4UUJC

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
AAVALLLGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 43
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4uujC00
2AHZA 2A79B 3PJSK 3OR7C 3OUFA 1R3IC 1K4DC 1V54C 3T4ZA 3WG7C 2WLLB 5IY5C 4G28B 4J9ZB 4PA6A 4PDLA 2HVKC 3F7YC 4ZBMA 3LUTB 5J9PC 4I9WA 5B3SC 4P9OA 3K04A 3SYAA 4PA7A 3SPCA 2WLLA 3LDEA 4MVZA 3K03A 2WLIA 3GB7C 2A9HA 5EC1C 3ABMC 3AG1C 2DYRC 1BL8A 3VOUA 3IFXA 1LNQA 4PDMA 2DWDC 3ZRSA 1G4YB 1XL4A 2NLJC 2X6CA 4PA3A 2BOBC 5CBFA 3K06A 1ORQC 3SPGA 2Q67A 3T1CA 1OCOC 2QKSA 4G27B 4XDLA 4DXWA 3SYOA 4J9YB 2EIMC 2IH1C 3FB6C 2HJFC 2OCCC 5E1AC 3RVYA 2QTOA 4MVQA 3ABKC 5B1AC 2EIJC 1P7BA 2Y69C 3E89A 3K08A 2WLIB 4JTDB 4P30A 4WFGA 4XDJA 3E83A 3RW0A 1KKDA 3ASOC 4JTAB 4MVMA 2HG5C 2P7TC 3LDDA 4JTCB 3KG2A 2W0FC 1V55C 3OUSA 1J95A 2H8PC 3IGAC 5EC2C 4WFHA 5CBHA 4MVOA 5B1BC 3ASNC 4LP8A 4QE7A 2R9RB 1M56C 2DWEC 2WLJA 3E8FA 4WFEA 3SPJA 3AG4C 4RUFA 3RVZA 4MTFA 4RUEA 1OCCC 3K0DA 4PDVA 2JK5C 4P9PA 2WLHA 2YEVA 4BW5A 3E8BA 3UM7A 3K0GA 4MTGA 1M57C 3STZC 4R50A 4RAIA 4RO2A 2WLKA 4HZ3A 3X2QC 1R3JC 4MSWC 2ITDC 2K1EA 3E86A 2HFEC 2ATKC 2ZD9A 3LDCA 4GX0A 4H37A 4OXSA 3SPIA 4X8AA 4MVRA 1QLEC 3E8GA 5EBMC 4MVUA 3FB5C 3EFFK 2Q69A 3STLC 1R3KC 4X88A 4GX1A 1OCZC 1ZWIC 2AHYA 2WLMA 3SYCA 3ZJZA 2Q68A 3F7VC 4HYOA 2ZXWC 5CBGA 3F5WC 4KFMA 1K4CC 3JYCA 5KUMA 4R7CA 4H33A 3SYPA 4R6ZA 1JVMA 2EIKC 4MW3A 5EK0A 5KUKA 4PA4A 4GX5A 3LNMB 4CBCA 4QE9A 4QNHB 2X6AA 2ITCC 2Q6AA 2X6BA 3TCUA 3AG2C 1OCRC 3HPLC 2IH3C 2BOCC 3OR6C 5EBWC 5BZBA 4PDRA 4WFFA 3FB8C 4R8CA 4XDKA 3SPHA 3SJQC 2KB1A 4MVSA 3T4DA 3ABLC 2HVJC 5EBLC 4MS2A 1XL6A 4LCUC 4EKWA 2WLNA 3BEHA 4UUJC 3RBZA 1R3LC 2EINC 4MTOA 4P2ZA 3AG3C 3FB7C 3SYQA 2A0LA 3T2MA 3UKMA 4F4LA 4PA9A 4X89A 3TETA 2DYSC 4TWKA 3OGCC 4MW8A 4LBEC 3R65A 2EILC 1S5HC 4GX2A 3E8HA
chains in the Genus database with same CATH superfamily
3L9DA 1K4DC 5DECA 1VEWA 4RWUA 1K73W 2WLLA 3LDEA 1KMIZ 5EC1C 2EZOA 5F2VO 3D8CA 1NVPB 2HHHB 1NT2B 4JI0B 2LFRA 3K57A 2X6CA 2QR4A 5IJ0B 4NYKA 5GW7A 4AHCA 1F7YA 3B8MA 4YIOA 1P7GA 4X20A 4J9YB 3SJBC 4O2AB 5LMNO 4MVQA 3Q4HA 5B1AC 1AVMA 3JALA 2XAQA 4JPRA 5IYDO 3LDDA 3IGAC 2ZR2A 2BSKA 5B1BC 1R6TA 1FD9A 4LF8B 4RUEA 2OT5A 1F4MA 3K9SA 4TV8B 2HFEC 4H37A 2P06A 1FYJA 4LF7B 1NR1A 4J41A 5DN6G 3M8AA 3R66A 2LFSA 1IBKB 5CBGA 1E1QG 4R7CA 1NR7A 3BHPA 4DV2O 1S76D 2QDOA 4PA4A 1OCZB 3JCZA 2M7WA 3JAKA 2QWNB 1MSWD 3L73H 4PD4F 3ASNB 4KHPB 4EEQA 1M56B 1HNZO 5L3GA 1OCCB 1H2MA 5ITZA 5IWAO 4HAMA 2B5UA 4QPJA 1R3LC 4P2ZA 3CB2A 4X64B 1GTOA 5CA0A 4CH6A 1YIJV 3J80N 2XT9A 1NH2B 1S5HC 3E8HA 1TUBA 1P84F 2LQTA 1YF2A 4UCUA 1GM7A 4OGQB 3HKCA 4KUMA 3GWKC 2BTQA 1E1RG 2JVDA 3QG5A 3VQYA 2A7WA 1M4UA 5KAIZ 2CTQA 2Q67A 1FXKC 4TQDA 2IJHA 5LOVA 2WA3A 2LP7A 2UUAB 1XNRB 2V7QG 4YIPA 3UCSC 4B3SO 1NTMH 4UCOA 4MVMA 1JX9A 1DK1A 4DR3B 3EXAA 4YJ3B 5GTHZ 1W0JG 1Q90D 2E3CA 1D2DA 3ABMB 4PDVA 1KP3A 2XAHA 2WLHA 3UM7A 4FLVA 1VQLV 5B1BB 1R3JC 2ITDC 4WFAV 2ZD9A 3P3NA 2DQ3A 4KHPO 2HP8A 3CS5A 2B9ZA 3MAQA 4BAYA 3F7VC 2X7RB 3F5WC 5IDJA 1OHHG 3BABA 2EIKC 4MW3A 1Q5OA 4LC1A 5BMVB 1W0KG 3LSUA 4GX5A 3EVKA 4YHHB 5D5QA 4JI5B 3APOA 4J11A 4UVBA 2PF4E 4B3MO 2AZ2A 4EFEA 4O2BB 1HNWB 3SJQC 3ZN0A 2HVJC 3CX5F 5KA5A 2VQFB 4EB6A 3UKMA 2JS3A 3TETA 1SQBH 5A2QN 3E2EA 4DR6B 3CRCA 4EFBA 1CP9A 3ZHTA 4U3JB 1YZBA 1SA0B 2GTSA 4LF5O 2HVKC 3F7YC 4FIPC 1QVGU 1ZSPA 2JIZG 3FAVA 2YS8A 1PP9H 4PA7A 1GRJA 3S3WA 3WB2A 1R6KA 1XMQO 3CJHB 2ZCEA 4K0KB 2Y4UA 3IFXA 1LNQA 3EHBB 4TT3G 3OW2U 2EBOA 1OCRB 1Y67A 1SERA 1PNMA 4IYIA 2W6JG 5IE9A 1I5YA 4JV5B 2QM8A 3T1CA 4BIUA 2FL4A 4G27B 1Q6IA 1IBMO 3CWBH 3AG3B 5B5EZ 2DYSB 2Y69C 4BWAA 2UUBO 1KKDA 4B7KA 3CCMV 3RFRA 1KP2A 4DV3B 4CC5A 3CCJV 1J95A 2H8PC 4WBNA 1S77D 4X66O 4IIJB 4KL1A 3LSQA 4NTXA 3HR0A 4CZZA 1N0JA 1MZEA 1JA8A 2IJIA 3APQA 5IYBO 5KX5B 1NVPD 2UXXA 1H8HG 5FNVA 4LF4B 1Q8IA 3ZJZA 1RM1B 1Q86W 4CS2A 4Z2WA 2ZNIA 2VQFO 3SYPA 1QR8A 1IX9A 3U10A 4K35A 1FFXA 4JGSA 1M93A 4IHJA 4DR6O 4B3TB 4QE9A 3JD0A 1PNKA 3AG2C 3HPLC 1NI8A 5LXTB 1R6NA 1LUWA 2CAZC 2YI9A 4J7ZA 4HNAA 3SYQA 3H1KH 1HR0B 2F4VO 4JV5O 3CC7V 1EZJA 4J42A 3PJSK 3RGBA 5CB4A 1ZTEA 1G8MA 3CC4V 3ZMSA 2ZQMA 1GN4A 2VWJA 3SPCA 1I7FA 1WA8B 2NN4A 1RSOB 3CPWU 4O4JB 1VQ4V 1PL4A 1VQMV 1ZLZA 3P30A 2CE4A 1OCOC 3ZMTA 4DRXA 3RYIA 1WN7A 1UPGA 4JI1O 3RW0A 2P4VA 5D5PA 2AZ0A 3ASOC 4DK0A 2P7TC 2XAJA 4DK1A 5H2FZ 1YDXA 2QJ1A 1NH2D 4FLTA 4JZ2A 2JK5C 3QO8A 2YEVA 5KHGA 5AG2A 4LFBB 4WF9V 3RT3C 5E1AC 3SJCC 1FAFA 3C3TA 2EX3A 2F95B 4GT1A 2QM4A 3G6EV 1XNQO 4J80A 4LFAO 4I7ZB 1JFFB 1GAXA 4ABMA 2ZXWC 4CS4A 4R6ZA 1WP8A 2CUGA 1GM9A 5LGTA 3M7MX 3ML0A 2Z0AA 4CBCA 3L72H 1OV9A 2X6AA 3OT7A 5LP6C 1URFA 2PYJA 4Q20A 1MOFA 4J7KA 4GKJB 4FZ1A 2P6JA 2Q0OC 1NJIW 1DGSA 2BOCC 1J5EO 2QWPB 5DM6V 5B1OA 1Z2GA 1H2NA 1WP7A 4JI4B 4X1YB 3FB7C 4LFCO 1RPRA 2DJVA 4I55B 4UVCA 4NTWA 3RYHB 2BCCH 1MNGA 1O9GA 2AHZA 1GK9A 5BR8B 2ZE5A 2IU3A 4JAUA 2UUCO 4F6RB 4D7TA 1VF6C 4PA6A 5IYZA 3K04A 4GUNA 2P4KA 3J81N 2DYRC 2R9AA 3VOUA 4JI8B 1XMOO 1G4YB 1PV0A 3K5NA 4I9QA 3TGUH 1NU1H 1FJGB 4IL6Z 5DEDA 1DTOA 5LHGA 2JGDB 3P32A 1BE3H 2UXBB 5FPOA 3TJTA 1RPOA 2Q0AA 2WLIB 3G80A 4GCZA 4DW1A 1OCOB 2B1IA 3D3QA 2Q73A 3RYCA 3BCCH 2ZE7A 4NXNO 1JJ2U 2ZM6B 2Q8VA 4LWSA 5B3SB 4P9PA 1QHTA 3B4SA 4BW5A 3X2QC 5LBQA 2K1EA 2ATKC 4O4LA 3JASB 3KCYA 3K5OA 1QLEC 2ILMA 4GKJO 1I08A 4DR5B 3STLC 1I0HA 1R73A 2Q68A 1MG1A 1XREA 2OCCB 4X1IA 2GSMB 4LH7A 1GN3A 2IJJA 2EIJB 1Y76B 3JARA 1B6QA 1K3EA 2FB5A 4LF6B 4NB5A 1HDJA 4FLWA 1X59A 1K33A 5JVDB 1JPXA 5J2UB 3AG4B 5EBWC 5EZYA 4H13B 4UB8Z 5JQGB 5LA6A 4FM2A 2VQEB 3E22A 3HKEB 2Z3YA 5K1PA 4ZOLB 4LNUB 2EINC 2OIGA 4DR4O 4I4TA 2A79B 2Q7GA 1R3IC 4L87A 1YJWV 2UXBO 2WLLB 3FYIB 4G28B 4FFBA 5J9PC 2JEUA 1PKXA 3ETQA 1NZ6A 3L70H 