4UUCA

Crystal structure of human asb11 ankyrin repeat domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
RSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Asb11 Ankyrin Repeat Domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ANKYRIN REPEAT AND SOCS BOX PROTEIN 11
total genus 75
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4uucA00
5AQ7A 5EIDA 1IHBA 3UTMA 1K3ZD 1BLXB 5CBNA 1D9SA 4OAVB 4UUCA 3B7BA 1QYMA 3HRAA 1WG0A 2RFMA 5CERB 2KBXA 4DRXE 2L6BA 2AJAA 3B95A 5CECB 3W9FA 2B0OE 4HB5A 5CEDB 3NOGD 1SW6A 1K1AA 5ENRD 5JMND 1AWCB 1BI7B 4HQDA 2ETBA 5BXOA 4BSZB 3TWWA 2F8YA 5AAOA 3ZNGA 3NBNB 1TR4A 3DEPA 4U96D 4BERA 5KBAA 4NIKA 3AAAC 1IXVA 4K5BA 5HKPA 4DUIA 5EIBE 5JA4D 4U95D 3V79K 4ZFHA 4GMRA 4OAUC 3V2XA 4O1PA 5ENPD 2FO1E 4C48B 4U8YD 1N0RA 2Y1LE 5D66A 3JUEA 1MX6A 4DX7D 3IXEA 4U8VD 2P2CP 2BKKB 2XENA 4DX6D 3DEOA 3TWVA 4HLLA 4QFVA 1A5EA 2V5QC 1G3NB 1BD8A 5FINA 5ENTD 3TWXA 4YDWA 3W9GA 3TWTA 5ENQD 2BKGA 4Z68A 3UI2A 4B93B 3V2OA 3T8KA 2NYJA 4HI8A 5AN8A 1BU9A 5FIOA 5HS0A 2Y0BG 3NOCD 3D9HA 1UOHA 4DX2A 3JXIA 2ETCA 4ZHBA 2JABA 1S70B 1MX4A 3F6QA 4G8LA 4O1OA 3AJIA 5EYPF 5KWDA 1MYOA 1SVXA 5ENOD 4DX5D 5CEAA 2PNNA 3KEAA 2DWZA 5KNHD 5CBOA 4J7WA 4J8YA 3TWRA 4QQIA 2DZOA 3ZUVB 3Q9UC 1DC2A 1N11A 2XEEA 1OT8A 4LNUD 3TWUA 4HRNA 3SO8A 2MYOA 4GPMA 3C5RA 3T9KA 3HG0D 2ZGGA 4CYMD 3J5QB 5AQ9A 1WDYA 1BI8B 4HRMB 4K5AB 4N5QA 1IKND 2QYJA 2HE0A 2QC9A 5EYLA 2XZDG 3V31A 4HRLA 1AP7A 3ZKJA 3TWQA 2XEHA 4DX1A 2RFAA 1OY3D 4LSZE 1YCSB 4HI9A 2J8SD 4RLYA 3J5PA 4G8KA 5ENSD 5AQBA 1MX2A 5HRYA 1NFIE 3V30A 2F8XK 1YMPA 2ETAA 4BETA 3JXJA 4YDYA 3EHQA 2KXPC 4CZ2D 2DZNA 4JB8P 2DVWA 4O60A 2ZGDA 4HNAD 1MJ0A 3TWSA 1K1BA 1N0QA 4F6RD 1YYHA 2VGEA 3EU9A 4A63B 4HBDA 3ZU7B 4ATZD 4BESA 2F37A 4F1PA 2V4HC 3EHRA 5AARA 4TUMA 4BEPA 3Q9NC 5EN5D 3UXGA 5ITZF 2A5EA 1DCQA 2XZTG 5KNGA 5EILA 5AQAA 4LG6A 3LJNA 5BXUA 4K5CA
chains in the Genus database with same CATH superfamily
2LO6A 3PDNA 2YHCA 1BLXB 3SGHA 2PL2A 1D9SA 1WG0A 2RFMA 2P9NG 3CQGB 2WXQA 2AJAA 1JWGA 3PNTB 4XEIG 5CECB 4CGWA 2J4DA 3Q4AB 5H7PA 1ELWA 1NI1A 3FUEA 5BUZA 4L23A 3FH8A 1IXVA 4N39A 1X81A 3E37A 4FC8A 2AXUA 4O1PA 3GZ2A 4LRZA 3Q49B 2BEDA 1MX6A 2NC9A 4KXKB 2I1KA 4GPKA 4DX6D 2CHWA 3FUJA 1G3NB 4Y6WA 3R9AB 4JA9A 5ENQD 2BKGA 3KEZA 2WVIA 2WMOA 4G24A 4OVVA 3JXIA 4JL0A 3OXFA 1W3BA 2X6FA 4DI3A 3DSWA 4UWKA 3SHFA 1OCCE 1E7VA 2OVFA 3BEEA 1SZAA 1N11A 3D9KA 3ABKE 5FZRA 5T4YA 2WXNA 3MZLB 3L16A 4GTOA 1U2VG 5LP0A 4G8KA 1TEZA 3LS8A 3Q7FA 3KS2A 5CMWA 4DI4A 2VTBA 2VSNA 1ZB1A 4O60A 2XGOA 3HYMB 2VSXE 4BESA 3AG3E 3RRMB 1FCHA 5EN5D 3APFA 2XZTG 1P5QA 4DLQA 3P1UA 1OWLA 2WPVA 1ELKA 5LCWJ 5BPPA 3B7BA 4GYWA 4P29A 2BF0X 2L6BA 5G2NA 5CCMA 5ENRD 3FEXA 2FF4A 4EQFA 4ANVA 4AV7A 3NZSA 3UT7A 2F0YA 2DYSE 4AXHA 4UI9J 4AJWA 4CT0A 4YVQC 3RKVA 3EIQC 1N0RA 4MKTA 2LUHA 4PDXA 5LOZA 2V5QC 3FU0A 5FINA 3ASGA 4I6EA 3X2QE 1N4PA 3SD5A 3ZW3A 1U3CA 4G8LA 5EYPF 3L17A 1QZ2A 4BT9A 4KYOB 4FLBA 5JJTA 3TWRA 4I2WA 1H2UA 4XX5A 4AY6A 5AQ9A 3HXBA 4N5QA 3R9MA 1HE8A 4HOSA 3OTNA 4URKA 1YCSB 4HORA 2XEVA 2GRLA 3QARA 3ZEFA 4JB8P 4G2VA 5KJNA 4H7XA 2V4HC 4GTRA 4U0ZA 3APDA 1KPSB 1DCQA 2BUGA 1E96B 3FDHA 2OEWA 2HYZA 3D9LA 2XRZA 1Z3XA 1SA5A 1IYGA 2R5SA 4L2LA 3Q7AA 3UM0A 2VSOE 1JCRA 3S7BA 3MA5A 2F8YA 3LEWA 3MGBA 4Q94A 5HI7A 4A55A 5EDSA 3RSEG 1Y6IA 3ZGQA 1INZA 1N4QA 3L6AA 2IFUA 2Y1LE 5ENNA 3TWVA 4AY5A 2GRNB 4CDRA 2WXMA 2Y0BG 3FTSA 1NL4A 3FTYA 1S70B 3HVEB 3E30A 3AJIA 5ANRA 3EDTB 1HU3A 3AG2E 5FTPA 4LNUD 3QWVA 2QFCA 3CGHA 3GZ1A 4L9PA 4HVBA 5EX0A 3HVEA 4HRMB 4BX8A 3V31A 2PM7A 3TWQA 1EYHA 4L7TA 4LSZE 2P58C 4GMJA 4RLYA 1MX2A 1YMPA 4KBQA 2Y69E 4YDYA 4TV3A 1JUQA 2DIWA 2H6HA 3U3WA 5AIJA 1NA0A 2ZXWE 2F37A 2C0MA 4W9RA 4GZ5A 3DSSA 2L0IA 3FUNA 4XI0A 4LG6A 2CFUA 3FUHA 1NP7A 2XCCA 4CEMA 4FADA 2X6KA 2XCBA 3C72A 