD 2VLRA 4JO2L 4WFFD 3P11H 1XGPB 4KTEH 3TH2T 3U7WL 5I71C 2YK1H 4GW4A 4S2SB 5KVEL 3RFZC 4MS8D 2EDFA 3UYRH 4OI9A 1CG9A 3SE8L 1PX3A 5C0GA 1V3MA 4LCYA 2Y9RT 1HHJA 5HHVH 1DTUA 4DW2H 2ZSVA 3SGJC 4P9HL 4YXKH 4DVBA 4NCC1 5DVMA 5DTFA 1TCRA 2CD0A 4Q6IB 4RZCA 5C0BB 1D7FA 5D2LA 3WLBB 2NY3B 3KPSB 5J89A 1YNKL 2NW3B 3ALXA 5KSVB 3L3HB 1YECH 1HKLL 2BVPA 2AGJL 4LOUC 2Y25A 4LGRB 2D0GA 1LMKA 3BEVB 4TNVK 4LBEB 4OIIH 3ZYOA 3X11A 5I1LA 1KBGL 3TBWA 5I71B 4LCCA 3MUGA 1NCCH 2P47B 1JP5A 1PSKL 5FOBB 4LPVA 1IL1B 2NX5A 1S7SA 4GMSH 2ICWI 3B3IA 5EOTA 2V5SA 1OPGL 5EUKA 2ERJC 4D3CL 5F6HI 3ULUE 1S9VA 5I1HL 4FXLA 3SDCB 2ARJB 3ZTJH 4OLUL 1CG9B 4RFOH 4HIIA 5LQBL 2DQGL 2VAJA 1KIRA 4JFXB 1WBXA 3JUYA 4JFFE 4YNYA 1IC5L 2V17H 1LK3L 1VFOA 3P4MB 5ERWA 2X44D 4PG9A 4XPTL 5C0IA 2BMKA 3IJSB 4PJGB 5ALCL 3FO2A 2PF6A 2Z8RA 4JY6B 4DGIL 4ZFFB 2R2HB 3C5JB 4TSBH 4Z78A 4GKZB 4P46B 3LQMA 1QRNB 5DJZB 1U8KA 4G8IB 1MF2L 3BXNA 3DX8B 2YWYA 1ZVSA 5H2BB 1VFAA 1MQ8A 4LMQE 4DN3L 4GRLA 3GRWL 3PGCB 4P5KA 1U3HD 4JLRB 2DQHH 1Q72H 2EDWA 4WY7L 3RAJH 4J7RA 2X9XA 4YLQT 1YMMB 5JDSA 2EDDA 3W11D 4R2GD 5E8NB 4JM2C 5J57B 1BQLH 1JF1A 3PNWA 1Z9SA 1YNKH 4H5SA 1NBZA 3TNMB 1S3KL 1YEFL 4PJ8C 2VLJD 4M7KH 4WW2C 4MA3B 4UIMB 1D9KA 5I1HH 3D85D 4LSSH 3LN5B 4Z76B 1NBQA 4YQXH 2JJSA 2XWJA 1AGBA 5DQ9A 1CGSH 3ARFB 4NQTA 1TJGH 3DGGB 4QXUH 4G6JL 1HOCA 2BVOA 1BFOB 5T1DL 1R3HB 5IIEB 2E5EA 4OZGE 2H45A 1FGVL 4H1LA 3TT1H 3F7YA 1V5JA 3BUYB 3MLPA 1ZAGA 2Z35B 2CKBH 5DJDB 15C8H 1T7WA 4TPRH 2A6DA 2FO4B 2IG2L 2R2EB 4CDGC 1FHGA 3ARWA 1JWUB 5E6IA 4BQCA 3T0VA 4ODSL 3UTOA 3VGDA 3AAZA 4PJFA 2AXJA 3L7FA 5D7IE 3RUGF 3T65A 1A6UH 2PO6A 5DK3A 1KCSL 5FM8A 4KKCD 5HI5D 1OTSC 4NZUL 1MRDH 4JANB 1X6LA 3EFDL 4LIQL 4OGAD 1VFBB 4NNPH 1IGJB 1MRFL 5HHME 3VXRD 5EZLB 4R26L 3U6RA 1S7SB 2FHCA 3DO7B 3UMTA 4G8GB 5HPMB 2E7HA 5L8LB 2CK0L 1KEML 3TBWB 4WWKB 1DJSA 1J8KA 1NQBA 3X14A 4MX7B 3WFZA 3FQUA 4NKMA 5H94B 1AHWB 1UM4L 2XTJE 1EAJA 3O41A 1R3KA 4CU7A 4G9FB 3HI5L 5EU4A 4RDQG 2VLJA 3U2SB 2ZG1A 4P2QB 1TQBB 2J8UB 5E8EB 3OHXB 4G8FB 4YHLL 5ID1A 3DX9A 5CMAA 4E41A 3HRZB 4HPYH 3C2AH 4U3HA 1TZIB 2APVA 4FQPA 4NC1C 2YUZA 3O3EA 4LVOB 4JDZA 5INDA 5SX5K 3VMNA 4CNIB 5MP6L 2F58L 4DZ8B 1HEZA 4LEOB 3BFOA 2VB5A 1HQRB 2E6JA 4UAOC 5TPWL 1G7QB 3UTSD 3Q3GA 1Q94B 4LVHB 4NQXA 4KAQH 4XNYH 4JVPA 4GRWH 5BV7C 5B22A 4BUHA 4Y5XB 3UJJH 2VYRE 3OAYK 5IWLA 5J8OA 2P8MA 5GHWL 3K2UL 3FOMA 3DWTA 3QBTB 4LLWA 3SDXB 4P23C 4HIHB 1SHMA 1YY9C 2GFBB 2FJGB 4XBPA 5EBLA 4YDVA 3UJIH 1X5IA 1JMZA 2XWJB 5C0CE 5HHOB 2GJ6B 3JV4A 5I18H 1ZLWH 2X4SA 5KJRL 4HHAB 1NFKA 1KG0B 1RJYA 4JEGB 1XCQB 4JHAH 4NN6C 5IESL 4EI6A 4H5SB 3MBXL 3RWCA 2V9RA 1ZGLB 4TN9A 1A6ZA 2WINB 4PJAB 1DEEB 1FG2A 1X5JA 1X6NA 5F89B 1CE6B 4JN2A 1QRKA 5F44A 4NN6B 4N8CH 2YD2A 5FHAL 3GM0A 1LEGA 2A74B 2EIZB 1UEYA 3IAPA 2YZ8A 2BOBA 4WU5A 1U8PB 4U3XA 3NPSC 2AK4A 4EDWH 2NY4D 3O2DH 4UIKH 4ZOEA 3V9FA 5BRZE 3F6LA 4J6RH 3TJEH 1ORQB 4PG2C 4KTDL 4OD1H 2X4OB 2OXHA 2G9HB 3C8KA 3NVQA 1OP3H 4PJAE 2XRAL 4HFUH 1AFVL 4ZNEA 5SX4I 1IFHH 4PB0H 5DA4A 3SDXA 4CVWA 4LK4A 1U3JA 1K4CA 3BWAB 3QXVA 5FYJL 1SMOA 3LV3A 4JHZA 3SPVB 8FABB 4G6AD 5IMLA 3MOAH 4XHJC 5SX4H 3LIZL 3OHXA 1MAMH 5C0CB 4OFPA 3VXRE 1NEZA 2AP2A 2HFTA 2DI9A 4APQD 3BQUD 1P5VA 3MA7A 4QHLB 3K2UH 4S1RL 5LGHH 4LFHG 2ZKHH 3NPZB 4XMPL 4JPWL 2ICEB 1EXUB 4FXGA 1EHLH 5ETUB 3VRJB 2WQRA 5IHZB 2P44B 1KJVA 4E0RA 1IGIH 2V2WA 5B4MD 1INEL 5CIPB 2W0FA 4LLMB 4G8FA 3KPQA 4AK1A 4NM4L 2VLJB 2VL5A 4Q6IA 2FGWL 3O6FD 3R06B 2W60A 2RR3A 4K3EL 1NFIB 3EFFA 4OZIA 3MRHB 2BXZA 3L5HA 4XXCC 4ZPVA 3FN3A 4LHUA 2HT3D 1IZKA 4YDVB 2FECL 1G7QA 3V5DA 3HAEH 3W39B 1WICA 