4UUQA

Crystal structure of human mono-glyceride lipase in complex with sar127303
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOGLYCERIDE LIPASE
publication title Selective Blockade of the Hydrolysis of the Endocannabinoid 2-Arachidonoylglycerol Impairs Learning and Memory Performance While Producing Antinociceptive Activity in Rodents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 107
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uuqA00
4W1PA 2HADA 1EVQA 3FOBA 4X97A 3NGMA 3AIOA 2WIDA 4X90A 2XLCA 4QDZA 2R8BA 1CPYA 4B81A 3Q8WA 2XQJA 5T4BA 1THTA 3FLAA 4MQLA 5AHXA 5CH8A 2OG1A 1EDEA 2OAGA 4DMKA 1GT6A 5AI9A 4KE9A 4BZWA 4KE6A 1RWQA 4UBOA 4D9JA 5AKGA 5JADA 1LBTA 4ZGBA 4AX4A 5ALFA 4E46A 5AKZA 3WIOA 2WFLA 3ED1A 5J3JA 5ALKA 5KWJA 2DFPA 1MT3A 2WHPA 1MX5A 4DTCA 1UFOA 3R3WA 3SC2A 3WL5A 5HKBA 2OPHA 3H2HA 5E2IA 1IUOA 2QKYA 3ZLVA 1YS1X 1LPSA 2HA4A 4DNFA 1R9MA 4UBLA 2CMFA 1TIBA 2D5LA 5ALGA 4G8BA 2JGJA 1QLWA 4LYDA 1JJFA 5DYWA 1LPPA 1ETHA 3AZQA 3IURA 2XMQA 3L1HA 2PSJA 5HZGA 5A62A 1GQRA 2C5FA 4X93A 5K3EA 3PF9A 5AI5A 1SCIA 1EB9A 2ZJFA 3V1LA 1ODTC 4BDSA 5K3AA 3G02A 3MUOA 2C58A 3WWPA 1CQWA 4H7FA 4CIBA 2QZPA 5AP9A 5I8PA 2J4FA 5ALJA 1EB8A 3I2JA 4Y2JA 1UK6A 3F98A 2X5XA 3EQ9A 4YPVA 2QUAA 2JIDA 4Q82A 4CCYA 5K3CA 3EQ8A 3FYUB 1DINA 3M82A 3BIWA 4KE8A 3GZJA 4FNGA 3ILSA 1YR2A 4K2AA 4WDQA 3ICWA 1U65A 2AXEA 3W2TA 3G0DA 2B61A 4AZ0A 4MXDA 1VXOA 3I6MA 3DKKA 5EGNA 3DNMA 2YXPX 3WKDA 2ONCA 4UPDA 4M0FA 4ITVA 3DLTA 1TCCA 4HRXA 2C4HA 3K6KA 3ZWQA 3QYJA 4BZZA 1GXSA 2VJAA 1MTZA 1ODCA 2PSDA 3OG9A 3T4UA 4AO7A 2DQZA 5CRIA 4MEBA 2DSNA 3WJ1A 1MU0A 2OCLA 3DL7A 4DSAA 1NU6A 4JUIA 4DMFA 4GLBA 1SCKA 4H0CA 1UK7A 4B84A 1B41A 2HA2A 3STVA 2WLSA 4Z49A 5KBYA 3WQHA 3HABA 1XZHA 3WWCA 5EHXA 4KRYA 1E3QA 5AKHA 3TRDA 1GPLA 2QMQA 3BF7A 4WJLA 1MPXA 3YASA 3D59A 1GGVA 4FWBA 3FVTA 1K63A 1ORWA 2XUKA 3D2CA 1EI9A 4J0GA 1HBJA 1QONA 1JMYA 5JARA 3W9BA 2HFJA 1R88A 2XDWA 4O08A 3OC0A 2G5PA 1A8SA 4BCCA 4AXBA 3PF8A 5AI6A 5IVKA 3R3XA 5ALOA 2HA5A 4HXEB 2PUJA 4FBLA 1UOQA 3EIOA 4WY8A 3P2MA 1H22A 2WKWA 2XUFA 5ALIA 4Y2YA 4RNCA 4CG3A 2PSFA 4AMZA 1F0PA 2JGIA 4W9RA 4LXIA 4ZI5A 1N5MA 2YYSA 1MJ5A 2XQIA 3AIMA 3GELA 4FLMA 2WUFA 2XUOA 1CUUA 1GPNA 1JU3A 5HF9A 5AM4A 4P9NA 1B6GA 3IVMA 1XZDA 4GWLA 4UHBA 2HA7A 1F8UA 4Y2UA 5LIPA 4UBJA 4EY8A 5HK8A 3HLKA 4A16A 1GPKA 3FYTA 4G4IA 4J0DA 