4DV5B 2CGOA 3TXQA 3ZRSA 2L35A 2ZM6O 2EJ7A 1JQ0A 1GH6A 5CBFA 1THZA 2ZKOA 4X20B 3FD9A 4AQYO 3AK3A 3NR7A 1BZKA 3JALB 1TAEA 2HJFC 1IURA 3UT5A 1ZAUA 2EILB 4DR5O 2BSKB 3ZMVA 4GKKB 3DXRA 4PI2A 3RYFA 3K5LA 1VF6A 3E8FA 4DW0A 4I0XA 1ENVA 1N4CA 4LF6O 3E8BA 1S72V 3D3IA 3ABTA 4RO2A 2A3QA 2JS5A 3I5DA 4CC6A 1VQ5V 1AJNA 1VF5B 3QF7A 2MK3A 3S3XA 2UU9B 5EK0A 2YXLA 3JAKB 3LNMB 4J10A 2XAFA 2CH7A 3JSLA 4PJ0Z 3CCRV 2E76B 2R70A 2Q6AA 4DR2B 2Q9LA 4JI6O 1EFRG 4PI0A 1KECA 3FB8C 3W7SA 2QKCA 5EBLC 4DUZB 1XL6A 2VWKA 1BCCH 4B3RO 2PY5A 1I94B 2XNDG 1AJQA 2RCVA 4PA9A 1N32B 1PNLA 2KG7A 1K7DA 4TWKA 3OGCC 5KHJA 2Q7HA 5IJ0A 1YJ9V 1N33B 1SETA 2E5LB 5BXZA 1CXZB 3E35A 4AI8A 5IY5C 2E75B 1F4NA 4JI7B 4H44B 3HKCB 2BTQB 1FFTB 1QNMA 4AILC 2DN9A 2HHHO 2OIEA 3OFNG 2V4DA 4PA3A 4JI0O 5LOVB 2WSSG 3N2KA 3N27A 3IC9A 1FS0G 4UCSA 3ZRWA 4DXWA 2DMXA 4YY3B 2QTOA 3G4SV 1P7BA 4TV8A 3K9AA 1SESA 4BR6A 4ZI7A 2JJ2G 5JH7A 1K8AW 5KLVH 2RNBA 3OEEG 2EZPA 3JSNA 4DYLA 4LF8O 3G6BA 4R50A 4X8AA 3ZHUA 4DR2O 3T1YB 4JI3B 1N36B 1SS3A 4K3AA 3SJAC 4LF7O 1KYOF 4TOIA 1NKDA 4LF9B 5B1AB 1IBKO 2UXNA 5B1NA 4U7NA 2ZDIC 3QO7A 3O65A 3BA9A 1G6UA 3JATA 1U96A 1M9NA 4YJ2A 3JCUZ 5IT9N 3OMAB 1SQGA 4J7JA 1AROP 1NQTA 4MS2A 2GUZB 3UO2A 4X64O 1SRYA 3ABUA 3SDLA 3A2FA 3FAVB 4J9ZB 4Q6GA 4DR7B 3FKSG 3F5TA 3I55V 2QE7G 1XQ8A 4I50A 1Z5WA 2A9HA 4CH4A 4DV7B 4A5UB 4OX9B 2NLJC 2GTAA 4JF3A 4CH3A 2UXCB 3ZHSA 2QWQB 2DQ0A 1IXBA 1IXMA 3QO5A 2YI8A 2IH1C 3FB6C 4X1KA 2UXDB 4C7UA 4NKGB 1ZL8A 1AP6A 1XEQA 2UUAO 1XNRO 4DV1B 2JGUA 3U0ZA 1SQPH 2WPDG 4WBNB 2ZE8A 1Q3EA 1AI6A 3OE7G 3LNNA 2K9PA 4H0LB 5KHKA 3CP1A 4DR3O 3FYEB 1COWG 4FLZA 3T1HB 1WPBA 5KMGA 4IT5A 4X9QA 3WB0A 5LMUB 4GX0A 3LDCA 2A06H 5FNVB 1F23A 2Q69A 1FXKB 2AHYA 2P22C 3SYCA 3OM3B 4HYOA 3DC6A 1K4CC 3JYCA 1FFXB 4TQFA 1QLNA 1KQSU 4IHJB 3OEHG 4YHHO 4JI5O 3TCUA 1KB9F 1SA0A 3CD6V 3OR6C 2IH3C 2ZE6A 4FM1A 2F43G 4NR1A 4HNAB 3CJHA 1HNWO 2WLNA 1DF4A 3RBZA 1AP5A 4DV7O 4JI2B 3SGIA 1W59A 4X89A 1LR1A 3KZIZ 3MDSA 2FKXA 1JCHA 3OUFA 3OR7C 1XUQA 2FMLA 3T4ZA 3WG7C 1QCEA 3HB3B 3CCLV 2EIKB 4NXMB 1D5AA 3SR2C 4O4HA 4DV1O 2QGNA 3OMNB 4UFZA 2ZDIA 3AG1C 2ZT9B 3CYOA 2OWOA 2QWRB 4JYYA 4GLXA 4K0KO 1Y66A 2BOBC 3K06A 4DRXB 1ORQC 3K3WA 2JRIA 3RYIB 1BT8A 1VP7A 2F23A 5GONA 1WAZA 4O4IA 3AEIA 4XDLA 2EIMC 1EZVH 2KQXA 1JJOA 3G71V 3TK1A 4XDJA 4PELA 3CRQA 2WWWA 3G67A 3BA8A 3RN4A 1H2SB 2YIBA 1BHBA 1M1KW 1R1BA 2OTLV 2LJ2A 4I5SA 4DV3O 1F51A 1TVKA 2YEVB 2YXHA 3N2GA 5EYPB 4QPKA 4JZGA 1H38A 4HZ3A 3T2MA 4DV6B 3ZHRA 4QGPA 2PI5A 1GM8A 4MVUA 2JJ1G 2ZNJA 2VRZA 1WPXA 4LF4O 2Y69B 1KKCA 1JVMA 4X65B 2RN9A 3C3SA 2Y0PA 1JR9A 2ITCC 2X6BA 4B3TO 1KUQA 2Q4PA 3QNEA 3ZHVA 4X62B 4R8CA 3KCXA 3ABLC 5C8YA 2PZSA 3A8TA 3CXCU 4EKWA 1V9PA 3UQ8A 3VQXA 4IYHA 4O4JA 5H9CA 1K5QA 4D6TH 4TUYB 1FKAO 1SQFA 2XAGA 2ARHA 4DV0B 4GX2A 2QKAA 5L3CA 1HR0O 1V54C 3GVMA 3LUTB 2BE3A 1SZTA 4ASUG 3MHHC 3K03A 3HKDA 1EN4A 3ZMUA 2WAMA 4PDMA 3AG2B 2NR5A 3C90A 1VMGA 1KBHA 1AI4A 3JAWB 3DTUB 2CK3G 3ZBHA 3VQVA 2QM7A 3WB1A 3ABKC 3K08A 1XHZA 3E83A 2F1MA 3CMEV 4MTXA 4LWSB 2YICA 5KHHA 5EC2C 4ZHQA 4BIZA 1AR5A 3KKYA 1Q81W 5J2TB 1FXVA 2H3OA 4O4LB 3K0GA 1M57C 1S5LZ 2D3OW 4LFBO 3E86A 2NNUA 2QTSA 1K92A 3CHXA 1N34B 4DV4B 5JCOA 2R72A 1MMMA 2RMKB 3JARB 3ZN1A 2MW2B 2P67A 1B06A 1HNXB 4UXNA 3ASOB 4ZKIA 3K5MA 3CCUV 5FPRA 4DV0O 1EN6A 5EZYB 5LA6B 1WB8A 2GDSA 2N74A 4WFFA 3D36A 3IC7A 3OD4A 3ETEA 1FPOA 4JI4O 2A0LA 2IW5A 4I4TB 1XI1A 3ZIAG 3W7UA 2ZXWB 5BR8O 5EIBC 1KC8W 2CTPA 5JJJB 1YXBA 2WLIA 1HW7A 1NS1A 2DE0X 5LP6B 5LGUA 4JI8O 1Y74A 1AR4A 5IJ9A 1QVFU 2L6LA 3UT5B 4WCEV 4WFBV 1FJGO 5LMNB 3JD4A 2XOKG 4WFGA 3DXRB 4JTAB 3RYFB 1RFYA 4DV4O 4JTCB 3KG2A 1V55C 1YSCA 3IJ4A 3OTOB 4I0XB 3ASNC 2C2AA 1M56C 2DWEC 2WLJA 1HNXO 3RVZA 2HEPA 1OCCC 4FFKA 3K0DA 2D2CB 2DYRB 1WNSA 2V1DA 1YCIA 1MZFA 1VIBA 3L71H 4BW9A 4TV9A 3STZC 3Q4HB 3L74H 4GX1A 3CCVV 1Q82W 3CMAV 2WLMA 5CA1A 1XBLA 1AILA 2P90A 1SKVA 4ZOLA 4LNUA 3CCSV 2CH7B 2CTWA 3UO3A 5TISZ 1CPYA 3U11A 1QU7A 1HNZB 4QNHB 3HKBA 3VQWA 1VQ8V 2PYLA 4Z1VA 3MHSC 5IWAB 4XDKA 1AB3A 3B8NA 3X2QB 1HP8A 2VQEO 1L1FA 2KG7B 1QLEB 3O9OA 4LBEC 3R65A 3H1JH 3RVYA 3H1IH 1SF9A 4CH5A 1UJWB 1JMKC 2RJZA 1JOYA 3WFVA 2BTOA 2B1GA 5ITZB 1Q43A 4P9OA 4F6EA 4KXRA 1H2GA 3ABMC 4LH6A 1BL8A 2LW1A 3CRMA 4DV5O 4NVPA 5CA0B 1EN5A 4JYBA 3OTOO 3N2KB 2AW9A 1BQ0A 3ZRWB 3CCEV 1TUBB 3A0HZ 5JJEB 3ETDA 1XOUA 2EINB 5CMUA 4B3SB 3E89A 5BY1A 2F66C 4N21A 3FFQA 4ZI7B 2XHBA 4O2AA 5GTIZ 1SC5B 5JH7B 4FLUA 3OUSA 4GKKO 1UFIA 4QE7A 2ADQB 1YVWA 2XUMA 2ADPA 3QVNA 1WB7A 4IGGA 1V55B 2EULA 3ZHQA 2LGQA 2WLKA 2PUSA 4MSWC 3OAAG 4UCTA 4OXSA 1GMGA 1NTKH 3FB5C 4X88A 4FJCC 1D5NA 2H94A 1BS3A 4OPHA 5KUMA 3W7WA 2HKOA 4H33A 4PV1B 4L8JA 3J7AU 2IJKA 2UU9O 3JATB 1TA8A 4QJFB 4YJ2B 4B3MB 1BSMA 1OCRC 3A0RA 3CSXA 1K34A 2Y0IA 2YIDA 4LCUC 4DUZO 1B04A 2YIAA 4MTOA 3AG3C 4FMTA 1ZUQA 1I94O 5H6RA 2DYSC 3IAYA 1N32O 1L0LH 2CDYA 4QIWF 1A32A 3OTFA 4LF5B 1N33O 2HLDG 3H1HH 1IBLB 2E5LO 1XMQB 4PDLA 4I50B 5LHHA 1L8DA 2FTKA 3MD0A 1Y6XA 5L3EA 3GB7C 4JI7O 2ZR3A 4EB6B 1US6A 1G1XB 3SPGA 4X1KB 3H9VA 1IBMB 2QKSA 1ZL8B 1PL0A 1Q6HA 1RM1C 2UUBB 1H2LA 2LW7A 4YY3O 2HG5C 3QTCA 3K59A 5IY5B 4WFHA 4X66B 4MVOA 5KMGB 4JASA 4FK5C 4YJ3A 1YEWA 2O57A 1ZX3A 1NTZH 5LGNA 1KU9A 2DW4A 3CC2V 3CRAA 1N0NA 1S0VA 1SZXA 5H5NA 2W0XA 4U7OA 3T1YO 4JI3O 1N36O 4KFMA 4N23A 2RDCA 4B7EA 2OTJV 2GUZA 2EJRA 1MABG 1YTFB 4LF9O 5KUKA 3DSQA 5CN0A 1YI2V 5BMVA 2KKWA 3BAAA 1X4TA 1IBLO 1K9MW 4RQFA 1GKFA 4PDRA 2P5OA 3BVOA 2KB1A 3T4DA 4UVAA 4YXWG 3NXSA 4O2BA 4UUJC 1S5JA 3BEHA 2ODMA 3CRRA 1Q7YW 2DOSA 5C93A 1GN6A 4F4LA 3W7TA 3JAMN 5L3DA 1QR9A 4U3FH 2F4VB 1U97A 1AR1B 2FYUH 2WA4A 1MA1A 2ZIMA 4O4HB 4U3JA 4ZBMA 4I9WA 1AI7A 3SYAA 1W2BU 3ZCCA 4DR7O 1XILA 2YUAA 1P4RA 2G38A 4DR1B 2AGAA 2ZINA 3H01A 2XTAA 