1U8HB 1SVZA 4ETYA 2NXYC 5ACLA 3ULVD 3QHZL 4F58H 2EKSB 5KSUA 2J12B 2ZOKA 4XAWH 1T22A 2FX8L 4V1DE 3P0YL 2GQHA 5DHYA 1FZKB 4KROC 2DQDH 3FB7B 1T0MA 3OL2A 3DVNB 4HIJB 2WWKO 2H6PA 1GPOL 5J12B 3ZHLA 1HIML 4QWWC 5C6TL 4OT1L 4U6TA 3BZEA 4B0MM 1Y0LB 4HS3A 4TUOA 2ED9A 2GITB 5CWSB 5CD5D 2OBGA 5IBUB 2IPKA 4IJ3B 4FFYH 4RAVB 5F7DB 5D1XA 1G1YA 3ZYJA 1MJ7H 3BP7A 5E2UH 3SDAB 3MCKB 3UTTE 3GZKA 4HGWA 4OCSL 5MENE 5ANMA 1K9TA 4ZS7L 2NZ9D 5MERA 5EUOA 1MHCB 2FWOB 3QUML 3EYQC 2VZ1A 3K2MC 4HC1A 4BKLB 2ZCLH 3RTQC 1SJHA 5DD3L 3NZ8A 1XR9A 1KG0A 3QIWC 3NACH 5E5RB 3DNKA 2XN9A 3MRPA 4U6VH 1GRWA 3T0XA 2VOTA 5FF6B 1SY6L 4RX4D 2IGFL 5HI3C 4JJ5B 3HUJB 4JM4H 2VISA 1Z9LA 3LS5L 5ESVA 3DX7A 1LO2H 3GFUA 2HTKD 4CW1A 3BXNB 1S5HA 4JFQA 5I1JL 1CR9L 2NCMA 1I1AA 5BV7B 2VLRD 2ICWJ 3D2UA 4MD4A 4QHNA 3U4BH 1FGNH 2BVQA 1UA6L 1BX2B 3BESR 8CGTA 1I3RB 3O4LA 1ND0B 4PB9H 3BPLB 4YHOH 5J13B 3QIUA 1INDL 3VFVA 3DV4B 5ERWB 5DVNA 2OJZL 5TJWK 3GMMA 3DUUB 4H1LB 2R1YB 5IJVB 4M1GH 1VGKB 4R7NA 4MNGA 5HPMA 3K4DA 4U6YB 1CL7I 5BOZG 1FC1A 4GXVH 2Y6SC 4FFZL 4I3GA 4QLRA 1NDMB 4RRPA 4HWEH 3PHQA 4S0TD 5GZOC 2PO6C 1RIHH 1T21A 2Q1EA 1ZE3C 2DTSA 1KCUL 3VWKC 3NCEB 1K8IB 1C08A 4HJ0C 3WE6A 3WHE1 4JANA 4DN4L 1HH9B 4TUKL 3ULVC 3ARSA 4Z0BH 2WP3O 2I07B 1BQLL 1EX0A 2WUCL 1FNGA 2IH1A 4PP2B 4M7LL 3RZCD 3ECBA 3QJFB 4JRXA 1JPGB 1RJLA 1QSED 1K2DB 4W70A 4LPWA 5E9DA 4UBDC 2BSRB 1FH5L 2R9HC 4TPRL 2BY0A 3TT3H 3MNWB 2DQJL 4ZG1A 2OP4H 1DN2A 3KYNA 2KDGA 1UWXK 1ADQL 2RGSA 1LP9F 1HXMA 5C09B 2DICA 1JHKH 2IANB 4FMKA 5GGUA 2CIKA 4GRMB 4NCDA 3GDBA 4JREB 3X13B 4PJ9C 3MV8D 2BVOB 2NNAA 1XMWA 4HQQH 1UH2A 4HWNA 5DFTA 1EGJL 5J9PA 1T1ZB 2N7BA 3BKCL 1HI6A 1NGYB 2VXUH 4N9OB 3P2TA 3GIZL 2FX7L 1KPUB 3LS5H 6FABL 5BS0A 4GRWB 3E2HB 1VKXA 3DVIA 3QPQC 1CXEA 2A6DB 2R2EA 2OQJB 4DKFH 3W9DB 5I1AB 4P2RE 1NLBH 3HC4L 4HWEL 1NLDL 2X4UA 4K3DL 1FNEA 3O6FC 4Z7WB 4D0DB 2WBKA 1H0DA 2OR8A 1RZ8B 4YHZH 4YHMH 4LP5A 5B38B 3QIWD 1NCCL 3GI9L 4DK6A 5K9OA 2Q86A 3RWEB 4HULB 1WF5A 5K59F 4Y4KA 4GSDL 4CVZA 2BRRH 1PQZA 1M7IA 4BFBD 4XCFL 1MUJA 4IMLB 4MA8L 2Z8WC 3V0VA 4Z95H 4BELD 1GGBH 4HK3N 1AE6H 3LKQA 5MEOB 3IRZA 4JM2B 2XTLA 4XCYA 4BYHA 3B9KC 1I85C 4N9GA 5E4IA 1D9KD 1GC1C 1YYLH 4PTUB 3WCYA 2LAGB 3FB6B 1KACB 4I0PA 1UYWH 1I7UB 1MCBA 1TNNA 3WNMA 1HI6B 1YPZB 4ORGA 2NXZB 2EE6A 3HC4H 3AXLA 4J1UB 1FRGH 4LARH 4W68A 4YFLF 3MROB 4OLZL 1RFDL 3GB7A 3HN3A 5SWSD 2P5EB 5IFAH 5I1GH 5EO0A 3MLRL 4HFWA 5B3JE 2ATPB 3CFKB 3TYFA 3FT2B 4Y5YC 1CGVA 1EGJH 5KJRH 4LBEA 2P8LB 5DK0B 4E5XB 2XA3A 3RIAF 2EDKA 4NC2B 3WFBH 1MCKA 1G84A 4CVUA 2PR4H 4PJXF 3RUGB 4JFEE 1TENA 2P5WB 2IQAB 2R39A 2R9HD 4ZUSA 1RPQA 3HS0B 4LRNL 1HDMB 1O0VA 4MMXC 4UI2A 1PKQE 1FL3A 2E6PA 4Y4HA 3MRQB 3PWPE 3KWWB 3GJFB 1K5NA 3T0ED 3SGKC 1MWAH 4KFZC 4O2CB 2AKRA 3ZDYF 5IVZA 5IMOB 2JIXD 4TRPH 2D9CA 5B3JF 1SJXA 1ZEAL 3VCLB 5D7JA 3L3HA 3PWNB 4AH2B 1IAKB 2KQMA 1FV1A 2AJZB 5C3TA 4LLAA 3G6DH 1BJ8A 2DD8H 2LU3A 3WFHB 4PRHB 1IAMA 3PP3H 2LQRA 2BHZA 4PJDB 3EKCA 3HPJA 1UG9A 2AJXL 1I3VA 4PJ7E 4FMFA 5T3XE 3OJVC 2CRZA 1YYLL 2ESVE 4ZXBA 2HFEA 4BSWB 3ARYA 4NRXA 1T3FA 1JGEA 4PGZA 4WFHE 5CKAA 4IRJC 3UJTL 2VDNH 1N2RA 3UC0L 4PJFE 1OWWA 3EO1B 4GW1B 4F33B 4PJ9B 4IDLA 1RURH 3V6OE 2P7TA 3SKOA 2WBJA 3VFOB 1UM4H 3M8OH 1SBSL 1JWSB 2D0HA 3CXHJ 5HYSG 1I1RA 2Z9TA 4LP4A 3EFDH 3RWDA 2EXYD 3VFPA 2ED8A 5E8DL 4M7ZC 2Z8VC 3HI1B 1RZKC 3Q6FA 1UJ3A 4XNMA 1FZMB 3LPWA 5D1QD 1PQZB 2A6IA 2WZPD 4MXVE 5E0QA 1IVLA 1N59A 4G43B 5L7XH 2M1KA 3HZMB 3O3EB 4D0BA 3MJ9L 3T0EA 2JJUA 4LRNH 3UYRL 1TFHA 12E8L 1F45A 5DQJB 2DL9A 4X99A 4D0DA 1MCHA 2IJ0C 2AJXH 3QZWA 4JDVA 3PDGA 1RK1A 2VDPL 3PHOA 1I75A 