4GZ6A 3AS4A 3BG0B 5JJ7A 2IJGX 3GYZA 1H2TC 1E8WA 4L2YA 5T8IA 1X5BA 4NIKA 5JHBA 4J6IA 4DPRA 4GMRA 3PVLA 3NZUA 1OWNA 3EIJA 4U07A 4U8VD 2FBNA 3C98A 5D0OD 3PZ4A 4U63A 3C3OA 1UG3A 2PM6A 3LKUA 3UM3A 3Q79A 3ZPJA 2XQ0A 4PH4B 1TNZA 2BTDA 2H6IA 4I1OB 2VYIA 5BV0A 3PE4A 3ISMC 1OT8A 4HRNA 3T9KA 5IY5E 1H19A 4ACKA 3LCAA 3JUIA 3UMVA 3J5PA 1OUVA 2J9QA 2ZGDA 4F7AA 3CV0A 4WWNA 4HBDA 3SI5A 4BX9A 3MJWA 2WQ7A 2C2LA 2GRQB 3SF4A 4PS7A 2KZTA 5C1DA 5AQ7A 2J49A 2I9CA 3Q47B 3UKUG 2E2EA 4UUCA 5KJLA 3MYVA 3PUKA 3ASHA 2FI7A 3ASDA 1HZ4A 5HQ8A 1HG2A 4WNGA 4EECA 3FP3A 3E34A 2P9SG 3CHRA 3ZNGA 1D8EA 5FWQA 2FULA 3B7SA 4JA7A 3E33A 4J8DA 4B94A 2DCPA 3EU5A 3ZYLA 3CVVA 5G04J 2J09A 1QQEA 4HLLA 2LNIA 3T5VA 1V54E 3RO3A 5FIOA 3NOCD 1UOHA 2YNQA 4ZHBA 2ETCA 2ZIRA 3L13A 3D9IA 3UX4A 3PEVB 1HH8A 2L0TB 2R59A 3DXMG 3HHMA 5FQ7A 4XIFA 3FHEA 2H6FA 4DJAA 4CYMD 1WDYA 3RIBA 2HR2A 4K5AB 4GTVA 4DLOA 3FUFA 3ZKJA 1FVFA 4AM9A 3BUAA 1H6PA 3FTZA 2OVBA 4I17A 2KXPC 2NXPA 4UQYA 1KZPA 4GTTA 3QNKA 2P9KG 3Q5MA 3ML9A 1JCQA 2ILRA 2A5EA 4FHJA 4KT6B 4CDNA 5EILA 3AS5A 2IO3C 5CBNA 2XHEA 1EF1C 1QYMA 2AW6A 2P9PG 1O1RA 3L08A 3CVWA 3D9PA 5CEDB 3PE3A 1B89A 4N3AA 3DEPA 4BERA 2IO2C 3ZHEA 4RSYA 2IOSA 3V2XA 5A6CA 2KCVA 2WM9A 3U66A 1A5EA 4XZ4A 3FTUA 1WM5A 5G55A 1HX8A 3LJ3A 4YDEA 5T3RA 2RKKA 4MS6A 2XRYA 3D9HA 1PY1A 3L9TA 4EPZA 4G23A 3IEGA 4ILHB 4UQXA 1JWFA 3FTWA 4G25A 2FEZA 4J8YA 4GA2A 4BWRA 2VTBB 2ZGGA 4GTMA 1BI8B 2HE0A 3O4ZA 5EYLA 4TXQA 2RFAA 3D9OA 2J8SD 4YDOA 3CVPA 5AQBA 5JJ6A 2KCLA 4WNDA 3PZDA 3ABME 1O1SA 1N0QA 2XPYA 4F1PA 3R7QA 4WWOA 3FU3A 4CDMA 5ITZF 3FWVA 1OWMA 5AQAA 4CRWA 2XS8A 4BY6A 3DWLG 5FQ6A 1SA4A 3IHYA 3CHPA 3HRAA 4GB9A 3CLJA 1ZBPA 3MCXA 3B95A 4EZLA 2B0OE 4ACLA 4N2QA 2OOEA 4HOTA 4FJYA 4K03A 4J8SA 3TWWA 4ABNA 4APOA 5KJMA 4K5BA 5EIBE 3TAXA 4U95D 3CVQA 3I4GA 2VGXA 3FUDA 4G1TA 2H6GA 1WAO1 4EZJA 1H0AA 3S2AA 3QJZA 3CR3A 1SQMA 3CVUA 3ESKA 4EBAA 1BU9A 2IF4A 3R7RA 5HS0A 4JXTA 2WXFA 2M63A 4ME2A 3KEAA 5AJDA 3B7TA 4GA0A 3ONLA 2OEVA 3CQCB 2LSUA 4IYPA 4H7YA 1N52A 2P9UG 2P9IG 2WXLA 2XZDG 4FLHA 2XEHA 4I6GA 4AEZC 1OY3D 3MX3A 4GZDA 1VDYA 2F8XK 4TXRA 4ANUA 4RVBA 3ZYQA 1MJ0A 3EUVA 4I9CA 2VGEA 4TUMA 5BNWA 4RQIA 5J90A 4ILGA 1E8XA 3IHVA 4X8QA 1N9AA 4HOQA 2LSVA 3MV2B 3PNLB 2Y4TA 2GRPB 4GTQA 3D3MA 4HQDA 3SY2A 5LX8A 2OCCE 1OCZE 2KM4A 1V55E 4Q96A 1XGWA 3G2WA 2VGXB 4DX7D 1IQRA 1IHGA 3RJVA 5C2YA 2J07A 4A3VA 4IN3B 2Q7FA 4FJZA 4LUNU 1MYOA 3AU4A 4XI9A 5ENOD 5CEAA 5KCMA 3S7FA 2DWZA 5E75A 5EKQD 4BTBA 5FQ4A 4JHJA 4FA6A 3APCA 4APFA 2IQCA 1S0PA 3QOUA 4B8AA 2R02A 4C0MA 4AIFA 4ATGA 1DVPA 1OCRE 1TN7A 1N4RA 2CG2A 1UN9A 2P9LG 3UM2A 3UXGA 1OWOA 2VSYA 4KVMA 4BSXA 4OVUA 3FY4A 2LXMA 4OAVB 4UI9C 5CERB 1H2VC 3QWWA 2QZAA 5KJKA 1N95A 4HB5A 1OWPA 3HXEA 3PZ3A 3SBSA 4WNFA 5JA4D 1HXIA 1DNPA 3DPDA 5ENPD 1S64A 4PS3A 4MRUA 3DEOA 4R7LA 2AVPA 4HI8A 4JC8A 5CMYA 2UY1B 3FTXA 3PREA 2WXKA 5FT9A 3UQ3A 3F6QA 4FULA 4U04A 2GW1A 5M72A 1SVXA 5FZSA 1OXJA 3U9WA 2XGMA 3Q9UC 4TUUA 4B89A 4A1SA 3C5RA 4MLPA 4PS8A 2QC9A 4U7EB 1RZ4A 2CG3A 3JQ1A 3GZSA 3NB2A 4DX1A 1FT1A 3ZYKA 1EPUA 2EIJE 2MOWA 3EHQA 1UJKA 1L5JA 1HG5A 5FJYA 3OXLA 4FU3A 3LY9A 4LEUA 5AARA 3FH5A 1HFAA 1UJJA 1DCEA 4AVXA 3S7JA 3E32A 2HO1A 3QAQA 4UWHA 1Z5SC 3OXGA 1NA3A 3T8MA 4GU5A 2CFZA 4GCNA 4HXIA 4JHRA 3P2BA 3W9FA 3NOGD 1SW6A 3HXDA 2L6JA 1BI7B 3CSFA 2V8SE 1EDUA 1TR4A 4O6FA 3ULEG 1TN8A 4N3BA 4ZFHA 3TXMA 3JYSA 3Q75A 3ENEA 4I1AA 3IXEA 2P2CP 2BKKB 1Z6TA 4J8FA 1Z3YA 5E76A 3CVYA 2R05A 4YDWA 4NRHB 2X3MA 3L22A 1H6OA 4E85A 5G05C 3LY8A 1YA0A 5KWDA 3K9IA 2AWIA 4WAFA 3LVRE 4C9BB 5KNHD 2J4BA 4QQIA 2GROB 4HS2A 3RAUA 4KVOA 3J5QB 1KT0A 3TGOA 2V0PA 4HOUA 4ANXA 3QWPA 3FH7A 2X6JA 2WXJA 1FVHA 4CZ2D 2DZNA 1LTXA 1A17A 4L1BA 3ZU7B 4GYOA 4J0UA 2VQ2A 3URZA 2UWJG 3MV3B 3KAEA 3QDNA 4I1MA 2MRIA 5EIDA 4GCOA 1IHBA 1K3ZD 2B6CA 5AYWD 4GA1A 