1L7QA 3BXPA 2JGMA 3UUEA 1LNSA 2Y6VA 3A2NA 1VLQA 5I7UA 3BF8A 5KREA 1TCBA 3QPDA 2GZSA 2PU5A 4FBMA 1QO9A 4PO3X 2XMGA 3I2KA 5I9IA 3R40A 3DOIA 1AX9A 4NS4A 2HU5A 3WI7A 5LZ5A 4MJ3A 1HLGA 3A2LA 1ZIXA 3WK9A 5CT8A 4V2IA 2RI6A 3H19A 2Z8XA 4H7HA 2AJCA 2W6CX 3AFIA 2WSLA 5A71A 2B9VA 4B80A 4YK7A 2XUHA 1XRLA 3V9AA 1QIHA 4QA9A 4W1QA 4BATA 3W04A 4N5HX 3D0KA 1WB5A 3D5EA 5AKIA 5D6OA 4BC1A 3V1MA 3DQZA 1C7JA 4W1SA 5HF6A 2JGKA 1EK2A 1Y7IA 2HL6A 1XRMA 2HIHA 4Y9SA 2PX6A 4X7BA 2PM8A 1L7AA 3B5EA 2OQVA 1QOZA 3C6BA 5AK4A 1CVLA 7YASA 3H2JA 1MNAA 1DQZA 1W4LA 4B85A 3C6YA 3CN9A 3H2GA 4KEAA 4HAIA 5CT9A 4G5XA 1QTIA 4BVKA 2HRQA 4JEIA 4KR0A 1Y7HA 1EVEA 2WHRA 4X6XA 3QMVA 4OB8A 5AOAA 4XJVA 1R9NA 4HXFB 1A8UA 1QIKA 3U1TA 5JALA 1BCRA 3GFFA 1UT6A 1W6RA 2XLBA 4K6HA 2PBLA 1CUSA 2DCMA 5LKAA 3FYUC 4LYEA 5AOBA 4P93A 1ISPA 1Z68A 4BYMA 2XUQA 2WJ4A 3NOXA 5T4EA 3QPAA 2HFKA 4P08A 1FFAA 2K2QB 1T2NA 5ALQA 5AM2A 2JEZA 2PUHA 2AJBA 3G9ZA 1AGYA 2WJ6A 2O2HA 5JAOA 2VJCA 2GYUA 4FHZA 2Q0XA 4PSUA 2QXTA 3F67A 5LZ7A 5ALNA 1HL7A 4DGQA 5DNVA 1X2BA 3RK4A 5ALEA 1D07A 4UHFA 1G66A 3H2KA 3E4DA 1YS2X 3UUFA 5AM1A 3WZLA 1DT3A 1UKAA 4OB7A 3VDXA 3DYIA 1UOOA 5C8XA 4L9AA 1CFJA 3FYUA 2O7RA 2VJDA 1MO2A 1AUOA 3AZPA 4BP9A 2HU8A 4QNNA 2YASA 3H1BA 2WIGA 2WQZA 2I3ZA 1R4ZA 2PKYX 1EXWA 2XE4A 3LCRA 4BE9A 2RONA 2JGFA 2QS9A 1G42A 2Z5GA 4J7AA 5K3FB 5EI5A 1ZIYA 1CUJA 1VJ5A 3E0XA 2IX9A 1MNQA 3S8YA 3I1IA 2QRUA 4H7EA 2FX5A 1DTEA 3CCBA 4NZZA 3KSRA 3VJMA 3WKAA 1ZJ5A 5FDFA 2QR5A 3BJMA 4PW0A 1UK9A 4N5IX 2QXUA 5JYCA 4KYVA 3VJKA 5K5EA 4QEKA 3G0BA 1SC9A 1E8DA 4X95A 3WLAA 1CIJA 3DJYA 5ALUA 1BU8A 1CLEA 3R41A 3B3QA 2WG0A 4UFPA 5CBKA 3IIIA 1M33A 3ZLUA 2VATA 3JYHA 3S2ZA 1XQVA 4LXGA 1ZI8A 4TGLA 4B6GA 1W1IA 4DNQA 1BROA 2GBCA 1AMNA 1LPAB 4IHAA 1XZMA 2Z8ZA 1VXRA 1BE0A 1CUCA 2E3JA 3STTA 3X3HA 1XRQA 2XUDA 4RGYA 1YA8A 3I1YA 4CG2A 4N8DA 3DYVA 3DD5A 5IVDA 4U2FA 2WUGA 4OUKX 5C7YA 3AIKA 1UXOA 3TJMA 1T4MA 4U2DA 3HXKA 5KWIA 4GEGA 5ISMA 3D4LA 1JI3A 4W1RA 2QOEA 5AKKA 2WIJA 2O2IA 1XQYA 2PSEA 1LZKA 4FOLA 1J06A 1N8SA 2OCIA 4NMWA 1DT5A 4G8DA 4INZA 1DX6A 4GBGA 2XMCA 4X71A 4X3CA 2H7CA 3C6XA 2VAXA 3H1AA 1IMJA 2O2GA 2HRRA 3FBWA 4H35A 4AQDA 4DNOA 1ZOIA 3ICVA 5CW2A 3V1NA 1O6GA 4TPKA 3DKRA 1QO7A 3AILA 3D3NA 4EY7A 4G4GA 4MEAA 4C4XA 3GBSA 1LPBB 3CN7A 5CURA 5A2GA 1XZKA 3WZMA 3QVMA 4B9EA 2VTVA 5LZ8A 4ZREA 3ZI7A 1CUGA 4U2BA 3A2MA 4BDTA 4Q3LA 