4UUJC

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
AAVALLLGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
total genus 43
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4uujC00
1XL6A 2A79B 4PA3A 4P9OA 3F7YC 3LNMB 4MW8A 4MS2A 4WFHA 1R3JC 4I9WA 4GX0A 5IY5C 3K0GA 3SYPA 2QKSA 3AG4C 4XDKA 5EBMC 1QLEC 3SPIA 1ORQC 2H8PC 3RBZA 3K08A 3LDEA 3IFXA 4J9YB 4XDJA 3SPGA 3ZRSA 2A0LA 4PDRA 2HVKC 3JYCA 4X8AA 3HPLC 5EC1C 3ZJZA 4MTGA 4UUJC 3RW0A 4J9ZB 4QE7A 3EFFK 3ABLC 5BZBA 3ABMC 4WFGA 5B1AC 5KUKA 3LUTB 3OUSA 4GX1A 3SPCA 4MTOA 2AHZA 3AG3C 5B1BC 2IH1C 4XDLA 4GX5A 3K03A 2X6BA 3FB8C 5EC2C 2HVJC 4EKWA 1G4YB 3F7VC 2X6AA 2A9HA 4MVRA 4TWKA 3ASNC 2WLKA 4QNHB 1BL8A 1XL4A 1V55C 2DWEC 2AHYA 2EIKC 2Y69C 4PA4A 4R7CA 2DWDC 4WFFA 4RUFA 3F5WC 4ZBMA 3SPJA 2WLNA 2IH3C 3X2QC 3E8HA 4R6ZA 2WLLA 3K0DA 3T1CA 3T4DA 3UKMA 2ITDC 4KFMA 2Q6AA 4MVUA 2Q68A 4P9PA 1ZWIC 4HZ3A 2DYSC 1K4DC 3ASOC 3ABKC 2WLIB 1M57C 3BEHA 3LDCA 5CBGA 3AG2C 3K06A 4JTCB 4G27B 1K4CC 3OR6C 4LCUC 4LP8A 4PDVA 3KG2A 4G28B 3SPHA 1OCOC 2EINC 4MW3A 3GB7C 3TCUA 2WLIA 3K04A 4PA6A 4R50A 2WLHA 2Q69A 2QTOA 2EILC 4MVOA 2W0FC 3SJQC 2R9RB 4MVMA 4QE9A 4OXSA 1R3IC 3LDDA 4MSWC 4P2ZA 4BW5A 2JK5C 5EBWC 1J95A 1S5HC 4MTFA 3FB5C 3OR7C 3OUFA 3RVZA 1M56C 3SYAA 2ITCC 2YEVA 3E83A 3E89A 4PDMA 5KUMA 3STLC 5CBFA 2NLJC 1R3KC 2K1EA 2HG5C 3FB7C 4LBEC 2BOBC 3E8BA 1OCRC 4RO2A 2EIJC 3E8GA 4PDLA 3T2MA 2WLMA 2P7TC 3IGAC 4RUEA 4X88A 1OCCC 2WLLB 2ATKC 2WLJA 1P7BA 5E1AC 2HJFC 2ZXWC 2Q67A 3SYOA 3STZC 5B3SC 5CBHA 1JVMA 4GX2A 3R65A 3WG7C 4R8CA 3T4ZA 4H33A 4PA9A 4HYOA 4MVZA 2X6CA 3UM7A 5EBLC 2ZD9A 2EIMC 4H37A 4MVQA 4CBCA 3AG1C 3RVYA 5EK0A 2KB1A 2BOCC 3E8FA 4JTAB 4RAIA 3VOUA 5J9PC 3TETA 1KKDA 3E86A 4JTDB 2HFEC 4DXWA 1LNQA 4F4LA 4WFEA 1OCZC 2OCCC 1V54C 3PJSK 3FB6C 3SYCA 3OGCC 4X89A 1R3LC 3SYQA 4P30A 4PA7A 2DYRC 4MVSA
chains in the Genus database with same CATH superfamily
4JYAO 4DK1A 2FKXA 5K1XA 3BCCH 1E1QG 2YI8A 1AI7A 5BXZA 3BAAA 3IFXA 1YEWA 1WAZA 2BSKB 1XHXA 3L71H 3L72H 5KX5A 1GM8A 3ABLC 5KUKA 3K9AA 4B7KA 1SQBH 5GONA 1VQOV 1EZJA 1S5LZ 3FD9A 4ZI7A 4B3TO 1ZTEA 3FB8C 4YIOA 4B3RB 2A9HA 1YSCA 2DOSA 2P67A 3ZIAG 3J7AU 1FXKA 1H2SB 4FMTA 3JATB 3E8HA 2WLLA 1LUWA 1P7GA 2ZXWB 1ZAUA 5CA0B 3SR2C 4CH6A 4PDVA 1EFRG 1N36O 3JD4A 1B04A 4MW3A 4LFCB 5IWAB 2WLHA 3K5NA 5B1AB 4LFBB 4B3MO 4WFAV 2LGWA 1XMOB 1BQ0A 1UFIA 3E8BA 5H5NA 3UT5A 4NXNO 4X88A 4LF5B 2QDOA 2Q7GA 4O2BA 4GKJO 2QE7G 1PL0A 4AI8A 2GDSA 3SYOA 3STZC 5B3SC 4YJ3B 2OIEA 2ZD9A 2GUZA 2Y4TA 3DXRA 4JTAB 4RAIA 2HKOA 1EZVH 3CC2V 4LF5O 2CTQA 4O2BB 5KMGA 3HKEB 1Q82W 2QWPB 3GVMA 3OT7A 3HKBA 1R3LC 2Q0AA 5JJNB 5LP6B 3CS5A 3O9OA 3OMIB 4WFHA 2QA4V 2QM8A 1ORQC 3L74H 3K08A 2ZDIA 4XDJA 5EC1C 4ZOLB 2KG7A 2QWRB 3W7SA 2WA3A 2IW5A 4XDLA 1UPGA 2QM4A 4LNUA 3ZRWB 4EKWA 4J80A 2B9ZA 4MVRA 3JATA 3HKCB 2JJ1G 4G2KA 1Z5VA 1QCEA 5L3BA 1OZ0A 4X64B 1K5QA 2EJRA 3BY6A 1BQZA 3AG7A 1NBMG 3T4DA 1BS3A 4MVUA 2Q6AA 3N2GA 2LQTA 4JI2B 4BIOA 4DW1A 3LDCA 1HNWB 2ZQMA 3OR6C 1GN6A 2RMKB 2LO1A 4R50A 2DN9A 2IJHA 4OXSA 4DV6O 1H2MA 2N05A 1S5HC 2LGQA 1Y67A 4YHHB 3BFRA 4L87A 4LFBO 1EM1A 4I4TB 1GH6A 2JIZG 2WSSG 5IJ0B 2L35A 2LJ2A 1XQ8A 2BE3A 5FNVA 4K0KB 1XUQA 4HBNA 1WPXA 2F95B 2CDYA 1QVGU 3WU2Z 3D36C 1RP3B 5LHGA 4UFZA 5C8YB 4LF7B 1WP8A 5JVDA 3BPZA 3IC7A 4F4LA 3VQXA 3EXAA 3ETGA 4HNAA 3SYCA 1OCOB 5FL7G 1Q6UA 4ZKIA 2OCHA 1R6TA 5J2UA 1R6NA 4IHJA 1N32B 5CA1A 2HJDA 2Z5UA 1VF6C 5HFMA 1SQFA 3I56V 4JI0B 5L3FA 2HVKC 3JYCA 3ZRXA 1U97A 3ZHQA 2UUAO 1TVKA 2H3OA 4L8JA 4JI6B 3QG5A 2L6LA 4MTOA 4IL6Z 1PPJH 4YIPA 2CE4A 2GV9A 5LP6C 4FVMA 3ZMZA 2UUAB 4I9QA 5KHHA 3CJHA 4DV4O 1YXBA 4K8XA 4O2AB 2Y0IA 1ZWIC 5BR8B 4JAVA 1K5SA 3CC7V 4FLWA 1GO3F 4ICGA 4C7UA 1XOUA 3H1LH 4PI2A 1O9GA 4BW9A 3QO8A 1FFXA 2HG5C 5IY5B 1OCRC 2QWOB 1GN4A 2E76B 2P7TC 1V55B 4NXMB 1OV9A 4NTYA 1MZEA 5H9CA 3JD0A 1FXHA 3C3SA 3FFQA 3ETDA 3N27A 1AR4A 2X6CA 1GRJA 2AZ2A 1VF5B 4X20A 2A06H 4DRXA 3W7UA 5DECA 1L1FA 4X1IA 2HFEC 5EYPB 4GT1A 3K3WA 4J7ZA 2VWJA 4MVSA 3JCZA 3OTOO 3QF7A 2W0XA 5IY5C 1E79G 1GN2A 4O4JA 3ABKB 1Y76B 3A0HZ 1XILA 5LL6Y 4I7ZB 2JDIG 2YS8A 5LOVA 1SQPH 4DR5B 3CP1A 3JAMN 3RYFA 5DEDA 1XDCA 4JI6O 4K8ZA 1XHZA 4UCSA 3EVKA 2YIBD 1RM1B 2CGNA 5HFLA 2Y69C 1L0NH 1M56B 1IXBA 2AXTZ 3ZMSA 1TGOA 1COWG 4I5SA 4I4TA 4Q6GA 4UB6Z 3P30A 1H2LA 4DUZO 4DR3B 1FJGO 1H2KA 2ETNA 1Y74A 3ZHSA 4PV1B 2EIMB 4G28B 1QNMA 4KXRA 3KZIZ 2R70A 3SJAC 2XUMA 4Z1MG 2Q0OC 1V54B 1ENVA 4MSWC 4P2ZA 2BTOA 4O4LA 2ZIMA 3E89A 4DV0B 1Q7YW 4DK0A 2ZNIA 3DTUB 3K9SA 3EHBB 3THOA 2E5LO 5CA3A 5J2TA 3CD6V 2Q67A 1VP7A 2PI4A 5CN0A 1SA0B 4O4HB 2R72A 5JJEB 1I7FA 4NXMO 4YHHO 4UCVA 1TUBA 1VEWA 1DF4A 2FL4A 4H37A 4MVQA 2IU3A 1XI1A 2BOCC 5IYZA 3VOUA 5J9PC 3K57A 1Q43A 3C90A 3I55V 3S3XA 1HR0B 1RM1C 1XNQB 5JH7A 1XL6A 4MW8A 4YJ2B 3UO3A 3VBBA 4DV2O 3RBZA 5LHHA 4EEQA 2X7RB 2A0LA 2EINB 4GYCB 4B3SO 3SJBC 1NTKH 1WB8A 3JD2A 1XEQA 4QE7A 4UVCA 5BZBA 3CSXA 3L9DA 4PHZA 1ZL8A 1VARA 2Q73A 4MT8A 3ETEA 2P4KA 4H13B 1KB9F 1LUVA 1HNZB 4OX9O 2OCCB 1N33O 3JASA 2E74B 4DW0A 1S76D 4PA4A 2YSUB 4YJ3A 5KHIA 3A0RA 1N8RW 1N36B 2WLNA 1QLEB 4GKKB 3HB3B 4DV3B 1RSOB 4TQFA 4I55B 1BSMA 1JMKC 4BAYA 2ZINA 3L70H 3MD0A 4LCUC 1JX9A 3TCUA 3E22A 3SJQC 1VQ4V 2F93B 2RN9A 4AQYB 2PY5A 1BGYH 3AEIA 2ITCC 2Q7HA 2YEVA 1PNMA 3OMAB 4MTXA 4EB6A 3RYIB 4O4HA 2WLLB 2ZE7A 1SRYA 4DV0O 1A32A 3WB0A 1AJNA 5CBHA 4WF9V 4DR2B 1HW7A 3U11A 4CBCA 1H2GA 2EJ7A 2OT5A 4LC1A 1F7YA 2IJJA 5TISZ 1FPOA 3U0ZA 3JAWB 1FFXB 3JSNA 4P30A 3P32A 1WNSA 3MAQA 3F7YC 1GM7A 5LHIA 4JGSA 4DV7B 3J81N 2P06A 1K3EA 5LA6A 1H8HG 2YUAA 1D5NA 3LUTB 1VQPV 2QTSA 4LF9B 2PF4E 2IH1C 4GX5A 1NQTA 4IHJB 5EC2C 4F6RA 1AB3A 3F7VC 3CYOA 1F4NA 1NR7A 4NTWA 1SA0A 3T1YB 4FLUA 1N0JA 4ZBMA 1WN7A 2BTQB 3CC4V 1V9PA 2IM9A 4R6ZA 3KCYA 3PN1A 