3D9JA 4BFRA 1TNBA 2KATA 3NF1A 2XPZA 4XKCA 3RU0A 4WUYA 5BXOA 2WMNA 2ZISA 3QB2A 4A3TA 2WXIA 3TG5A 3CVNA 4LERA 1N94A 4FP7A 4BTAA 2JLBA 5DBKA 2XENA 4DK5A 2PQNA 5ENTD 3TWTA 1ELRA 3LDZA 3UI2A 5BT1A 4G26A 2KCKA 4UI9K 2I1JA 2WXPA 3DSTA 4DX5D 2OV8A 1S63A 1U3DA 3G2TA 3PS6A 3U4TA 3ASNE 2E0IA 2MYOA 2AXVA 1FPPA 4U0UA 5A23A 3C3RA 1TNUA 2WQHA 4KZCA 5ENSD 5HRYA 4BETA 3ZIMA 2YQ8A 4GTPA 3FFLA 3DSVA 2XPIA 5G05J 4BT8A 3PUJA 4ANWA 3EHRA 3EJNA 4JPSA 2PZIA 3LJNA 3SQVA 3VTYA 4M7CA 3DXKG 3SNXA 4V3IA 3DSUA 2A5UA 2NSZA 4XKBA 4GZ3A 4JZYA 3SBTB 2KBXA 1O5MA 3CKCA 4PUCA 1ZU2A 2IY0C 4GTSA 5FQ8A 4HFGA 5G04C 2YHEA 1K1AA 1AWCB 4JEUA 4GYYA 3ULYA 3Q15A 3RRUA 1MHQA 5CCLA 3EHNA 5ANLA 3FULA 4U8YD 4WWPA 3TWXA 5AN8A 3KSLA 5CHEE 4GMLA 3CSTA 2JABA 3ZRHA 2FO7A 3TG4A 4UQZA 3LXUX 3CVLA 4LNGA 5CBOA 2WB2A 2DZOA 1DC2A 3VLFA 3ULQA 1K8KG 4B0ZA 2UY1A 2I6HA 2CHXA 2WXRA 3RO2A 1BPOA 3MKQA 2MHKA 5D2MC 4I6JA 2QY7A 3AS8A 2WXHA 4CT4A 3KSQA 3JXJA 1JPLA 5ARGA 4GZCA 5B1AE 3I5PA 3LVQE 2DVWA 3I4RB 1LD7A 1K1BA 3CEQA 1SZ9A 3EU9A 2DYRE 1OCOE 3S7DA 3PRZA 4KMOA 2KC7A 3ABLE 3GW4A 3MKRA 4IRUA 3EHMA 5BV1A 4ILIA 4TRQA 4DRXE 2EQXA 3JCKC 4YNDA 3JQ0A 4AP2A 4XE0A 4BSZB 4NURA 4CGVA 3ZHEB 5AAOA 1QBQA 5KBAA 3TXNA 5HKPA 4OAUC 2EILE 2FO1E 3AU5A 4N3CA 3JUEA 3CHOA 3ZN3A 1FT2A 2X6HA 3V2OA 3T8KA 4WNEA 4N2SA 4IULA 5ARFA 4F1SA 3TJPA 4LNBA 3UPVA 2RG8A 3OAWA 2PNNA 3FEYA 3T5XA 1D8DA 2CHZA 2XEEA 2VJ8A 1PAQA 3DSXA 1TYQG 4A1GA 3PH0C 3L54A 2V4LA 3ZYMA 2HM8A 4AOFA 1IKND 1HS6A 2QYJA 3VTXA 1TJCA 1TNYA 4C0EA 4TXPA 3ASOE 2I2OA 5LCWC 3G2UA 2LAIA 1JCSA 2AXZA 1UW4B 1XNFA 2IEJA 3KD7A 5KNGA 2Y4UA 2VGYA 3HXFA 2LXLA 2DBAA 3Q78A 3DBSA 5D0QD 3CVXA 3DRAA 5B1BE 4U8HA 3LPZA 2GRMA 3AG1E 4FHKA 5BW8C 3ZXPA 4CCAA 3PZ1A 1RW2A 1O1TA 3FU6A 1N54A 1Y8MA 4J8EA 3UIPC 3IKOB 1UN8A 4C48B 4QFVA 3W9GA 4D10C 3B7RL 3BQOA 2KZTB 3ESLA 1MX4A 5J08A 4EBAG 3B7UX 4RG6A 3FUMA 3IBEA 3DPYA 4J7WA 1GW6A 2R17C 3ZFWA 2QYUA 2GRRB 3AG4E 1Q2ZA 5AENA 3BG1B 2WQ6A 1LF8A 2A4ZA 3CHSA 4UWFA 4HLEA 4HRLA 4B8CB 3QKYA 4RG9A 4JD2G 1NFIE 1E8ZA 3CK9A 3D9NA 4K0RA 3WXXA 5CRUA 1MZCA 5DIZA 4KZ0A 3Q73A 3CK7A 1TJFA 2IOLA 3QC1A 3B13A 3HIZA 5BXUA 4I2ZA 3RRNB 1KT1A 1KLXA 4EHMA 2YINA 5JMND 2RD0A 2X6IA 4U0SA 4U96D 3N71A 3SFZA 1NZNA 5LFAA 1H6KA 5JHAA 4Q69A 1HF8A 5B3SE 4NQ0A 2L9BA 2ONDA 2NYJA 3SZ7A 1TN6A 3G2VA 3UKRG 4LCTA 3O48A 4YVOA 4OYSA 5FZQA 4F3VA 3UM1A 3I3NA 2IONA 3SFYA 3ML8A 2PQRA 4GPMA 2XS1A 4JVSA 4JHKA 1E90A 3UT8A 3NAWA 4HI9A 4I43A 4M3OA 3V30A 2V5FA 2ETAA 3PZ2A 2R03A 2WXGA 3CHQA 2ZU6B 1MQSA 2R2LA 3CK8A 4HNAD 3TWSA 4UWLA 4F6RD 4A63B 4ATZD 4BEPA 3FUIA 3UINC 3UT4A 1IQUA 2GGFA 3ZXSA 3U64A 3PEUB 5CRVA 5EX3A 3UTMA 4MBGA 2C0LA 4E6HA 3L82A 4GAAA 5A7DB 1HO8A 3FU5A 4NACA 3ASFA 3VLEA 2ETBA 4JEHA 1PC2A 2Y3AA 3WG7E 3HXCA 3NBNB 3ONKA 1LD8A 3VLDA 3FTVA 3AAAC 4DUIA 3V79K 3NQPA 3CIAA 2J08A 5D66A 3CHMA 3E4BA 5AJLA 3RK6A 4UWGA 2XGSA 1E8YA 3CKBA 1N4SA 1BD8A 4Z68A 2EIKE 4B93B 2IU1A 3IV0A 2JEKA 1E7UA 3LY7A 4DX2A 3D9MA 2WXOA 1WY6A 4O1OA 4G11A 3MEKA 3TL5A 3MKQB 4N5CA 4F53A 2EINE 3ZUVB 3C3QA 3FUKA 3TWUA 3SO8A 3HG0D 3SFXA 2EIME 4EZKA 3LYAA 1KZOA 3BU8A 4Y6CA 1AP7A 3UIOC 2X38A 3UUXA 4I9EA 1YYHA 3G2SA 3HDXA 3Q9NC 1QNFA 2LAHA 1TNOA 4JW1A 3ZVVA 3QK0A 4K5CA
chains in the Genus database with same CATH topology