1EINA 3D2BA 1TAHA 3G9UA 4MYDA 4FLEA 4AN0A 1ZGBA 3N2ZB 1EDBA 2QTBA 2AJ8A 1R1DA 2XB6A 2NW6A 4U2GA 5ESRA 3QH4A 4CFSA 1P0IA 3G7NA 3O4IA 5DNWA 3KOOA 4GXNA 2OCGA 5ALZA 3IUNA 2QT9A 4HZGA 5AICA 3O4GA 1HDEA 4LXHA 1WHSA 4S0XA 3N0TA 5LKRA 4FTWA 3G9TA 5AIBA 2WTNA 5AK6A 4QDTA 4PF1A 3RARA 4QWMA 2WFZA 4G4JA 1CUZA 3OM8A 4KE7A 1YASA 1AZWA 2EDAA 3KWFA 4GI1A 2H9YA 1BN6A 2DHCA 1EA5A 2VQ6A 4P92A 3VVMA 3G0IA 4B9AA 1CV2A 5AH0A 1ORVA 5FUMA 2XMZA 5LP1A 3FAKA 3ZLTA 2ZJ6A 1R3DA 3O95A 4C4YA 1A8QA 5FXMA 4U2CA 4J0CA 2G63A 3AINA 2CJPA 2EDCA 4XWGA 3AZOA 2PVSA 2VT7A 4FDMA 4Q1VA 3LIPA 2JF0A 4HS9A 5LZ2A 4I4CA 1CUFA 3LIIA 2W22A 3C87A 1SOMA 4UFNA 4XX1A 4FFWA 1JFRA 4L3WA 3WWOA 3JW8A 4WY5A 4UBIA 5JD5A 3H18A 2XUPA 3IB3A 3STWA 1XLUA 1EHYA 3PUIA 2I78A 4C6HA 1EK1A 1E8NA 4OD0A 3G0GA 2HU7A 1CUAA 5A7FA 3A70A 5ALDA 4RE5A 3O9VA 2HA3A 2WIKA 1ZD3A 1Q83A 4H7DA 3WK8A 3PI6A 3CXUA 3R3YA 5ALXA 1UKCA 4UBMA 1CRLA 2QVBA 5D7BA 2GYVA 4WFIA 5EIHA 5K3FA 5AI0A 1W52X 2OGTA 5DLPA 3C6ZA 3F96A 3AJAA 3R3UA 1WPRA 3I6YA 2IITA 3SK0A 5BOVA 3HZOA 5H3HA 4DM7A 5HFNA 4Y2QA 4BRZA 2XQGA 1WCYA 3ESDA 2BJHA 5JAPA 4AO6A 5ALMA 1MAHA 2ES4A 2ZJ7A 1P0MA 1ZICA 3ESBA 3HC7A 2JGLA 5LZ4A 3NUZA 1WPXA 5JAHA 2Y6UA 4KAJA 5FPQA 4CI9A 1JKMA 1PFQA 2WU3A 5IVIA 3PUHA 4DLNA 2VA9A 1TCAA 4XIIA 1BRTA 2OGSA 2ROQA 3FCYA 1ACLA 3PICA 4X94A 4EB0A 1XZCA 3D2AA 1XKLA 1U2EA 4KRXA 2ECFA 4BE4A 1ZI9A 4XVCA 6YASA 1WM1A 1LPNA 1XZJA 1WB4A 3C8HA 3QMMA 5FOQA 3WL6A 1P0PA 1THGA 4BVLA 4J0KA 4WFJA 5C81A 5DTIA 4BTLA 3IULA 3O4JA 2J4CA 2AJDA 5EFZA 2RHTA 1CUYA 4QLOA 2GBIA 1USWA 4H77A 2YH2A 1CUIA 3FLEA 4GECA 5EIAA 4MWTA 1EDDA 4IH4A 2JBWA 3LS2A 1OILA 5HFAA 1QFSA 3Q0TA 3H04A 1QJ4A 4LKOA 2Y1KA 2J3QA 4OU4A 3G9XA 4BB0A 5BWCA 3KXPA 4DSZA 1E89A 2XUJA 4ZV7A 3STUA 1CUDA 2AJLI 3UMJA 2IIVA 1UZAA 5AM3A 1HQDA 1VE7A 1DWOA 4X92A 5E4JA 3H2IA 2H7YA 5HF5A 5FKJA 3FSGA 5F4ZA 1YAJA 3L1JA 5K3DA 3KWJA 3C43A 4Q3KA 2V9ZA 5AI8A 3DL4A 1Q84A 2GBFA 3D7RA 3GUUA 2C7BA 3WK4A 5JD6A 3MGAA 4ZRDA 2BCEA 3C5WP 3SWWA 3ESAA 1QIEA 2X76A 2GZRA 3M3DA 5JANA 2R11A 1VKHA 1DX4A 1NX9A 3WMRA 4N8SA 1CUHA 3O0DA 5AK3A 1KEZA 1IZ8A 2BUBA 4J0JA 4YASA 4F21A 2CEKA 4QDUA 1VOTA 4UFOA 5LYYA 4QDXA 2Y2UA 4C89A 1CUBA 2PPLA 5ALPA 2VT6A 2Z3ZA 5DWDA 2D0DA 1K5PA 3WA6A 3WWEA 1CR6A 1U8EA 1HKHA 3IA2A 1GQSA 1E66A 5CT4A 2DR0A 4MWSA 4UHCA 2HA0A 1H2WA 1PV1A 4E15A 1WB6A 5FRDA 5IKXA 4Y2XA 4Q34A 4E14A 