2M6YA 1WJZA 4NTYA 1YITV 3THOA 1Q6UA 4OX9O 5GONB 2UXCO 4O4IB 5CB4B 1B3QA 2QEXV 1T5EA 2JEXA 4JI1B 4B08A 1NBMG 1TUEB 2UXDO 4P30A 3A0BZ 4HBNA 4UCRA 3M99B 1E79G 4XBFA 1YJNV 3P3PA 1FXKA 1BMFG 1WLEA 2W0FC 1GN2A 1XDCA 1TVKB 4LP8A 3N2GB 5LHIA 2QA4V 2R9RB 4MTFA 5JCOC 3PN1A 4IIJA 3T1HO 3BPZA 5A9GA 2R9IA 1P49A 2W6IG 1XNQB 1VQ6V 5LMUO 4LFAB 3EFFK 5K1XA 3AG7A 5EIBD 1EM1A 4FLYA 1QBZA 3OMIB 3TXSA 2N04A 5KX5A 1SQQH 4UB6Z 5KA6A 3OGIB 4MT8A 3LSSA 3D36C 1H2KA 5KHIA 1TGOA 1J5EB 1VQOV 3BY6A 5LYJA 5LYJB 2CGNA 3AK2A 2YXYA 5C8YB 3B09A 2IBZH 1VF7A 3SPHA 1IZ3A 3ZS8C 1BGYH 4MVSA 3ZMZA 4FPPA 5LXTA 2YSUB 4GYCB 4LFCB 4DR1O 2ZIOA 4JI2O 1PPJH 2UUCB 1VQPV 4W4LA 1DLBA 1L0NH 2YDEA 3JD2A 2QWOB 3HKDB 5B3SC 4G2KA 4NXMO 1EBOA 4MVZA 1XHXA 2GV9A 1XMOB 1Z5VA 1WA8A 5FLXN 1Y4MA 2RQ6A 1XL4A 1RSOA 2AXTZ 4JAAA 3B40A 3H1LH 1OZ0A 4FZ0A 1N8RW 5JWPA 4JYCA 3CXHF 5EYPA 4FM0A 5IYZB 2OCCC 5IYCO 2EIJC 4JTDB 1HWYA 1K5SA 4ICGA 4NXNB 4ZHQB 3L75H 3WG7B 1FXHA 1VQKV 1K97A 4WFEA 3AG4C 2N05A 1YHQV 4W4KA 4CS3A 3DC5A 3AG1B 4PHZA 4UV9A 1H8EG 1RP3B 4ZIBA 4FLXA 2GBOA 3SPIA 3E8GA 5EBMC 4DV6O 4BIOA 5L3FA 2Y4TA 3RYCB 1R3KC 5FL7G 1ZWIC 3ZX6A 2EIMB 3BRCA 1KD1W 2Z5UA 1JFFA 4FVMA 3JD3A 1M5IA 4X65O 1OJHA 1VARA 3WU2Z 4Z1MG 4K8XA 4TUYA 5HFLA 5LL6Y 5KAFZ 1M90W 3B2EE 5E79Z 4LR3A 4X1IB 4X62O 2KSDA 5HFMA 2IM9A 4DR4B 3I56V 4X1YA 3B77A 2F93B 4RQEA 4MW8A 2EILC 4DUYB 3JAWA 2YC0A 4I55A 3RYHA 2QSAA 4DO2A 4UCVA 4GZRB 2OCHA 4F6RA 3E22B 4JYAB 2X0LA 1I5XA 3BFRA 1QQCA 2IU0A 2DWDC 1Y74B 3ICXA 2VS0A 5IJ9B 1YTFD 4JAVA 3ETGA 3W7XA 1GO3F 1DF5A 2XASA 4AQYB 1PM9A 2ETNA 3ABLB 2JDIG 1IDSA 5B66Z 3ZEDA 3DGEA 2LO1A 5J2TA 3SYOA 4FFBB 2JGDA 4D7SA 1O9HA 1BHAA 1VQNV 4TSFG 4OPAA 1V54B 5CA3A 5CBHA 4E4EA 3K58A 1ROPA 5L3BA 3SPJA 4RUFA 3ZRXA 2Y48A 3FX7A 2Q7EA 4TV9B 2PI4A 1CEZA 4MTGA 4RAIA 2PGGA 3JD1A 4MVRA 5CA1B 1VQ7V 3JASA 2Q5ZA 1OCZC 3K79A 1N34O 3ABKB 1SQVH 5JJNB 2GHYA 2HR3A 1S3JA 4K8ZA 1SQXH 1LUVA 1Y76A 4E2LA 1AJPA 1VQ9V 3VBBA 3HKBB 4UV8A 4DUYO 3ZRVA 2HJDA 4JI6B 2LGWA 2YIBD 1BQZA 1PD3A 3AK1A 5BZBA 5JVDA 4KP4A 2E74B 5J2UA 4B3RB 3CCQV 5JQGA 1M57B 2PTMA 1MSDA 2CTRA 4JYAO 3CEIA 5H6QA 3GWOA 3HKEA 3RWRD 1AI5A 5LP6A 4DV2B 3CE2A 1IVSA 2OYQA
chains in the Genus database with same CATH topology
2AHZA 1JCHA 3OR7C 3OUFA 1K4DC 2HLDG 3T4ZA 3WG7C 1QCEA 2IU3A 3HB3B 4JAUA 3CCLV 2EIKB 4PDLA 4PA6A 5LHHA 2FTKA 3K04A 3MD0A 1K73W 2WLLA 3LDEA 5EC1C 5L3EA 3GB7C 2EZOA 3OMNB 2ZR3A 2ZDIA 3AG1C 2DYRC 3VOUA 1NVPB 3CYOA 1G4YB 2LFRA 1Y66A 2X6CA 2BOBC 3K06A 5GW7A 1ORQC 3K3WA 3B8MA 3SPGA 1DTOA 5LHGA 2QKSA 1PL0A 3AEIA 3P32A 4XDLA 4J9YB 2EIMC 1RM1C 3G71V 4MVQA 1RPOA 5B1AC 3TK1A 4XDJA 4PELA 2WLIB 4GCZA 1OCOB 2XAQA 2WWWA 4JPRA 2B1IA 5IYDO 2HG5C 3LDDA 1BHBA 1M1KW 2OTLV 4I5SA 3IGAC 2ZR2A 1JJ2U 5IY5B 4WFHA 4MVOA 5B1BC 1F51A 4JASA 5B3SB 4FK5C 2YEVB 4RUEA 4P9PA 2OT5A 4BW5A 4QPKA 1F4MA 5LGNA 1H38A 3X2QC 4HZ3A 5LBQA 2DW4A 2K1EA 3T2MA 3CC2V 2HFEC 2ATKC 4H37A 1S0VA 2PI5A 1QLEC 1GM8A 4MVUA 1NR1A 3STLC 5DN6G 4U7OA 1R73A 2JJ1G 2LFSA 2Q68A 1MG1A 2OCCB 5CBGA 4KFMA 1WPXA 2GSMB 4N23A 2OTJV 1E1QG 2EIJB 2IJJA 1NR7A 2EJRA 2Y69B 4R7CA 1JVMA 1B6QA 1MABG 1K3EA 1S76D 1YTFB 5KUKA 4PA4A 1OCZB 5CN0A 1YI2V 3JCZA 2M7WA 1MSWD 2ITCC 1K33A 2X6BA 3ASNB 1M56B 1JPXA 3QNEA 5L3GA 3AG4B 1K9MW 5EBWC 1OCCB 4RQFA 1GKFA 4PDRA 4R8CA 2KB1A 3T4DA 3ABLC 4UVAA 4HAMA 3NXSA 2B5UA 4YXWG 2Z3YA 3CXCU 4EKWA 4UUJC 3BEHA 1Q7YW 5C93A 4QPJA 1R3LC 2EINC 4P2ZA 4F4LA 3W7TA 5L3DA 1QR9A 1GTOA 5H9CA 1K5QA 1YIJV 1AR1B 2XAGA 1NH2B 1S5HC 4GX2A 3E8HA 5L3CA 2A79B 1R3IC 4L87A 1V54C 1YJWV 2WLLB 3FYIB 4G28B 4ZBMA 3LUTB 5J9PC 4I9WA 1SZTA 1AI7A 2JEUA 1PKXA 3SYAA 3MHHC 4ASUG 1W2BU 3ZCCA 3K03A 1P4RA 3ZMUA 1GM7A 2WAMA 4PDMA 3H01A 4KUMA 3ZRSA 1E1RG 3AG2B 1YITV 1JQ0A 5CBFA 1THZA 1AI4A 2Q67A 3DTUB 1FXKC 2CK3G 2IJHA 2QEXV 2JEXA 2HJFC 2QM7A 2LP7A 1NBMG 2V7QG 3ABKC 1TUEB 3K08A 4P30A 3E83A 3M99B 1E79G 2EILB 4XBFA 1YJNV 3CMEV 4MTXA 4MVMA 3ZMVA 1JX9A 1FXKA 1BMFG 1WLEA 2W0FC 5EC2C 4LP8A 5LHIA 2QA4V 4BIZA 2R9RB 1W0JG 3E8FA 4MTFA 1Q81W 3ABMB 4PDVA 1KP3A 1ENVA 2XAHA 2WLHA 1FXVA 3E8BA 3UM7A 1VQLV 1S72V 3K0GA 3D3IA 1M57C 3ABTA 5B1BB 4RO2A 2D3OW 1R3JC 2R9IA 2ITDC 3E86A 4WFAV 2W6IG 2ZD9A 1VQ6V 2DQ3A 2NNUA 1K92A 1VQ5V 3EFFK 1AJNA 4BAYA 1QBZA 3OMIB 3F7VC 2MK3A 2X7RB 3ZN1A 3F5WC 5IDJA 2P67A 1OHHG 5KA6A 2EIKC 4MW3A 4LC1A 5EK0A 1W0KG 4UXNA 4GX5A 3LNMB 3ASOB 4MT8A 4ZKIA 3LSSA 2XAFA 3CCUV 3CCRV 2Q6AA 4UVBA 1VQOV 3BY6A 1EFRG 1KECA 4WFFA 3FB8C 3SPHA 3SJQC 3ZMZA 4MVSA 3W7SA 3D36A 3ZN0A 2HVJC 5EBLC 3IC7A 4FPPA 1XL6A 2YSUB 3ETEA 5KA5A 2XNDG 1AJQA 3UKMA 2A0LA 3TETA 4PA9A 2IW5A 1PNLA 3E2EA 1K7DA 4TWKA 3OGCC 1YJ9V 3ZIAG 1SETA 1CP9A 3W7UA 2ZXWB 1VQPV 3E35A 1DLBA 5IY5C 3JD2A 1F4NA 2HVKC 3F7YC 4FIPC 1QVGU 5B3SC 2JIZG 1KC8W 4G2KA 4PA7A 1EBOA 1R6KA 4MVZA 2WLIA 1FFTB 3IFXA 1LNQA 3EHBB 4TT3G 3OW2U 5LGUA 1Y4MA 2EBOA 1OCRB 1XL4A 3OFNG 4PA3A 1SERA 1PNMA 2W6JG 1I5YA 1OZ0A 1N8RW 2QM8A 2WSSG 4JYCA 3T1CA 4BIUA 1QVFU 4G27B 4WCEV 4WFBV 1FS0G 3ZRWA 4DXWA 3JD4A 3AG3B 2OCCC 2XOKG 2QTOA 5IYCO 3G4SV 2DYSB 2EIJC 1P7BA 2Y69C 4JTDB 4WFGA 1KKDA 3K9AA 1SESA 1HWYA 3CCMV 1K5SA 4JTAB 1KP2A 4JTCB 3KG2A 1V55C 3WG7B 1YSCA 1J95A 1FXHA 2H8PC 2JJ2G 3CCJV 1K8AW 1VQKV 1S77D 3ASNC 2C2AA 1K97A 1M56C 2DWEC 2WLJA 3OEEG 4WFEA 3AG4C 3RVZA 1YHQV 2EZPA 1OCCC 3K0DA 3LSQA 3AG1B 2DYRB 4UV9A 2V1DA 1H8EG 3STZC 4CZZA 4R50A 3SPIA 2IJIA 4X8AA 3E8GA 5EBMC 5L3FA 5IYBO 1NVPD 1R3KC 2UXXA 4GX1A 3CCVV 1H8HG 1ZWIC 5FL7G 3CMAV 1Q82W 2WLMA 2EIMB 3ZJZA 1RM1B 1KD1W 1Q86W 2Z5UA 1NKDA 2P90A 5B1AB 3CCSV 3SYPA 2UXNA 5B1NA 1QR8A 3JD3A 4U7NA 2ZDIC 4JGSA 3QO7A 1CPYA 4Z1MG 5HFLA 4QE9A 3JD0A 4QNHB 1PNKA 1M9NA 3AG2C 3HPLC 1VQ8V 1M90W 3OMAB 3MHSC 4XDKA 1R6NA 1AROP 1NQTA 3B8NA 4MS2A 3X2QB 5HFMA 1L1FA 3SYQA 