5AQ7A 5EIDA 1IHBA 3UTMA 1K3ZD 1BLXB 5CBNA 1D9SA 4OAVB 4UUCA 3B7BA 1QYMA 3HRAA 1WG0A 2RFMA 5CERB 2KBXA 4DRXE 2L6BA 2AJAA 3B95A 5CECB 3W9FA 2B0OE 4HB5A 5CEDB 3NOGD 1SW6A 1K1AA 5ENRD 5JMND 1AWCB 1BI7B 4HQDA 2ETBA 5BXOA 4BSZB 3TWWA 2F8YA 5AAOA 3ZNGA 3NBNB 1TR4A 3DEPA 4U96D 4BERA 5KBAA 4NIKA 3AAAC 1IXVA 4K5BA 5HKPA 4DUIA 5EIBE 5JA4D 4U95D 3V79K 4ZFHA 4GMRA 4OAUC 3V2XA 4O1PA 5ENPD 2FO1E 4C48B 4U8YD 1N0RA 2Y1LE 5D66A 3JUEA 1MX6A 4DX7D 3IXEA 4U8VD 2P2CP 2BKKB 2XENA 4DX6D 3DEOA 3TWVA 4HLLA 4QFVA 1A5EA 2V5QC 1G3NB 1BD8A 5FINA 5ENTD 3TWXA 4YDWA 3W9GA 3TWTA 5ENQD 2BKGA 4Z68A 3UI2A 4B93B 3V2OA 3T8KA 2NYJA 4HI8A 5AN8A 1BU9A 5FIOA 5HS0A 2Y0BG 3NOCD 3D9HA 1UOHA 4DX2A 3JXIA 2ETCA 4ZHBA 2JABA 1S70B 1MX4A 3F6QA 4G8LA 4O1OA 3AJIA 5EYPF 5KWDA 1MYOA 1SVXA 5ENOD 4DX5D 5CEAA 2PNNA 3KEAA 2DWZA 5KNHD 5CBOA 4J7WA 4J8YA 3TWRA 4QQIA 2DZOA 3ZUVB 3Q9UC 1DC2A 1N11A 2XEEA 1OT8A 4LNUD 3TWUA 4HRNA 3SO8A 2MYOA 4GPMA 3C5RA 3T9KA 3HG0D 2ZGGA 4CYMD 3J5QB 5AQ9A 1WDYA 1BI8B 4HRMB 4K5AB 4N5QA 1IKND 2QYJA 2HE0A 2QC9A 5EYLA 2XZDG 3V31A 4HRLA 1AP7A 3ZKJA 3TWQA 2XEHA 4DX1A 2RFAA 1OY3D 4LSZE 1YCSB 4HI9A 2J8SD 4RLYA 3J5PA 4G8KA 5ENSD 5AQBA 1MX2A 5HRYA 1NFIE 3V30A 2F8XK 1YMPA 2ETAA 4BETA 3JXJA 4YDYA 3EHQA 2KXPC 4CZ2D 2DZNA 4JB8P 2DVWA 4O60A 2ZGDA 4HNAD 1MJ0A 3TWSA 1K1BA 1N0QA 4F6RD 1YYHA 2VGEA 3EU9A 4A63B 4HBDA 3ZU7B 4ATZD 4BESA 2F37A 4F1PA 2V4HC 3EHRA 5AARA 4TUMA 4BEPA 3Q9NC 5EN5D 3UXGA 5ITZF 2A5EA 1DCQA 2XZTG 5KNGA 5EILA 5AQAA 4LG6A 3LJNA 5BXUA 4K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ7 A;  5EID A;  1IHB A;  3UTM A;  1K3Z D;  1BLX B;  5CBN A;  1D9S A;  4OAV B;  4UUC A;  3B7B A;  1QYM A;  3HRA A;  1WG0 A;  2RFM A;  5CER B;  2KBX A;  4DRX E;  2L6B A;  2AJA A;  3B95 A;  5CEC B;  3W9F A;  2B0O E;  4HB5 A;  5CED B;  3NOG D;  1SW6 A;  1K1A A;  5ENR D;  5JMN D;  1AWC B;  1BI7 B;  4HQD A;  2ETB A;  5BXO A;  4BSZ B;  3TWW A;  2F8Y A;  5AAO A;  3ZNG A;  3NBN B;  1TR4 A;  3DEP A;  4U96 D;  4BER A;  5KBA A;  4NIK A;  3AAA C;  1IXV A;  4K5B A;  5HKP A;  4DUI A;  5EIB E;  5JA4 D;  4U95 D;  3V79 K;  4ZFH A;  4GMR A;  4OAU C;  3V2X A;  4O1P A;  5ENP D;  2FO1 E;  4C48 B;  4U8Y D;  1N0R A;  2Y1L E;  5D66 A;  3JUE A;  1MX6 A;  4DX7 D;  3IXE A;  4U8V D;  2P2C P;  2BKK B;  2XEN A;  4DX6 D;  3DEO A;  3TWV A;  4HLL A;  4QFV A;  1A5E A;  2V5Q C;  1G3N B;  1BD8 A;  5FIN A;  5ENT D;  3TWX A;  4YDW A;  3W9G A;  3TWT A;  5ENQ D;  2BKG A;  4Z68 A;  3UI2 A;  4B93 B;  3V2O A;  3T8K A;  2NYJ A;  4HI8 A;  5AN8 A;  1BU9 A;  5FIO A;  5HS0 A;  2Y0B G;  3NOC D;  3D9H A;  1UOH A;  4DX2 A;  3JXI A;  2ETC A;  4ZHB A;  2JAB A;  1S70 B;  1MX4 A;  3F6Q A;  4G8L A;  4O1O A;  3AJI A;  5EYP F;  5KWD A;  1MYO A;  1SVX A;  5ENO D;  4DX5 D;  5CEA A;  2PNN A;  3KEA A;  2DWZ A;  5KNH D;  5CBO A;  4J7W A;  4J8Y A;  3TWR A;  4QQI A;  2DZO A;  3ZUV B;  3Q9U C;  1DC2 A;  1N11 A;  2XEE A;  1OT8 A;  4LNU D;  3TWU A;  4HRN A;  3SO8 A;  2MYO A;  4GPM A;  3C5R A;  3T9K A;  3HG0 D;  2ZGG A;  4CYM D;  3J5Q B;  5AQ9 A;  1WDY A;  1BI8 B;  4HRM B;  4K5A B;  4N5Q A;  1IKN D;  2QYJ A;  2HE0 A;  2QC9 A;  5EYL A;  2XZD G;  3V31 A;  4HRL A;  1AP7 A;  3ZKJ A;  3TWQ A;  2XEH A;  4DX1 A;  2RFA A;  1OY3 D;  4LSZ E;  1YCS B;  4HI9 A;  2J8S D;  4RLY A;  3J5P A;  4G8K A;  5ENS D;  5AQB A;  1MX2 A;  5HRY A;  1NFI E;  3V30 A;  2F8X K;  1YMP A;  2ETA A;  4BET A;  3JXJ A;  4YDY A;  3EHQ A;  2KXP C;  4CZ2 D;  2DZN A;  4JB8 P;  2DVW A;  4O60 A;  2ZGD A;  4HNA D;  1MJ0 A;  3TWS A;  1K1B A;  1N0Q A;  4F6R D;  1YYH A;  2VGE A;  3EU9 A;  4A63 B;  4HBD A;  3ZU7 B;  4ATZ D;  4BES A;  2F37 A;  4F1P A;  2V4H C;  3EHR A;  5AAR A;  4TUM A;  4BEP A;  3Q9N C;  5EN5 D;  3UXG A;  5ITZ F;  2A5E A;  1DCQ A;  2XZT G;  5KNG A;  5EIL A;  5AQA A;  4LG6 A;  3LJN A;  5BXU A;  4K5C A; 
#chains in the Genus database with same CATH topology