4G9FA 3AM8A 2WUBH 4E41E 3IU4L 2OI9B 5KANG 4DAGH 4H20L 1PVHA 4ODTL 4LOUD 2XQBH 1KB9K 4RRPG 3T0DA 4AIZA 3D48R 4EQ2A 3PL6A 1QFHA 3LEXB 5EIIA 3UAJC 1YNTB 1A3LL 1XR8A 3RWIB 1XIWC 2D31B 5D6CA 3U6RB 4PBWD 5MI0B 3U46B 5FKPA 3MLWH 3M8OL 2FJFA 1QQDB 1CICC 4G9DB 4KHTL 1R3LB 3FN0L 3TA3B 1SMAA 1E4WL 3C60C 1OTUD 3BZEB 3NZ8B 2B5IC 4D9LL 3TZVC 3B5TA 3EOAB 1NCDL 5F7NC 4H8WC 2HRPH 5LCVH 3RGVC 2R1WA 3RJQB 2OTPA 1U8OB 1M71B 3OKLB 1I85A 1KB5L 3B9KA 5JHLH 5D1XB 3DSNA 3ZHKA 4APQB 1FL5B 1NJ9A 3PJSA 4OTXH 4EUPG 1KFAH 4DZBA 1LE5A 1J1XH 1Z5LA 4HV8A 4JFDD 4PJDE 1HHGA 3NACL 4GFTB 2PTTB 1C12B 4L9DA 1S9KC 3BDYH 4P2OA 3NZHL 4QTHA 2OXGA 1N2RB 5FA4B 1W72A 1B2WL 5J6GB 3PWVA 1YN7A 4IRJD 2BVUA 4JY4B 4L29A 1JGUL 4PGDA 1GGCL 5I1KL 5C8JB 3ARGB 1JWSA 5BS0D 3X17A 5TH2B 4WWKC 1UC6A 1J0IA 4TOYL 5E7FA 4LLVA 4R2GC 4XHQA 3WLWD 4JFQB 2AK4E 4QT5A 1QFWL 5DZOA 3EOTL 4ODVH 2EDXA 3HNSL 4YDIL 1MLBB 3BD5A 4G9DA 3DXAD 4HAGA 1EERB 1F4WL 1QSVA 4WUKL 3S98A 1QP1A 5T5NF 5FHBH 1J0YA 1OB1B 2JTDA 3L3OB 2X4OA 2X2YA 1L7IH 1I7RB 4I0CC 2XZQL 2HRPL 5FYLE 1S3KH 4U1KA 4OCXL 2FEDD 1A6PA 4XP5H 4HH9A 4HMDA 4Y5YB 5I6XB 4NP4H 1LQSR 4ORZC 3VRJA 4PD4K 5EULV 4FFZH 2OSLA 5CBEA 2DIBA 5E5MA 3I6GB 3GMOB 3DVGB 1IGFH 4WO4D 5J3HD 3CLFL 2FBJL 3FN0H 3VXRA 2XXMB 3P4MA 4GAJL 4PV8B 4LVEA 4M3JA 1T83A 1JPTL 1ZWIA 2YUVA 4EDWL 3O2DL 5MHSD 1DEEA 1FG2B 1UCTA 3RWFB 3G5YA 3BJ91 1ACZA 5FDWB 4K94H 5FV1L 1DUZB 1KCRH 2OK0L 2VDQL 1A7PH 3MLXL 4HX1A 3HMXH 3QIWB 4NPYA 1ZVHA 4WCYH 1C1EL 4L4VD 3MV11 4O2FA 2JELH 4RGNB 4I2XE 4JZJC 3QWOA 4MGXA 4Z7UF 4DQOL 3RNQB 1ODAA 3DETC 4MWFA 5KVMC 1KB5B 1E6JL 4V1DD 5FEBA 5FGCE 3GUTB 5JLZA 2Q86B 5I1LB 1N26A 4QXGL 4I5BA 4TSCL 5DRNB 4JM2D 4KZDL 3ZZ1A 3LHPL 1YNLH 3C9NB 5CJXC 5E2TL 1L7IL 3VXQB 3OPZL 1YC8A 3Q2CA 4F37K 4ZODA 4PJ8D 3MACH 2NW3A 3RGVD 3NPSB 2X4NB 4D0CA 3R0NA 5M94B 2ENSA 3GB7B 3VG0L 4OJFL 4ZNCD 5KZCB 2BNRB 2V2XB 5HVHB 5HD8D 3O3DA 1A2YA 3O4OC 2AI0H 5BQ7A 1JPTH 2ZJSH 2EDRA 1FLRH 2AJ3A 4OZHA 1QLFA 5K93A 3P9LA 4V1DA 3UTTD 1AXSB 3V0VB 3M07A 2J7LA 3G5YB 3C08L 1QLRA 5CEYA 5L9DL 2XPGB 1BD2E 4UNUA 1KJ2H 1WBZB 4GAGL 3NIDE 4Y88A 3VXTA 4NP4L 2IALB 4RDQF 4XXDB 1EFQA 5BRZD 3B9AA 3ARXA 5C0DA 2MCG1 1IM3B 1O7VA 5D1QB 1LILA 1KCLA 5HI5C 1K5NB 5FOJA 4KJPC 3H9YA 3MLYH 3VJ6A 4OGAC 4AYFA 1H3XA 2YD5A 3EOBB 2R2BA 1T4KB 3MV9A 3MA7B 3WIFB 1I8IB 5DYOA 2E7MA 1UJTA 1OB1A 3DECA 3UTTA 5JA9A 5IVNA 3OTTA 3T1FA 3RKPA 1F02I 4YHKL 4G6MH 2OL3L 5GS3A 3OGCB 2MPAL 5L8KB 4DQOH 2CIKB 1FRGL 1NANI 1WT5C 4GRMA 4JRXD 4LARL 4Y4HC 4NZTH 1SJEA 4PUBH 3MJGX 5DD3H 2OJEA 4XB8A 2NX5D 4Z7UE 4XB7A 2C5DC 3IFPA 1MCIA 1QSEB 5T5FH 2H3NA 3ZYIA 1U2HA 1BVLB 3U83A 1KT2A 3FFCE 3X12B 5FYLH 1QR4A 3VGGA 4MNQD 5ESAB 5CHNA 1ZA3A 2DQEH 4BK5A 2MSPA 4NFBA 3BIKB 4Z18A 5ITBH 5H8DA 1LP9B 4FOMA 4F7TA 4GXVL 1B0RA 5ESVB 3KLSA 4WFFE 5EOCL 3KLDA 1DBAL 2M8XA 1UA6H 2W0LA 2IMNA 3NA9L 4MLSA 2R4SL 4X9IA 5CJQH 5DT1L 4YDJA 4U6HB 4XNZB 4AEHH 4AQOA 3SJVB 3CZJA 4FRWA 3LN5A 1KTKE 4Z76A 2D03L 3NTCL 4IIQB 4M5YH 4JN1H 4YXKL 4Z7VA 4L4JA 4DEPC 1CGUA 1A14H 1SJHB 4KTDH 3KLHC 5I8EB 3ZSTA 1A8JH 1J0KA 4OZGF 1X5HA 5IW6A 4R7NB 4U2YA 2WMPA 4GAGH 3QUKA 1FL6A 1R24A 1HHHB 1RUKH 3B8SA 1R5WA 5AG8A 5SWSE 3UTPD 4BSVB 4KUCF 4I48A 1Q38A 1RK0A 4UOW1 3B2UC 4KQ3L 4XZUA 1OY3B 1KBGH 1KXTB 3GSWB 4WNQB 3MCLH 3VDAA 1B0GA 4NJAL 3RL1B 1CDHA 4X7FC 4RCAA 1JZ3A 3BKCH 3QT2A 4PJBF 2DLFH 2BX5A 1R5IB 4DOHB 2GUOB 5DA0B 5IR1A 1FNLA 5DMIL 3GSQA 1W8NA 4HLZG 3IDIB 2QR0A 2J8UF 1QOKA 5CZXD 5HGGS 3ARFC 5DT1H 4BKLA 2FJHB 2R0LH 4YEFA 2OL3B 4X99B 2HAZA 3ZDZF 3GKZA 4HC1L 4OCRH 3EJYD 5E56A 3JV6A 1V7NH 4QRTA 4UOJA 2DYPD 4MCZA 1KIUA 3D3VB 