1QE3A 4L72A 4CIAA 1FFEA 3STXA 5EHZA 2XI4A 3HSSA 3MVEA 3ZV7A 2JGEA 4PQEA 4BAZA 4EZIA 1LPOA 4OPMA 3I2IA 4WDRA 3WA7A 1LLFA 3ANTA 1XZLA 3K9BA 3MUNA 1LGYA 4J0HA 1XZFA 1ODSA 1ZD2P 4HXGA 1XZGA 2QM0A 3GA7A 4JYMA 4BVJA 3QITA 3R3ZA 2VAVA 3CCCA 1C7IA 5EHQA 1YA4A 2BAGA 1G4HA 3WYDA 1XZEA 1XQXA 1KU6A 4EUSA 2WUDA 3U0VA 1FFCA 2ZYHA 4CCWA 4AMYA 4Q05A 2WM2A 5EHNA 2BUAA 5JZBA 2ACEA 4GHWA 5CT5A 5AKLA 4WFKA 1JJIA 1H2XA 4F0JA 1XRRA 1QGED 3K2IA 3IUJA 2ZYIA 1HPLA 3WJ2A 4RPCA 5AKYA 2XMDA 2GBGA 1C4XA 1TRHA 3IBTA 5ALRA 3PFBA 2B4KA 3ESCA 1GKLA 1AKNA 3FLBA 1XLVA 3EQ7A 4PSCA 1QFMA 3BDVA 5JZ9A 1SFRA 2OAEA 4H7KA 5SYMA 5T4HA 5JZSA 3SX4A 5FP0A 1H2ZA 1FFBA 4B82A 5A6VA 1AQLA 4DYHA 3R3VA 3O4HA 3JWEA 4MYSA 1VA5A 2XUGA 5AM5A 2XMSA 3QZUA 1MX9A 3IUMA 1IUNA 4X91A 4ROTA 5E4TA 4C88A 2ZYRA 3FCXA 3WYNA 1Q0RA 2OQIA 1BN7A 1CUXA 2BGRA 4NVRA 3WL7A 4AN1A 3LLCA 3DS8A 2ZYSA 4HTAA 2WJ3A 2QUBA 2G5TA 1DWPA 4HVTA 5DTJA 5HCUA 5C8VA 3QBJA 5HKAA 4IO0A 4Y2RA 4IQ4A 2BGNA 2PU7A 3C5VA 3WIBA 4JH0A 1J2EA 3OOSA 2QJWA 5SYNA 4C4ZA 1SCQA 4B83A 1FJ2A 2GYWA 1BS9A 3WK7A 1R50A 1XROA 4BTVA 5AJHA 4J3JA 4PNZA 4GDMA 3VKFA 4ZXFA 1CUVA 4DIUA 4E11A 2QJRA 3V48A 2HHAA 2X8BA 1RP1A 3DDUA 2OCKA 2LIPA 1MN6A 2XUAA 3HRHA 4EY5A 2PSHA 2H7XA 3AUKA 5DJ5A 5CXUA 4QZVA 1QIGA 1JJBA 2Y2VA 4LHEA 1YSCA 2HA6A 3HI4A 4OYYA 1YB6A 3GROA 4C01A 1QIIA 4FLFA 4C87A 2Z3WA 4K6KA 1TK3A 3KDAA 1A7UA 1UOPA 4QDOA 4AZ3A 3H17A 1XFDA 5CMLA 5LZ9A 4ZWNA 5EIEA 1CQZA 1TKRA 2WILA 2XQFA 3W05A 5IH7A 4UHDA 1WOMA 2BUCA 5T4FA 5DNUA 5CH5A 1N1MA 1K8QA 5D3ZA 3KD2A 2VF2A 1H2YA 4Y2TA 3FWHA 4G9GA 3QPCA 1LPMA 1CEXA 2C0QA 5ALWA 4GW3A 1DWQA 3DOHA 4ARBA 1ZD4A 4H7IA 5JASA 3DCNA 3HACA 5D3KA 4Y2SA 3HEAA 1X70A 2G4LA 1NU8A 3FSGD 1YB7A 2FJ0A 3V1KA 5BWBA 4BCBA 1UK8A 4U2EA 3PFCA 2CKMA 5ALSA 4ARAA 4Y2PA 3C8DA 4UHHA 1RYYA 3FNBA 5ALTA 5HF8A 1E8MA 1JT2A 4BC0A 3QM1A 5JAUA 1N5RA 4UUQA 1W75A 1VZ2A 1K4YA 3OURA 2WFLB 5AOCA 2UZ0A 4EBBA 4BRSA 5BV7A 2WHPB 4UBNA 3WK5A 4I3FA 3BL8A 4PSDA 2CUTA 4B0PA 4ETWA 4M0MA 1J1IA 3H0CA 1E5TA 5AO9A 4KAFA 1I6WA 1MAAA 3WWDA 2BFNA 2C0PA 3E1GA 1BEZA 3F97A 1BEEA 1F0NA 2CBGA 4W63A 1XRPA 3T52A 3W9UA 1KU0A 1XRNA 4I19A 1Q0ZA 2RHWA 4DMCA 4MQMA 5HK9A 5JATA 3M83A 1FSSA 2ACKA 1K6EA 2PL5A 1QIFA 3L1IA 1ZGCA 3OTQA 2FUKA 2WG2A 4FMPA 2JEYA 2V98A 5HQ3A 1MX1A 3W06A 3WKBA 3G0CA 4UBKA 4A23A 2RIPA 3WL8A 2WTMA 3RKSA 2ZSIA 4KAAA 1H23A 3WK6A 3PE6A 