3HR0A 4KFMA 2UU9B 1M9NA 1Z5WA 3E22B 1ZSPA 4LFCO 1PM9A 3MHSC 1WA8B 3ABMB 5LGUA 2VQFO 4E2LA 1K4CC 3U10A 4TV9B 3RYFB 3CE2A 3K04A 4PA6A 1FAFA 2XNDG 2Q69A 2ZM6O 1RFYA 1YVWA 3TJTA 2B5UA 4K0KO 4ABMA 4BW5A 1IBKO 5B5EZ 3FYIB 4DR4O 4DR3O 2K1EA 4LBEC 4RO2A 4DR1B 4AQYO 1H38A 1I0HA 1WJZA 3WFVA 1OHHG 1K97A 2Z3YA 3JD3A 1R6KA 2WLJA 1P7BA 2YIDA 1PNLA 3X2QB 3ZN0A 2W6IG 4H33A 4PA9A 5K1PA 5KHKA 2EIMC 1YJWV 3J80N 3RVYA 2JEXA 1PKXA 4DR1O 5B1BB 3LSQA 1SESA 2WWWA 3BRCA 1NU1H 2C2AA 1H2NA 3FB6C 2R9IA 1G8MA 4UUJC 1IBLO 4LNUB 3SYPA 4D7TA 4RQEA 1VQ9V 2KQXA 4PDRA 5KHJA 1XNQO 1JJOA 5A2QN 2CTWA 3CCVV 4FJCC 3AG3C 1KKCA 1N34B 2DQ0A 1NT2B 2HVJC 4PI0A 1CPYA 2X6AA 3AG1B 4QIWF 5LP6A 3JAKA 1XREA 3JAWA 4LF6B 4R7CA 4GUNA 3AK1A 4KL1A 1YI2V 3CCUV 3Q4HB 1WLEA 3T1HB 2QJ1A 3ZRWA 3CCMV 2X0LA 1TA8A 2XTAA 3OGIB 1HNZO 2ITDC 1FS0G 1EN4A 4J10A 5A9GA 3JAKB 5LGNA 4FLZA 2RDCA 2YIAA 1VQLV 2WLIB 4LF6O 4U3JA 1FXKC 4ZHQB 3E2EA 5DM6V 3KG2A 2JVDA 1YCIA 3GB7C 1GTOA 4MVOA 3E35A 4LR3A 2LW7A 3G6EV 2F23A 4HAMA 1DF5A 4ASUG 2D3OW 4TV9A 1IZ3A 2ZM6B 5KUMA 1WA8A 2RNBA 2BOBC 3E8GA 4Z1VA 4JASA 1SZTA 3OE7G 4JI1B 1JVMA 1JA8A 3RWRD 2XAFA 2VWKA 1WB7A 4UCRA 4NYKA 3CCLV 4KUMA 5EK0A 3K5OA 3ASOB 5L3GA 3CCJV 1PP9H 1VQ7V 1JFFB 4NXNB 4B7EA 3SDLA 2LFSA 2B1IA 3OGCC 1JJ2U 3SYQA 3K59A 2PUSA 1P49A 4PA3A 5LMNB 5FNVB 4MS2A 5IYBO 4I9WA 3K0GA 3SPIA 5IJ9A 2ZCEA 3ZBHA 3KCXA 3FX7A 1N32O 3N2GB 3HPLC 1VQKV 4DRXB 2HR3A 5FLXN 4U3JB 2DW4A 4FLVA 1S3JA 2XASA 4GX1A 5B1BC 2KKWA 2CH7B 2LW1A 4JI5O 1Q5OA 3ZHVA 2UUBB 1DLBA 2AHYA 4CH3A 2DWDC 4WCEV 4FLYA 2A7WA 4JYBA 3SPJA 3QO5A 3UKMA 1I94O 1QVFU 1Q86W 1BZKA 1J5EO 1L0LH 2OTLV 3I5DA 3BEHA 2MW2B 1OJHA 3K06A 2JS3A 4G27B 2YXHA 2WLIA 4D6TH 2F4VB 2G38A 2W0FC 4NTXA 4MVMA 3W7XA 4ZOLA 5LA6B 4MTFA 2ZIOA 1YIJV 4O2AA 2IBZH 1KUQA 1W0KG 1VMGA 2IU0A 1AR1B 1AJPA 3OTFA 5CBFA 2VQFB 1BMFG 1R3KC 2YDEA 3A2FA 1Q90D 3FB7C 3M8AA 1PNKA 4JYYA 1QHTA 2CTRA 2EIJC 4PDLA 4UV8A 3G4SV 2ZE8A 3IGAC 1MSDA 1NH2B 2OIGA 2ZXWC 3APOA 4CH5A 1AILA 1B6QA 4GX2A 3RGBA 3WG7C 2FYUH 4IIJA 1K7DA 3HKCA 3UM7A 5F2VO 3OEHG 1Q6HA 2ZT9B 4FLXA 2V7QG 2UXCB 4PJ0Z 1R1BA 3OTOB 3OAAG 1PL4A 4X89A 3TK1A 3UCSC 4B3SB 4PA7A 3T2MA 2E75B 2A79B 4P9OA 1MSWD 5H6RA 1G1XB 2AW9A 4CH4A 1QLEC 3RYIA 3CCQV 2H8PC 4X62B 1M4UA 3OEEG 4DR5O 1RSOA 3ZJZA 3DC6A 1VQ8V 3EFFK 1K92A 5B1AC 2AGAA 1CP9A 2XAQA 1BE3H 2N04A 3D36A 1G4YB 1R73A 2QR4A 1URFA 1F23A 5CA0A 4TQDA 4RQFA 5LGTA 3JCUZ 2ZR2A 3RT3C 5LYJA 3ZMVA 3TGUH 1OCCB 4H0LB 2OYQA 2F1MA 4X64O 1W59A 5GTIZ 2NNUA 1QQCA 4PD4F 3GWOA 4F6EA 1YDXA 2EZPA 1SQXH 2QTOA 2P22C 4FFKA 1N4CA 4DR2O 2RCVA 2HHHB 2IJIA 3K58A 1SERA 2HP8A 3SYAA 3RFRA 4FK5C 3JSLA 4DV6B 4Z2WA 2ILMA 1TAEA 4KP4A 3H9VA 2UXXA 2F43G 1PV0A 1B06A 1JOYA 2Z0AA 3AG3B 4F6RB 2AZ0A 4FFBB 4LWSB 4X65O 1PD3A 4X1KA 4XBFA 1DGSA 1MNGA 1YJ9V 2KG7B 1ROPA 4UV9A 1VQNV 1V54C 2ADPA 4DR7B 1TUBB 5ITZA 4DV7O 4UCOA 4DV1O 5JWPA 1QR9A 2XOKG 3BA9A 1E1RG 3B2EE 2QKSA 4BWAA 2CUGA 4LFAO 3CPWU 1MABG 3HKBB 1TVKB 3LDEA 3ZRSA 1Y76A 4DR7O 2Y0PA 4O4JB 4MTGA 4X62O 4JI3B 2Q4PA 3ABMC 4WFGA 4B3TB 2WAMA 3WB2A 3H1JH 3CRCA 1SS3A 3K03A 2X6BA 2F66C 2WPDG 2JJ2G 3G71V 3ASNC 5BMVA 2GSMB 4OPHA 1DK1A 5JVDB 3ICXA 3JD1A 2EX3A 3JASB 1Q6IA 4JI5B 4H44B 1YTFB 1CXZB 4YXWG 1M5IA 4W4LA 1I08A 2WA4A 4DUYO 1HNXO 1JPXA 3N2KA 3W7WA 4NKGB 4I55A 4GCZA 4NR1A 1DTOA 1IURA 4U3FH 1XMQB 4DUZB 3E83A 3STLC 4U7OA 5JH7B 4DUYB 5C93A 2HHHO 1SF9A 5LMUB 3K5MA 3DSQA 5E1AC 1NVPB 4ZI7B 2CAZC 3B09A 5B66Z 2GBOA 2GTAA 5EYPA 1ZL8B 3TETA 2XHBA 4QGPA 1FXVA 3CXHF 3LNNA 5J2TB 2CK3G 3PJSK 2M6YA 2OTJV 2QKCA 4JZ2A 2KSDA 1IBMB 2QWQB 5GTHZ 1NH2D 4O4LB 1R3JC 2LFRA 4OPAA 1HP8A 1MOFA 5GW7A 2UXCO 1KP2A 3N2KB 1WPBA 4AHCA 2D2CB 2M7WA 3H1KH 4B3RO 2VQEB 4X8AA 3KKYA 3CMAV 4LF9O 1H8EG 3H1IH 1Y74B 4DR6O 2PTMA 2EZOA 1RPOA 5J2UB 2O57A 4DYLA 1M93A 4JAUA 4O4IA 3SPCA 1F4MA 2ZNJA 4DV2B 4FM0A 1HDJA 2YC0A 3NXSA 4BIZA 2HEPA 1BL8A 3CB2A 3HKEA 3AK3A 4FZ0A 1MMMA 2UXBB 1FKAO 3X2QC 2EIJB 2GUZB 4A5UB 2CH7A 3CJHB 1SETA 1Y66A 3ZMUA 1WP7A 2Q68A 1KD1W 3K79A 3LSSA 3HKDB 5FPOA 2Q5ZA 2UXBO 1OCOC 2EINC 4UB8Z 3UT5B 4DV3O 4FLTA 2YICA 2R9RB 3ZHUA 2XAJA 4J11A 5H6QA 5IJ9B 4JI1O 1QR8A 2ZKOA 4LH6A 3RVZA 1S5JA 5IDJA 4TUYA 5ITZB 1XNRO 1Y4MA 4JV5B 4J7KA 4JI8O 4DV5B 5JQGB 4JI7O 3ML0A 2FMLA 4LF4B 5IJ0A 1SQGA 4X20B 3C3TA 4HYOA 2JGDA 4JI4B 3BVOA 3VQVA 5E79Z 2V4DA 3P3PA 1LNQA 2K9PA 1VF6A 3LSUA 1VQ6V 3M7MX 4IYIA 1YHQV 3ASNB 3F5TA 5KAFZ 3CXCU 3OD4A 4N21A 1KU9A 1K8AW 4KHPB 3QNEA 1GAXA 3RYCB 1W2BU 2ODMA 3M99B 4DV1B 3RW0A 3ZHRA 4X1IB 2Q8VA 2CGOA 4FZ1A 3A8TA 4NVPA 1BHAA 3ZX6A 5KMGB 4DR6B 3DC5A 2VS0A 3WB1A 3APQA 1BHBA 1YJNV 3G80A 4I50B 3T1HO 4DV4B 2MK3A 1XL4A 1SKVA 2EBOA 2EIKC 3Q4HA 4Q20A 4JI3O 1N33B 5KA5A 5BR8O 3K0DA 3WG7B 3ZN1A 2JGUA 2UUCO 5B1OA 2QKAA 4GKKO 3D8CA 3H1HH 1M57C 1G6UA 1X4TA 5D5PA 3AG2C 2LP7A 4JTCB 1W0JG 4JPRA 1KP3A 4B3MB 4EFBA 1NZ6A 5IT9N 1R3IC 3LDDA 4N23A 2JK5C 3B8MA 1RPRA 4FM2A 5IWAO 2Y69B 3OUFA 3P3NA 5CA1B 1M56C 4WBNB 1NR1A 1YTFD 1OCCC 2ATKC 4ZIBA 3D3QA 2IJKA 3R65A 1AROP 4R8CA 1M57B 1NI8A 2DQ3A 4JI7B 4TV8B 4NB5A 1Z2GA 2ZDIC 3E8FA 3OFNG 2EILB 4JZGA 4JI0O 2QEXV 1KBHA 5KAIZ 2PZSA 4W4KA 1THZA 3GWKC 1K73W 2P6JA 2RQ6A 2YIBA 3UQ8A 1NVPD 1D2DA 3L73H 1NTZH 3JALA 2QGNA 2BSKA 1VQMV 1AJQA 1EN5A 3SPGA 3ZS8C 1ZUQA 4X66O 1JCHA 2ADQB 1MA1A 5L3DA 2JEUA 3B4SA 1GM9A 1NKDA 2YXYA 5C8YA 3S3WA 4UVBA 4GZRB 3OM3B 2UUBO 4CS3A 1FFTB 1VQ5V 2Y4UA 1XBLA 4RWUA 1LR1A 1OCRB 4TWKA 2WLKA 3CX5F 1JR9A 3DGEA 2PYJA 4WFFA 1OCZB 1FYJA 4I50A 3RYHA 1F51A 4CS4A 1K33A 2Q7EA 3T1CA 3RYHB 1N34O 5CMUA 5DN6G 3CWBH 1K4DC 2V1DA 1I94B 5CBGA 2UUCB 3SGIA 4UXNA 4D7SA 4QJFB 4X9QA 5GONB 2CTPA 2EILC 3OW2U 2A3QA 3RYCA 3CRAA 4CC6A 3MHHC 3FB5C 3OR7C 5LXTB 1EN6A 4K3AA 4PDMA 3O65A 1L8DA 4JF3A 2QSAA 5EZYB 1IXMA 2Q9LA 3JALB 