4QRPE 3HRZA 5I19H 3BP6A 4LMQI 4X80L 3T8XB 1OT1A 1OGTB 4WI3A 3MPCA 5C07E 1XGRA 1RZ7L 3P0VL 4MVBC 5GRUL 1JZ8A 4D3CH 2F8VA 5EUOB 3T3MF 4XWOC 3CXDH 5TFSL 4ZYKB 2WIIB 3GRWA 1FDLL 3QDJD 4MNQA 4QHUA 3NGBC 3O2VH 4NJ9H 3VXSD 4CJ0A 4XCNB 3EOYG 4CN6A 3NCCB 3MRNA 4C83B 5C0IB 1YMMA 1Z0MA 2KPNA 2ZUWA 3LH2L 1GIGH 5DVLA 3QEQE 3WIFA 1MFEL 3VXUB 5HD8C 4F2MB 5I66B 5JZ7D 3S9DB 5FECA 4UINH 3FO9B 3IDXL 5H2BA 1I9JH 2AQ1A 4Q0XL 3BKYH 1KLFA 3O3AA 2F19L 4F8QA 4EXKA 5C7XL 2Y5TA 4OZ4B 1BD2B 1FQ9C 2BOCA 2DS4A 4NKDB 4QGTA 5T1DH 5LWYH 4HXBH 5EZIH 5JIKA 3IJHB 5E99H 5C09D 4DVRH 4TULL 1F4AA 2AEPL 4OGXL 4XMKL 4Z7UB 2AV7A 1P1ZB 3EYQD 4KY1H 2PUQT 1OQXA 2BNUB 5EN2A 1BJ1H 5IOPB 5I1DA 1IFHL 5B3NA 4HKBA 5I75B 4ZS7H 1PG7H 5L2KB 3IETA 5DQ9B 4DN3H 5I1EL 4I48B 4JFOB 4B5EA 5JR1L 5DS8B 4NJ9L 1WTGT 4IHOB 4LDLB 4M9PA 4HC1H 4OCRL 4PJIE 1MJJA 3KPPA 3LRSA 3O8XD 1X5AA 4NBXB 5JW4M 4IEFB 3RAJL 4FS0A 4P5MB 3JWOH 5D7KE 5D7SH 1MRFH 5FM5M 3K46A 2F53A 3LH2H 2DAVA 5MI0C 1KPRB 4R97C 4LGSB 1VACB 3PIQB 4JFEA 2VL5B 1A7QH 4WDIA 2I24N 4QHLA 1MPAH 2B20A 2J5LB 1WEJL 3B9DA 4D9RD 5J6HB 1KNOA 3GIVA 4NSKB 2L7UA 4P4RA 4GW4B 4ZS6C 1BIIA 1F13A 1FO0L 4GRLB 3OB0K 1FYTB 2OSLB 2FL5B 3GJFK 4O51A 4N0FB 4X6BA 4QRSB 3MRGB 4I5BB 4O5LH 3TBYB 4GLRI 4HKXA 2Q7YB 4LIQH 3HTLX 4P46A 1HE7A 3SKMB 2Q76B 4WUUB 1U3HB 3U0TB 1CICB 5IB2B 3WV0A 1T0MB 4HJ0D 4X5WA 1Y6KR 3O9WA 5E6YA 5JQHC 2JK5A 3P4NA 4HT1L 4MVBD 3UTQA 2FB4L 3MXWH 4YUEH 5BMFH 5CBEB 4GQPH 4U0RB 5C0BD 2CRIA 5HHNB 3ZLQC 1U8HA 4FG6C 5E6ID 2X7LB 1L9NA 3RA7H 3FO1A 5ISZA 4P48A 4K71B 3B2UD 5GHWH 1MUJB 4I0PC 2F54B 3UC0H 1R3JA 1MELA 1WUNT 3ARED 1MCWM 5CLWA 5C3LD 1HCFX 3S34H 4HMCA 3M17B 4WCYL 3KXFA 1NCBH 5ACZA 4OLYL 3BPCA 3EO0A 2R8SH 1T04B 1UVQA 4KZEH 4ZSOB 5HPOA 4LPXA 3VH8A 3CFDA 3D85A 4OLVL 4P3CH 5KW9H 3JWOL 5D1ZB 3BRGC 1I8MB 4DAGL 3F58L 2C1OB 4H20H 3GHBH 3K4ZA 3LKOB 3RWCB 4R97B 3V6ZA 1YNLL 3VW3H 1P7QA 2I5YH 4BSJA 5D7LD 1FYTD 3MZGB 1QEWA 4QRRA 5C0JB 5C0EB 2YXFA 3MMEA 4MXWH 2MNUA 1MFCH 1XGYH 3D39B 4Y16C 1A6TA 4GRLC 4NKIL 1N3NA 4TSAL 5DUBA 4R4FL 4XCEB 2DDQL 3CGTA 1I3GL 1KN2L 2VZVA 4NT6A 3GO1H 2AJYH 3SDDC 1E6OH 3KPOA 1CD1A 5CZVL 2VQ1B 5HHQA 3HNTL 4P4KD 3D5OF 1HSBA 3L6FA 4PRBA 2BNRD 4Y19B 4MQXD 3MRCA 1WVZA 3TZVA 4PRIA 4HW6A 1CU4H 1MWAA 1REIA 2AEWA 4PJFB 5KSAB 4K3JH 1WZ1H 2VWEC 3NABL 2R1WB 4U1SA 3NFNA 4NQSA 2VLKB 4MS8C 4GW5B 2WAHA 1XCTA 1NMCC 1DQDH 5EO9A 3SGDH 2UV3A 1IC1A 2YN5A 2FIKB 5DRZB 4A6YA 4IDJL 1OTTC 1FFNB 2ZPKH 3HAEG 5EBMB 5FDWA 3EGSA 1N59B 1P9MA 4G43A 1KPVA 3OKNB 4LSVL 4RGOL 3DBXB 2R4RL 3MA9H 5ESQA 5DFVD 4D9RE 4WIQA 1NCNA 5DJ2B 2XZAH 4PTTB 3IGAB 3QG6B 1VADA 4FQQA 4LRIC 4MB5A 5GS2H 1RK1B 2ICCA 1Z3GL 2HMID 1FPTL 4PJHB 1P4IH 2A6JB 3OBAA 3VXPA 4MJ2A 1MAJA 2CDEB 5C6WH 4RAUB 4XTRD 3QUZB 2R0KH 5EU6A 3SKNB 3I3BA 4PREA 2A6IB 1IGJA 4WFED 5JQ6H 3U7AA 4G8EA 4U1HA 4UUJA 3U46A 1UKTA 2ZG2A 3RVVC 1E27B 2QQKL 3HG1B 4XNUH 3BW9B 4YHKH 1CFVL 3QIBB 3DI3B 5AZEH 3FQRA 1KTLB 1CDJA 2ZOLB 3MGOA 2A6JA 2AQ3A 4GAJH 1DL7L 1I7ZB 4JZOA 4HIXH 4L8DA 1Y6MR 3CIQA 1OCWL 1H8NA 4I4WB 2VIRA 3JV0A 3OXRB 3N9GL 2DWEB 3L3DB 1KCRL 1MEXL 2DL2A 5SWZB 1LDPL 3RY6A 4ETQA 1OF2B 4JQIL 1JNLH 3OGCA 1Q8MA 5EU5B 1YPZE 4L3CA 5DD5L 5F3HB 1B4JL 1JL8A 5IQ9A 1FVCA 3NA9H 3V5HA 1INEH 5ID0B 2QTEA 3NFNB 5KOMC 5AEAA 1QFWH 2DM2A 4RGMB 1MCWW 3HI6H 2ERJB 2LTQC 1X44A 3K80A 5FAAA 3C5ZA 1QG3A 2EXWC 4KMLB 2VXQH 4BZ2L 4R3SA 2CLZB 1HSBB 1JYWA 1V3KA 2A77L 4ODHL 5GJTL 1T5XB 3KDMB 3G5XA 1X5FA 5DRXB 3Q0HA 3O4LD 5EBGA 4NT6B 2NY1C 3QUMH 4R90H 5DUBB 1VFAB 3X3GL 4DVBB 1DL7H 1AD0A 1CDIA 2OLDA 4WFGD 4R0LB 5I17B 3H9SE 1OD9A 4TSCH 3HZYA 2EIBA 2XY1A 1A2YB 4M93C 