4UU9C

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'STLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI7814
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01821 ANATO Anaphylotoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 4uu9C00
1CFAA 4P39A 2A73B 4FXKB 3HQAA 4I6OA 3KLSA 3CU7A 4P3BA 1C5AA 5B4PB 4HW5A 4WB3A 4HWJA 3HQBA 4P3AA 1KJSA 4UU9C 5JPNB 2B39A 4WB2A
chains in the Genus database with same CATH superfamily
5CQEA 1CFAA 4P39A 4WB2A 4D9JA 2A73B 4FXKB 3HQAA 4I6OA 3KLSA 3CU7A 4FXGB 4P3BA 1C5AA 4ITVA 3VDXA 1EA3A 5B4PB 3MD2A 4IQ4A 4PUSA 1AA7A 4HW5A 2Z16A 4WB3A 4HWJA 5JPMB 3HQBA 4P3AA 1KJSA 4UU9C 2B39A 5JPNB
chains in the Genus database with same CATH topology
1CFAA 4P39A 2A73B 4FXKB 3HQAA 4I6OA 3KLSA 3CU7A 4P3BA 1C5AA 5B4PB 4HW5A 4WB3A 4HWJA 3HQBA 4P3AA 1KJSA 4UU9C 5JPNB 2B39A 4WB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFA A;  4P39 A;  2A73 B;  4FXK B;  3HQA A;  4I6O A;  3KLS A;  3CU7 A;  4P3B A;  1C5A A;  5B4P B;  4HW5 A;  4WB3 A;  4HWJ A;  3HQB A;  4P3A A;  1KJS A;  4UU9 C;  5JPN B;  2B39 A;  4WB2 A; 
#chains in the Genus database with same CATH topology
 5CQE A;  1CFA A;  4P39 A;  4WB2 A;  4D9J A;  2A73 B;  4FXK B;  3HQA A;  4I6O A;  3KLS A;  3CU7 A;  4FXG B;  4P3B A;  1C5A A;  4ITV A;  3VDX A;  1EA3 A;  5B4P B;  3MD2 A;  4IQ4 A;  4PUS A;  1AA7 A;  4HW5 A;  2Z16 A;  4WB3 A;  4HWJ A;  5JPM B;  3HQB A;  4P3A A;  1KJS A;  4UU9 C;  2B39 A;  5JPN B; 
#chains in the Genus database with same CATH homology
 1CFA A;  4P39 A;  2A73 B;  4FXK B;  3HQA A;  4I6O A;  3KLS A;  3CU7 A;  4P3B A;  1C5A A;  5B4P B;  4HW5 A;  4WB3 A;  4HWJ A;  3HQB A;  4P3A A;  1KJS A;  4UU9 C;  5JPN B;  2B39 A;  4WB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...