4DR4B 4UCUA 4IGGA 5LYJB 3JARA 4I0XB 3TXSA 2HJFC 3SJCC 3HKDA 2R9AA 3DXRB 1NS1A 2QM7A 4J7JA 5EBLC 4WBNA 1YF2A 2KB1A 1Q8IA 2DYSB 5JQGA 1AI5A 1AI6A 4JV5O 4YY3B 4WFEA 3UO2A 4TOIA 4LF8O 1FD9A 4EB6B 2OWOA 4LF4O 3CRMA 2YI9A 1Q81W 2YEVB 3LNMB 3R66A 5LOVB 4JI4O 4XDKA 5EBMC 1SC5B 3IC9A 1I5YA 4J9YB 4LF8B 5KLVH 2PI5A 4JAAA 5BY1A 1Q3EA 4TSFG 4ZHQA 2W6JG 4KHPO 4J42A 4WFBV 1SQQH 4EFEA 3IJ4A 4UCTA 3FAVB 4QNHB 4IIJB 5IYCO 3IAYA 4AILC 1HNXB 1KC8W 1KECA 5KA6A 2N74A 1YITV 3B8NA 1T5EA 3ABKC 1MG1A 1S0VA 5IYDO 4LH7A 4LP8A 2BCCH 5LMUO 2QWNB 2NR5A 3TXQA 2E5LB 5L3CA 2B1GA 1AI4A 4QE9A 1J5EB 1J95A 1I5XA 1Y6XA 3ABTA 1M90W 2NLJC 1GMGA 3QTCA 4X65B 2F4VO 1AP6A 2DJVA 2UXNA 2UXDO 2ZR3A 5IYZB 1IBMO 5KHGA 4JYAB 4MVZA 1P84F 5D5QA 4IYHA 3AG1C 4DO2A 1X59A 5KX5B 1VIBA 3E86A 4JTDB 4BR6A 3MDSA 1OCZC 2JGDB 1NJIW 3FAVA 3NR7A 1M1KW 4LFAB 2EULA 4YY3O 4TT3G 4JYCA 3CCEV 2YXLA 1VF7A 4QPJA 3AK2A 4LF7O 1KMIZ 4OX9B 5LMNO 2JS5A 1ZX3A 1U96A 1S77D 4UVAA 1BCCH 5JCOA 3OUSA 2AHZA 1QBZA 2FB5A 4HNAB 1JFFA 2BTQA 4QPKA 4X66B 1V55C 1CEZA 3K5LA 4FPPA 3ZEDA 4CZZA 3F5WC 2IH3C 3AG4B 1SQVH 2P5OA 4E4EA 2HLDG 2DE0X 4P9PA 4HZ3A 2DYSC 4FFBA 4LWSA 3ZCCA 4X1YB 1N0NA 3FKSG 2Y48A 2XAGA 2ZE5A 1FJGB 4GLXA 5CB4B 4DV5O 4PELA 1AVMA 3RN4A 5EBWC 4K35A 1S72V 3ZHTA 1GK9A 3B77A 3CHXA 1IDSA 5EIBD 2WLMA 2FTKA 4RUEA 3W7TA 2P90A 1K9MW 5FPRA 3CCSV 3VQWA 3BA8A 3T4ZA 3ZMTA 4FM1A 2ARHA 3ETQA 1O9HA 5AG2A 4DXWA 1HWYA 3CMEV 3B40A 1JQ0A 3ABUA 4O4IB 3G67A 3D3IA 4FIPC 2PGGA 4CC5A 1D5AA 2NN4A 3OMNB 2GTSA 2E3CA 1BT8A 4GX0A 1B3QA 1UJWB 2VQEO 4BIUA 1HR0O 3AG4C 1GKFA 1P4RA 5CB4A 3QVNA 3QO7A 1IVSA 4J9ZB 1YZBA 3T1YO 5IE9A 1SZXA 2GHYA 4CS2A 4X1YA 4IT5A 1MZFA 4JI2O 2UU9O 1QU7A 3CCRV 3A0BZ 2DWEC 2XAHA 1HNWO 2RJZA 3CRRA 3H01A 4RUFA 4TUYB 5B1NA 3ZRVA 5B3SB 4TV8A 3JARB 4I0XA 5JCOC 3G6BA 5LBQA 1IBKB 5EZYA 4B08A 3ASOC 2ZE6A 3ABLB 2XT9A 5LXTA 3CRQA 2P4VA 3SPHA 1XMOO 1ZLZA 2DYRB 1US6A 1IX9A 5JJJB 5H2FZ 1AR5A 4YJ2A 1XNRB 4JI8B 3BHPA 2H94A 4GKJB 3CEIA 1KQSU 2EIKB 1NTMH 1TUEB 3L75H 4OGQB 3BABA 1FXKB 1QLNA 5L3EA 3AG2B 5BMVB 1XMQO 1IBLB 3VQYA 2JRIA 2PYLA 1EBOA 1KKDA 2DMXA 5EIBC 1GN3A 1AP5A 3FYEB 1K34A 2OCCC 2VRZA 4X1KB 2UXDB 1KYOF 4U7NA 4J41A 2DYRC
chains in the Genus database with same CATH topology
2P6JA 1XL6A 2A79B 4P9OA 4MW8A 1MSWD 5H6RA 1NVPD 3VBBA 1QLEC 1VQMV 1E1QG 3CCQV 2H8PC 3RBZA 5LHHA 1AI7A 1AJQA 3OEEG 2X7RB 3IFXA 3SPGA 2A0LA 1JCHA 3ZJZA 2EINB 1VQ8V 3JD2A 4QE7A 5L3DA 2JEUA 4UVCA 1GM9A 3EFFK 1GM8A 3ABLC 5BZBA 1NKDA 1K92A 5B1AC 3K9AA 5KUKA 4UVBA 3OM3B 4MT8A 1VQOV 3ETEA 1EZJA 1CP9A 1FFTB 2XAQA 1VQ5V 3FB8C 2OCCB 3D36A 1G4YB 1OCRB 1R73A 2A9HA 4TWKA 2WLKA 1F23A 1S76D 4PA4A 3DGEA 1YSCA 2YSUB 3A0RA 1N8RW 4WFFA 2P67A 3ZIAG 4RQFA 1OCZB 1FXKA 5LGTA 4FMTA 1F51A 2WLNA 2ZR2A 1K33A 1QLEB 3E8HA 3T1CA 2WLLA 3HB3B 3ZMVA 1OCCB 5CMUA 5DN6G 2ZXWB 1K4DC 2V1DA 2NNUA 4BAYA 5CBGA 3GWOA 4UXNA 4PDVA 3MD0A 4QJFB 4LCUC 1EFRG 3JD4A 4MW3A 2EZPA 1JX9A 3TCUA 2WLHA 2QTOA 2EILC 3SJQC 1VQ4V 3OW2U 5B1AB 4WFAV 3MHHC 2IJIA 3FB5C 3OR7C 1SERA 3AEIA 3SYAA 2ITCC 2YEVA 3OMAB 1PNMA 4PDMA 4MTXA 4FK5C 4JF3A 3E8BA 1IXMA 4KP4A 2UXXA 2F43G 4X88A 2WLLB 1SRYA 1PL0A 2QE7G 1JOYA 2HJFC 3AG3B 3SYOA 1AJNA 3STZC 5B3SC 5CBHA 4WF9V 2QM7A 1PD3A 5EBLC 2ZD9A 4CBCA 2KB1A 1H2GA 2DYSB 4JTAB 1AI5A 1AI6A 4RAIA 4XBFA 2HKOA 1YJ9V 3CC2V 2OT5A 4LC1A 1ROPA 4WFEA 4UV9A 1VQNV 2IJJA 1V54C 1Q82W 1R3LC 1Q81W 4P30A 1QR9A 3P32A 2XOKG 2YEVB 3F7YC 1GM7A 3LNMB 3OMIB 4WFHA 1E1RG 2QA4V 2QM8A 2QKSA 4XDKA 5EBMC 5LHIA 4JGSA 1ORQC 3CPWU 1MABG 1I5YA 3K08A 3LDEA 2ZDIA 4J9YB 4XDJA 1K3EA 3ZRSA 2PI5A 5EC1C 4MTGA 4TSFG 2W6JG 1H8HG 3ABMC 4WFGA 3W7SA 2WAMA 3LUTB 1VQPV 2IH1C 2IW5A 4XDLA 4GX5A 3K03A 2X6BA 4WFBV 1NQTA 5EC2C 3ZRWB 2WPDG 4EKWA 3F7VC 2JJ2G 4MVRA 3G71V 3ASNC 4QNHB 3CYOA 2GSMB 1F4NA 2JJ1G 4G2KA 1NR7A 1QCEA 5IYCO 5L3BA 1OZ0A 4ZBMA 1KC8W 1KECA 1K5QA 3CC4V 3JD1A 2EJRA 4R6ZA 3BY6A 5KA6A 3T4DA 1NBMG 4KFMA 2Q6AA 4MVUA 1M9NA 1YITV 1YTFB 3B8NA 4YXWG 3ABKC 3MHSC 1MG1A 3LDCA 3ABMB 1S0VA 5IYDO 5LGUA 2ZQMA 4E2LA 4LP8A 1K4CC 3OR6C 1JPXA 3K04A 4PA6A 4R50A 3W7WA 2XNDG 2Q69A 2IJHA 5L3CA 2B5UA 4GCZA 2B1GA 1AI4A 4OXSA 4QE9A 4BW5A 1DTOA 3FYIB 1J95A 1S5HC 4L87A 1I5XA 3ABTA 3E83A 3STLC 1M90W 2NLJC 2K1EA 4U7OA 1GMGA 4LBEC 4RO2A 5C93A 2JIZG 1H38A 2WSSG 3WFVA 1OHHG 1K97A 2Z3YA 3JD3A 1R6KA 2WLJA 1P7BA 1PNLA 5E1AC 2UXNA 1WPXA 1NVPB 2ZR3A 3X2QB 3ZN0A 1QVGU 2W6IG 4H33A 4PA9A 4MVZA 5LHGA 2EIMC 1YJWV 3AG1C 4DO2A 3RVYA 2JEXA 1PKXA 5B1BB 3LSQA 3TETA 3E86A 1FXVA 4JTDB 1SESA 2WWWA 2CK3G 3IC7A 4F4LA 1OCZC 2C2AA 3ETGA 3FB6C 3PJSK 1NJIW 2OTJV 3SYCA 1OCOB 2R9IA 1G8MA 5FL7G 4ZKIA 1M1KW 4UUJC 1R6NA 1NH2D 4TT3G 1R3JC 2LFRA 4JYCA 3CCEV 1MOFA 2Z5UA 4QPJA 3SYPA 5GW7A 5HFMA 3I56V 1KP2A 5L3FA 2M7WA 4RQEA 1VQ9V 4PDRA 2HVKC 3JYCA 4X8AA 3CMAV 3ZRXA 1H8EG 1S77D 3CCVV 4UVAA 2EZOA 1RPOA 4JAUA 3OUSA 3SPCA 4FJCC 4MTOA 2AHZA 3AG3C 1F4MA 1QBZA 2DQ0A 2HVJC 3NXSA 4QPKA 4BIZA 1CPYA 2X6AA 3AG1B 4QIWF 1BL8A 1V55C 1CEZA 4FPPA 4R7CA 3ZMZA 4CZZA 3F5WC 1YI2V 3CCUV 1WLEA 3X2QC 2IH3C 3AG4B 3ZRWA 3CCMV 2EIJB 2X0LA 1SETA 2HLDG 1Y66A 2ITDC 1FS0G 3ZMUA 2Q68A 4P9PA 1ZWIC 4HZ3A 3K79A 5LGNA 2DYSC 1KD1W 3ZCCA 3LSSA 1VQLV 2WLIB 1FXKC 4JAVA 1K5SA 3FKSG 3CC7V 3E2EA 1GO3F 2Y48A 5DM6V 3KG2A 2XAGA 1OCOC 2EINC 3GB7C 1GTOA 4MVOA 3E35A 2R9RB 4PELA 2XAJA 3G6EV 4HAMA 5H6QA 1DF5A 4ASUG 2D3OW 5EBWC 1QR8A 1S72V 3RVZA 3QO8A 5KUMA 1GK9A 5IDJA 3B77A 2HG5C 5IY5B 2BOBC 1OCRC 1Y4MA 3E8GA 2WLMA 2P7TC 2FTKA 1V55B 4JASA 4RUEA 3W7TA 2P90A 1K9MW 1SZTA 3OE7G 5H9CA 3JD0A 3ML0A 1FXHA 3CCSV 1JVMA 3T4ZA 3ETDA 3ZMTA 4HYOA 2XAFA 2X6CA 3CCLV 4KUMA 5EK0A 3ASOB 3W7UA 5L3GA 3CCJV 1L1FA 2HFEC 1VQ7V 4DXWA 1LNQA 1HWYA 3CMEV 1VQ6V 1JQ0A 2LFSA 3ABUA 2B1IA 3OGCC 4GT1A 3D3IA 1YHQV 1JJ2U 3ASNB 