3MBXH 4JQVC 3QHFH 3V8OA 4YWGL 4GKZA 4OKDA 4YE4H 4YGVB 4XAWL 3GK8H 5FIEA 5EORH 1UWEL 2E7LA 1A1MB 4WHYG 1NKRA 3SDDB 2FO1A 2ZP0T 5AZEL 4OCSH 3KPRA 3GMLB 5CIPA 3HB3D 5I1GL 1BECA 1CL7H 3I84A 3RL1A 1F6LL 4NN5B 3C6SA 1QFUH 2AKRB 5DK0A 1BFOA 1HOCB 4LASL 3V6OC 3O6MH 5EIQA 5H37H 4JKKA 3JXAA 1ZS8B 3ZT7A 3JTTA 4HZLB 4Q6IC 4BFIA 1YEDA 1N64H 3EO9L 4HGMA 4PTUA 4JM4L 3P4LA 3L3IB 4FFWD 1G6RB 2W9EH 4RA0C 2NR6C 1KCVL 5GISL 2AAVA 2R1XB 3O3BA 4LSPL 1DSFH 2R0WL 1OWRM 3VG0H 3OMZA 1WGOA 3OQ3B 2JJSC 2N7AA 4P5MA 2BNQB 1VGEH 4OAWA 1LO5B 3LRSB 4FFVC 1MJJB 3KPPB 3O0RL 4UV7H 5DI8B 1HQ4A 1CWVA 5FDYA 2NLJB 2VMFA 3D3VE 4H1LH 3TGXA 1ED3A 1C5CH 5C07D 1ZLVK 1MI5A 3CZFB 4JM2A 3MUY1 3OG4B 4ELKA 1JN6A 4PP1C 3K81A 5EA0H 3HPJB 4I9WD 1DEDA 3HRPA 4X83A 4LDEB 4LKCB 3WFHA 3ZKMC 5DFVC 1HXMB 1SM3L 4GKSA 1T66C 1OAKL 5E2VL 2AXFA 4JG0L 5DDHB 4LASH 2P5EE 3G9AB 3B9VA 1AP2B 3G9VA 5D2LE 1PYWB 4JO3H 4OB5L 5AD0A 4S1RH 3NFPB 5DHVH 1YMHB 4WWKD 4LKXA 1OOAA 3KPRD 5D70H 1WK0A 3BKMH 3RTQB 3O3AB 2X70A 5EUKB 4NO0D 3HE7B 3CH8A 1ETZB 3HUJF 3SGEH 4JY5H 1A6AA 3O2DA 2I9TA 3TN0A 3QUMB 2BSTA 5I1EH 1X5YA 2LV4A 4IJ3C 2ITCA 2AEQH 5FYKD 3ZT5A 3JWDC 1QSFE 3CPLA 4FZEL 3QDJA 1KELH 4HWBL 4LEXL 5DVKA 1AO7A 1QA9B 3PWPD 2YN3A 5J3HC 3U7YH 4XP5L 3DXAA 3W9DA 3WLBA 3RWHA 5F9DC 5HDQH 2GEEA 4NM8L 1RI8A 2KH2B 4P5TC 3RGHA 4U1LB 1JMXA 1VGEL 4LNRA 5D93C 2E9WA 5TE6H 1D5IH 3BVNB 3VDCA 2WUBL 1R3LA 5BCAA 2IQ9L 1U8IA 3H9SB 4C4KT 2CUHA 4PJHF 4BH8A 1G7JA 2BRRL 3FO0H 5L88L 4QHKJ 4LSDA 5CINH 3NH7L 4GRWE 5HHOD 4JCLA 4LQFH 4F8TA 3AS1A 1NMAH 3ZSSA 4HCRH 3MFGB 3WKML 1TIUA 1RFDH 3H8NA 4JCMA 4BQ9A 5EU4B 5GPRA 2NW2A 4FQXA 4U6XB 1T89A 4H0GA 1OLZA 1NMCB 5DHXB 2GCYA 3GMNB 4PRNB 5GGTA 5GGVH 4OUOA 4QRPA 1YEDB 2A1WL 5F1IA 1P7HL 3F58H 4WNQA 1WCBB 4IS6A 4ZPTA 4FFYL 1FZOA 1E4XH 43C9A 4GBXA 1UM5H 1BOYA 2QV2A 4DFHA 1BFTA 4LU5L 4UU9B 3STBA 2VDML 4MD0A 4WGVB 4JFZL 2FR4B 4KKBD 1IC4H 5MENB 2R29L 4OI7A 2ZCLL 3U4EA 2EYSA 1LEIB 4P2CG 3ZDXE 3VFNA 2VLKA 1Q9WB 5EZIL 1AJ7H 1ZVYA 3HC3L 43CAB 3LS4H 4NZUH 4PY7B 5DJ0B 3MNZB 4KDWA 1FZJA 1YEGL 4NRZB 1UB6B 1I1YA 4KC3B 4HH9B 5D7IA 5HYQA 3IDXH 3UDWA 3HG1A 4K3JL 4F3FA 2AGJH 4OKVB 4UV4L 4L3AA 4XC1H 5JPNB 1R0AL 3F5WA 2LE9A 3RL2B 2O5XH 1KCUH 1A4JB 1N7ML 3MLRH 4ZOBA 3OAUL 4BFGA 4XH2B 3RGVB 3SKNA 3JWOC 5JXED 4RWHA 2JJTC 3UTPE 2VLKD 3ZKSD 4RAUA 3S5LB 1WC7A 2H2PD 5EUOF 2I07A 4KPHL 4LLUB 4JB9H 4WEBH 3ZE0E 3PDOA 4EI5C 3LY6A 3TVMA 4KROD 1PG7L 2D7TL 2HKHH 3ZE0F 2BRQA 2F58H 2CLRA 3RKDC 3RZCB 3DOSA 1F8TL 4E0RB 4PJ5A 2F53E 1JF5A 2FATL 2FIKA 5DRZA 4A6YB 1F42A 4ONFH 2X1WL 3H3PH 2DQEL 2J8OA 4LHUD 2X1QA 4GT7A 3QXDA 1JYNA 4KU1A 6FABH 2Q3ZA 3QXWA 5CSGA 2UUDH 5C2UB 4N0UB 5FO7B 3MGTA 3TH3T 3VA6A 3MJ9H 3QXAB 4U1SB 4Y2DA 1YN6B 3STLA 1DE4A 2P5WA 1G9NL 1NMBH 1M6OA 3BHBB 3CU7A 3V95A 3QRGH 1E4KA 1FVEB 4MB4A 4LLMA 4WI2A 5ICXA 5ECJE 3EFFB 1UADC 5FYKU 4X8JA 5D2LF 5EBWA 3HZVA 5CJ5A 5IFHH 1IM9A 1L6ZA 5D7LB 4OZHB 2G75A 1Z6JT 2X4PB 4NKQB 4K2UH 4PRDA 2VITA 1WSST 3GSNH 2I9LB 3FFCB 3I3EA 5L2KE 2E9IA 3HMWL 4F57L 1KLUB 1K6QL 1RUQL 4ZPVB 3SN6N 1MEXH 5D71H 3LQAC 3AS0A 4HT1H 4Y19E 4KMQA 4ZUUB 1EEQA 1U8MB 3VXPB 1V7MH 3VXMA 4JFYB 2X9WA 3U36B 4AMKL 4Y8AA 3NCJL 1IGCH 3UTQB 2D7QA 5C0DB 1TPXB 1U92B 3MCLL 1CDBA 3PHOB 4Z8FL 1LO0H 1G7MA 4MQ7B 2K9UA 1I8MA 1CD8A 4IMKC 4KUZL 3C8DA 3NIDF 3TPKA 4RQQB 4PLJC 2LU7A 3KHQA 2IADA 4TVPH 1T2QL 1BBDH 1U8LB 2BZDA 4LF3B 2B2XL 4IRZH 2PW1A 4PR5A 1VCAA 3MYZA 4XBGA 3MODH 4JFOA 1SYSA 1UGNA 3K1DA 3NBNA 1MCPL 4NOBA 4M03A 2Y06H 3MJ9A 3I3DA 3CSYB 2JCCF 3U1SL 4WU5B 1QLEL 1JYXA 5I9QB 4JFEB 2P8MB 3PIQA 3QULA 4GO6B 2VLRB 4N0CD 5KANI 5F1OB 15C8L 