5DYYA 5YASA 2J3DA 3DEAA 4B0OA 1A88A 4QWWA 4OSEA 1G5FA 3VXKA 2RGUA 1W76A 3BE8A 4PV7A 1XZAA 4QE3A 4CCYB 4IH1A 3BDIA 2FJPA 5LLSA 4TVKA 4UHEA 4G1FA 4AB1A 2ZVDA 3IUQA 1X2EA 3HYSA 4OU5A 2B20A 4EA6A 1BCSA 4K5QA 4OB6A 3VVLA 2XQKA 2V97A 4FKBA 1XKTA 1XLWA 2HM7A 3C70A 4DMHA 1CUEA 4H7JA 4BP8A 3BJRA 3WKEA 5A7HA 1OCEA 1F6WA 1P0QA 4Y7DA 1VZ3A 3I2HA 1DQYA 2V96A 4JNCA 3F9CA 1XZIA 3I28A 5AKEA 4K6GA 1LZLA 3I2FA 2ZSHA 2XMRA 5IVHA 3A6ZA 5AKJA 3PDCA 3BIXA 4RE6A 5A7GA 4FFVA 2RAUA 1QZ3A 2XUIA 3BWXA 5ALVA 4OCZA 5ALYA 1IZ7A 1VE6A 5AI4A 1QIJA 1QIDA 3NWOA 5FLKA 2I03A 3VISA 4AO8A 1IUPA 5K3BA 2WIFA 2WUEA 4KJXA 2C5GA 4BAUA 5C8ZA 1FFDA 1EX9A 2O7VA 5AKXA 1QIMA 4F60A 2I3DA 1AC5A 3F8SA 3IDAA 4Y2VA 4G9EA 3I2GA 4X00A 4B7ZA 2XMBA 3O9MA 1WHTA 2CB9A 2CZQA 2EEPA 4LIPD 3RLIA 1DU4A 4L0CA 1YAHA 4H18A 5CTAA 1CUWA 5CXXA 3WKCA 4QLAA 1YCDA 2VJBA 3HJUA 1ZD5A 3STYA 3E3AA 1XZBA 4WCVA 4X6UA 4F5ZA 3M81A 1AURA 1ZJ4A 1VA4A 4EY6A 2WFMA 4J03A 4M0EA 1L7RA 2BKLA 4BBZA 4N8EA 4EY4A 3B12A 1ACJA 1U4NA 4ZV9A 2ORYA 1IVYA 1QTRA 5DYTA 2HDWA 4FNMA 1Y37A 5AK5A 3OPMA 1OXMA 3QMWA 1JMKC 3RM3A 3TEJA 1UKBA 1XQWA 1UWCA 4DNPA 2P8SA 4BAGA 1S8OA 3FVRA 3C45A 4EHBA 3R0VA 5FPPA 5ALLA 2H1IA 3VJLA 5CT6A 1JU4A 4Q3OA 2DHDA 2DQYA 2XT0A 3ZPXA 4OYLA 5HQ3B 5ALHA 4KACA 1EH5A 1LBSA 5E4YA 3EBLA 2VSQA 5JD4A 5FV4A 4X6YA 4X85A 4BCDA 4YX9A 1GKKA 3EF3A 1PJAA 4A5SA 2WHQA 1J07A 5JIBA 3I6ZA 1GZ7A 2OLEA 1TQHA 1ZI6A 1O6FA 4J0IA 2OXEA 3ANSA 4HRYA 5AM0A 4CG1A 3LP5A 2VEOA 5AIAA 2WU4A 4G8CA 2WG1A 4JYPA 3TGLA 3G8YA 4IH9A 2OGZA 2DHEA 5CH3A
chains in the Genus database with same CATH superfamily
5TMEA 2NUPB 1NF3A 2R6HA 4OH1A 4N65A 3LGSA 2ZQ5A 1AB6A 5FAXA 5KNCH 3MILA 5IF9A 1TCUA 1Y8AA 2CDRA 3HO8A 4R83A 3LT1A 4MZDA 4X97A 3EQZA 3NGMA 5IULC 3AIOA 3OZXA 1QRTA 2XLCA 3IB6A 2CJFA 2R8BA 5A5VA 4I4TA 4M88A 4ND4A 3A9CA 5LA6A 3Q3CA 3SEQA 1P1KA 1SOWA 1E92A 2NU9A 1ZUWA 2HOQA 1VGVA 3R6GA 3NT4A 1A1VA 1ZHFA 2XQJA 4I55F 4C03A 3QX3A 2QRKA 1THTA 2PA0A 4FHCA 4MQLA 2NXJA 5JJKA 3SBDA 4EI8A 1EDEA 5A2QA 1UPBA 3BD8A 2QRNA 2WZQA 5EQTA 1UDBA 1GT6A 3MOGA 3P1JA 5DW3A 3SJBA 2GN1A 1JSRA 3BGOS 1ZX1A 4PZDA 4EYQA 4OJNA 4D9JA 4FGJA 4DW8A 4F46A 1QAMA 4HVAA 3FIJA 3IQDB 5JADA 2C8LA 4MV3A 4YUAA 4ZGBA 5IFKA 4AX4A 5ALFA 3GOQA 1JB1A 4BFSA 2Q45A 4Q18A 4XZ3A 1B1CA 5AKZA 3WIOA 3MSCA 5LUAA 1NMZA 2BF4A 1CZHA 3ED1A 1F8GA 3CGWA 5J3JA 4P32A 4CKZA 3G82C 1MT3A 