3K3WA 4FIPC 3CXCU 3SYQA 4MVSA 3JCZA 4PA3A 4N21A 3OMNB 4MS2A 5IYBO 4I9WA 1K8AW 4GX0A 1UJWB 5IY5C 3QNEA 1E79G 4BIUA 3K0GA 3SPIA 3AG4C 1W2BU 3ABKB 1GKFA 1P4RA 3QO7A 3HPLC 3M99B 2JDIG 3RW0A 4J9ZB 1VQKV 2HR3A 2DW4A 1S3JA 2XASA 2GHYA 4GX1A 3CP1A 5B1BC 1BHAA 1BHBA 1YJNV 1RM1B 3CCRV 2MK3A 1XL4A 2EBOA 2EIKC 2DWEC 1DLBA 2AHYA 2Y69C 5HFLA 2XAHA 4Q20A 4WCEV 2DWDC 1M56B 3H01A 4RUFA 4JYBA 5KA5A 3SPJA 5B1NA 3QO5A 3ZRVA 5B3SB 3K0DA 3WG7B 3ZN1A 3UKMA 1QVFU 3ZMSA 1Q86W 1COWG 4I5SA 5B1OA 5LBQA 2OTLV 3ASOC 3P30A 1M57C 3ABLB 3BEHA 3AG2C 3K06A 2LP7A 4JTCB 1W0JG 4G27B 4JPRA 1KP3A 2EIMB 4G28B 3SPHA 2WLIA 2DYRB 2W0FC 4MVMA 4Z1MG 1V54B 1ENVA 1R3IC 3W7XA 3LDDA 4MSWC 4N23A 4P2ZA 2JK5C 3B8MA 1RPRA 4MTFA 1YIJV 2Y69B 3OUFA 1W0KG 1M56C 2IU0A 1AR1B 1AJPA 3E89A 2H94A 1Q7YW 5CBFA 1BMFG 1R3KC 3DTUB 3FB7C 1NR1A 1PNKA 1YTFD 2EIJC 3EHBB 4PDLA 4UV8A 3G4SV 1KQSU 2EIKB 3IGAC 1OCCC 2ATKC 1TUEB 5CA3A 3CD6V 1NH2B 2ZXWC 2Q67A 2PI4A 1B6QA 2IJKA 4GX2A 1AROP 3R65A 5CN0A 4R8CA 1M57B 3WG7C 1FXKB 1K7DA 5L3EA 1QLNA 3AG2B 2DQ3A 3UM7A 3OEHG 1DF4A 4H37A 4MVQA 2IU3A 2ZDIC 3E8FA 2BOCC 2V7QG 3OFNG 3VOUA 1EBOA 5J9PC 1KKDA 2EILB 3I55V 3FYEB 1K34A 2OCCC 2QEXV 1RM1C 3OAAG 4X89A 3TK1A 4U7NA 1THZA 4PA7A 2DYRC 3T2MA 1K73W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XL6 A;  2A79 B;  4PA3 A;  4P9O A;  3F7Y C;  3LNM B;  4MW8 A;  4MS2 A;  4WFH A;  1R3J C;  4I9W A;  4GX0 A;  5IY5 C;  3K0G A;  3SYP A;  2QKS A;  3AG4 C;  4XDK A;  5EBM C;  1QLE C;  3SPI A;  1ORQ C;  2H8P C;  3RBZ A;  3K08 A;  3LDE A;  3IFX A;  4J9Y B;  4XDJ A;  3SPG A;  3ZRS A;  2A0L A;  4PDR A;  2HVK C;  3JYC A;  4X8A A;  3HPL C;  5EC1 C;  3ZJZ A;  4MTG A;  4UUJ C;  3RW0 A;  4J9Z B;  4QE7 A;  3EFF K;  3ABL C;  5BZB A;  3ABM C;  4WFG A;  5B1A C;  5KUK A;  3LUT B;  3OUS A;  4GX1 A;  3SPC A;  4MTO A;  2AHZ A;  3AG3 C;  5B1B C;  2IH1 C;  4XDL A;  4GX5 A;  3K03 A;  2X6B A;  3FB8 C;  5EC2 C;  2HVJ C;  4EKW A;  1G4Y B;  3F7V C;  2X6A A;  2A9H A;  4MVR A;  4TWK A;  3ASN C;  2WLK A;  4QNH B;  1BL8 A;  1XL4 A;  1V55 C;  2DWE C;  2AHY A;  2EIK C;  2Y69 C;  4PA4 A;  4R7C A;  2DWD C;  4WFF A;  4RUF A;  3F5W C;  4ZBM A;  3SPJ A;  2WLN A;  2IH3 C;  3X2Q C;  3E8H A;  4R6Z A;  2WLL A;  3K0D A;  3T1C A;  3T4D A;  3UKM A;  2ITD C;  4KFM A;  2Q6A A;  4MVU A;  2Q68 A;  4P9P A;  1ZWI C;  4HZ3 A;  2DYS C;  1K4D C;  3ASO C;  3ABK C;  2WLI B;  1M57 C;  3BEH A;  3LDC A;  5CBG A;  3AG2 C;  3K06 A;  4JTC B;  4G27 B;  1K4C C;  3OR6 C;  4LCU C;  4LP8 A;  4PDV A;  3KG2 A;  4G28 B;  3SPH A;  1OCO C;  2EIN C;  4MW3 A;  3GB7 C;  3TCU A;  2WLI A;  3K04 A;  4PA6 A;  4R50 A;  2WLH A;  2Q69 A;  2QTO A;  2EIL C;  4MVO A;  2W0F C;  3SJQ C;  2R9R B;  4MVM A;  4QE9 A;  4OXS A;  1R3I C;  3LDD A;  4MSW C;  4P2Z A;  4BW5 A;  2JK5 C;  5EBW C;  1J95 A;  1S5H C;  4MTF A;  3FB5 C;  3OR7 C;  3OUF A;  3RVZ A;  1M56 C;  3SYA A;  2ITC C;  2YEV A;  3E83 A;  3E89 A;  4PDM A;  5KUM A;  3STL C;  5CBF A;  2NLJ C;  1R3K C;  2K1E A;  2HG5 C;  3FB7 C;  4LBE C;  2BOB C;  3E8B A;  1OCR C;  4RO2 A;  2EIJ C;  3E8G A;  4PDL A;  3T2M A;  2WLM A;  2P7T C;  3IGA C;  4RUE A;  4X88 A;  1OCC C;  2WLL B;  2ATK C;  2WLJ A;  1P7B A;  5E1A C;  2HJF C;  2ZXW C;  2Q67 A;  3SYO A;  3STZ C;  5B3S C;  5CBH A;  1JVM A;  4GX2 A;  3R65 A;  3WG7 C;  4R8C A;  3T4Z A;  4H33 A;  4PA9 A;  4HYO A;  4MVZ A;  2X6C A;  3UM7 A;  5EBL C;  2ZD9 A;  2EIM C;  4H37 A;  4MVQ A;  4CBC A;  3AG1 C;  3RVY A;  5EK0 A;  2KB1 A;  2BOC C;  3E8F A;  4JTA B;  4RAI A;  3VOU A;  5J9P C;  3TET A;  1KKD A;  3E86 A;  4JTD B;  2HFE C;  4DXW A;  1LNQ A;  4F4L A;  4WFE A;  1OCZ C;  2OCC C;  1V54 C;  3PJS K;  3FB6 C;  3SYC A;  3OGC C;  4X89 A;  1R3L C;  3SYQ A;  4P30 A;  4PA7 A;  2DYR C;  4MVS A; 
#chains in the Genus database with same CATH topology
 4JYA O;  4DK1 A;  2FKX A;  5K1X A;  3BCC H;  1E1Q G;  2YI8 A;  1AI7 A;  5BXZ A;  3BAA A;  3IFX A;  1YEW A;  1WAZ A;  2BSK B;  1XHX A;  3L71 H;  3L72 H;  5KX5 A;  1GM8 A;  3ABL C;  5KUK A;  3K9A A;  4B7K A;  1SQB H;  5GON A;  1VQO V;  1EZJ A;  1S5L Z;  3FD9 A;  4ZI7 A;  4B3T O;  1ZTE A;  3FB8 C;  4YIO A;  4B3R B;  2A9H A;  1YSC A;  2DOS A;  2P67 A;  3ZIA G;  3J7A U;  1FXK A;  1H2S B;  4FMT A;  3JAT B;  3E8H A;  2WLL A;  1LUW A;  1P7G A;  2ZXW B;  1ZAU A;  5CA0 B;  3SR2 C;  4CH6 A;  4PDV A;  1EFR G;  1N36 O;  3JD4 A;  1B04 A;  4MW3 A;  4LFC B;  5IWA B;  2WLH A;  3K5N A;  5B1A B;  4LFB B;  4B3M O;  4WFA V;  2LGW A;  1XMO B;  1BQ0 A;  1UFI A;  3E8B A;  5H5N A;  3UT5 A;  4NXN O;  4X88 A;  4LF5 B;  2QDO A;  2Q7G A;  4O2B A;  4GKJ O;  2QE7 G;  1PL0 A;  4AI8 A;  2GDS A;  3SYO A;  3STZ C;  5B3S C;  4YJ3 B;  2OIE A;  2ZD9 A;  2GUZ A;  2Y4T A;  3DXR A;  4JTA B;  4RAI A;  2HKO A;  1EZV H;  3CC2 V;  4LF5 O;  2CTQ A;  4O2B B;  5KMG A;  3HKE B;  1Q82 W;  2QWP B;  3GVM A;  3OT7 A;  3HKB A;  1R3L C;  2Q0A A;  5JJN B;  5LP6 B;  3CS5 A;  3O9O A;  3OMI B;  4WFH A;  2QA4 V;  2QM8 A;  1ORQ C;  3L74 H;  3K08 A;  2ZDI A;  4XDJ A;  5EC1 C;  4ZOL B;  2KG7 A;  2QWR B;  3W7S A;  2WA3 A;  2IW5 A;  4XDL A;  1UPG A;  2QM4 A;  4LNU A;  3ZRW B;  4EKW A;  4J80 A;  2B9Z A;  4MVR A;  3JAT A;  3HKC B;  2JJ1 G;  4G2K A;  1Z5V A;  1QCE A;  5L3B A;  1OZ0 A;  4X64 B;  1K5Q A;  2EJR A;  3BY6 A;  1BQZ A;  3AG7 A;  1NBM G;  3T4D A;  1BS3 A;  4MVU A;  2Q6A A;  3N2G A;  2LQT A;  4JI2 B;  4BIO A;  4DW1 A;  3LDC A;  1HNW B;  2ZQM A;  3OR6 C;  1GN6 A;  2RMK B;  2LO1 A;  4R50 A;  2DN9 A;  2IJH A;  4OXS A;  4DV6 O;  1H2M A;  2N05 A;  1S5H C;  2LGQ A;  1Y67 A;  4YHH B;  3BFR A;  4L87 A;  4LFB O;  1EM1 A;  4I4T B;  1GH6 A;  2JIZ G;  2WSS G;  5IJ0 B;  2L35 A;  2LJ2 A;  1XQ8 A;  2BE3 A;  5FNV A;  4K0K