 2LO6 A;  3PDN A;  2YHC A;  1BLX B;  3SGH A;  2PL2 A;  1D9S A;  1WG0 A;  2RFM A;  2P9N G;  3CQG B;  2WXQ A;  2AJA A;  1JWG A;  3PNT B;  4XEI G;  5CEC B;  4CGW A;  2J4D A;  3Q4A B;  5H7P A;  1ELW A;  1NI1 A;  3FUE A;  5BUZ A;  4L23 A;  3FH8 A;  1IXV A;  4N39 A;  1X81 A;  3E37 A;  4FC8 A;  2AXU A;  4O1P A;  3GZ2 A;  4LRZ A;  3Q49 B;  2BED A;  1MX6 A;  2NC9 A;  4KXK B;  2I1K A;  4GPK A;  4DX6 D;  2CHW A;  3FUJ A;  1G3N B;  4Y6W A;  3R9A B;  4JA9 A;  5ENQ D;  2BKG A;  3KEZ A;  2WVI A;  2WMO A;  4G24 A;  4OVV A;  3JXI A;  4JL0 A;  3OXF A;  1W3B A;  2X6F A;  4DI3 A;  3DSW A;  4UWK A;  3SHF A;  1OCC E;  1E7V A;  2OVF A;  3BEE A;  1SZA A;  1N11 A;  3D9K A;  3ABK E;  5FZR A;  5T4Y A;  2WXN A;  3MZL B;  3L16 A;  4GTO A;  1U2V G;  5LP0 A;  4G8K A;  1TEZ A;  3LS8 A;  3Q7F A;  3KS2 A;  5CMW A;  4DI4 A;  2VTB A;  2VSN A;  1ZB1 A;  4O60 A;  2XGO A;  3HYM B;  2VSX E;  4BES A;  3AG3 E;  3RRM B;  1FCH A;  5EN5 D;  3APF A;  2XZT G;  1P5Q A;  4DLQ A;  3P1U A;  1OWL A;  2WPV A;  1ELK A;  5LCW J;  5BPP A;  3B7B A;  4GYW A;  4P29 A;  2BF0 X;  2L6B A;  5G2N A;  5CCM A;  5ENR D;  3FEX A;  2FF4 A;  4EQF A;  4ANV A;  4AV7 A;  3NZS A;  3UT7 A;  2F0Y A;  2DYS E;  4AXH A;  4UI9 J;  4AJW A;  4CT0 A;  4YVQ C;  3RKV A;  3EIQ C;  1N0R A;  4MKT A;  2LUH A;  4PDX A;  5LOZ A;  2V5Q C;  3FU0 A;  5FIN A;  3ASG A;  4I6E A;  3X2Q E;  1N4P A;  3SD5 A;  3ZW3 A;  1U3C A;  4G8L A;  5EYP F;  3L17 A;  1QZ2 A;  4BT9 A;  4KYO B;  4FLB A;  5JJT A;  3TWR A;  4I2W A;  1H2U A;  4XX5 A;  4AY6 A;  5AQ9 A;  3HXB A;  4N5Q A;  3R9M A;  1HE8 A;  4HOS A;  3OTN A;  4URK A;  1YCS B;  4HOR A;  2XEV A;  2GRL A;  3QAR A;  3ZEF A;  4JB8 P;  4G2V A;  5KJN A;  4H7X A;  2V4H C;  4GTR A;  4U0Z A;  3APD A;  1KPS B;  1DCQ A;  2BUG A;  1E96 B;  3FDH A;  2OEW A;  2HYZ A;  3D9L A;  2XRZ A;  1Z3X A;  1SA5 A;  1IYG A;  2R5S A;  4L2L A;  3Q7A A;  3UM0 A;  2VSO E;  1JCR A;  3S7B A;  3MA5 A;  2F8Y A;  3LEW A;  3MGB A;  4Q94 A;  5HI7 A;  4A55 A;  5EDS A;  3RSE G;  1Y6I A;  3ZGQ A;  1INZ A;  1N4Q A;  3L6A A;  2IFU A;  2Y1L E;  5ENN A;  3TWV A;  4AY5 A;  2GRN B;  4CDR A;  2WXM A;  2Y0B G;  3FTS A;  1NL4 A;  3FTY A;  1S70 B;  3HVE B;  3E30 A;  3AJI A;  5ANR A;  3EDT B;  1HU3 A;  3AG2 E;  5FTP A;  4LNU D;  3QWV A;  2QFC A;  3CGH A;  3GZ1 A;  4L9P A;  4HVB A;  5EX0 A;  3HVE A;  4HRM B;  4BX8 A;  3V31 A;  2PM7 A;  3TWQ A;  1EYH A;  4L7T A;  4LSZ E;  2P58 C;  4GMJ A;  4RLY A;  1MX2 A;  1YMP A;  4KBQ A;  2Y69 E;  4YDY A;  4TV3 A;  1JUQ A;  2DIW A;  2H6H A;  3U3W A;  5AIJ A;  1NA0 A;  2ZXW E;  2F37 A;  2C0M A;  4W9R A;  4GZ5 A;  3DSS A;  2L0I A;  3FUN A;  4XI0 A;  4LG6 A;  2CFU A;  3FUH A;  1NP7 A;  2XCC A;  4CEM A;  4FAD A;  2X6K A;  2XCB A;  3C72 A;  4GZ6 A;  3AS4 A;  3BG0 B;  5JJ7 A;  2IJG X;  3GYZ A;  1H2T C;  1E8W A;  4L2Y A;  5T8I A;  1X5B A;  4NIK A;  5JHB A;  4J6I A;  4DPR A;  4GMR A;  3PVL A;  3NZU A;  1OWN A;  3EIJ A;  4U07 A;  4U8V D;  2FBN A;  3C98 A;  5D0O D;  3PZ4 A;  4U63 A;  3C3O A;  1UG3 A;  2PM6 A;  3LKU A;  3UM3 A;  3Q79 A;  3ZPJ A;  2XQ0 A;  4PH4 B;  1TNZ A;  2BTD A;  2H6I A;  4I1O B;  2VYI A;  5BV0 A;  3PE4 A;  3ISM C;  1OT8 A;  4HRN A;  3T9K A;  5IY5 E;  1H19 A;  4ACK A;  3LCA A;  3JUI A;  3UMV A;  3J5P A;  1OUV A;  2J9Q A;  2ZGD A;  4F7A A;  3CV0 A;  4WWN A;  4HBD A;  3SI5 A;  4BX9 A;  3MJW A;  2WQ7 A;  2C2L A;  2GRQ B;  3SF4 A;  4PS7 A;  2KZT A;  5C1D A;  5AQ7 A;  2J49 A;  2I9C A;  3Q47 B;  3UKU G;  2E2E A;  4UUC A;  5KJL A;  3MYV A;  3PUK A;  3ASH A;  2FI7 A;  3ASD A;  1HZ4 A;  5HQ8 A;  1HG2 A;  4WNG A;  4EEC A;  3FP3 A;  3E34 A;  2P9S G;  3CHR A;  3ZNG A;  1D8E A;  5FWQ A;  2FUL A;  3B7S A;  4JA7 A;  3E33 A;  4J8D A;  4B94 A;  2DCP A;  3EU5 A;  3ZYL A;  3CVV A;  5G04 J;  2J09 A;  1QQE A;  4HLL A;  2LNI A;  3T5V A;  1V54 E;  3RO3 A;  5FIO A;  3NOC D;  1UOH A;  2YNQ A;  4ZHB A;  2ETC A;  2ZIR A;  3L13 A;  3D9I A;  3UX4 A;  3PEV B;  1HH8 A;  2L0T B;  2R59 A;  3DXM G;  3HHM A;  5FQ7 A;  4XIF A;  3FHE A;  2H6F A;  4DJA A;  4CYM D;  1WDY A;  3RIB A;  2HR2 A;  4K5A B;  4GTV A;  4DLO A;  3FUF A;  3ZKJ A;  1FVF A;  4AM9 A;  3BUA A;  1H6P A;  3FTZ A;  2OVB A;  4I17 A;  2KXP C;  2NXP A;  4UQY A;  1KZP A;  