2HJFA 5M7QA 5ELIA 3SDXF 1CVRA 4MXWL 3S6CA 4G8GE 5DJYB 2EDLA 4OGZA 1ZT4B 4ELMB 3STZB 1OM3L 3G6AB 5CSZA 1MFDH 1ACYL 4M1DH 2FSEA 1KPUA 1A6TB 3WUZA 2RB8A 1DUYA 2NY3D 3KPSD 5KN5A 2VSDA 1NC2D 5F1KC 5J9PB 4FN0A 4QXWA 2DJ4A 1EEYB 4YH6A 2V9TA 4OLVH 4P3CL 3T0BA 4F15B 3F7VA 4KVCL 3UROR 1U8PA 4LSUH 5F7HA 4NZRH 4HWZA 5IW3A 4OBRA 4AIXA 2F5AH 4XPFL 4NFDA 1CU4L 4EN3C 1UXSB 1GGTA 3C5ZC 3CAFA 1I9JL 2BSRA 4Y2DB 1QBAA 2EO9A 4DFIA 4ZSOA 2BC4A 4ZFOA 4C56A 4QCIB 1NPUA 3Q3GB 1RJLB 3VFGL 1CYGA 1RULH 5INCA 5T3ZD 1W2KT 1KJVB 2HLAA 3GNMH 4JPKL 4NQDE 5I0ZA 3H9HB 3H2WA 4FHBD 5CEZD 2J3SA 4LSVH 1N6QH 4L3EB 5D4QA 4HDIB 4OZIE 3WHXA 1IE5A 2XFXA 5IEHB 1T0NA 3PHQB 3A6CL 1J0HA 1KLGA 2P24A 2OI9C 1K3IA 2HTLD 5D7LA 1UQSA 3ARZA 2OL3A 4XRCA 1C5DB 4H25A 1I9RH 4F9LA 4UB0L 1U9KA 3BD4A 2HFGH 3SGEI 1UB5A 1ZT7A 2DMKA 1G7IA 4KAQL 4XNYL 1ONQB 5E2VH 2EDEA 1WFNA 1T03L 1NGPL 5EO0B 4JY4A 4L29B 3O0RH 5I9QC 1A64A 4ZFOL 4P9MH 4D9QE 4DGVL 4TTGA 5IIEA 1LP9E 4X8XA 3WS6A 1WEJH 2GK0B 3BH9B 2UZXB 3HMXL 5E8OA 4NO2B 4OJFH 4WV1B 4PRHE 4P0DA 3DO7A 4R2GB 5EPMB 4PJGE 4YK4C 1FYTE 4Q58C 1T6WA 4QHMB 4HF5H 4HWUA 1EHXA 3CNKA 3FFDB 4EQ3A 4F7CA 5CJBA 1NGXA 4JGUA 4LCUB 5DWUL 3OX8B 3QUKB 4KZDH 1QA9A 5GGVY 1F2XK 4OFDA 2IAND 1NUGA 4LAJH 3P11L 3QXTA 1GOGA 3UCRA 3PWJB 3SDAA 5EUOE 1DDHA 2NY4B 1QYGH 2EE2A 1YPZF 1H5BA 5F7DA 5FHAH 3F62A 1WAAF 4L9LA 4U1GC 2F54D 3D69A 1Q0YL 4APQC 4I0PD 4I3RH 4L1DA 2FJFB 3MOAL 5CJOH 5A2LH 1CXLA 4QRPB 1MJ8L 2VAAB 1N6QL 1PEZA 5GGSA 2B4CC 1FL6B 1R24B 4J4PD 5T1KB 4I8DA 2YSSB 4WO4B 3IJHA 2XRAH 4K07A 4YGAB 4KTEL 1UWEH 1I4FB 2ATKA 5IB5A 3D9AH 4UINL 1EAPB 3TYGL 3FB8B 1WWCA 3C6LB 1JHTA 5D5MA 3PP4L 1VFUA 4OD3H 4WUUD 1CZ8L 2HP4A 3ESVF 3G5ZB 4HUWB 1D5XB 1IAII 3S35H 5A43C 3ME0A 3EDDA 2RQ8A 1F6FB 1RZGB 4OZHF 3MRJB 3VG9C 1A3QA 1QZ1A 3QEHB 3L9RB 2GJZA 1VDGA 3DMMB 4XP6H 4E41B 1CLZH 4GRLD 3EO9H 4HD9A 1AGBB 2VQTA 3E3QE 5EOCH 1OGAD 1CS6A 3MRHA 2HJKA 3OJ2C 3PWJA 4QRUA 1KN4L 2B1HH 4GJTB 3NCYP 3WSQL 1VFMA 1RJZB 5IQ7H 5K9QG 4QKXB 1IKNC 1AH1A 5ACMA 2PW2A 3OGOE 1AGDB 2JCCA 2QSQA 4X98A 3MLYL 3ZKXB 5D9SB 1WBZA 4JO1L 1BM3L 5SWSB 4RWYH 4K3HA 4P3DA 1VFBA 4X4ME 1T4KA 4WFGE 3GK8L 3L5XH 3RI5F 3LQAH 1U6AH 3EJJX 2GK0A 1MCLA 1U42A 3IKKA 1AXTL 4KKAC 1N5YL 4KV5E 2BNRA 4U1GB 3DROB 1YEJH 1BPVA 5C0GB 3QCVL 5C0FB 3EOTH 2HJLB 2Z93B 1HK6A 3DUSA 5K33A 4XPGL 4WEUD 5IMKA 1LEKA 2BMKB 1LK3H 4AT6B 1QFOA 4U1IB 5GZNC 1QSEA 5I75C 5D7JB 4Z7NF 1H3PL 2P4AB 2R4RH 3TM6A 5C2BL 2B0SL 1EIBA 1MCCA 2IFFL 1H3TA 3TO4C 4QWWD 1HNGA 3CSPA 5F9WC 4BFEA 1QRNE 2VDOL 4M5ZL 2OMBA 5E24E 2PKDA 3KWWA 1FPTH 1XH3A 2V2XA 4U1MB 1RK0B 2VDRH 3CLFH 3QWOB 1OAUL 1RUMH 1DSFL 2GAZB 5HI3D 3VMPA 5IHLB 1XGQB 2CK2A 1W0WB 4LLDB 3OJDB 2AK4B 3Q5TA 5GSVB 3A0OA 5IB4A 3CPLB 4NKOA 3TNNA 2R1XA 4R7DB 4PRPD 4UTBH 5CGYD 1PYWA 5L0QB 3LKQB 1S5IH 4X6CE 4YHIB 1CE6A 1G6RA 1PFCA 1S8DA 4JN2B 4L1HA 3SJVA 4HKJA 1PGRB 1B4RA 5LXGH 5KS9B 1KIQB 3HC0A 5DO2D 3BE1L 4KZEL 3QUMA 3BZFB 5HYIA 4K7PY 5F7LB 1L0YA 3WUWA 4H0HB 2XNAB 4ZQKA 5HDOA 3V5KB 4FABL 4DW2L 4NN7B 4XC3L 5LJYH 2BDNH 3CXHK 4K2UL 25C8H 1AR2A 5F1NB 1ZA3B 3O6LH 5CHNB 3LCYA 5GZOD 2HLFC 4JY6A 4ZFFA 1ED3B 2VXTL 3O8XB 4HUUB 4ZMAT 2E7CA 2VXSH 4M5ZH 3STZA 3W9EB 4S2SA 4MSWB 3I6KA 1F4XL 1F11B 4HUMB 3B4NA 4QT5B 4ISVA 3SDCA 4LKCA 4O9HH 3BP5B 3QUXA 1NC4B 3VFSA 3QRFM 4XTRC 3VI4F 3EIFA 3GO1L 4CGTA 4NQVB 4U1NA 1J5OL 5FYJE 5GGSB 3WD5H 1DANU 3HLAB 3FONB 1WCQA 1NC2B 1PG7W 1MNUL 1B88A 2MCPH 3VWJA 2PW1B 4PR5B 1TETH 2GTWB 4OUUA 3RVVD 3P30H 3E6HA 5E9DB 1GZQB 3VG9B 3BEVA 3ARPA 3MO1B 4NNXA 3G5VB 3HZVB 4MCYB 1DQDL 3P9MA 4XC3H 4Z8FH 3IYLW 1F90L 2X4TA 4HXBL 4PV8A 5L2KD 