B;  1XUQ A;  4HBN A;  1WPX A;  2F95 B;  2CDY A;  1QVG U;  3WU2 Z;  3D36 C;  1RP3 B;  5LHG A;  4UFZ A;  5C8Y B;  4LF7 B;  1WP8 A;  5JVD A;  3BPZ A;  3IC7 A;  4F4L A;  3VQX A;  3EXA A;  3ETG A;  4HNA A;  3SYC A;  1OCO B;  5FL7 G;  1Q6U A;  4ZKI A;  2OCH A;  1R6T A;  5J2U A;  1R6N A;  4IHJ A;  1N32 B;  5CA1 A;  2HJD A;  2Z5U A;  1VF6 C;  5HFM A;  1SQF A;  3I56 V;  4JI0 B;  5L3F A;  2HVK C;  3JYC A;  3ZRX A;  1U97 A;  3ZHQ A;  2UUA O;  1TVK A;  2H3O A;  4L8J A;  4JI6 B;  3QG5 A;  2L6L A;  4MTO A;  4IL6 Z;  1PPJ H;  4YIP A;  2CE4 A;  2GV9 A;  5LP6 C;  4FVM A;  3ZMZ A;  2UUA B;  4I9Q A;  5KHH A;  3CJH A;  4DV4 O;  1YXB A;  4K8X A;  4O2A B;  2Y0I A;  1ZWI C;  5BR8 B;  4JAV A;  1K5S A;  3CC7 V;  4FLW A;  1GO3 F;  4ICG A;  4C7U A;  1XOU A;  3H1L H;  4PI2 A;  1O9G A;  4BW9 A;  3QO8 A;  1FFX A;  2HG5 C;  5IY5 B;  1OCR C;  2QWO B;  1GN4 A;  2E76 B;  2P7T C;  1V55 B;  4NXM B;  1OV9 A;  4NTY A;  1MZE A;  5H9C A;  3JD0 A;  1FXH A;  3C3S A;  3FFQ A;  3ETD A;  3N27 A;  1AR4 A;  2X6C A;  1GRJ A;  2AZ2 A;  1VF5 B;  4X20 A;  2A06 H;  4DRX A;  3W7U A;  5DEC A;  1L1F A;  4X1I A;  2HFE C;  5EYP B;  4GT1 A;  3K3W A;  4J7Z A;  2VWJ A;  4MVS A;  3JCZ A;  3OTO O;  3QF7 A;  2W0X A;  5IY5 C;  1E79 G;  1GN2 A;  4O4J A;  3ABK B;  1Y76 B;  3A0H Z;  1XIL A;  5LL6 Y;  4I7Z B;  2JDI G;  2YS8 A;  5LOV A;  1SQP H;  4DR5 B;  3CP1 A;  3JAM N;  3RYF A;  5DED A;  1XDC A;  4JI6 O;  4K8Z A;  1XHZ A;  4UCS A;  3EVK A;  2YIB D;  1RM1 B;  2CGN A;  5HFL A;  2Y69 C;  1L0N H;  1M56 B;  1IXB A;  2AXT Z;  3ZMS A;  1TGO A;  1COW G;  4I5S A;  4I4T A;  4Q6G A;  4UB6 Z;  3P30 A;  1H2L A;  4DUZ O;  4DR3 B;  1FJG O;  1H2K A;  2ETN A;  1Y74 A;  3ZHS A;  4PV1 B;  2EIM B;  4G28 B;  1QNM A;  4KXR A;  3KZI Z;  2R70 A;  3SJA C;  2XUM A;  4Z1M G;  2Q0O C;  1V54 B;  1ENV A;  4MSW C;  4P2Z A;  2BTO A;  4O4L A;  2ZIM A;  3E89 A;  4DV0 B;  1Q7Y W;  4DK0 A;  2ZNI A;  3DTU B;  3K9S A;  3EHB B;  3THO A;  2E5L O;  5CA3 A;  5J2T A;  3CD6 V;  2Q67 A;  1VP7 A;  2PI4 A;  5CN0 A;  1SA0 B;  4O4H B;  2R72 A;  5JJE B;  1I7F A;  4NXM O;  4YHH O;  4UCV A;  1TUB A;  1VEW A;  1DF4 A;  2FL4 A;  4H37 A;  4MVQ A;  2IU3 A;  1XI1 A;  2BOC C;  5IYZ A;  3VOU A;  5J9P C;  3K57 A;  1Q43 A;  3C90 A;  3I55 V;  3S3X A;  1HR0 B;  1RM1 C;  1XNQ B;  5JH7 A;  1XL6 A;  4MW8 A;  4YJ2 B;  3UO3 A;  3VBB A;  4DV2 O;  3RBZ A;  5LHH A;  4EEQ A;  2X7R B;  2A0L A;  2EIN B;  4GYC B;  4B3S O;  3SJB C;  1NTK H;  1WB8 A;  3JD2 A;  1XEQ A;  4QE7 A;  4UVC A;  5BZB A;  3CSX A;  3L9D A;  4PHZ A;  1ZL8 A;  1VAR A;  2Q73 A;  4MT8 A;  3ETE A;  2P4K A;  4H13 B;  1KB9 F;  1LUV A;  1HNZ B;  4OX9 O;  2OCC B;  1N33 O;  3JAS A;  2E74 B;  4DW0 A;  1S76 D;  4PA4 A;  2YSU B;  4YJ3 A;  5KHI A;  3A0R A;  1N8R W;  1N36 B;  2WLN A;  1QLE B;  4GKK B;  3HB3 B;  4DV3 B;  1RSO B;  4TQF A;  4I55 B;  1BSM A;  1JMK C;  4BAY A;  2ZIN A;  3L70 H;  3MD0 A;  4LCU C;  1JX9 A;  3TCU A;  3E22 A;  3SJQ C;  1VQ4 V;  2F93 B;  2RN9 A;  4AQY B;  2PY5 A;  1BGY H;  3AEI A;  2ITC C;  2Q7H A;  2YEV A;  1PNM A;  3OMA B;  4MTX A;  4EB6 A;  3RYI B;  4O4H A;  2WLL B;  2ZE7 A;  1SRY A;  4DV0 O;  1A32 A;  3WB0 A;  1AJN A;  5CBH A;  4WF9 V;  4DR2 B;  1HW7 A;  3U11 A;  4CBC A;  1H2G A;  2EJ7 A;  2OT5 A;  4LC1 A;  1F7Y A;  2IJJ A;  5TIS Z;  1FPO A;  3U0Z A;  3JAW B;  1FFX B;  3JSN A;  4P30 A;  3P32 A;  1WNS A;  3MAQ A;  3F7Y C;  1GM7 A;  5LHI A;  4JGS A;  4DV7 B;  3J81 N;  2P06 A;  1K3E A;  5LA6 A;  1H8H G;  2YUA A;  1D5N A;  3LUT B;  1VQP V;  2QTS A;  4LF9 B;  2PF4 E;  2IH1 C;  4GX5 A;  1NQT A;  4IHJ B;  5EC2 C;  4F6R A;  1AB3 A;  3F7V C;  3CYO A;  1F4N A;  1NR7 A;  4NTW A;  1SA0 A;  3T1Y B;  4FLU A;  1N0J A;  4ZBM A;  1WN7 A;  2BTQ B;  3CC4 V;  1V9P A;  2IM9 A;  4R6Z A;  3KCY A;  3PN1 A;  3HR0 A;  4KFM A;  2UU9 B;  1M9N A;  1Z5W A;  3E22 B;  1ZSP A;  4LFC O;  1PM9 A;  3MHS C;  1WA8 B;  3ABM B;  5LGU A;  2VQF O;  4E2L A;  1K4C C;  3U10 A;  4TV9 B;  3RYF B;  3CE2 A;  3K04 A;  4PA6 A;  1FAF A;  2XND G;  2Q69 A;  2ZM6 O;  1RFY A;  1YVW A;  3TJT A;  2B5U A;  4K0K O;  4ABM A;  4BW5 A;  1IBK O;  5B5E Z;  3FYI B;  4DR4 O;  4DR3 O;  2K1E A;  4LBE C;  4RO2 A;  4DR1 B;  4AQY O;  1H38 A;  1I0H A;  1WJZ A;  3WFV A;  1OHH G;  1K97 A;  2Z3Y A;  3JD3 A;  1R6K A;  2WLJ A;  1P7B A;  2YID A;  1PNL A;  3X2Q B;  3ZN0 A;  2W6I G;  4H33 A;  4PA9 A;  5K1P A;  5KHK A;  2EIM C;  1YJW V;  3J80 N;  3RVY A;  2JEX A;  1PKX A;  4DR1 O;  5B1B B;  3LSQ A;  1SES A;  2WWW A;  3BRC A;  1NU1 H;  2C2A A;  1H2N A;  3FB6 C;  2R9I A;  1G8M A;  4UUJ C;  1IBL O;  4LNU B;  3SYP A;  4D7T A;  4RQE A;  1VQ9 V;  2KQX A;  4PDR A;  5KHJ A;  1XNQ O;  1JJO A;  5A2Q N;  2CTW A;  3CCV V;  4FJC C;  3AG3 C;  1KKC A;  1N34 B;  2DQ0 A;  1NT2 B;  2HVJ C;  4PI0 A;  1CPY A;  2X6A A;  3AG1 B;  4QIW F;  5LP6 A;  3JAK A;  1XRE A;  3JAW A;  4LF6 B;  4R7C A;  4GUN A;  3AK1 A;  4KL1 A;  1YI2 V;  3CCU V;  3Q4H B;  1WLE A;  3T1H B;  2QJ1 A;  3ZRW A;  3CCM V;  2X0L A;  1TA8 A;  2XTA A;  3OGI B;  1HNZ O;  2ITD C;  1FS0 G;  1EN4 A;  4J10 A;  5A9G A;  3JAK B;  5LGN A;  4FLZ A;  2RDC A;  2YIA A;  1VQL V;  2WLI B;  4LF6 O;  4U3J A;  1FXK C;  4ZHQ B;  3E2E A;  5DM6 V;  3KG2 A;  2JVD A;  1YCI A;  3GB7 C;  1GTO A;  4MVO A;  3E35 A;  4LR3 A;  2LW7 A;  3G6E V;  2F23 A;  4HAM A;  1DF5 A;  4ASU G;  2D3O W;  4TV9 A;  1IZ3 A;  2ZM6 B;  5KUM A;  1WA8 A;  2RNB A;  2BOB C;  3E8G A;  4Z1V A;  4JAS A;  1SZT A;  3OE7 G;  4JI1 B;  1JVM A;  1JA8 A;  3RWR D;  2XAF A;  2VWK A;  1WB7 A;  4UCR A;  4NYK A;  3CCL V;  4KUM A;  5EK0 A;  3K5O A;  3ASO B;  5L3G A;  3CCJ V;  1PP9 H;  1VQ7 V;  1JFF B;  4NXN B;  4B7E A;  3SDL A;  2LFS A;  2B1I