4GTT A;  3QNK A;  2P9K G;  3Q5M A;  3ML9 A;  1JCQ A;  2ILR A;  2A5E A;  4FHJ A;  4KT6 B;  4CDN A;  5EIL A;  3AS5 A;  2IO3 C;  5CBN A;  2XHE A;  1EF1 C;  1QYM A;  2AW6 A;  2P9P G;  1O1R A;  3L08 A;  3CVW A;  3D9P A;  5CED B;  3PE3 A;  1B89 A;  4N3A A;  3DEP A;  4BER A;  2IO2 C;  3ZHE A;  4RSY A;  2IOS A;  3V2X A;  5A6C A;  2KCV A;  2WM9 A;  3U66 A;  1A5E A;  4XZ4 A;  3FTU A;  1WM5 A;  5G55 A;  1HX8 A;  3LJ3 A;  4YDE A;  5T3R A;  2RKK A;  4MS6 A;  2XRY A;  3D9H A;  1PY1 A;  3L9T A;  4EPZ A;  4G23 A;  3IEG A;  4ILH B;  4UQX A;  1JWF A;  3FTW A;  4G25 A;  2FEZ A;  4J8Y A;  4GA2 A;  4BWR A;  2VTB B;  2ZGG A;  4GTM A;  1BI8 B;  2HE0 A;  3O4Z A;  5EYL A;  4TXQ A;  2RFA A;  3D9O A;  2J8S D;  4YDO A;  3CVP A;  5AQB A;  5JJ6 A;  2KCL A;  4WND A;  3PZD A;  3ABM E;  1O1S A;  1N0Q A;  2XPY A;  4F1P A;  3R7Q A;  4WWO A;  3FU3 A;  4CDM A;  5ITZ F;  3FWV A;  1OWM A;  5AQA A;  4CRW A;  2XS8 A;  4BY6 A;  3DWL G;  5FQ6 A;  1SA4 A;  3IHY A;  3CHP A;  3HRA A;  4GB9 A;  3CLJ A;  1ZBP A;  3MCX A;  3B95 A;  4EZL A;  2B0O E;  4ACL A;  4N2Q A;  2OOE A;  4HOT A;  4FJY A;  4K03 A;  4J8S A;  3TWW A;  4ABN A;  4APO A;  5KJM A;  4K5B A;  5EIB E;  3TAX A;  4U95 D;  3CVQ A;  3I4G A;  2VGX A;  3FUD A;  4G1T A;  2H6G A;  1WAO 1;  4EZJ A;  1H0A A;  3S2A A;  3QJZ A;  3CR3 A;  1SQM A;  3CVU A;  3ESK A;  4EBA A;  1BU9 A;  2IF4 A;  3R7R A;  5HS0 A;  4JXT A;  2WXF A;  2M63 A;  4ME2 A;  3KEA A;  5AJD A;  3B7T A;  4GA0 A;  3ONL A;  2OEV A;  3CQC B;  2LSU A;  4IYP A;  4H7Y A;  1N52 A;  2P9U G;  2P9I G;  2WXL A;  2XZD G;  4FLH A;  2XEH A;  4I6G A;  4AEZ C;  1OY3 D;  3MX3 A;  4GZD A;  1VDY A;  2F8X K;  4TXR A;  4ANU A;  4RVB A;  3ZYQ A;  1MJ0 A;  3EUV A;  4I9C A;  2VGE A;  4TUM A;  5BNW A;  4RQI A;  5J90 A;  4ILG A;  1E8X A;  3IHV A;  4X8Q A;  1N9A A;  4HOQ A;  2LSV A;  3MV2 B;  3PNL B;  2Y4T A;  2GRP B;  4GTQ A;  3D3M A;  4HQD A;  3SY2 A;  5LX8 A;  2OCC E;  1OCZ E;  2KM4 A;  1V55 E;  4Q96 A;  1XGW A;  3G2W A;  2VGX B;  4DX7 D;  1IQR A;  1IHG A;  3RJV A;  5C2Y A;  2J07 A;  4A3V A;  4IN3 B;  2Q7F A;  4FJZ A;  4LUN U;  1MYO A;  3AU4 A;  4XI9 A;  5ENO D;  5CEA A;  5KCM A;  3S7F A;  2DWZ A;  5E75 A;  5EKQ D;  4BTB A;  5FQ4 A;  4JHJ A;  4FA6 A;  3APC A;  4APF A;  2IQC A;  1S0P A;  3QOU A;  4B8A A;  2R02 A;  4C0M A;  4AIF A;  4ATG A;  1DVP A;  1OCR E;  1TN7 A;  1N4R A;  2CG2 A;  1UN9 A;  2P9L G;  3UM2 A;  3UXG A;  1OWO A;  2VSY A;  4KVM A;  4BSX A;  4OVU A;  3FY4 A;  2LXM A;  4OAV B;  4UI9 C;  5CER B;  1H2V C;  3QWW A;  2QZA A;  5KJK A;  1N95 A;  4HB5 A;  1OWP A;  3HXE A;  3PZ3 A;  3SBS A;  4WNF A;  5JA4 D;  1HXI A;  1DNP A;  3DPD A;  5ENP D;  1S64 A;  4PS3 A;  4MRU A;  3DEO A;  4R7L A;  2AVP A;  4HI8 A;  4JC8 A;  5CMY A;  2UY1 B;  3FTX A;  3PRE A;  2WXK A;  5FT9 A;  3UQ3 A;  3F6Q A;  4FUL A;  4U04 A;  2GW1 A;  5M72 A;  1SVX A;  5FZS A;  1OXJ A;  3U9W A;  2XGM A;  3Q9U C;  4TUU A;  4B89 A;  4A1S A;  3C5R A;  4MLP A;  4PS8 A;  2QC9 A;  4U7E B;  1RZ4 A;  2CG3 A;  3JQ1 A;  3GZS A;  3NB2 A;  4DX1 A;  1FT1 A;  3ZYK A;  1EPU A;  2EIJ E;  2MOW A;  3EHQ A;  1UJK A;  1L5J A;  1HG5 A;  5FJY A;  3OXL A;  4FU3 A;  3LY9 A;  4LEU A;  5AAR A;  3FH5 A;  1HFA A;  1UJJ A;  1DCE A;  4AVX A;  3S7J A;  3E32 A;  2HO1 A;  3QAQ A;  4UWH A;  1Z5S C;  3OXG A;  1NA3 A;  3T8M A;  4GU5 A;  2CFZ A;  4GCN A;  4HXI A;  4JHR A;  3P2B A;  3W9F A;  3NOG D;  1SW6 A;  3HXD A;  2L6J A;  1BI7 B;  3CSF A;  2V8S E;  1EDU A;  1TR4 A;  4O6F A;  3ULE G;  1TN8 A;  4N3B A;  4ZFH A;  3TXM A;  3JYS A;  3Q75 A;  3ENE A;  4I1A A;  3IXE A;  2P2C P;  2BKK B;  1Z6T A;  4J8F A;  1Z3Y A;  5E76 A;  3CVY A;  2R05 A;  4YDW A;  4NRH B;  2X3M A;  3L22 A;  1H6O A;  4E85 A;  5G05 C;  3LY8 A;  1YA0 A;  5KWD A;  3K9I A;  2AWI A;  4WAF