1QLEB 3I56V 3B77A 4RQEA 1SRYA 4MW8A 3ABUA 4LBEC 3R65A 2EILC 3RVYA 3CC7V 1EZJA 3PJSK 1UJWB 4J9ZB 1G8MA 3WFVA 4DO2A 1JOYA 3CC4V 2B1GA 3ZMSA 2ZQMA 3FKSG 4P9OA 3I55V 3SPCA 2QE7G 1H2GA 2A9HA 3ABMC 2X0LA 1I5XA 1BL8A 2IU0A 2DWDC 3CPWU 1YTFD 2NLJC 4JAVA 4JF3A 1VQ4V 1VQMV 3ETGA 3W7XA 4JYBA 1GO3F 3P30A 1DF5A 2XASA 3ZRWB 3CCEV 3ABLB 2DQ0A 1IXMA 2JDIG 1OCOC 3QO5A 3ZMTA 3DGEA 3ETDA 3SYOA 3FB6C 2IH1C 2EINB 5CMUA 3E89A 3RW0A 4N21A 1BHAA 1VQNV 2WPDG 3ASOC 4TSFG 2P7TC 1AI6A 1V54B 3OE7G 3OUSA 5CA3A 5CBHA 2XAJA 3CP1A 4QE7A 3FYEB 1COWG 1ROPA 5L3BA 3SPJA 1NH2D 4RUFA 3ZRXA 2Y48A 2JK5C 2PI4A 1V55B 1CEZA 3QO8A 2YEVA 4WF9V 4MTGA 4RAIA 2WLKA 4MSWC 5E1AC 4GX0A 3OAAG 3LDCA 4OXSA 3JD1A 4MVRA 1GMGA 4GT1A 3G6EV 1F23A 3FB5C 1VQ7V 2Q69A 1FXKB 4X88A 1OCZC 2AHYA 3K79A 4FJCC 3SYCA 3OM3B 4HYOA 2H94A 2ZXWC 1K4CC 3JYCA 5KUMA 3W7WA 3ABKB 2HKOA 4H33A 4R6ZA 2GHYA 2IJKA 2HR3A 1QLNA 1KQSU 1S3JA 5LGTA 1GM9A 3ML0A 4E2LA 3OEHG 1AJPA 4QJFB 3VBBA 4CBCA 1VQ9V 4UV8A 2X6AA 3ZRVA 3TCUA 4Q20A 1MOFA 1PD3A 3CD6V 2P6JA 1OCRC 3OR6C 2IH3C 2BOCC 1NJIW 5BZBA 5DM6V 5B1OA 4KP4A 3A0RA 2F43G 3CCQV 1K34A 1M57B 4LCUC 2WLNA 1DF4A 3RBZA 5H6QA 3GWOA 4MTOA 3AG3C 3FB7C 1AI5A 4X89A 4FMTA 5H6RA 2DYSC 1RPRA 4UVCA 4QIWF 1GK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHZ A;  2A79 B;  3PJS K;  3OR7 C;  3OUF A;  1R3I C;  1K4D C;  1V54 C;  3T4Z A;  3WG7 C;  2WLL B;  5IY5 C;  4G28 B;  4J9Z B;  4PA6 A;  4PDL A;  2HVK C;  3F7Y C;  4ZBM A;  3LUT B;  5J9P C;  4I9W A;  5B3S C;  4P9O A;  3K04 A;  3SYA A;  4PA7 A;  3SPC A;  2WLL A;  3LDE A;  4MVZ A;  3K03 A;  2WLI A;  3GB7 C;  2A9H A;  5EC1 C;  3ABM C;  3AG1 C;  2DYR C;  1BL8 A;  3VOU A;  3IFX A;  1LNQ A;  4PDM A;  2DWD C;  3ZRS A;  1G4Y B;  1XL4 A;  2NLJ C;  2X6C A;  4PA3 A;  2BOB C;  5CBF A;  3K06 A;  1ORQ C;  3SPG A;  2Q67 A;  3T1C A;  1OCO C;  2QKS A;  4G27 B;  4XDL A;  4DXW A;  3SYO A;  4J9Y B;  2EIM C;  2IH1 C;  3FB6 C;  2HJF C;  2OCC C;  5E1A C;  3RVY A;  2QTO A;  4MVQ A;  3ABK C;  5B1A C;  2EIJ C;  1P7B A;  2Y69 C;  3E89 A;  3K08 A;  2WLI B;  4JTD B;  4P30 A;  4WFG A;  4XDJ A;  3E83 A;  3RW0 A;  1KKD A;  3ASO C;  4JTA B;  4MVM A;  2HG5 C;  2P7T C;  3LDD A;  4JTC B;  3KG2 A;  2W0F C;  1V55 C;  3OUS A;  1J95 A;  2H8P C;  3IGA C;  5EC2 C;  4WFH A;  5CBH A;  4MVO A;  5B1B C;  3ASN C;  4LP8 A;  4QE7 A;  2R9R B;  1M56 C;  2DWE C;  2WLJ A;  3E8F A;  4WFE A;  3SPJ A;  3AG4 C;  4RUF A;  3RVZ A;  4MTF A;  4RUE A;  1OCC C;  3K0D A;  4PDV A;  2JK5 C;  4P9P A;  2WLH A;  2YEV A;  4BW5 A;  3E8B A;  3UM7 A;  3K0G A;  4MTG A;  1M57 C;  3STZ C;  4R50 A;  4RAI A;  4RO2 A;  2WLK A;  4HZ3 A;  3X2Q C;  1R3J C;  4MSW C;  2ITD C;  2K1E A;  3E86 A;  2HFE C;  2ATK C;  2ZD9 A;  3LDC A;  4GX0 A;  4H37 A;  4OXS A;  3SPI A;  4X8A A;  4MVR A;  1QLE C;  3E8G A;  5EBM C;  4MVU A;  3FB5 C;  3EFF K;  2Q69 A;  3STL C;  1R3K C;  4X88 A;  4GX1 A;  1OCZ C;  1ZWI C;  2AHY A;  2WLM A;  3SYC A;  3ZJZ A;  2Q68 A;  3F7V C;  4HYO A;  2ZXW C;  5CBG A;  3F5W C;  4KFM A;  1K4C C;  3JYC A;  5KUM A;  4R7C A;  4H33 A;  3SYP A;  4R6Z A;  1JVM A;  2EIK C;  4MW3 A;  5EK0 A;  5KUK A;  4PA4 A;  4GX5 A;  3LNM B;  4CBC A;  4QE9 A;  4QNH B;  2X6A A;  2ITC C;  2Q6A A;  2X6B A;  3TCU A;  3AG2 C;  1OCR C;  3HPL C;  2IH3 C;  2BOC C;  3OR6 C;  5EBW C;  5BZB A;  4PDR A;  4WFF A;  3FB8 C;  4R8C A;  4XDK A;  3SPH A;  3SJQ C;  2KB1 A;  4MVS A;  3T4D A;  3ABL C;  2HVJ C;  5EBL C;  4MS2 A;  1XL6 A;  4LCU C;  4EKW A;  2WLN A;  3BEH A;  4UUJ C;  3RBZ A;  1R3L C;  2EIN C;  4MTO A;  4P2Z A;  3AG3 C;  3FB7 C;  3SYQ A;  2A0L A;  3T2M A;  3UKM A;  4F4L A;  4PA9 A;  4X89 A;  3TET A;  2DYS C;  4TWK A;  3OGC C;  4MW8 A;  4LBE C;  3R65 A;  2EIL C;  1S5H C;  4GX2 A;  3E8H A; 
#chains in the Genus database with same CATH topology
 3L9D A;  1K4D C;  5DEC A;  1VEW A;  4RWU A;  1K73 W;  2WLL A;  3LDE A;  1KMI Z;  5EC1 C;  2EZO A;  5F2V O;  3D8C A;  1NVP B;  2HHH B;  1NT2 B;  4JI0 B;  2LFR A;  3K57 A;  2X6C A;  2QR4 A;  5IJ0 B;  4NYK A;  5GW7 A;  4AHC A;  1F7Y A;  3B8M A;  4YIO A;  1P7G A;  4X20 A;  4J9Y B;  3SJB C;  4O2A B;  5LMN O;  4MVQ A;  3Q4H A;  5B1A C;  1AVM A;  3JAL A;  2XAQ A;  4JPR A;  5IYD O;  3LDD A;  3IGA C;  2ZR2 A;  2BSK A;  5B1B C;  1R6T A;  1FD9 A;  4LF8 B;  4RUE A;  2OT5 A;  1F4M A;  3K9S A;  4TV8 B;  2HFE C;  4H37 A;  2P06 A;  1FYJ A;  4LF7 B;  1NR1 A;  4J41 A;  5DN6 G;  3M8A A;  3R66 A;  2LFS A;  1IBK B;  5CBG A;  1E1Q G;  4R7C A;  1NR7 A;  3BHP A;  4DV2 O;  1S76 D;  2QDO A;  4PA4 A;  1OCZ B;  3JCZ A;  2M7W A;  3JAK A;  2QWN B;  1MSW D;  3L73 H;  4PD4 F;  3ASN B;  4KHP B;  4EEQ A;  1M56 B;  1HNZ O;  5L3G A;  1OCC B;  1H2M A;  5ITZ A;  5IWA O;  4HAM A;  2B5U A;  4QPJ A;  1R3L C;  4P2Z A;  3CB2 A;  4X64 B;  1GTO A;  5CA0 A;  4CH6 A;  1YIJ V;  3J80 N;  2XT9 A;  1NH2 B;  1S5H C;  3E8H A;  1TUB A;  1P84 F;  2LQT A;  1YF2 A;  4UCU A;  1GM7 A;  4OGQ B;  3HKC A;  4KUM A;  3GWK C;  2BTQ A;  1E1R G;  2JVD A;  3QG5 A;  3VQY A;  2A7W A;  1M4U A;  5KAI Z;  2CTQ A;  2Q67 A;  1FXK C;  4TQD A;  2IJH A;  5LOV A;  2WA3 A;  2LP7 A;  2UUA B;  1XNR B;  2V7Q G;  4YIP A;  3UCS C;  4B3S O;  1NTM H;  4UCO A;  4MVM A;  1JX9 A;  1DK1 A;  4DR3 B;  3EXA A;  4YJ3 B;  5GTH Z;  1W0J G;  1Q90 D;  2E3C A;  1D2D A;  3ABM B;  4PDV A;  1KP3 A;  2XAH A;  2WLH A;  3UM7 A;  4FLV A;  1VQL V;  5B1B B;  1R3J C;  2ITD C;  4WFA V;  2ZD9 A;  3P3N A;  2DQ3 A;  4KHP O;  2HP8 A;  3CS5 A;  2B9Z A;  3MAQ A;  4BAY A;  3F7V C;  2X7R B;  3F5W C;  5IDJ A;  1OHH G;  3BAB A;  2EIK C;  4MW3 A;  1Q5O A;  4LC1 A;  5BMV B;  1W0K G;  3LSU A;  4GX5 A;  3EVK A;  4YHH B;  5D5Q A;  4JI5 B;  3APO A;  4J11 A;  4UVB A;  2PF4 E;  4B3M