A;  3OGC C;  1JJ2 U;  3SYQ A;  3K59 A;  2PUS A;  1P49 A;  4PA3 A;  5LMN B;  5FNV B;  4MS2 A;  5IYB O;  4I9W A;  3K0G A;  3SPI A;  5IJ9 A;  2ZCE A;  3ZBH A;  3KCX A;  3FX7 A;  1N32 O;  3N2G B;  3HPL C;  1VQK V;  4DRX B;  2HR3 A;  5FLX N;  4U3J B;  2DW4 A;  4FLV A;  1S3J A;  2XAS A;  4GX1 A;  5B1B C;  2KKW A;  2CH7 B;  2LW1 A;  4JI5 O;  1Q5O A;  3ZHV A;  2UUB B;  1DLB A;  2AHY A;  4CH3 A;  2DWD C;  4WCE V;  4FLY A;  2A7W A;  4JYB A;  3SPJ A;  3QO5 A;  3UKM A;  1I94 O;  1QVF U;  1Q86 W;  1BZK A;  1J5E O;  1L0L H;  2OTL V;  3I5D A;  3BEH A;  2MW2 B;  1OJH A;  3K06 A;  2JS3 A;  4G27 B;  2YXH A;  2WLI A;  4D6T H;  2F4V B;  2G38 A;  2W0F C;  4NTX A;  4MVM A;  3W7X A;  4ZOL A;  5LA6 B;  4MTF A;  2ZIO A;  1YIJ V;  4O2A A;  2IBZ H;  1KUQ A;  1W0K G;  1VMG A;  2IU0 A;  1AR1 B;  1AJP A;  3OTF A;  5CBF A;  2VQF B;  1BMF G;  1R3K C;  2YDE A;  3A2F A;  1Q90 D;  3FB7 C;  3M8A A;  1PNK A;  4JYY A;  1QHT A;  2CTR A;  2EIJ C;  4PDL A;  4UV8 A;  3G4S V;  2ZE8 A;  3IGA C;  1MSD A;  1NH2 B;  2OIG A;  2ZXW C;  3APO A;  4CH5 A;  1AIL A;  1B6Q A;  4GX2 A;  3RGB A;  3WG7 C;  2FYU H;  4IIJ A;  1K7D A;  3HKC A;  3UM7 A;  5F2V O;  3OEH G;  1Q6H A;  2ZT9 B;  4FLX A;  2V7Q G;  2UXC B;  4PJ0 Z;  1R1B A;  3OTO B;  3OAA G;  1PL4 A;  4X89 A;  3TK1 A;  3UCS C;  4B3S B;  4PA7 A;  3T2M A;  2E75 B;  2A79 B;  4P9O A;  1MSW D;  5H6R A;  1G1X B;  2AW9 A;  4CH4 A;  1QLE C;  3RYI A;  3CCQ V;  2H8P C;  4X62 B;  1M4U A;  3OEE G;  4DR5 O;  1RSO A;  3ZJZ A;  3DC6 A;  1VQ8 V;  3EFF K;  1K92 A;  5B1A C;  2AGA A;  1CP9 A;  2XAQ A;  1BE3 H;  2N04 A;  3D36 A;  1G4Y B;  1R73 A;  2QR4 A;  1URF A;  1F23 A;  5CA0 A;  4TQD A;  4RQF A;  5LGT A;  3JCU Z;  2ZR2 A;  3RT3 C;  5LYJ A;  3ZMV A;  3TGU H;  1OCC B;  4H0L B;  2OYQ A;  2F1M A;  4X64 O;  1W59 A;  5GTI Z;  2NNU A;  1QQC A;  4PD4 F;  3GWO A;  4F6E A;  1YDX A;  2EZP A;  1SQX H;  2QTO A;  2P22 C;  4FFK A;  1N4C A;  4DR2 O;  2RCV A;  2HHH B;  2IJI A;  3K58 A;  1SER A;  2HP8 A;  3SYA A;  3RFR A;  4FK5 C;  3JSL A;  4DV6 B;  4Z2W A;  2ILM A;  1TAE A;  4KP4 A;  3H9V A;  2UXX A;  2F43 G;  1PV0 A;  1B06 A;  1JOY A;  2Z0A A;  3AG3 B;  4F6R B;  2AZ0 A;  4FFB B;  4LWS B;  4X65 O;  1PD3 A;  4X1K A;  4XBF A;  1DGS A;  1MNG A;  1YJ9 V;  2KG7 B;  1ROP A;  4UV9 A;  1VQN V;  1V54 C;  2ADP A;  4DR7 B;  1TUB B;  5ITZ A;  4DV7 O;  4UCO A;  4DV1 O;  5JWP A;  1QR9 A;  2XOK G;  3BA9 A;  1E1R G;  3B2E E;  2QKS A;  4BWA A;  2CUG A;  4LFA O;  3CPW U;  1MAB G;  3HKB B;  1TVK B;  3LDE A;  3ZRS A;  1Y76 A;  4DR7 O;  2Y0P A;  4O4J B;  4MTG A;  4X62 O;  4JI3 B;  2Q4P A;  3ABM C;  4WFG A;  4B3T B;  2WAM A;  3WB2 A;  3H1J H;  3CRC A;  1SS3 A;  3K03 A;  2X6B A;  2F66 C;  2WPD G;  2JJ2 G;  3G71 V;  3ASN C;  5BMV A;  2GSM B;  4OPH A;  1DK1 A;  5JVD B;  3ICX A;  3JD1 A;  2EX3 A;  3JAS B;  1Q6I A;  4JI5 B;  4H44 B;  1YTF B;  1CXZ B;  4YXW G;  1M5I A;  4W4L A;  1I08 A;  2WA4 A;  4DUY O;  1HNX O;  1JPX A;  3N2K A;  3W7W A;  4NKG B;  4I55 A;  4GCZ A;  4NR1 A;  1DTO A;  1IUR A;  4U3F H;  1XMQ B;  4DUZ B;  3E83 A;  3STL C;  4U7O A;  5JH7 B;  4DUY B;  5C93 A;  2HHH O;  1SF9 A;  5LMU B;  3K5M A;  3DSQ A;  5E1A C;  1NVP B;  4ZI7 B;  2CAZ C;  3B09 A;  5B66 Z;  2GBO A;  2GTA A;  5EYP A;  1ZL8 B;  3TET A;  2XHB A;  4QGP A;  1FXV A;  3CXH F;  3LNN A;  5J2T B;  2CK3 G;  3PJS K;  2M6Y A;  2OTJ V;  2QKC A;  4JZ2 A;  2KSD A;  1IBM B;  2QWQ B;  5GTH Z;  1NH2 D;  4O4L B;  1R3J C;  2LFR A;  4OPA A;  1HP8 A;  1MOF A;  5GW7 A;  2UXC O;  1KP2 A;  3N2K B;  1WPB A;  4AHC A;  2D2C B;  2M7W A;  3H1K H;  4B3R O;  2VQE B;  4X8A A;  3KKY A;  3CMA V;  4LF9 O;  1H8E G;  3H1I H;  1Y74 B;  4DR6 O;  2PTM A;  2EZO A;  1RPO A;  5J2U B;  2O57 A;  4DYL A;  1M93 A;  4JAU A;  4O4I A;  3SPC A;  1F4M A;  2ZNJ A;  4DV2 B;  4FM0 A;  1HDJ A;  2YC0 A;  3NXS A;  4BIZ A;  2HEP A;  1BL8 A;  3CB2 A;  3HKE A;  3AK3 A;  4FZ0 A;  1MMM A;  2UXB B;  1FKA O;  3X2Q C;  2EIJ B;  2GUZ B;  4A5U B;  2CH7 A;  3CJH B;  1SET A;  1Y66 A;  3ZMU A;  1WP7 A;  2Q68 A;  1KD1 W;  3K79 A;  3LSS A;  3HKD B;  5FPO A;  2Q5Z A;  2UXB O;  1OCO C;  2EIN C;  4UB8 Z;  3UT5 B;  4DV3 O;  4FLT A;  2YIC A;  2R9R B;  3ZHU A;  2XAJ A;  4J11 A;  5H6Q A;  5IJ9 B;  4JI1 O;  1QR8 A;  2ZKO A;  4LH6 A;  3RVZ A;  1S5J A;  5IDJ A;  4TUY A;  5ITZ B;  1XNR O;  1Y4M A;  4JV5 B;  4J7K A;  4JI8 O;  4DV5 B;  5JQG B;  4JI7 O;  3ML0 A;  2FML A;  4LF4 B;  5IJ0 A;  1SQG A;  4X20 B;  3C3T A;  4HYO A;  2JGD A;  4JI4 B;  3BVO A;  3VQV A;  5E79 Z;  2V4D A;  3P3P A;  1LNQ A;  2K9P A;  1VF6 A;  3LSU A;  1VQ6 V;  3M7M X;  4IYI A;  1YHQ V;  3ASN B;  3F5T A;  5KAF Z;  3CXC U;  3OD4 A;  4N21 A;  1KU9 A;  1K8A W;  4KHP B;  3QNE A;  1GAX A;  3RYC B;  1W2B U;  2ODM A;  3M99 B;  4DV1 B;  3RW0 A;  3ZHR A;  4X1I B;  2Q8V A;  2CGO A;  4FZ1 A;  3A8T A;  4NVP A;  1BHA A;  3ZX6 A;  5KMG B;  4DR6 B;  3DC5 A;  2VS0 A;  3WB1 A;  3APQ A;  1BHB A;  1YJN V;  3G80 A;  4I50 B;  3T1H O;  4DV4 B;  2MK3 A;  1XL4 A;  1SKV A;  2EBO A;  2EIK C;  3Q4H A;  4Q20 A;  4JI3 O;  1N33 B;  5KA5 A;  5BR8 O;  3K0D A;  3WG7 B;  3ZN1 A;  2JGU A;  2UUC O;  5B1O A;  2QKA A;  4GKK O;  3D8C A;  3H1H H;  1M57 C;  1G6U A;  1X4T A;  5D5P A;  3AG2 C;  2LP7 A;  4JTC B;  1W0J G;  4JPR A;  1KP3 A;  4B3M B;  4EFB A;  1NZ6 A;  5IT9 N;  1R3I C;  3LDD A;  4N23 A;  2JK5 C;  3B8M A;  1RPR A;  4FM2 A;  5IWA O;  2Y69 B;  3OUF A;  3P3N A;  5CA1 B;  1M56 C;  4WBN B;  1NR1 A;  1YTF D;  1OCC C;  2ATK C;  4ZIB A;  3D3Q A;  2IJK A;  3R65 A;  1ARO P;  4R8C A;  1M57 B;  1NI8 A;  2DQ3 A;  4JI7 B;  4TV8 B;  4NB5 A;  1Z2G A;  2ZDI C;  3E8F A;  3OFN G;  2EIL B;  4JZG A;  4JI0 O;  2QEX V;  1KBH A;  5KAI