A;  3LVR E;  4C9B B;  5KNH D;  2J4B A;  4QQI A;  2GRO B;  4HS2 A;  3RAU A;  4KVO A;  3J5Q B;  1KT0 A;  3TGO A;  2V0P A;  4HOU A;  4ANX A;  3QWP A;  3FH7 A;  2X6J A;  2WXJ A;  1FVH A;  4CZ2 D;  2DZN A;  1LTX A;  1A17 A;  4L1B A;  3ZU7 B;  4GYO A;  4J0U A;  2VQ2 A;  3URZ A;  2UWJ G;  3MV3 B;  3KAE A;  3QDN A;  4I1M A;  2MRI A;  5EID A;  4GCO A;  1IHB A;  1K3Z D;  2B6C A;  5AYW D;  4GA1 A;  3D9J A;  4BFR A;  1TNB A;  2KAT A;  3NF1 A;  2XPZ A;  4XKC A;  3RU0 A;  4WUY A;  5BXO A;  2WMN A;  2ZIS A;  3QB2 A;  4A3T A;  2WXI A;  3TG5 A;  3CVN A;  4LER A;  1N94 A;  4FP7 A;  4BTA A;  2JLB A;  5DBK A;  2XEN A;  4DK5 A;  2PQN A;  5ENT D;  3TWT A;  1ELR A;  3LDZ A;  3UI2 A;  5BT1 A;  4G26 A;  2KCK A;  4UI9 K;  2I1J A;  2WXP A;  3DST A;  4DX5 D;  2OV8 A;  1S63 A;  1U3D A;  3G2T A;  3PS6 A;  3U4T A;  3ASN E;  2E0I A;  2MYO A;  2AXV A;  1FPP A;  4U0U A;  5A23 A;  3C3R A;  1TNU A;  2WQH A;  4KZC A;  5ENS D;  5HRY A;  4BET A;  3ZIM A;  2YQ8 A;  4GTP A;  3FFL A;  3DSV A;  2XPI A;  5G05 J;  4BT8 A;  3PUJ A;  4ANW A;  3EHR A;  3EJN A;  4JPS A;  2PZI A;  3LJN A;  3SQV A;  3VTY A;  4M7C A;  3DXK G;  3SNX A;  4V3I A;  3DSU A;  2A5U A;  2NSZ A;  4XKB A;  4GZ3 A;  4JZY A;  3SBT B;  2KBX A;  1O5M A;  3CKC A;  4PUC A;  1ZU2 A;  2IY0 C;  4GTS A;  5FQ8 A;  4HFG A;  5G04 C;  2YHE A;  1K1A A;  1AWC B;  4JEU A;  4GYY A;  3ULY A;  3Q15 A;  3RRU A;  1MHQ A;  5CCL A;  3EHN A;  5ANL A;  3FUL A;  4U8Y D;  4WWP A;  3TWX A;  5AN8 A;  3KSL A;  5CHE E;  4GML A;  3CST A;  2JAB A;  3ZRH A;  2FO7 A;  3TG4 A;  4UQZ A;  3LXU X;  3CVL A;  4LNG A;  5CBO A;  2WB2 A;  2DZO A;  1DC2 A;  3VLF A;  3ULQ A;  1K8K G;  4B0Z A;  2UY1 A;  2I6H A;  2CHX A;  2WXR A;  3RO2 A;  1BPO A;  3MKQ A;  2MHK A;  5D2M C;  4I6J A;  2QY7 A;  3AS8 A;  2WXH A;  4CT4 A;  3KSQ A;  3JXJ A;  1JPL A;  5ARG A;  4GZC A;  5B1A E;  3I5P A;  3LVQ E;  2DVW A;  3I4R B;  1LD7 A;  1K1B A;  3CEQ A;  1SZ9 A;  3EU9 A;  2DYR E;  1OCO E;  3S7D A;  3PRZ A;  4KMO A;  2KC7 A;  3ABL E;  3GW4 A;  3MKR A;  4IRU A;  3EHM A;  5BV1 A;  4ILI A;  4TRQ A;  4DRX E;  2EQX A;  3JCK C;  4YND A;  3JQ0 A;  4AP2 A;  4XE0 A;  4BSZ B;  4NUR A;  4CGV A;  3ZHE B;  5AAO A;  1QBQ A;  5KBA A;  3TXN A;  5HKP A;  4OAU C;  2EIL E;  2FO1 E;  3AU5 A;  4N3C A;  3JUE A;  3CHO A;  3ZN3 A;  1FT2 A;  2X6H A;  3V2O A;  3T8K A;  4WNE A;  4N2S A;  4IUL A;  5ARF A;  4F1S A;  3TJP A;  4LNB A;  3UPV A;  2RG8 A;  3OAW A;  2PNN A;  3FEY A;  3T5X A;  1D8D A;  2CHZ A;  2XEE A;  2VJ8 A;  1PAQ A;  3DSX A;  1TYQ G;  4A1G A;  3PH0 C;  3L54 A;  2V4L A;  3ZYM A;  2HM8 A;  4AOF A;  1IKN D;  1HS6 A;  2QYJ A;  3VTX A;  1TJC A;  1TNY A;  4C0E A;  4TXP A;  3ASO E;  2I2O A;  5LCW C;  3G2U A;  2LAI A;  1JCS A;  2AXZ A;  1UW4 B;  1XNF A;  2IEJ A;  3KD7 A;  5KNG A;  2Y4U A;  2VGY A;  3HXF A;  2LXL A;  2DBA A;  3Q78 A;  3DBS A;  5D0Q D;  3CVX A;  3DRA A;  5B1B E;  4U8H A;  3LPZ A;  2GRM A;  3AG1 E;  4FHK A;  5BW8 C;  3ZXP A;  4CCA A;  3PZ1 A;  1RW2 A;  1O1T A;  3FU6 A;  1N54 A;  1Y8M A;  4J8E A;  3UIP C;  3IKO B;  1UN8 A;  4C48 B;  4QFV A;  3W9G A;  4D10 C;  3B7R L;  3BQO A;  2KZT B;  3ESL A;  1MX4 A;  5J08 A;  4EBA G;  3B7U X;  4RG6 A;  3FUM A;  3IBE A;  3DPY A;  4J7W A;  1GW6 A;  2R17 C;  3ZFW A;  2QYU A;  2GRR B;  3AG4 E;  1Q2Z A;  5AEN A;  3BG1 B;  2WQ6 A;  1LF8 A;  2A4Z A;  3CHS A;  4UWF A;  4HLE A;  4HRL A;  4B8C B;  3QKY A;  4RG9 A;  4JD2 G;  1NFI E;  1E8Z A;  3CK9 A;  3D9N A;  4K0R A;  3WXX A;  5CRU A;  1MZC A;  5DIZ A;  4KZ0 A;  3Q73 A;  3CK7 A;  1TJF A;  2IOL A;  3QC1 A;  3B13 A;  3HIZ A;  5BXU A;  4I2Z A;  3RRN B;  1KT1 A;  1KLX A;  4EHM A;  2YIN A;  5JMN D;  2RD0 A;  2X6I A;  4U0S A;  4U96 D;  3N71 A;  3SFZ A;  1NZN A;  5LFA A;  1H6K A;  5JHA A;  4Q69 A;  1HF8 