4UU9C

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
STLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MEDI7814
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01821 ANATO Anaphylotoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 4uu9C00
2B39A 3KLSA 4P3AA 4WB3A 2A73B 3HQAA 5JPNB 4UU9C 1CFAA 4HWJA 1KJSA 4P39A 3HQBA 5B4PB 4P3BA 4HW5A 1C5AA 4I6OA 4FXKB 4WB2A 3CU7A
chains in the Genus database with same CATH superfamily
2B39A 3KLSA 4FXGB 4P3AA 1AA7A 4WB3A 2A73B 3HQAA 5JPNB 4IQ4A 4UU9C 1CFAA 4HWJA 1KJSA 4ITVA 4P39A 2Z16A 3HQBA 1EA3A 5JPMB 5B4PB 3VDXA 4P3BA 4D9JA 4HW5A 3MD2A 1C5AA 4PUSA 4I6OA 4FXKB 5CQEA 4WB2A 3CU7A
chains in the Genus database with same CATH topology
2B39A 3KLSA 4P3AA 4WB3A 2A73B 3HQAA 5JPNB 4UU9C 1CFAA 4HWJA 1KJSA 4P39A 3HQBA 5B4PB 4P3BA 4HW5A 1C5AA 4I6OA 4FXKB 4WB2A 3CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B39 A;  3KLS A;  4P3A A;  4WB3 A;  2A73 B;  3HQA A;  5JPN B;  4UU9 C;  1CFA A;  4HWJ A;  1KJS A;  4P39 A;  3HQB A;  5B4P B;  4P3B A;  4HW5 A;  1C5A A;  4I6O A;  4FXK B;  4WB2 A;  3CU7 A; 
#chains in the Genus database with same CATH topology
 2B39 A;  3KLS A;  4FXG B;  4P3A A;  1AA7 A;  4WB3 A;  2A73 B;  3HQA A;  5JPN B;  4IQ4 A;  4UU9 C;  1CFA A;  4HWJ A;  1KJS A;  4ITV A;  4P39 A;  2Z16 A;  3HQB A;  1EA3 A;  5JPM B;  5B4P B;  3VDX A;  4P3B A;  4D9J A;  4HW5 A;  3MD2 A;  1C5A A;  4PUS A;  4I6O A;  4FXK B;  5CQE A;  4WB2 A;  3CU7 A; 
#chains in the Genus database with same CATH homology
 2B39 A;  3KLS A;  4P3A A;  4WB3 A;  2A73 B;  3HQA A;  5JPN B;  4UU9 C;  1CFA A;  4HWJ A;  1KJS A;  4P39 A;  3HQB A;  5B4P B;  4P3B A;  4HW5 A;  1C5A A;  4I6O A;  4FXK B;  4WB2 A;  3CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...