Z;  2PZS A;  4W4K A;  1THZ A;  3GWK C;  1K73 W;  2P6J A;  2RQ6 A;  2YIB A;  3UQ8 A;  1NVP D;  1D2D A;  3L73 H;  1NTZ H;  3JAL A;  2QGN A;  2BSK A;  1VQM V;  1AJQ A;  1EN5 A;  3SPG A;  3ZS8 C;  1ZUQ A;  4X66 O;  1JCH A;  2ADQ B;  1MA1 A;  5L3D A;  2JEU A;  3B4S A;  1GM9 A;  1NKD A;  2YXY A;  5C8Y A;  3S3W A;  4UVB A;  4GZR B;  3OM3 B;  2UUB O;  4CS3 A;  1FFT B;  1VQ5 V;  2Y4U A;  1XBL A;  4RWU A;  1LR1 A;  1OCR B;  4TWK A;  2WLK A;  3CX5 F;  1JR9 A;  3DGE A;  2PYJ A;  4WFF A;  1OCZ B;  1FYJ A;  4I50 A;  3RYH A;  1F51 A;  4CS4 A;  1K33 A;  2Q7E A;  3T1C A;  3RYH B;  1N34 O;  5CMU A;  5DN6 G;  3CWB H;  1K4D C;  2V1D A;  1I94 B;  5CBG A;  2UUC B;  3SGI A;  4UXN A;  4D7S A;  4QJF B;  4X9Q A;  5GON B;  2CTP A;  2EIL C;  3OW2 U;  2A3Q A;  3RYC A;  3CRA A;  4CC6 A;  3MHH C;  3FB5 C;  3OR7 C;  5LXT B;  1EN6 A;  4K3A A;  4PDM A;  3O65 A;  1L8D A;  4JF3 A;  2QSA A;  5EZY B;  1IXM A;  2Q9L A;  3JAL B;  4DR4 B;  4UCU A;  4IGG A;  5LYJ B;  3JAR A;  4I0X B;  3TXS A;  2HJF C;  3SJC C;  3HKD A;  2R9A A;  3DXR B;  1NS1 A;  2QM7 A;  4J7J A;  5EBL C;  4WBN A;  1YF2 A;  2KB1 A;  1Q8I A;  2DYS B;  5JQG A;  1AI5 A;  1AI6 A;  4JV5 O;  4YY3 B;  4WFE A;  3UO2 A;  4TOI A;  4LF8 O;  1FD9 A;  4EB6 B;  2OWO A;  4LF4 O;  3CRM A;  2YI9 A;  1Q81 W;  2YEV B;  3LNM B;  3R66 A;  5LOV B;  4JI4 O;  4XDK A;  5EBM C;  1SC5 B;  3IC9 A;  1I5Y A;  4J9Y B;  4LF8 B;  5KLV H;  2PI5 A;  4JAA A;  5BY1 A;  1Q3E A;  4TSF G;  4ZHQ A;  2W6J G;  4KHP O;  4J42 A;  4WFB V;  1SQQ H;  4EFE A;  3IJ4 A;  4UCT A;  3FAV B;  4QNH B;  4IIJ B;  5IYC O;  3IAY A;  4AIL C;  1HNX B;  1KC8 W;  1KEC A;  5KA6 A;  2N74 A;  1YIT V;  3B8N A;  1T5E A;  3ABK C;  1MG1 A;  1S0V A;  5IYD O;  4LH7 A;  4LP8 A;  2BCC H;  5LMU O;  2QWN B;  2NR5 A;  3TXQ A;  2E5L B;  5L3C A;  2B1G A;  1AI4 A;  4QE9 A;  1J5E B;  1J95 A;  1I5X A;  1Y6X A;  3ABT A;  1M90 W;  2NLJ C;  1GMG A;  3QTC A;  4X65 B;  2F4V O;  1AP6 A;  2DJV A;  2UXN A;  2UXD O;  2ZR3 A;  5IYZ B;  1IBM O;  5KHG A;  4JYA B;  4MVZ A;  1P84 F;  5D5Q A;  4IYH A;  3AG1 C;  4DO2 A;  1X59 A;  5KX5 B;  1VIB A;  3E86 A;  4JTD B;  4BR6 A;  3MDS A;  1OCZ C;  2JGD B;  1NJI W;  3FAV A;  3NR7 A;  1M1K W;  4LFA B;  2EUL A;  4YY3 O;  4TT3 G;  4JYC A;  3CCE V;  2YXL A;  1VF7 A;  4QPJ A;  3AK2 A;  4LF7 O;  1KMI Z;  4OX9 B;  5LMN O;  2JS5 A;  1ZX3 A;  1U96 A;  1S77 D;  4UVA A;  1BCC H;  5JCO A;  3OUS A;  2AHZ A;  1QBZ A;  2FB5 A;  4HNA B;  1JFF A;  2BTQ A;  4QPK A;  4X66 B;  1V55 C;  1CEZ A;  3K5L A;  4FPP A;  3ZED A;  4CZZ A;  3F5W C;  2IH3 C;  3AG4 B;  1SQV H;  2P5O A;  4E4E A;  2HLD G;  2DE0 X;  4P9P A;  4HZ3 A;  2DYS C;  4FFB A;  4LWS A;  3ZCC A;  4X1Y B;  1N0N A;  3FKS G;  2Y48 A;  2XAG A;  2ZE5 A;  1FJG B;  4GLX A;  5CB4 B;  4DV5 O;  4PEL A;  1AVM A;  3RN4 A;  5EBW C;  4K35 A;  1S72 V;  3ZHT A;  1GK9 A;  3B77 A;  3CHX A;  1IDS A;  5EIB D;  2WLM A;  2FTK A;  4RUE A;  3W7T A;  2P90 A;  1K9M W;  5FPR A;  3CCS V;  3VQW A;  3BA8 A;  3T4Z A;  3ZMT A;  4FM1 A;  2ARH A;  3ETQ A;  1O9H A;  5AG2 A;  4DXW A;  1HWY A;  3CME V;  3B40 A;  1JQ0 A;  3ABU A;  4O4I B;  3G67 A;  3D3I A;  4FIP C;  2PGG A;  4CC5 A;  1D5A A;  2NN4 A;  3OMN B;  2GTS A;  2E3C A;  1BT8 A;  4GX0 A;  1B3Q A;  1UJW B;  2VQE O;  4BIU A;  1HR0 O;  3AG4 C;  1GKF A;  1P4R A;  5CB4 A;  3QVN A;  3QO7 A;  1IVS A;  4J9Z B;  1YZB A;  3T1Y O;  5IE9 A;  1SZX A;  2GHY A;  4CS2 A;  4X1Y A;  4IT5 A;  1MZF A;  4JI2 O;  2UU9 O;  1QU7 A;  3CCR V;  3A0B Z;  2DWE C;  2XAH A;  1HNW O;  2RJZ A;  3CRR A;  3H01 A;  4RUF A;  4TUY B;  5B1N A;  3ZRV A;  5B3S B;  4TV8 A;  3JAR B;  4I0X A;  5JCO C;  3G6B A;  5LBQ A;  1IBK B;  5EZY A;  4B08 A;  3ASO C;  2ZE6 A;  3ABL B;  2XT9 A;  5LXT A;  3CRQ A;  2P4V A;  3SPH A;  1XMO O;  1ZLZ A;  2DYR B;  1US6 A;  1IX9 A;  5JJJ B;  5H2F Z;  1AR5 A;  4YJ2 A;  1XNR B;  4JI8 B;  3BHP A;  2H94 A;  4GKJ B;  3CEI A;  1KQS U;  2EIK B;  1NTM H;  1TUE B;  3L75 H;  4OGQ B;  3BAB A;  1FXK B;  1QLN A;  5L3E A;  3AG2 B;  5BMV B;  1XMQ O;  1IBL B;  3VQY A;  2JRI A;  2PYL A;  1EBO A;  1KKD A;  2DMX A;  5EIB C;  1GN3 A;  1AP5 A;  3FYE B;  1K34 A;  2OCC C;  2VRZ A;  4X1K B;  2UXD B;  1KYO F;  4U7N A;  4J41 A;  2DYR C; 
#chains in the Genus database with same CATH homology
 2P6J A;  1XL6 A;  2A79 B;  4P9O A;  4MW8 A;  1MSW D;  5H6R A;  1NVP D;  3VBB A;  1QLE C;  1VQM V;  1E1Q G;  3CCQ V;  2H8P C;  3RBZ A;  5LHH A;  1AI7 A;  1AJQ A;  3OEE G;  2X7R B;  3IFX A;  3SPG A;  2A0L A;  1JCH A;  3ZJZ A;  2EIN B;  1VQ8 V;  3JD2 A;  4QE7 A;  5L3D A;  2JEU A;  4UVC A;  1GM9 A;  3EFF K;  1GM8 A;  3ABL C;  5BZB A;  1NKD A;  1K92 A;  5B1A C;  3K9A A;  5KUK A;  4UVB A;  3OM3 B;  4MT8 A;  1VQO V;  3ETE A;  1EZJ A;  1CP9 A;  1FFT B;  2XAQ A;  1VQ5 V;  3FB8 C;  2OCC B;  3D36 A;  1G4Y B;  1OCR B;  1R73 A;  2A9H A;  4TWK A;  2WLK A;  1F23 A;  1S76 D;  4PA4 A;  3DGE A;  1YSC A;  2YSU B;  3A0R A;  1N8R W;  4WFF A;  2P67 A;  3ZIA G;  4RQF A;  1OCZ B;  1FXK A;  5LGT A;  4FMT A;  1F51 A;  2WLN A;  2ZR2 A;  1K33 A;  1QLE B;  3E8H A;  3T1C A;  2WLL A;  3HB3 B;  3ZMV A;  1OCC B;  5CMU A;  5DN6 G;  2ZXW B;  1K4D C;  2V1D A;  2NNU A;  4BAY A;  5CBG A;  3GWO A;  4UXN A;  4PDV A;  3MD0 A;  4QJF B;  4LCU C;  1EFR G;  3JD4 A;  4MW3 A;  2EZP A;  1JX9 A;  3TCU A;  2WLH A;  2QTO A;  2EIL C;  3SJQ C;  1VQ4 V;  3OW2 U;  5B1A B;  4WFA V;  3MHH C;  2IJI A;  3FB5 C;  3OR7 C;  1SER A;  3AEI A;  3SYA A;  2ITC C;  2YEV A;  3OMA B;  1PNM A;  4PDM A;  4MTX A;  4FK5 C;  4JF3 A;  3E8B A;  1IXM A;  4KP4 A;  2UXX A;  2F43 G;  4X88 A;  2WLL B;  1SRY A;  1PL0 A;  2QE7 G;  1JOY A;  2HJF C;  3AG3 B;  3SYO A;  1AJN A;  3STZ C;  5B3S