A;  5B3S E;  4NQ0 A;  2L9B A;  2OND A;  2NYJ A;  3SZ7 A;  1TN6 A;  3G2V A;  3UKR G;  4LCT A;  3O48 A;  4YVO A;  4OYS A;  5FZQ A;  4F3V A;  3UM1 A;  3I3N A;  2ION A;  3SFY A;  3ML8 A;  2PQR A;  4GPM A;  2XS1 A;  4JVS A;  4JHK A;  1E90 A;  3UT8 A;  3NAW A;  4HI9 A;  4I43 A;  4M3O A;  3V30 A;  2V5F A;  2ETA A;  3PZ2 A;  2R03 A;  2WXG A;  3CHQ A;  2ZU6 B;  1MQS A;  2R2L A;  3CK8 A;  4HNA D;  3TWS A;  4UWL A;  4F6R D;  4A63 B;  4ATZ D;  4BEP A;  3FUI A;  3UIN C;  3UT4 A;  1IQU A;  2GGF A;  3ZXS A;  3U64 A;  3PEU B;  5CRV A;  5EX3 A;  3UTM A;  4MBG A;  2C0L A;  4E6H A;  3L82 A;  4GAA A;  5A7D B;  1HO8 A;  3FU5 A;  4NAC A;  3ASF A;  3VLE A;  2ETB A;  4JEH A;  1PC2 A;  2Y3A A;  3WG7 E;  3HXC A;  3NBN B;  3ONK A;  1LD8 A;  3VLD A;  3FTV A;  3AAA C;  4DUI A;  3V79 K;  3NQP A;  3CIA A;  2J08 A;  5D66 A;  3CHM A;  3E4B A;  5AJL A;  3RK6 A;  4UWG A;  2XGS A;  1E8Y A;  3CKB A;  1N4S A;  1BD8 A;  4Z68 A;  2EIK E;  4B93 B;  2IU1 A;  3IV0 A;  2JEK A;  1E7U A;  3LY7 A;  4DX2 A;  3D9M A;  2WXO A;  1WY6 A;  4O1O A;  4G11 A;  3MEK A;  3TL5 A;  3MKQ B;  4N5C A;  4F53 A;  2EIN E;  3ZUV B;  3C3Q A;  3FUK A;  3TWU A;  3SO8 A;  3HG0 D;  3SFX A;  2EIM E;  4EZK A;  3LYA A;  1KZO A;  3BU8 A;  4Y6C A;  1AP7 A;  3UIO C;  2X38 A;  3UUX A;  4I9E A;  1YYH A;  3G2S A;  3HDX A;  3Q9N C;  1QNF A;  2LAH A;  1TNO A;  4JW1 A;  3ZVV A;  3QK0 A;  4K5C A; 
#chains in the Genus database with same CATH homology
 5AQ7 A;  5EID A;  1IHB A;  3UTM A;  1K3Z D;  1BLX B;  5CBN A;  1D9S A;  4OAV B;  4UUC A;  3B7B A;  1QYM A;  3HRA A;  1WG0 A;  2RFM A;  5CER B;  2KBX A;  4DRX E;  2L6B A;  2AJA A;  3B95 A;  5CEC B;  3W9F A;  2B0O E;  4HB5 A;  5CED B;  3NOG D;  1SW6 A;  1K1A A;  5ENR D;  5JMN D;  1AWC B;  1BI7 B;  4HQD A;  2ETB A;  5BXO A;  4BSZ B;  3TWW A;  2F8Y A;  5AAO A;  3ZNG A;  3NBN B;  1TR4 A;  3DEP A;  4U96 D;  4BER A;  5KBA A;  4NIK A;  3AAA C;  1IXV A;  4K5B A;  5HKP A;  4DUI A;  5EIB E;  5JA4 D;  4U95 D;  3V79 K;  4ZFH A;  4GMR A;  4OAU C;  3V2X A;  4O1P A;  5ENP D;  2FO1 E;  4C48 B;  4U8Y D;  1N0R A;  2Y1L E;  5D66 A;  3JUE A;  1MX6 A;  4DX7 D;  3IXE A;  4U8V D;  2P2C P;  2BKK B;  2XEN A;  4DX6 D;  3DEO A;  3TWV A;  4HLL A;  4QFV A;  1A5E A;  2V5Q C;  1G3N B;  1BD8 A;  5FIN A;  5ENT D;  3TWX A;  4YDW A;  3W9G A;  3TWT A;  5ENQ D;  2BKG A;  4Z68 A;  3UI2 A;  4B93 B;  3V2O A;  3T8K A;  2NYJ A;  4HI8 A;  5AN8 A;  1BU9 A;  5FIO A;  5HS0 A;  2Y0B G;  3NOC D;  3D9H A;  1UOH A;  4DX2 A;  3JXI A;  2ETC A;  4ZHB A;  2JAB A;  1S70 B;  1MX4 A;  3F6Q A;  4G8L A;  4O1O A;  3AJI A;  5EYP F;  5KWD A;  1MYO A;  1SVX A;  5ENO D;  4DX5 D;  5CEA A;  2PNN A;  3KEA A;  2DWZ A;  5KNH D;  5CBO A;  4J7W A;  4J8Y A;  3TWR A;  4QQI A;  2DZO A;  3ZUV B;  3Q9U C;  1DC2 A;  1N11 A;  2XEE A;  1OT8 A;  4LNU D;  3TWU A;  4HRN A;  3SO8 A;  2MYO A;  4GPM A;  3C5R A;  3T9K A;  3HG0 D;  2ZGG A;  4CYM D;  3J5Q B;  5AQ9 A;  1WDY A;  1BI8 B;  4HRM B;  4K5A B;  4N5Q A;  1IKN D;  2QYJ A;  2HE0 A;  2QC9 A;  5EYL A;  2XZD G;  3V31 A;  4HRL A;  1AP7 A;  3ZKJ A;  3TWQ A;  2XEH A;  4DX1 A;  2RFA A;  1OY3 D;  4LSZ E;  1YCS B;  4HI9 A;  2J8S D;  4RLY A;  3J5P A;  4G8K A;  5ENS D;  5AQB A;  1MX2 A;  5HRY A;  1NFI E;  3V30 A;  2F8X K;  1YMP A;  2ETA A;  4BET A;  3JXJ A;  4YDY A;  3EHQ A;  2KXP C;  4CZ2 D;  2DZN A;  4JB8 P;  2DVW A;  4O60 A;  2ZGD A;  4HNA D;  1MJ0 A;  3TWS A;  1K1B A;  1N0Q A;  4F6R D;  1YYH A;  2VGE A;  3EU9 A;  4A63 B;  4HBD A;  3ZU7 B;  4ATZ D;  4BES A;  2F37 A;  4F1P A;  2V4H C;  3EHR A;  5AAR A;  4TUM A;  4BEP A;  3Q9N C;  5EN5 D;  3UXG A;  5ITZ F;  2A5E A;  1DCQ A;  2XZT G;  5KNG A;  5EIL A;  5AQA A;  4LG6 A;  3LJN A;  5BXU A;  4K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...