3SZOA 4YJ2F 5DWVA 1Z6XA 2G5GX 3RV4A 5IJ9A 4YHBA 1MX5A 1UFOA 2WSYB 3AUXA 4EG3A 4EUKA 1BCRB 1RAAA 2OB2A 1E4OA 3DMNA 2PX2A 4D96A 4EKYA 2FW0A 1JWAB 3KJGA 3SHVA 3H2HA 4DXDA 4J9VA 1WZEA 2HSZA 4J1QA 1DBWA 2G77B 1NVMB 1X14A 3ZZNA 1UDWA 2GF0A 2FSVC 3PEUA 4OHFA 5IYZB 3MFQA 1GYRA 1U2DC 2R62A 3UJPA 4IGAA 3OP4A 4QJ4A 2BKAA 2YRFA 1UWKA 2DY0A 4WCFA 1U7HA 2NQTA 1CDOA 4LYFA 2EFCB 4ZJYA 3KZNA 1XVUA 3B3GA 5HX7A 3UJAA 1R9MA 1TUBA 3BL6A 5DP1A 2CMFA 3WG9A 4HDKB 3ZJ4A 1SXQA 2Q3FA 5AW4A 3PUZA 1UFQA 4MI1A 4Z4EA 1FK8A 1OYOA 4RFLA 3BC1A 3DE5X 3NBXX 2JGJA 3QV1A 1TNDA 1FTQA 3A04A 4KZKA 1L7VC 4QYTA 3QVXA 1M74A 4PZPA 3O75A 3W5JA 1JG1A 1LPPA 4FQ7A 4ZZ2A 3WB1A 1II0A 4FE3A 2YDXA 3BBLA 3VFDA 3CEPB 1X1CA 4DKXA 4DLBA 5G4KB 1I2BA 4NFYA 5IT5A 5LB4A 1HYEA 4ARIA 1L7BA 4IIVA 4I81A 2R7MA 1MIHA 4KQFA 3DLCA 5KMGA 4UEWA 1V8FA 2G0TA 4PVCA 5DGHA 2CXSA 2Z2YA 3R4VA 5K3EA 3O31A 1KK2A 2D2IA 3NATA 2WWIA 1FX1A 1SCIA 1WSAA 3RR2A 2YWEA 1X3SA 5K3AA 1UC5B 4ZT3A 1W0KA 4QIHA 3BAFA 1CERA 3RF7A 4FXPA 4K9KA 1Q6YA 3TD9A 1VCNA 3L49A 2A9OA 1FRNA 3L0OA 2IPOA 2WFAA 4KH0A 4WBNB 1CQWA 3ZV4A 3PQ5A 2HU2A 3DV0A 4P6VF 1XI2A 4H7FA 4TWZA 4EQ6A 4F9EA 2VSXA 2ZBPA 1E61A 7REQA 4LXUA 2D2EA 5AP9A 5G1NA 3T0GA 2J4FA 2QPTA 2QSYA 4KFSA 3PSHA 1N4DA 3I2JA 3GLIA 2G4VA 1ARZA 5CA1F 4BQOA 5JC1A 4BY9E 2I2BA 5ARDA 4QUBA 1UK6A 2VHQA 3SX0A 2SBTA 3EQ9A 1WKBA 5JXWA 2C57A 4N7JA 5H3CA 5JI3E 2NMVA 5BVHA 1KAHA 4P7JA 3WL4A 1OGYA 4ZI3A 5F2NA 3IJ5A 4D6XA 5JJBA 4LXXA 2QTVA 1IZ0A 1C4WA 1PZHA 4HS4A 4KE8A 5K0CA 2FP4A 1ZA2A 2QUJA 1VTKA 3EZLA 3GY0A 1ZQ1A 3ZVMA 3UANA 3CMMA 1QM5A 1V6SA 1GG9A 3ZY6A 2Q3BA 1Q1EA 4IQ8A 3CLHA 4LI0A 4MKIA 4K2AA 3QTLA 5EJMA 5BN5B 1JZQA 1YR1A 3K0AB 1SQFA 4P38A 3VZQA 1YQDA 3PEYA 3G0DA 3VZBA 1ORHA 2A5YB 4IV0A 1DAPA 3LQYA 2Q5IA 1VXOA 3JQDA 4MXDA 3DH0A 4N82A 5FI1B 5TMDA 4IHKA 5B3AA 4MWZA 2PR2A 2NTYC 1KAMA 5EGNA 2CHFA 3EAFA 3DA8A 5E2AA 1O2DA 2F17A 3D43A 2ONCA 3T6KA 3EVEA 3LGXA 3T0FA 3N6VA 3A2KA 4MR9B 4RAQA 1CDDA 3NIDB 5EIWA 3DLTA 1D6MA 1T9GS 3F9RA 4G1MB 1GTJ1 2HBZA 1TQ8A 2NSYA 3DV2A 4HB3A 4NYJR 1TCCA 4J29A 3K6KA 1CKEA 2ZR0A 3ZWQA 1ZA1A 1IPFA 2A0YA 2OMEA 2QTRA 3VM6A 3T3HA 5JAQA 2AKEA 1UZLA 4TS3A 1WD5A 1RDFA 3ZBQA 4S1NA 1SB8A 5REQA 2CW5A 3H11A 5EYPA 1Y8CA 5F9HA 4D9FA 2D0PB 3CNHA 5AVJA 2BM0A 1QXSA 3T4UA 1SO8A 3TD2A 1MR3F 1SBYA 1HE4A 4JJEA 4J2HA 4V2UA 4RDXA 2JFYA 1QE0A 3Q2OA 4B33A 3PJDA 4CT0A 3CZ4A 