O;  2AZ2 A;  4EFE A;  4O2B B;  1HNW B;  3SJQ C;  3ZN0 A;  2HVJ C;  3CX5 F;  5KA5 A;  2VQF B;  4EB6 A;  3UKM A;  2JS3 A;  3TET A;  1SQB H;  5A2Q N;  3E2E A;  4DR6 B;  3CRC A;  4EFB A;  1CP9 A;  3ZHT A;  4U3J B;  1YZB A;  1SA0 B;  2GTS A;  4LF5 O;  2HVK C;  3F7Y C;  4FIP C;  1QVG U;  1ZSP A;  2JIZ G;  3FAV A;  2YS8 A;  1PP9 H;  4PA7 A;  1GRJ A;  3S3W A;  3WB2 A;  1R6K A;  1XMQ O;  3CJH B;  2ZCE A;  4K0K B;  2Y4U A;  3IFX A;  1LNQ A;  3EHB B;  4TT3 G;  3OW2 U;  2EBO A;  1OCR B;  1Y67 A;  1SER A;  1PNM A;  4IYI A;  2W6J G;  5IE9 A;  1I5Y A;  4JV5 B;  2QM8 A;  3T1C A;  4BIU A;  2FL4 A;  4G27 B;  1Q6I A;  1IBM O;  3CWB H;  3AG3 B;  5B5E Z;  2DYS B;  2Y69 C;  4BWA A;  2UUB O;  1KKD A;  4B7K A;  3CCM V;  3RFR A;  1KP2 A;  4DV3 B;  4CC5 A;  3CCJ V;  1J95 A;  2H8P C;  4WBN A;  1S77 D;  4X66 O;  4IIJ B;  4KL1 A;  3LSQ A;  4NTX A;  3HR0 A;  4CZZ A;  1N0J A;  1MZE A;  1JA8 A;  2IJI A;  3APQ A;  5IYB O;  5KX5 B;  1NVP D;  2UXX A;  1H8H G;  5FNV A;  4LF4 B;  1Q8I A;  3ZJZ A;  1RM1 B;  1Q86 W;  4CS2 A;  4Z2W A;  2ZNI A;  2VQF O;  3SYP A;  1QR8 A;  1IX9 A;  3U10 A;  4K35 A;  1FFX A;  4JGS A;  1M93 A;  4IHJ A;  4DR6 O;  4B3T B;  4QE9 A;  3JD0 A;  1PNK A;  3AG2 C;  3HPL C;  1NI8 A;  5LXT B;  1R6N A;  1LUW A;  2CAZ C;  2YI9 A;  4J7Z A;  4HNA A;  3SYQ A;  3H1K H;  1HR0 B;  2F4V O;  4JV5 O;  3CC7 V;  1EZJ A;  4J42 A;  3PJS K;  3RGB A;  5CB4 A;  1ZTE A;  1G8M A;  3CC4 V;  3ZMS A;  2ZQM A;  1GN4 A;  2VWJ A;  3SPC A;  1I7F A;  1WA8 B;  2NN4 A;  1RSO B;  3CPW U;  4O4J B;  1VQ4 V;  1PL4 A;  1VQM V;  1ZLZ A;  3P30 A;  2CE4 A;  1OCO C;  3ZMT A;  4DRX A;  3RYI A;  1WN7 A;  1UPG A;  4JI1 O;  3RW0 A;  2P4V A;  5D5P A;  2AZ0 A;  3ASO C;  4DK0 A;  2P7T C;  2XAJ A;  4DK1 A;  5H2F Z;  1YDX A;  2QJ1 A;  1NH2 D;  4FLT A;  4JZ2 A;  2JK5 C;  3QO8 A;  2YEV A;  5KHG A;  5AG2 A;  4LFB B;  4WF9 V;  3RT3 C;  5E1A C;  3SJC C;  1FAF A;  3C3T A;  2EX3 A;  2F95 B;  4GT1 A;  2QM4 A;  3G6E V;  1XNQ O;  4J80 A;  4LFA O;  4I7Z B;  1JFF B;  1GAX A;  4ABM A;  2ZXW C;  4CS4 A;  4R6Z A;  1WP8 A;  2CUG A;  1GM9 A;  5LGT A;  3M7M X;  3ML0 A;  2Z0A A;  4CBC A;  3L72 H;  1OV9 A;  2X6A A;  3OT7 A;  5LP6 C;  1URF A;  2PYJ A;  4Q20 A;  1MOF A;  4J7K A;  4GKJ B;  4FZ1 A;  2P6J A;  2Q0O C;  1NJI W;  1DGS A;  2BOC C;  1J5E O;  2QWP B;  5DM6 V;  5B1O A;  1Z2G A;  1H2N A;  1WP7 A;  4JI4 B;  4X1Y B;  3FB7 C;  4LFC O;  1RPR A;  2DJV A;  4I55 B;  4UVC A;  4NTW A;  3RYH B;  2BCC H;  1MNG A;  1O9G A;  2AHZ A;  1GK9 A;  5BR8 B;  2ZE5 A;  2IU3 A;  4JAU A;  2UUC O;  4F6R B;  4D7T A;  1VF6 C;  4PA6 A;  5IYZ A;  3K04 A;  4GUN A;  2P4K A;  3J81 N;  2DYR C;  2R9A A;  3VOU A;  4JI8 B;  1XMO O;  1G4Y B;  1PV0 A;  3K5N A;  4I9Q A;  3TGU H;  1NU1 H;  1FJG B;  4IL6 Z;  5DED A;  1DTO A;  5LHG A;  2JGD B;  3P32 A;  1BE3 H;  2UXB B;  5FPO A;  3TJT A;  1RPO A;  2Q0A A;  2WLI B;  3G80 A;  4GCZ A;  4DW1 A;  1OCO B;  2B1I A;  3D3Q A;  2Q73 A;  3RYC A;  3BCC H;  2ZE7 A;  4NXN O;  1JJ2 U;  2ZM6 B;  2Q8V A;  4LWS A;  5B3S B;  4P9P A;  1QHT A;  3B4S A;  4BW5 A;  3X2Q C;  5LBQ A;  2K1E A;  2ATK C;  4O4L A;  3JAS B;  3KCY A;  3K5O A;  1QLE C;  2ILM A;  4GKJ O;  1I08 A;  4DR5 B;  3STL C;  1I0H A;  1R73 A;  2Q68 A;  1MG1 A;  1XRE A;  2OCC B;  4X1I A;  2GSM B;  4LH7 A;  1GN3 A;  2IJJ A;  2EIJ B;  1Y76 B;  3JAR A;  1B6Q A;  1K3E A;  2FB5 A;  4LF6 B;  4NB5 A;  1HDJ A;  4FLW A;  1X59 A;  1K33 A;  5JVD B;  1JPX A;  5J2U B;  3AG4 B;  5EBW C;  5EZY A;  4H13 B;  4UB8 Z;  5JQG B;  5LA6 A;  4FM2 A;  2VQE B;  3E22 A;  3HKE B;  2Z3Y A;  5K1P A;  4ZOL B;  4LNU B;  2EIN C;  2OIG A;  4DR4 O;  4I4T A;  2A79 B;  2Q7G A;  1R3I C;  4L87 A;  1YJW V;  2UXB O;  2WLL B;  3FYI B;  4G28 B;  4FFB A;  5J9P C;  2JEU A;  1PKX A;  3ETQ A;  1NZ6 A;  3L70 H;  4DV5 B;  2CGO A;  3TXQ A;  3ZRS A;  2L35 A;  2ZM6 O;  2EJ7 A;  1JQ0 A;  1GH6 A;  5CBF A;  1THZ A;  2ZKO A;  4X20 B;  3FD9 A;  4AQY O;  3AK3 A;  3NR7 A;  1BZK A;  3JAL B;  1TAE A;  2HJF C;  1IUR A;  3UT5 A;  1ZAU A;  2EIL B;  4DR5 O;  2BSK B;  3ZMV A;  4GKK B;  3DXR A;  4PI2 A;  3RYF A;  3K5L A;  1VF6 A;  3E8F A;  4DW0 A;  4I0X A;  1ENV A;  1N4C A;  4LF6 O;  3E8B A;  1S72 V;  3D3I A;  3ABT A;  4RO2 A;  2A3Q A;  2JS5 A;  3I5D A;  4CC6 A;  1VQ5 V;  1AJN A;  1VF5 B;  3QF7 A;  2MK3 A;  3S3X A;  2UU9 B;  5EK0 A;  2YXL A;  3JAK B;  3LNM B;  4J10 A;  2XAF A;  2CH7 A;  3JSL A;  4PJ0 Z;  3CCR V;  2E76 B;  2R70 A;  2Q6A A;  4DR2 B;  2Q9L A;  4JI6 O;  1EFR G;  4PI0 A;  1KEC A;  3FB8 C;  3W7S A;  2QKC A;  5EBL C;  4DUZ B;  1XL6 A;  2VWK A;  1BCC H;  4B3R O;  2PY5 A;  1I94 B;  2XND G;  1AJQ A;  2RCV A;  4PA9 A;  1N32 B;  1PNL A;  2KG7 A;  1K7D A;  4TWK A;  3OGC C;  5KHJ A;  2Q7H A;  5IJ0 A;  1YJ9 V;  1N33 B;  1SET A;  2E5L B;  5BXZ A;  1CXZ B;  3E35 A;  4AI8 A;  5IY5 C;  2E75 B;  1F4N A;  4JI7 B;  4H44 B;  3HKC B;  2BTQ B;  1FFT B;  1QNM A;  4AIL C;  2DN9 A;  2HHH O;  2OIE A;  3OFN G;  2V4D A;  4PA3 A;  4JI0 O;  5LOV B;  2WSS G;  3N2K A;  3N27 A;  3IC9 A;  1FS0 G;  4UCS A;  3ZRW A;  4DXW A;  2DMX A;  4YY3 B;  2QTO A;  3G4S V;  1P7B A;  4TV8 A;  3K9A A;  1SES A;  4BR6 A;  4ZI7 A;  2JJ2 G;  5JH7 A;  1K8A W;  5KLV H;  2RNB A;  3OEE G;  2EZP A;  3JSN A;  4DYL A;  4LF8 O;  3G6B A;  4R50 A;  4X8A A;  3ZHU A;  4DR2 O;  3T1Y B;  4JI3 B;  1N36 B;  1SS3 A;  4K3A A;  3SJA C;  4LF7 O;  1KYO F;  4TOI A;  1NKD A;  4LF9 B;  5B1A B;  1IBK O;  2UXN A;  5B1N A;  4U7N A;  2ZDI C;  3QO7 A;  3O65 A;  3BA9 A;  1G6U A;  3JAT A;  1U96 A;  1M9N A;  4YJ2 A;  3JCU Z;  5IT9 N;  3OMA B;  1SQG A;  4J7J A;  1ARO P;  1NQT A;  4MS2 A;  2GUZ B;  3UO2 A;  4X64 O;  1SRY A;  3ABU A;  3SDL A;  3A2F A;  