1PLGL 5F96L 2ZUQC 5BS0B 4N0YH 3IGAA 5J6GA 1AC0A 4M6OL 3U30B 3C2AL 2WBWB 1NGYA 5AWNH 3UJJL 1FJ1B 1U8MA 4Q2ZA 4TVPL 4JM2F 3O2WL 5SWZE 4KVNL 4YX2L 3VWJD 5DJAB 5FM5O 4PGBA 2VLKE 3IFOA 3B8YA 4FQXC 1HKFA 3LSOA 2DQHL 4WTWA 2HWZL 5HHOE 4UT6L 4RSVA 2V2TB 3DETD 5TDOB 3FQTA 3FQNA 1LEKB 3ZKND 1HYSD 1I7ZA 5GIRA 1I3RA 3QNZB 4N8VA 4ZTOH 3VFUB 1QLEH 1D6EB 4R3SB 3SDCD 3NN8A 3HG1E 1ZLUH 4ONGL 3QP3A 1HH6A 4DKFL 4HWBA 2NTFA 1DBML 3I75B 3V4VH 5D1ZD 3WKNA 3BAEL 2PTUA 2Z35A 5ID0A 1EHAA 2LAAA 5FGCB 1N7MH 4P5TA 3VE0A 4D8PA 3D39E 5FKAA 1TZGL 5F88B 1ZLSL 2B39A 3W0WA 4RFOL 1GL4B 4OKVA 2ESVB 3HPLA 5ENWA 2P45B 4HDIA 1E0OB 3K3QA 3P4OA 4L8SC 4LVOC 2KZ1B 2A38A 3D0LA 3VU2A 4UDTA 3ES6B 3IDJB 4NOFA 1OGAE 4PJHE 1WAAE 1Q9KB 1BFVL 2DWEA 4KRLB 1BJ1J 1FZMA 3EZ8A 4UBDD 5IROA 5HJ3B 1MPAL 4PYGA 4Z77B 3QI9C 3RU8H 5SWQB 5DMIH 3S7GA 2ITDB 3CFJA 2DYPB 3CC5A 4P2QD 5E2JA 3EYFA 4G9FE 2FBOJ 3VWKB 4G6FD 3QFJE 1OARH 3RQ3A 1TJIL 1BVKB 2FB4H 3MXWL 4U0QB 4LCIH 5KSAD 2HG5A 3TCLA 1AGFA 4RFNC 2DJSA 3IT8D 1GC1H 4DCQA 2H9GB 2OTWB 1AQDB 1EFXD 2W0KA 4ZPTB 3VXNB 1JRHH 1ZHBB 5HY9A 2P5WE 2ORBH 5JOPE 3F5WB 3QPQD 4UNVA 3RIFK 5F7FA 3GJFH 3GHEH 3N1GC 3QA3B 3CDYA 3L5WA 3O6KL 1A6UL 1A47A 5KVGL 5TFSH 1D3CA 3PWLB 4Y1AA 4JPIA 3LEYH 4XVSH 3MNZA 4OM0L 4JKMA 2XIDA 1UM6H 43CAA 1INQB 1GIGL 3QHFL 3O9WB 4HPYL 5DO2C 3BSZL 5FYKL 2FYYB 4POYA 4P5TD 3IAGC 5D71L 3WO4B 5GS0C 5JW4Q 3U4AA 1JZ6A 2QLVB 1PBYA 2V7NB 4KK8D 2H8PA 5L8JB 4PP1D 2CDFA 3HZMA 4OFKA 4ZOCA 4FXKA 3DV6B 4P4KB 2D9QB 3DTXB 1NJ9B 2DBLH 4M62L 4OZFA 3UBXB 3RPIB 2I27N 3S88L 2DBJA 3EYFB 3B9KB 3HZKA 3HI5H 1IL1A 5D8JL 2EC9T 2ZPKL 3HI1A 4ENED 4PJ8B 1MFAL 1BP3B 5IW1A 2BK8A 4NM4H 5AUMB 4LPTA 4MQ7A 4XPBL 4NO5A 3PGFL 5DMJB 1CE1H 3VD7A 5KZCD 1BFVH 4W4OC 4NNPL 1Z9OA 4WHDA 2N56A 4YC2B 5DJ8B 3SCMD 1VEMA 3EYOA 1UWGH 4POZD 3RUGE 3CK0L 1Q1JH 3WXVH 1NMAL 1JIBA 4Q2ZB 3RX8A 3SBWC 1FAIL 4ZXBD 3UYPA 1D5BA 2FEEL 1YQ2A 4PJ5D 2V2TA 5BJTB 2EE3A 3FL7A 1BQHG 3IFOB 1OW0A 4FQCL 3MXVH 4X0KB 4P2OD 5BV7L 1TTUA 2X7LA 4NRYA 2E7LC 1E6OL 3FTGA 1FE8L 3PL6B 5IHUH 4EZMA 1VEPA 5IB1B 5L6YH 3WN5B 4RGOH 3MOBL 3ILQD 3WMSA 3GSOB 4P2RB 3H0TA 4O2EA 1O5DT 3ARUA 3TIEB 2FRGP 4NBYB 3RWHB 2NXYB 1JTPA 2VABB 3SE9H 1C5BL 2MKWA 2WK2A 4J2XA 3PP4H 3BMVA 1RULL 1X5LA 2HJLA 5C0FA 1Z0NA 5IFJA 3E6FB 2VQUA 3T09A 5IQ7L 5JDJA 1OGAB 4GKOA 1OTSD 2PXYC 3H9HA 4N0FA 3A6OA 4XPBH 3W2DL 1KSRA 2M26A 3ZDYE 4Y4HB 4ZAKD 4XPFH 4HK0A 1M7IB 3PQYB 4JQIH 4ZSOE 4N8PA 2XZAL 4YHIA 2D7NA 2PXYA 3HE7A 5HYSA 4LLYA 2XQYK 1P2CA 2OCFD 3MV01 3SDCC 2H2PC 3WIHA 5D8JH 3NA4A 1YEJL 1Q72L 3KAAA 5GRZA 3ESUF 3IDNB 4X6DB 2WIMA 3IKCA 4X6FB 4WV1C 4KDTA 4BQBA 4N1EA 4CVZB 5CGTA 1LO4H 4GOSA 1S8DB 4JO4H 1GH7A 1ZANH 5D7LE 3TA3D 1ZT4A 5LGJA 4K3GA 4R7DA 3N1MC 4H0IA 2AV7B 2R8SL 1JGDB 3P73A 3BZFA 3SE8H 1OW0C 3QG7H 2WQ8A 1C7TA 2EIZA 3TIDB 3EUUA 1G7HA 4KK5C 4KHTH 4RBPH 2HT2C 2IANE 3OKKA 3PDDA 3FZUD 1CT8A 3E3QC 3AGVA 1GSMA 2FATH 1ORSB 1JZ7A 4XI5D 5KS9E 2YD3A 3TNNB 5KOVC 3WJLA 3L7EA 2B8OT 3NH7H 5IHBA 1CXIA 2F53B 3J7HA 5JHDB 5JXAL 1OAXL 2GY7B 1FH5H 1HZHH 1MY7A 4P23D 5DC0A 3N50A 1JNHB 4UU9A 1YDPB 2RIKA 4N8VG 3QQ3B 5BZDA 3K0WA 5BJTA 4JFDE 5ID1B 1U3ZA 1WISA 5C07B 3REWA 4AT6A 2JKXA 4G8GD 3AB0B 2C4FU 4G6KH 4L4TD 4FQLL 3ULUF 5EU7E 2D7OA 2NYYD 2YEZB 2WWMD 5A3ID 1IGYA 3QNYB 1T83C 3MV7B 3OX8A 2NY0C 3O3UN 4C55A 2Q7NA 3H3BC 2Z93A 3NIFF 4ZS6D 2EEDA 4G7VH 1UCBL 1I3GH 1KN2H 3HR5A 4QTIL 4U6HA 4MCZB 4IRSB 3ZDZE 1IEAB 2O26U 1MVFA 4J8RA 1AY1H 3AMLA 1AR1D 3OKMA 1XGUB 2A6KA 3TZVD 1TVHA 5HVFB 5FECB 1A7NH 4CN1A 4GG6E 1C8PA 2IH3B 4PRAB 3DX6A 1CK0L 4Y5XC 1IQDB 4E9LA 3DURA 3DX9B 2QHRH 4PG2A 3UTSE 5ESAA 