2BMJA 4FUQA 5CYFA 3IAS1 2WT4A 3RVPA 3U16A 2ZKLA 4KPGA 1N0HA 1KEEA 3GO4A 1BXRB 1D4ZA 1NU6A 2QN8A 5FLYA 5A4IS 2E5LB 1ISRA 4ER7A 2V54A 4BLSA 4ZEOA 1G21E 1YVDA 1LK7A 4AKHA 3I83A 3FNGA 2R48A 2FRVA 3GQVA 4MO9A 5TSDA 3O8LA 3WMGA 5KTRA 2GCPA 2WIBA 5K51A 1E0KA 2ZATA 1EFVB 4Z49A 4TZ6A 3MCAA 3SVTA 1IN6A 1OA0A 3G1UA 1MD9A 2IUSA 3E9NA 3HHEA 5B53A 2Q1YA 2WSIA 5DK4A 5GJVC 3QWHA 3JQPA 3HO6A 3ZNQA 4A6PA 2VQEB 2C2BA 2VT3A 2OLJA 1AV7A 5J4HA 1BDBA 1GPLA 4HFMA 2N1MA 2OFPA 1XRJA 3IPLA 3LOPA 4RH3A 2X1HA 1XXHA 3FIUA 3AUSA 1XTPA 2VYNA 1S0UA 1V4NA 2P9YA 1GGVA 2R8YA 1HWYA 3EW9A 5JNUA 3LPAA 3CX8A 4IDBA 4EVIA 4J6EA 1XQ9A 4B35A 1OSNA 2FPUA 4ZODA 3HUTA 4MWDA 3D2CA 4HJRA 1OMOA 3M6AA 3QBDA 3U62A 5BYJA 2D1QA 1XTRA 3OEWA 1JMYA 2HLDA 3W9BA 1QP8A 2Z6VA 4K7JA 1L5HA 1T8WA 5LIRA 5A9SA 2JHGA 4W82A 2P5YA 2GWRA 2W37A 3K15A 3OC0A 3NDJA 1H8HD 1U0OC 1VQ1A 3EC1A 1Q0UA 2KE5A 2G5PA 2Q5OA 3TK1A 1A8SA 3N7TA 5JOQA 1FFHA 3FAZA 1XF9A 1A8HA 3ONFA 2WKPA 4AXBA 2FVXA 1L8XA 5IVKA 4GXQA 2PL9A 3PZBA 4LSMA 5A1TA 4EPRA 2XCLA 1N6KA 1T3LA 2JLZA 1B1AA 2DE0X 3O6VA 4PLFA 1W35A 1L5KA 1A9XB 1UDXA 1XDUA 2G6BA 4Z6KA 3B36A 1IBCA 1EGAA 1ESCA 1LVGA 1WP9A 2FQWA 1O96A 2HA5A 1NOIA 2OVFA 2VA8A 1KZHA 3GFQA 721PA 3AL0C 3INNA 4PRZA 1UZMA 5DBEX 1NQWA 1SBHA 3OTGA 5AJWA 3F6BX 5F5LA 1V7CA 5GONF 5KHLB 5I5GA 3AKZA 1CEEA 2WKWA 4Z86A 1AK2A 2QTWB 2MMCA 1GAEO 2P6UA 4Q48A 1PJ3A 3BMNA 4Y2YA 5A0FA 3VC7A 3DT6A 821PA 3QLUA 3P20A 4IILA 3V2HA 1F0PA 3EGOA 3EXHC 4GPBA 4X84A 2YJNA 3R4CA 4LCJA 3QXGA 2QV0A 3C3XA 2JGDB 3SICE 3UCEA 1JHRA 2J9RA 1EFAA 3E27A 5TQ0A 5LBIA 1R64A 4BZQA 1QZXA 1FL9A 4D98A 1XDZA 3CBQA 1WB9A 2XQIA 3RH0A 1W4CA 1F48A 1SUDA 2C2GA 1YXMA 3G8DA 3GELA 2AGVA 3IAM1 4HAXA 1Z2EA 2XUOA 4W7HA 3RRYA 1J0AA 4IW3B 2XGOA 1EP1B 3VC2A 1SZPA 2J3MA 2OK7A 4PG7A 1OIVA 1JU3A 2UYHA 3DFFA 3LBIA 3PT5A 1TT7A 2DECA 4N40A 3SY8A 5DWQA 2C7RA 1STOA 2A5FA 2PKXA 3NHZA 3OCWA 1B6GA 1NW9B 1VRCA 3IVMA 4GMDA 3EIFA 1JIIA 4GOND 4MARA 4AT1A 4UOEA 1NHWA 1NLUA 2J3HA 4Q1BA 5IHPA 1ZD1A 2VH2A 1PSWA 2ZAOA 4L4ZA 5FUWA 1I7QB 5DV9A 5JWOA 3D0RA 5TJHA 4C2BA 1Q91A 4F6LA 1I5EA 3OTOB 4KXWA 4EY8A 3U2QA 3OQ1A 2RGRA 3DZJA 4MIEA 3VR4A 3T3OA 4WPGA 2OV6A 1JUDA 3DVAB 1X7HA 2VPPA 1OIWA 2FI1A 3A6HA 4PONA 3FYTA 3TZBA 1TLLA 4E2FA 3QE9Y 2NYAA 1RYFA 1V7PC 1XTJA 3BXPA 4Q1CA 2JGMA 4R69A 4B4UA 3KV1A 4TYQA 3PKJA 1KMIY 3IIEA 3TLYA 3B38A 4KFCA 4ISCA 5T67A 