3FAV B;  4J9Z B;  4Q6G A;  4DR7 B;  3FKS G;  3F5T A;  3I55 V;  2QE7 G;  1XQ8 A;  4I50 A;  1Z5W A;  2A9H A;  4CH4 A;  4DV7 B;  4A5U B;  4OX9 B;  2NLJ C;  2GTA A;  4JF3 A;  4CH3 A;  2UXC B;  3ZHS A;  2QWQ B;  2DQ0 A;  1IXB A;  1IXM A;  3QO5 A;  2YI8 A;  2IH1 C;  3FB6 C;  4X1K A;  2UXD B;  4C7U A;  4NKG B;  1ZL8 A;  1AP6 A;  1XEQ A;  2UUA O;  1XNR O;  4DV1 B;  2JGU A;  3U0Z A;  1SQP H;  2WPD G;  4WBN B;  2ZE8 A;  1Q3E A;  1AI6 A;  3OE7 G;  3LNN A;  2K9P A;  4H0L B;  5KHK A;  3CP1 A;  4DR3 O;  3FYE B;  1COW G;  4FLZ A;  3T1H B;  1WPB A;  5KMG A;  4IT5 A;  4X9Q A;  3WB0 A;  5LMU B;  4GX0 A;  3LDC A;  2A06 H;  5FNV B;  1F23 A;  2Q69 A;  1FXK B;  2AHY A;  2P22 C;  3SYC A;  3OM3 B;  4HYO A;  3DC6 A;  1K4C C;  3JYC A;  1FFX B;  4TQF A;  1QLN A;  1KQS U;  4IHJ B;  3OEH G;  4YHH O;  4JI5 O;  3TCU A;  1KB9 F;  1SA0 A;  3CD6 V;  3OR6 C;  2IH3 C;  2ZE6 A;  4FM1 A;  2F43 G;  4NR1 A;  4HNA B;  3CJH A;  1HNW O;  2WLN A;  1DF4 A;  3RBZ A;  1AP5 A;  4DV7 O;  4JI2 B;  3SGI A;  1W59 A;  4X89 A;  1LR1 A;  3KZI Z;  3MDS A;  2FKX A;  1JCH A;  3OUF A;  3OR7 C;  1XUQ A;  2FML A;  3T4Z A;  3WG7 C;  1QCE A;  3HB3 B;  3CCL V;  2EIK B;  4NXM B;  1D5A A;  3SR2 C;  4O4H A;  4DV1 O;  2QGN A;  3OMN B;  4UFZ A;  2ZDI A;  3AG1 C;  2ZT9 B;  3CYO A;  2OWO A;  2QWR B;  4JYY A;  4GLX A;  4K0K O;  1Y66 A;  2BOB C;  3K06 A;  4DRX B;  1ORQ C;  3K3W A;  2JRI A;  3RYI B;  1BT8 A;  1VP7 A;  2F23 A;  5GON A;  1WAZ A;  4O4I A;  3AEI A;  4XDL A;  2EIM C;  1EZV H;  2KQX A;  1JJO A;  3G71 V;  3TK1 A;  4XDJ A;  4PEL A;  3CRQ A;  2WWW A;  3G67 A;  3BA8 A;  3RN4 A;  1H2S B;  2YIB A;  1BHB A;  1M1K W;  1R1B A;  2OTL V;  2LJ2 A;  4I5S A;  4DV3 O;  1F51 A;  1TVK A;  2YEV B;  2YXH A;  3N2G A;  5EYP B;  4QPK A;  4JZG A;  1H38 A;  4HZ3 A;  3T2M A;  4DV6 B;  3ZHR A;  4QGP A;  2PI5 A;  1GM8 A;  4MVU A;  2JJ1 G;  2ZNJ A;  2VRZ A;  1WPX A;  4LF4 O;  2Y69 B;  1KKC A;  1JVM A;  4X65 B;  2RN9 A;  3C3S A;  2Y0P A;  1JR9 A;  2ITC C;  2X6B A;  4B3T O;  1KUQ A;  2Q4P A;  3QNE A;  3ZHV A;  4X62 B;  4R8C A;  3KCX A;  3ABL C;  5C8Y A;  2PZS A;  3A8T A;  3CXC U;  4EKW A;  1V9P A;  3UQ8 A;  3VQX A;  4IYH A;  4O4J A;  5H9C A;  1K5Q A;  4D6T H;  4TUY B;  1FKA O;  1SQF A;  2XAG A;  2ARH A;  4DV0 B;  4GX2 A;  2QKA A;  5L3C A;  1HR0 O;  1V54 C;  3GVM A;  3LUT B;  2BE3 A;  1SZT A;  4ASU G;  3MHH C;  3K03 A;  3HKD A;  1EN4 A;  3ZMU A;  2WAM A;  4PDM A;  3AG2 B;  2NR5 A;  3C90 A;  1VMG A;  1KBH A;  1AI4 A;  3JAW B;  3DTU B;  2CK3 G;  3ZBH A;  3VQV A;  2QM7 A;  3WB1 A;  3ABK C;  3K08 A;  1XHZ A;  3E83 A;  2F1M A;  3CME V;  4MTX A;  4LWS B;  2YIC A;  5KHH A;  5EC2 C;  4ZHQ A;  4BIZ A;  1AR5 A;  3KKY A;  1Q81 W;  5J2T B;  1FXV A;  2H3O A;  4O4L B;  3K0G A;  1M57 C;  1S5L Z;  2D3O W;  4LFB O;  3E86 A;  2NNU A;  2QTS A;  1K92 A;  3CHX A;  1N34 B;  4DV4 B;  5JCO A;  2R72 A;  1MMM A;  2RMK B;  3JAR B;  3ZN1 A;  2MW2 B;  2P67 A;  1B06 A;  1HNX B;  4UXN A;  3ASO B;  4ZKI A;  3K5M A;  3CCU V;  5FPR A;  4DV0 O;  1EN6 A;  5EZY B;  5LA6 B;  1WB8 A;  2GDS A;  2N74 A;  4WFF A;  3D36 A;  3IC7 A;  3OD4 A;  3ETE A;  1FPO A;  4JI4 O;  2A0L A;  2IW5 A;  4I4T B;  1XI1 A;  3ZIA G;  3W7U A;  2ZXW B;  5BR8 O;  5EIB C;  1KC8 W;  2CTP A;  5JJJ B;  1YXB A;  2WLI A;  1HW7 A;  1NS1 A;  2DE0 X;  5LP6 B;  5LGU A;  4JI8 O;  1Y74 A;  1AR4 A;  5IJ9 A;  1QVF U;  2L6L A;  3UT5 B;  4WCE V;  4WFB V;  1FJG O;  5LMN B;  3JD4 A;  2XOK G;  4WFG A;  3DXR B;  4JTA B;  3RYF B;  1RFY A;  4DV4 O;  4JTC B;  3KG2 A;  1V55 C;  1YSC A;  3IJ4 A;  3OTO B;  4I0X B;  3ASN C;  2C2A A;  1M56 C;  2DWE C;  2WLJ A;  1HNX O;  3RVZ A;  2HEP A;  1OCC C;  4FFK A;  3K0D A;  2D2C B;  2DYR B;  1WNS A;  2V1D A;  1YCI A;  1MZF A;  1VIB A;  3L71 H;  4BW9 A;  4TV9 A;  3STZ C;  3Q4H B;  3L74 H;  4GX1 A;  3CCV V;  1Q82 W;  3CMA V;  2WLM A;  5CA1 A;  1XBL A;  1AIL A;  2P90 A;  1SKV A;  4ZOL A;  4LNU A;  3CCS V;  2CH7 B;  2CTW A;  3UO3 A;  5TIS Z;  1CPY A;  3U11 A;  1QU7 A;  1HNZ B;  4QNH B;  3HKB A;  3VQW A;  1VQ8 V;  2PYL A;  4Z1V A;  3MHS C;  5IWA B;  4XDK A;  1AB3 A;  3B8N A;  3X2Q B;  1HP8 A;  2VQE O;  1L1F A;  2KG7 B;  1QLE B;  3O9O A;  4LBE C;  3R65 A;  3H1J H;  3RVY A;  3H1I H;  1SF9 A;  4CH5 A;  1UJW B;  1JMK C;  2RJZ A;  1JOY A;  3WFV A;  2BTO A;  2B1G A;  5ITZ B;  1Q43 A;  4P9O A;  4F6E A;  4KXR A;  1H2G A;  3ABM C;  4LH6 A;  1BL8 A;  2LW1 A;  3CRM A;  4DV5 O;  4NVP A;  5CA0 B;  1EN5 A;  4JYB A;  3OTO O;  3N2K B;  2AW9 A;  1BQ0 A;  3ZRW B;  3CCE V;  1TUB B;  3A0H Z;  5JJE B;  3ETD A;  1XOU A;  2EIN B;  5CMU A;  4B3S B;  3E89 A;  5BY1 A;  2F66 C;  4N21 A;  3FFQ A;  4ZI7 B;  2XHB A;  4O2A A;  5GTI Z;  1SC5 B;  5JH7 B;  4FLU A;  3OUS A;  4GKK O;  1UFI A;  4QE7 A;  2ADQ B;  1YVW A;  2XUM A;  2ADP A;  3QVN A;  1WB7 A;  4IGG A;  1V55 B;  2EUL A;  3ZHQ A;  2LGQ A;  2WLK A;  2PUS A;  4MSW C;  3OAA G;  4UCT A;  4OXS A;  1GMG A;  1NTK H;  3FB5 C;  4X88 A;  4FJC C;  1D5N A;  2H94 A;  1BS3 A;  4OPH A;  5KUM A;  3W7W A;  2HKO A;  4H33 A;  4PV1 B;  4L8J A;  3J7A U;  2IJK A;  2UU9 O;  3JAT B;  1TA8 A;  4QJF B;  4YJ2 B;  4B3M B;  1BSM A;  1OCR C;  3A0R A;  3CSX A;  1K34 A;  2Y0I A;  2YID A;  4LCU C;  4DUZ O;  1B04 A;  2YIA A;  4MTO A;  3AG3 C;  4FMT A;  1ZUQ A;  1I94 O;  5H6R A;  2DYS C;  3IAY A;  1N32 O;  1L0L H;  2CDY A;  4QIW F;  1A32 A;  3OTF A;  4LF5 B;  1N33 O;  2HLD G;  3H1H H;  1IBL B;  2E5L O;  1XMQ B;  4PDL A;  4I50 B;  5LHH A;  1L8D A;  2FTK A;  3MD0 A;  1Y6X A;  5L3E A;  3GB7 C;  4JI7 O;  2ZR3 A;  4EB6 B;  1US6 A;  1G1X B;  3SPG A;  4X1K B;  3H9V A;  1IBM B;  2QKS A;  1ZL8 B;  1PL0 A;  1Q6H A;  1RM1 C;  2UUB B;  1H2L A;  2LW7 A;  