5BVJB 4Q9QH 1M6OB 5D5MF 5E95B 1U36A 1IKNA 2BNQD 3GEWB 4FP8H 3MGOB 3P0GB 5C70A 1DFBH 4ZO6A 4QHNB 4AL8H 2CRYA 4N0CC 3OKOA 1IKFH 4G6AC 1MJ8H 2EDNA 2HH0H 2HT4D 3CMOL 4M7ZB 3ZTJG 1F90H 3WJLC 3PV6B 1UH3A 1FCCA 2YPKB 5K9KA 3BDBA 4P2OC 1I8IA 5DYOB 3D25B 5AWNL 3CDGA 1QPXA 4OD2B 4QOKA 4U6YA 4L8SA 3G04B 1MFDL 3FT4B 4RMSA 5HVWA 1A7BA 2F5BL 3QJHA 1AIFB 2FJHA 4KQ3H 4IRJB 1G6VK 1RZKL 2VLJE 1ZT1B 5TGBB 4XPGH 4EN3D 2FX9L 1CIUA 4NJAH 5I2IA 3QEUA 5DVOA 1CVSC 4PRHD 2AXFB 5DDHA 3JWDL 1L7TH 3QDMA 4N90D 2XT1B 3IDJA 5IP4A 1U6AL 2C3VA 5JPNA 3F7PC 4CMMB 2QQKH 1J88A 2CQVA 2ICWA 3H6JA 3ISWA 5HDQL 5HGBB 1E28A 1KGCE 4F7TB 2BNRE 5LGJB 2JLLA 4L4TA 1D5XA 5EA0L 1DP0A 2VN4A 3ARDB 3ULVE 3HUJE 1SM3H 2JB5L 5HDBF 1NAKL 5IFHL 2EH8H 1XIWA 4WW2B 1QSEE 3QEQB 3HMXA 5D1XD 3JVGC 3N85H 2WV3A 5C2BH 3UZQA 3O11B 1KIRB 4JKLA 3PL6C 4ALAH 2AK1H 3FO0L 3QNYA 5D2NE 4WO4A 2AVGA 1D6EA 4X7CC 4GUPA 2JJWA 4XMLL 1JF1B 3PNWB 3U9UA 1TLKA 2VXVL 5IM7A 1SEBB 3AM8C 5GRYA 5A2JH 1LD9A 2NY0D 5JUEL 1C08B 2XA8H 4JFDB 3TWCL 9CGTA 1HYRC 2OTUA 4ESKA 5CILL 1PD6A 3VXUD 3PGCA 1CFSA 2FLBT 4F7MB 5E4EC 5JHDE 1H3GA 2CXGA 1QHPA 1XF3A 5IVOA 1PG7X 2QHLA 4EIGB 2B5IB 4YHLH 1WIPA 2PETA 3FQWB 5HHXH 4MAYB 4RQQA 1VB9A 4OGXH 4XMKH 3SJVE 1KEGL 4K8RD 1H15A 3JVGA 1IAIH 1F4XH 5FFLA 1WBXB 1J7VR 3TBTB 2ADFH 3KLHD 5KAQF 5ICYA 3DVGA 5IBLC 2EH8L 1K8DA 1OAUH 4LCIL 5BRZA 4JFYA 1J5OH 5ICZA 3QQNA 4YR6A 1TVBB 2BHUA 5B4MC 3WFEL 4LCWE 5FO8A 5FGRA 4D2NA 4E42B 4W4OA 5A2IH 4X9GA 1U3HC 1PW3A 3RNKB 2DKUA 1L0QA 5IK3B 3QUYC 2C3GA 4ZFOB 3MV8B 5DJCB 4LQFL 3MJ7B 1KCVH 5GISH 2CIIA 4NDMB 4YBLB 2NYYC 4OZIB 1TJHH 3TT3L 3OB0H 4J4PC 1N8ZA 5GRVK 3ARVA 4YHZL 1S7QB 3CU1A 4HGWB 3BE1H 3N1FC 3I6KB 2HN7B 1CF8L 1E4JA 3QO0A 2C7UA 4MDIA 4ZO9A 4PJ8A 2BJMH 2XFXB 1BAFL 2GITA 5CWSA 1QUNA 4MA8H 4PYHA 2VXVH 2YPLB 3P9WB 4B50A 1YEFH 3OKDB 5L7XL 4KXZI 1MF2H 2HTKC 5ETUA 4RIRA 5EU5A 1CGSL 4Y4HD 5CP7B 1IC4L 4KI5E 3BGAA 3S35X 1TZHA 2XWTB 4PJIB 4YJZL 2QQLL 2IPUG 3U9PL 4H88L 3SDAD 1WV7T 1MJUH 3PQYA 4L8CB 1I7TB 1RY7B 4X6DE 2UWEE 4LLUA 4Y5XA 2IG2H 2QEJA 3DRTA 4QY8A 5AYQA 3F7VB 4U7SA 2JK5B 3P4NB 3V79C 5GRUH 3BW9A 2X4RB 3LEVL 2WW8A 3SKJH 2PYEA 3IETB 3ARDA 3CVHH 3KNBB 4DTGL 1LK2B 4H1LG 3BPOC 4M6ML 2X41A 5IROC 1S78C 5F6IB 1E4WH 4HBCH 4NPYB 4NGHH 4WTXA 1J05B 5KVDL 5GGSY 1LGVA 1TZIA 5GGQH 2YMXH 2QQNH 4KPHH 5CJ8A 4ZUVA 2J8UA 5E8EA 4AG4H 4LLYB 2DQFA 2P48B 3JTSB 2YPLE 2AQ2A 3T4YA 4PJFF 4JDTL 1H15B 3PWUA 2L0DA 2Z31A 3D6GA 5IK3A 2X9YA 1QBMH 3RX5A 1NKOA 3RWJA 4O58L 3VFNB 5J4MA 2WM0A 3GMRB 3REVA 1TJIH 3EAKA 1HEZB 2DDQH 5IMMA 2H32A 3MRLB 1OGAA 2Y36H 1RJYB 3QDGB 3A6BL 2OM5A 3CUPB 1MFEH 3QIBD 5I8CB 3GBLA 3PUCA 1OSZA 2GTZA 4Y4KC 4YDKL 1BD2D 5F7EL 4NQDD 3SGJA 5KSBE 5ANME 1GGYA 3Q6GH 5I1KH 3O41B 1XF4A 2VH5H 4GH7B 1EGJA 5TDPB 3NABH 1RJZA 2VDRL 5I30L 1T80A 4MJ6B 1CFQB 3ULSB 1LE9B 1D6VL 4F9PC 4Y2OA 4JPIB 1I1AC 2Y06L 3VRIA 2J5LC 1MCSA 2DQTL 2R23A 1DBBL 3AUVA 2CO7B 1NFDA 3FT3A 1IAOB 5J11C 3GMPB 2P5ED 4KJWC 5DXWA 5FA4A 2I9LA 3P40A 4F3FB 3TVMB 3W5MA 1S7TB 4CNIA 2EYRA 2YXMA 5D2NC 3GSVB 4PLOB 1Q9OA 2R56H 3G5ZA 3LEXA 1HZHL 4RGNC 2W91A 3RZCA 4APQA 3N06B 4G5ZL 4HEME 4OIAA 1M7DA 3BDXA 1MFAH 1A6ZB 3A6BH 1CGTA 3QXDB 4KRPD 2YSSA 1MIEL 2J6EH 5LKNA 3LZFL 3MLXH 4EVNB 2H8PB 1RMFH 4AENB 5GSRB 4HAFA 1OGTA 1CQKA 2MHAA 4F7EB 2I26N 3BQUB 2BSTB 4BSVA 2PYFB 4JFPA 4BH7A 1EK3A 1KB9J 2O5ZL 2JJVA 5HHMB 3QI9B 1S78D 1IEBB 4J3XA 1BQHB 3B6SA 1EVUA 5HVGB 1Q9KA 1JGVL 1MFBL 2W9DH 4PGEA 2YUXA 3RBSA 1TPXC 3S37X 3DI2B 3L5IA 4QOKB 3U48A 3VFWB 1OVZA 5BVJA 2O61A 1OM3H 2GKIA 5DLML 3OKKB 3UJIL 1MLCA 4F37F 1TJGL 5B8CB 4HFWB 1P5UA 2ARJA 5IEKA