C;  5CBH A;  4WF9 V;  2QM7 A;  1PD3 A;  5EBL C;  2ZD9 A;  4CBC A;  2KB1 A;  1H2G A;  2DYS B;  4JTA B;  1AI5 A;  1AI6 A;  4RAI A;  4XBF A;  2HKO A;  1YJ9 V;  3CC2 V;  2OT5 A;  4LC1 A;  1ROP A;  4WFE A;  4UV9 A;  1VQN V;  2IJJ A;  1V54 C;  1Q82 W;  1R3L C;  1Q81 W;  4P30 A;  1QR9 A;  3P32 A;  2XOK G;  2YEV B;  3F7Y C;  1GM7 A;  3LNM B;  3OMI B;  4WFH A;  1E1R G;  2QA4 V;  2QM8 A;  2QKS A;  4XDK A;  5EBM C;  5LHI A;  4JGS A;  1ORQ C;  3CPW U;  1MAB G;  1I5Y A;  3K08 A;  3LDE A;  2ZDI A;  4J9Y B;  4XDJ A;  1K3E A;  3ZRS A;  2PI5 A;  5EC1 C;  4MTG A;  4TSF G;  2W6J G;  1H8H G;  3ABM C;  4WFG A;  3W7S A;  2WAM A;  3LUT B;  1VQP V;  2IH1 C;  2IW5 A;  4XDL A;  4GX5 A;  3K03 A;  2X6B A;  4WFB V;  1NQT A;  5EC2 C;  3ZRW B;  2WPD G;  4EKW A;  3F7V C;  2JJ2 G;  4MVR A;  3G71 V;  3ASN C;  4QNH B;  3CYO A;  2GSM B;  1F4N A;  2JJ1 G;  4G2K A;  1NR7 A;  1QCE A;  5IYC O;  5L3B A;  1OZ0 A;  4ZBM A;  1KC8 W;  1KEC A;  1K5Q A;  3CC4 V;  3JD1 A;  2EJR A;  4R6Z A;  3BY6 A;  5KA6 A;  3T4D A;  1NBM G;  4KFM A;  2Q6A A;  4MVU A;  1M9N A;  1YIT V;  1YTF B;  3B8N A;  4YXW G;  3ABK C;  3MHS C;  1MG1 A;  3LDC A;  3ABM B;  1S0V A;  5IYD O;  5LGU A;  2ZQM A;  4E2L A;  4LP8 A;  1K4C C;  3OR6 C;  1JPX A;  3K04 A;  4PA6 A;  4R50 A;  3W7W A;  2XND G;  2Q69 A;  2IJH A;  5L3C A;  2B5U A;  4GCZ A;  2B1G A;  1AI4 A;  4OXS A;  4QE9 A;  4BW5 A;  1DTO A;  3FYI B;  1J95 A;  1S5H C;  4L87 A;  1I5X A;  3ABT A;  3E83 A;  3STL C;  1M90 W;  2NLJ C;  2K1E A;  4U7O A;  1GMG A;  4LBE C;  4RO2 A;  5C93 A;  2JIZ G;  1H38 A;  2WSS G;  3WFV A;  1OHH G;  1K97 A;  2Z3Y A;  3JD3 A;  1R6K A;  2WLJ A;  1P7B A;  1PNL A;  5E1A C;  2UXN A;  1WPX A;  1NVP B;  2ZR3 A;  3X2Q B;  3ZN0 A;  1QVG U;  2W6I G;  4H33 A;  4PA9 A;  4MVZ A;  5LHG A;  2EIM C;  1YJW V;  3AG1 C;  4DO2 A;  3RVY A;  2JEX A;  1PKX A;  5B1B B;  3LSQ A;  3TET A;  3E86 A;  1FXV A;  4JTD B;  1SES A;  2WWW A;  2CK3 G;  3IC7 A;  4F4L A;  1OCZ C;  2C2A A;  3ETG A;  3FB6 C;  3PJS K;  1NJI W;  2OTJ V;  3SYC A;  1OCO B;  2R9I A;  1G8M A;  5FL7 G;  4ZKI A;  1M1K W;  4UUJ C;  1R6N A;  1NH2 D;  4TT3 G;  1R3J C;  2LFR A;  4JYC A;  3CCE V;  1MOF A;  2Z5U A;  4QPJ A;  3SYP A;  5GW7 A;  5HFM A;  3I56 V;  1KP2 A;  5L3F A;  2M7W A;  4RQE A;  1VQ9 V;  4PDR A;  2HVK C;  3JYC A;  4X8A A;  3CMA V;  3ZRX A;  1H8E G;  1S77 D;  3CCV V;  4UVA A;  2EZO A;  1RPO A;  4JAU A;  3OUS A;  3SPC A;  4FJC C;  4MTO A;  2AHZ A;  3AG3 C;  1F4M A;  1QBZ A;  2DQ0 A;  2HVJ C;  3NXS A;  4QPK A;  4BIZ A;  1CPY A;  2X6A A;  3AG1 B;  4QIW F;  1BL8 A;  1V55 C;  1CEZ A;  4FPP A;  4R7C A;  3ZMZ A;  4CZZ A;  3F5W C;  1YI2 V;  3CCU V;  1WLE A;  3X2Q C;  2IH3 C;  3AG4 B;  3ZRW A;  3CCM V;  2EIJ B;  2X0L A;  1SET A;  2HLD G;  1Y66 A;  2ITD C;  1FS0 G;  3ZMU A;  2Q68 A;  4P9P A;  1ZWI C;  4HZ3 A;  3K79 A;  5LGN A;  2DYS C;  1KD1 W;  3ZCC A;  3LSS A;  1VQL V;  2WLI B;  1FXK C;  4JAV A;  1K5S A;  3FKS G;  3CC7 V;  3E2E A;  1GO3 F;  2Y48 A;  5DM6 V;  3KG2 A;  2XAG A;  1OCO C;  2EIN C;  3GB7 C;  1GTO A;  4MVO A;  3E35 A;  2R9R B;  4PEL A;  2XAJ A;  3G6E V;  4HAM A;  5H6Q A;  1DF5 A;  4ASU G;  2D3O W;  5EBW C;  1QR8 A;  1S72 V;  3RVZ A;  3QO8 A;  5KUM A;  1GK9 A;  5IDJ A;  3B77 A;  2HG5 C;  5IY5 B;  2BOB C;  1OCR C;  1Y4M A;  3E8G A;  2WLM A;  2P7T C;  2FTK A;  1V55 B;  4JAS A;  4RUE A;  3W7T A;  2P90 A;  1K9M W;  1SZT A;  3OE7 G;  5H9C A;  3JD0 A;  3ML0 A;  1FXH A;  3CCS V;  1JVM A;  3T4Z A;  3ETD A;  3ZMT A;  4HYO A;  2XAF A;  2X6C A;  3CCL V;  4KUM A;  5EK0 A;  3ASO B;  3W7U A;  5L3G A;  3CCJ V;  1L1F A;  2HFE C;  1VQ7 V;  4DXW A;  1LNQ A;  1HWY A;  3CME V;  1VQ6 V;  1JQ0 A;  2LFS A;  3ABU A;  2B1I A;  3OGC C;  4GT1 A;  3D3I A;  1YHQ V;  1JJ2 U;  3ASN B;  3K3W A;  4FIP C;  3CXC U;  3SYQ A;  4MVS A;  3JCZ A;  4PA3 A;  4N21 A;  3OMN B;  4MS2 A;  5IYB O;  4I9W A;  1K8A W;  4GX0 A;  1UJW B;  5IY5 C;  3QNE A;  1E79 G;  4BIU A;  3K0G A;  3SPI A;  3AG4 C;  1W2B U;  3ABK B;  1GKF A;  1P4R A;  3QO7 A;  3HPL C;  3M99 B;  2JDI G;  3RW0 A;  4J9Z B;  1VQK V;  2HR3 A;  2DW4 A;  1S3J A;  2XAS A;  2GHY A;  4GX1 A;  3CP1 A;  5B1B C;  1BHA A;  1BHB A;  1YJN V;  1RM1 B;  3CCR V;  2MK3 A;  1XL4 A;  2EBO A;  2EIK C;  2DWE C;  1DLB A;  2AHY A;  2Y69 C;  5HFL A;  2XAH A;  4Q20 A;  4WCE V;  2DWD C;  1M56 B;  3H01 A;  4RUF A;  4JYB A;  5KA5 A;  3SPJ A;  5B1N A;  3QO5 A;  3ZRV A;  5B3S B;  3K0D A;  3WG7 B;  3ZN1 A;  3UKM A;  1QVF U;  3ZMS A;  1Q86 W;  1COW G;  4I5S A;  5B1O A;  5LBQ A;  2OTL V;  3ASO C;  3P30 A;  1M57 C;  3ABL B;  3BEH A;  3AG2 C;  3K06 A;  2LP7 A;  4JTC B;  1W0J G;  4G27 B;  4JPR A;  1KP3 A;  2EIM B;  4G28 B;  3SPH A;  2WLI A;  2DYR B;  2W0F C;  4MVM A;  4Z1M G;  1V54 B;  1ENV A;  1R3I C;  3W7X A;  3LDD A;  4MSW C;  4N23 A;  4P2Z A;  2JK5 C;  3B8M A;  1RPR A;  4MTF A;  1YIJ V;  2Y69 B;  3OUF A;  1W0K G;  1M56 C;  2IU0 A;  1AR1 B;  1AJP A;  3E89 A;  2H94 A;  1Q7Y W;  5CBF A;  1BMF G;  1R3K C;  3DTU B;  3FB7 C;  1NR1 A;  1PNK A;  1YTF D;  2EIJ C;  3EHB B;  4PDL A;  4UV8 A;  3G4S V;  1KQS U;  2EIK B;  3IGA C;  1OCC C;  2ATK C;  1TUE B;  5CA3 A;  3CD6 V;  1NH2 B;  2ZXW C;  2Q67 A;  2PI4 A;  1B6Q A;  2IJK A;  4GX2 A;  1ARO P;  3R65 A;  5CN0 A;  4R8C A;  1M57 B;  3WG7 C;  1FXK B;  1K7D A;  5L3E A;  1QLN A;  3AG2 B;  2DQ3 A;  3UM7 A;  3OEH G;  1DF4 A;  4H37 A;  4MVQ A;  2IU3 A;  2ZDI C;  3E8F A;  2BOC C;  2V7Q G;  3OFN G;  3VOU A;  1EBO A;  5J9P C;  1KKD A;  2EIL B;  3I55 V;  3FYE B;  1K34 A;  2OCC C;  2QEX V;  1RM1 C;  3OAA G;  4X89 A;  3TK1 A;  4U7N A;  1THZ A;  4PA7 A;  2DYR C;  3T2M A;  1K73 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...