4YY3 O;  2HG5 C;  3QTC A;  3K59 A;  5IY5 B;  4WFH A;  4X66 B;  4MVO A;  5KMG B;  4JAS A;  4FK5 C;  4YJ3 A;  1YEW A;  2O57 A;  1ZX3 A;  1NTZ H;  5LGN A;  1KU9 A;  2DW4 A;  3CC2 V;  3CRA A;  1N0N A;  1S0V A;  1SZX A;  5H5N A;  2W0X A;  4U7O A;  3T1Y O;  4JI3 O;  1N36 O;  4KFM A;  4N23 A;  2RDC A;  4B7E A;  2OTJ V;  2GUZ A;  2EJR A;  1MAB G;  1YTF B;  4LF9 O;  5KUK A;  3DSQ A;  5CN0 A;  1YI2 V;  5BMV A;  2KKW A;  3BAA A;  1X4T A;  1IBL O;  1K9M W;  4RQF A;  1GKF A;  4PDR A;  2P5O A;  3BVO A;  2KB1 A;  3T4D A;  4UVA A;  4YXW G;  3NXS A;  4O2B A;  4UUJ C;  1S5J A;  3BEH A;  2ODM A;  3CRR A;  1Q7Y W;  2DOS A;  5C93 A;  1GN6 A;  4F4L A;  3W7T A;  3JAM N;  5L3D A;  1QR9 A;  4U3F H;  2F4V B;  1U97 A;  1AR1 B;  2FYU H;  2WA4 A;  1MA1 A;  2ZIM A;  4O4H B;  4U3J A;  4ZBM A;  4I9W A;  1AI7 A;  3SYA A;  1W2B U;  3ZCC A;  4DR7 O;  1XIL A;  2YUA A;  1P4R A;  2G38 A;  4DR1 B;  2AGA A;  2ZIN A;  3H01 A;  2XTA A;  2M6Y A;  1WJZ A;  4NTY A;  1YIT V;  3THO A;  1Q6U A;  4OX9 O;  5GON B;  2UXC O;  4O4I B;  5CB4 B;  1B3Q A;  2QEX V;  1T5E A;  2JEX A;  4JI1 B;  4B08 A;  1NBM G;  1TUE B;  2UXD O;  4P30 A;  3A0B Z;  4HBN A;  4UCR A;  3M99 B;  1E79 G;  4XBF A;  1YJN V;  3P3P A;  1FXK A;  1BMF G;  1WLE A;  2W0F C;  1GN2 A;  1XDC A;  1TVK B;  4LP8 A;  3N2G B;  5LHI A;  2QA4 V;  2R9R B;  4MTF A;  5JCO C;  3PN1 A;  4IIJ A;  3T1H O;  3BPZ A;  5A9G A;  2R9I A;  1P49 A;  2W6I G;  1XNQ B;  1VQ6 V;  5LMU O;  4LFA B;  3EFF K;  5K1X A;  3AG7 A;  5EIB D;  1EM1 A;  4FLY A;  1QBZ A;  3OMI B;  3TXS A;  2N04 A;  5KX5 A;  1SQQ H;  4UB6 Z;  5KA6 A;  3OGI B;  4MT8 A;  3LSS A;  3D36 C;  1H2K A;  5KHI A;  1TGO A;  1J5E B;  1VQO V;  3BY6 A;  5LYJ A;  5LYJ B;  2CGN A;  3AK2 A;  2YXY A;  5C8Y B;  3B09 A;  2IBZ H;  1VF7 A;  3SPH A;  1IZ3 A;  3ZS8 C;  1BGY H;  4MVS A;  3ZMZ A;  4FPP A;  5LXT A;  2YSU B;  4GYC B;  4LFC B;  4DR1 O;  2ZIO A;  4JI2 O;  1PPJ H;  2UUC B;  1VQP V;  4W4L A;  1DLB A;  1L0N H;  2YDE A;  3JD2 A;  2QWO B;  3HKD B;  5B3S C;  4G2K A;  4NXM O;  1EBO A;  4MVZ A;  1XHX A;  2GV9 A;  1XMO B;  1Z5V A;  1WA8 A;  5FLX N;  1Y4M A;  2RQ6 A;  1XL4 A;  1RSO A;  2AXT Z;  4JAA A;  3B40 A;  3H1L H;  1OZ0 A;  4FZ0 A;  1N8R W;  5JWP A;  4JYC A;  3CXH F;  5EYP A;  4FM0 A;  5IYZ B;  2OCC C;  5IYC O;  2EIJ C;  4JTD B;  1HWY A;  1K5S A;  4ICG A;  4NXN B;  4ZHQ B;  3L75 H;  3WG7 B;  1FXH A;  1VQK V;  1K97 A;  4WFE A;  3AG4 C;  2N05 A;  1YHQ V;  4W4K A;  4CS3 A;  3DC5 A;  3AG1 B;  4PHZ A;  4UV9 A;  1H8E G;  1RP3 B;  4ZIB A;  4FLX A;  2GBO A;  3SPI A;  3E8G A;  5EBM C;  4DV6 O;  4BIO A;  5L3F A;  2Y4T A;  3RYC B;  1R3K C;  5FL7 G;  1ZWI C;  3ZX6 A;  2EIM B;  3BRC A;  1KD1 W;  2Z5U A;  1JFF A;  4FVM A;  3JD3 A;  1M5I A;  4X65 O;  1OJH A;  1VAR A;  3WU2 Z;  4Z1M G;  4K8X A;  4TUY A;  5HFL A;  5LL6 Y;  5KAF Z;  1M90 W;  3B2E E;  5E79 Z;  4LR3 A;  4X1I B;  4X62 O;  2KSD A;  5HFM A;  2IM9 A;  4DR4 B;  3I56 V;  4X1Y A;  3B77 A;  2F93 B;  4RQE A;  4MW8 A;  2EIL C;  4DUY B;  3JAW A;  2YC0 A;  4I55 A;  3RYH A;  2QSA A;  4DO2 A;  4UCV A;  4GZR B;  2OCH A;  4F6R A;  3E22 B;  4JYA B;  2X0L A;  1I5X A;  3BFR A;  1QQC A;  2IU0 A;  2DWD C;  1Y74 B;  3ICX A;  2VS0 A;  5IJ9 B;  1YTF D;  4JAV A;  3ETG A;  3W7X A;  1GO3 F;  1DF5 A;  2XAS A;  4AQY B;  1PM9 A;  2ETN A;  3ABL B;  2JDI G;  1IDS A;  5B66 Z;  3ZED A;  3DGE A;  2LO1 A;  5J2T A;  3SYO A;  4FFB B;  2JGD A;  4D7S A;  1O9H A;  1BHA A;  1VQN V;  4TSF G;  4OPA A;  1V54 B;  5CA3 A;  5CBH A;  4E4E A;  3K58 A;  1ROP A;  5L3B A;  3SPJ A;  4RUF A;  3ZRX A;  2Y48 A;  3FX7 A;  2Q7E A;  4TV9 B;  2PI4 A;  1CEZ A;  4MTG A;  4RAI A;  2PGG A;  3JD1 A;  4MVR A;  5CA1 B;  1VQ7 V;  3JAS A;  2Q5Z A;  1OCZ C;  3K79 A;  1N34 O;  3ABK B;  1SQV H;  5JJN B;  2GHY A;  2HR3 A;  1S3J A;  4K8Z A;  1SQX H;  1LUV A;  1Y76 A;  4E2L A;  1AJP A;  1VQ9 V;  3VBB A;  3HKB B;  4UV8 A;  4DUY O;  3ZRV A;  2HJD A;  4JI6 B;  2LGW A;  2YIB D;  1BQZ A;  1PD3 A;  3AK1 A;  5BZB A;  5JVD A;  4KP4 A;  2E74 B;  5J2U A;  4B3R B;  3CCQ V;  5JQG A;  1M57 B;  2PTM A;  1MSD A;  2CTR A;  4JYA O;  3CEI A;  5H6Q A;  3GWO A;  3HKE A;  3RWR D;  1AI5 A;  5LP6 A;  4DV2 B;  3CE2 A;  1IVS A;  2OYQ A; 
#chains in the Genus database with same CATH homology
 2AHZ A;  1JCH A;  3OR7 C;  3OUF A;  1K4D C;  2HLD G;  3T4Z A;  3WG7 C;  1QCE A;  2IU3 A;  3HB3 B;  4JAU A;  3CCL V;  2EIK B;  4PDL A;  4PA6 A;  5LHH A;  2FTK A;  3K04 A;  3MD0 A;  1K73 W;  2WLL A;  3LDE A;  5EC1 C;  5L3E A;  3GB7 C;  2EZO A;  3OMN B;  2ZR3 A;  2ZDI A;  3AG1 C;  2DYR C;  3VOU A;  1NVP B;  3CYO A;  1G4Y B;  2LFR A;  1Y66 A;  2X6C A;  2BOB C;  3K06 A;  5GW7 A;  1ORQ C;  3K3W A;  3B8M A;  3SPG A;  1DTO A;  5LHG A;  2QKS A;  1PL0 A;  3AEI A;  3P32 A;  4XDL A;  4J9Y B;  2EIM C;  1RM1 C;  3G71 V;  4MVQ A;  1RPO A;  5B1A C;  3TK1 A;  4XDJ A;  4PEL A;  2WLI B;  4GCZ A;  1OCO B;  2XAQ A;  2WWW A;  4JPR A;  2B1I A;  5IYD O;  2HG5 C;  3LDD A;  1BHB A;  1M1K W;  2OTL V;  4I5S A;  3IGA C;  2ZR2 A;  1JJ2 U;  5IY5 B;  4WFH A;  4MVO A;  5B1B C;  1F51 A;  4JAS A;  5B3S B;  4FK5 C;  2YEV B;  4RUE A;  4P9P A;  2OT5 A;  4BW5 A;  4QPK A;  1F4M A;  5LGN A;  1H38 A;  3X2Q C;  4HZ3 A;  5LBQ A;  2DW4 A;  2K1E A;  3T2M A;  3CC2 V;  2HFE C;  2ATK C;  4H37 A;  1S0V A;  2PI5 A;  1QLE C;  1GM8 A;  4MVU A;  1NR1 A;  3STL C;  5DN6 G;  4U7O A;  1R73 A;  2JJ1 G;  2LFS A;  2Q68 A;  1MG1 A;  2OCC B;  5CBG A;  4KFM A;  1WPX A;  2GSM B;  4N23 A;  2OTJ V;  1E1Q G;  2EIJ B;  2IJJ A;  1NR7 A;  2EJR A;  2Y69 B;  4R7C A;  1JVM A;  1B6Q A;  1MAB G;  1K3E A;  1S76 D;  1YTF B;  5KUK A;  4PA4 A;  1OCZ B;  5CN0 A;  1YI2 V;  3JCZ A;  2M7W A;  1MSW D;  2ITC C;  1K33 A;  2X6B A;  3ASN B;  1M56 B;  1JPX A;  3QNE A;  5L3G A;  3AG4 B;  1K9M W;  5EBW C;  1OCC B;  4RQF A;  1GKF A;  4PDR A;  4R8C A;  2KB1 A;  3T4D A;  3ABL C;  4UVA A;  4HAM A;  3NXS A;  2B5U A;  4YXW G;  2Z3Y A;  3CXC U;  4EKW A;  4UUJ C;  3BEH A;  1Q7Y W;  5C93 A;  4QPJ A;  1R3L C;  2EIN C;  4P2Z A;  4F4L A;  3W7T A;  5L3D A;  1QR9 A;  1GTO A;  5H9C A;  1K5Q A;  1YIJ V;  1AR1 B;  2XAG A;  1NH2 B;  1S5H C;  4GX2 A;  3E8H A;  5L3C A;  2A79 B;  1R3I C;  4L87 A;  1V54 C;  1YJW V;  2WLL B;  3FYI B;  4G28 B;  4ZBM A;  3LUT B;  5J9P C;  4I9W A;  1SZT A;  1AI7 A;  2JEU A;  1PKX A;  3SYA A;  3MHH C;  4ASU G;  1W2B U;  3ZCC A;  3K03 A;  1P4R A;  3ZMU A;  1GM7 A;  2WAM A;  4PDM A;  3H01 A;  4KUM A;  3ZRS A;  1E1R G;  3AG2 B;  1YIT V;  1JQ0 A;  5CBF A;  1THZ A;  1AI4 A;  2Q67 A;  3DTU B;  1FXK C;  2CK3 G;  2IJH A;  2QEX V;  2JEX A;  2HJF C;  2QM7 A;  2LP7 A;  1NBM G;  2V7Q G;  3ABK C;  1TUE B;  3K08 A;  4P30 A;  3E83 A;  3M99 B;  1E79 G;  2EIL B;  4XBF A;  1YJN V;  3CME V;  4MTX A;  4MVM A;  3ZMV A;  1JX9 A;  1FXK A;  1BMF G;  1WLE A;  2W0F C;  5EC2 C;  4LP8 A;  5LHI A;  2QA4 V;  4BIZ A;  2R9R B;  1W0J G;  3E8F A;  4MTF A;  1Q81 W;  3ABM B;  4PDV A;  1KP3 A;  1ENV A;  2XAH A;  2WLH A;  1FXV A;  3E8B A;  3UM7 A;  1VQL V;  1S72 V;  3K0G A;  3D3I A;  1M57 C;  3ABT A;  5B1B B;  4RO2 A;  2D3O W;  1R3J C;  2R9I A;  2ITD C;  3E86 A;  4WFA V;  2W6I G;  2ZD9 A;  1VQ6 V;  2DQ3 A;  2NNU A;  1K92 A;  1VQ5 V;  3EFF K;  1AJN A;  4BAY A;  1QBZ A;  3OMI B;  3F7V C;  2MK3 A;  2X7R B;  3ZN1 A;  3F5W C;  5IDJ A;  2P67 A;  1OHH G;  5KA6 A;  2EIK C;  4MW3 A;  4LC1 A;  5EK0 A;  1W0K G;  4UXN A;  4GX5 A;  3LNM B;  3ASO B;  4MT8 A;  4ZKI A;  3LSS A;  2XAF A;  3CCU V;  3CCR V;  2Q6A A;  4UVB A;  1VQO V;  3BY6 A;  1EFR G;  1KEC A;  4WFF A;  3FB8 C;  3SPH A;  3SJQ C;  3ZMZ A;  4MVS A;  3W7S A;  3D36 A;  3ZN0 A;  2HVJ C;  5EBL C;  3IC7 A;  4FPP A;  1XL6 A;  2YSU B;  3ETE A;  5KA5 A;  2XND G;  1AJQ A;  3UKM A;  2A0L A;  3TET A;  4PA9 A;  2IW5 A;  1PNL A;  3E2E A;  1K7D A;  4TWK A;  3OGC C;  1YJ9 V;  3ZIA G;  1SET A;  1CP9 A;  3W7U A;  2ZXW B;  1VQP V;  3E35 A;  1DLB A;  5IY5 C;  3JD2 A;  1F4N A;  2HVK C;  3F7Y C;  4FIP C;  1QVG U;  5B3S C;  2JIZ G;  1KC8 W;  4G2K A;  4PA7 A;  1EBO A;  1R6K A;  4MVZ A;  2WLI A;  1FFT B;  3IFX A;  1LNQ A;  3EHB B;  4TT3 G;  3OW2 U;  5LGU A;  1Y4M A;  2EBO A;  1OCR B;  1XL4 A;  3OFN G;  4PA3 A;  1SER A;  1PNM A;  2W6J G;  1I5Y A;  1OZ0 A;  1N8R W;  2QM8 A;  2WSS G;  4JYC A;  3T1C A;  4BIU A;  1QVF U;  4G27 B;  4WCE V;  4WFB V;  1FS0 G;  3ZRW A;  4DXW A;  3JD4 A;  3AG3 B;  2OCC C;  2XOK G;  2QTO A;  5IYC O;  3G4S V;  2DYS B;  2EIJ C;  1P7B A;  2Y69 C;  4JTD B;  4WFG A;  1KKD A;  3K9A A;  1SES A;  1HWY A;  3CCM V;  1K5S A;  4JTA B;  1KP2 A;  4JTC B;  3KG2 A;  1V55 C;  3WG7 B;  1YSC A;  1J95 A;  1FXH A;  2H8P C;  2JJ2 G;  3CCJ V;  1K8A W;  1VQK V;  1S77 D;  3ASN C;  2C2A A;  1K97 A;  1M56 C;  2DWE C;  2WLJ A;  3OEE G;  4WFE A;  3AG4 C;  3RVZ A;  1YHQ V;  2EZP A;  1OCC C;  3K0D A;  3LSQ A;  3AG1 B;  2DYR B;  4UV9 A;  2V1D A;  1H8E G;  3STZ C;  4CZZ A;  4R50 A;  3SPI A;  2IJI A;  4X8A A;  3E8G A;  5EBM C;  5L3F A;  5IYB O;  1NVP D;  1R3K C;  2UXX A;  4GX1 A;  3CCV V;  1H8H G;  1ZWI C;  5FL7 G;  3CMA V;  1Q82 W;  2WLM A;  2EIM B;  3ZJZ A;  1RM1 B;  1KD1 W;  1Q86 W;  2Z5U A;  1NKD A;  2P90 A;  5B1A B;  3CCS V;  3SYP A;  2UXN A;  5B1N A;  1QR8 A;  3JD3 A;  4U7N A;  2ZDI C;  4JGS A;  3QO7 A;  1CPY A;  4Z1M G;  5HFL A;  4QE9 A;  3JD0 A;  4QNH B;  1PNK A;  1M9N A;  3AG2 C;  3HPL C;  1VQ8 V;  1M90 W;  3OMA B;  3MHS C;  4XDK A;  1R6N A;  1ARO P;  1NQT A;  3B8N A;  4MS2 A;  3X2Q B;  5HFM A;  1L1F A;  3SYQ A;  1QLE B;  3I56 V;  3B77 A;  4RQE A;  1SRY A;  4MW8 A;  3ABU A;  4LBE C;  3R65 A;  2EIL C;  3RVY A;  3CC7 V;  1EZJ A;  3PJS K;  1UJW B;  4J9Z B;  1G8M A;  3WFV A;  4DO2 A;  1JOY A;  3CC4 V;  2B1G A;  3ZMS A;  2ZQM A;  3FKS G;  4P9O A;  3I55 V;  3SPC A;  2QE7 G;  1H2G A;  2A9H A;  3ABM C;  2X0L A;  1I5X A;  1BL8 A;  2IU0 A;  2DWD C;  3CPW U;  1YTF D;  2NLJ C;  4JAV A;  4JF3 A;  1VQ4 V;  1VQM V;  3ETG A;  3W7X A;  4JYB A;  1GO3 F;  3P30 A;  1DF5 A;  2XAS A;  3ZRW B;  3CCE V;  3ABL B;  2DQ0 A;  1IXM A;  2JDI G;  1OCO C;  3QO5 A;  3ZMT A;  3DGE A;  3ETD A;  3SYO A;  3FB6 C;  2IH1 C;  2EIN B;  5CMU A;  3E89 A;  3RW0 A;  4N21 A;  1BHA A;  1VQN V;  2WPD G;  3ASO C;  4TSF G;  2P7T C;  1AI6 A;  1V54 B;  3OE7 G;  3OUS A;  5CA3 A;  5CBH A;  2XAJ A;  3CP1 A;  4QE7 A;  3FYE B;  1COW G;  1ROP A;  5L3B A;  3SPJ A;  1NH2 D;  4RUF A;  3ZRX A;  2Y48 A;  2JK5 C;  2PI4 A;  1V55 B;  1CEZ A;  3QO8 A;  2YEV A;  4WF9 V;  4MTG A;  4RAI A;  2WLK A;  4MSW C;  5E1A C;  4GX0 A;  3OAA G;  3LDC A;  4OXS A;  3JD1 A;  4MVR A;  1GMG A;  4GT1 A;  3G6E V;  1F23 A;  3FB5 C;  1VQ7 V;  2Q69 A;  1FXK B;  4X88 A;  1OCZ C;  2AHY A;  3K79 A;  4FJC C;  3SYC A;  3OM3 B;  4HYO A;  2H94 A;  2ZXW C;  1K4C C;  3JYC A;  5KUM A;  3W7W A;  3ABK B;  2HKO A;  4H33 A;  4R6Z A;  2GHY A;  2IJK A;  2HR3 A;  1QLN A;  1KQS U;  1S3J A;  5LGT A;  1GM9 A;  3ML0 A;  4E2L A;  3OEH G;  1AJP A;  4QJF B;  3VBB A;  4CBC A;  1VQ9 V;  4UV8 A;  2X6A A;  3ZRV A;  3TCU A;  4Q20 A;  1MOF A;  1PD3 A;  3CD6 V;  2P6J A;  1OCR C;  3OR6 C;  2IH3 C;  2BOC C;  1NJI W;  5BZB A;  5DM6 V;  5B1O A;  4KP4 A;  3A0R A;  2F43 G;  3CCQ V;  1K34 A;  1M57 B;  4LCU C;  2WLN A;  1DF4 A;  3RBZ A;  5H6Q A;  3GWO A;  4MTO A;  3AG3 C;  3FB7 C;  1AI5 A;  4X89 A;  4FMT A;  5H6R A;  2DYS C;  1RPR A;  4UVC A;  4QIW F;  1GK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...