1C5KA 1N2HA 1N5DA 4ZYYA 3GQBB 1JILA 4ENSA 3NMUF 4PFJA 4PNHA 1TZ2A 1N6IA 1SCNE 3QPDA 3NGXA 1JVSA 1Z5UA 4ZZ0A 3NIBA 1ZM4A 4FBMA 1QO9A 1R8QA 4JOBA 3H0KA 4N54A 4OO3A 2XMGA 4U3JB 1IOZA 3I2KA 2O23A 1R66A 5AXDA 4E6PA 1RJWA 2FOIA 3H2SA 4Y1GA 4PYQA 1MX3A 4FSDA 3MBOA 4Q93A 3VNAA 4RTMA 3WR5A 4MPRA 4P83A 1AX9A 2WTUA 4Y9TA 2X0DA 2E6KA 2W9XA 3ZWYA 2I2CA 1G98A 2HU5A 4CLEA 3WI7A 5LQJA 1DKLA 2PX0A 3HR8A 3PR3A 1FP4B 3VAZA 2XRFA 4YMGA 3T7EA 3WK9A 1C9DB 4CLHA 2ZBVA 4MPDA 5I9NA 4QBGB 2RI6A 2IXFA 3H19A 2Z8XA 4ZVVA 4A0QA 1ZRMA 4AKSA 3ZWNA 3TLEA 5CFLA 1I2CA 3K8QA 3OT4A 1GL3A 3TNFA 2VJKA 3WGYA 3L40A 5CVVA 1CQJB 1HEIA 2FWNA 2JRLA 5FULA 1W5AA 1QUFA 1W4AA 1JLMA 1S1CA 2W6PA 4ESEA 1BX3A 3G2LA 3O5AA 3PDHA 3QLVA 4OMFG 4G56A 4FSHA 5AYVA 4EB8A 4P4NA 4CMEA 2GPNA 2YZGA 1MUUA 2NZYA 2XUHA 4P35A 5KYXA 3HSKA 3L04A 3EEYA 4OGGA 5LMNB 3COZA 1GTRA 3WGOA 4CCSA 5CCDA 4QA9A 5U4XA 5IM4A 4B3DA 3EUFA 4IUCS 1T4BA 2B9EA 2NUPA 2ZS7A 3ED5A 4N5HX 4RELA 4RZSA 5FO0A 1WB5A 1WHSB 2GS9A 1NUTA 3D5EA 4UNNA 3V1MA 3KJEA 2X0RA 1DKRA 3DQZA 1OXVA 2PSSA 1D09A 1CB7A 4OAQA 4Q1FA 2HPHA 3NIWA 2B4AA 1Y7IA 3AP3A 4LTNA 1UBTS 2B69A 4G84A 4HFJA 4Y9SA 1U1DA 3VR5A 1XNJA 4XW2A 1BOFA 3MJDA 2PM8A 3B5EA 1ZOLA 1JA0A 1K66A 2XYGA 2ORIA 2NSDA 5KDDA 4ID9A 5EEGA 3IE1A 3GJXC 2YIJA 3KT8A 1IPEA 2V4UA 4DNXA 5IKOA 1CYDA 1Q2XA 1CU1A 4M1KA 2QF7A 3W5VA 2YXBA 1KO4A 3ZDQA 4XWOA 1P1HA 1A7KA 3LPCA 3EEOA 1SU6A 1U7XA 3CN9A 3H2GA 1JRLA 4KEAA 4M9QA 5EIBD 4ENQA 3DCIA 4ETNA 1MB2A 1V3TA 9ATCA 3M4ZA 5CT9A 3DZDA 4LBYA 1QTIA 1OVGA 4OVKA 2OM2A 4YPFA 3LUGA 4N7MA 4B44A 4JEIA 1SY7A 4IIUA 1F2UB 2PO7A 2QLFA 3DZHA 3QU4A 5LMZA 1G1AA 4ND3A 3EPLA 4RSGA 4X6XA 2F6RA 3RTAA 3NUGA 4H9GA 1Y3DE 1R9NA 2P6OA 2Y0EA 4IVNA 5CK5A 2VP3A 1WZNA 3EASA 3MJCA 1GZUA 4WJKB 3VPCA 5JALA 3A8TA 1E1QA 3O7MA 5LB2A 1BCRA 3PX2A 4MRNA 1WUHS 2XCOA 4ARSA 1AN0A 4L9WA 2BHNA 1ZWLA 3U4QB 2E4ZA 1H8HA 5F12A 3FMFA 1NF2A 1S2DA 4O0LA 4QSHA 4ESVA 4R2WA 2AL7A 2P2ZA 2XLBA 4ACBA 1NDQA 1UBLS 3BHIA 1USVA 1H3FA 4AD8A 2OR3A 1NP7A 5LKAA 1BWPA 3RIEA 1NXVA 4BNVA 1H85A 2ZUDA 3MWJA 4YAJA 3WNQA 4GE0A 4LYEA 4Y6QA 3BORA 1IXKA 1OLSB 2BHLA 2I1LA 3KAKA 1YC2A 1XTSA 2FETA 1R0BA 5GM1A 4BKMA 3QPAA 4YXWD 4HGRA 2ZIVB 1Y4SA 1R0CA 4HDKA 4PS0A 3CVYA 3UV7A 2HFKA 3C8ZA 1VC2A 3V2IA 1ZUD1 4UEJA 3QQ5A 4BFYA 1MBZA 1A4IA 4EMTA 4DCJA 3SIRA 5AM2A 2X40A 2PUHA 2VDQB 3CPJB 3GJ6A 1TI7A 4NCIA 4OQDA 4R9RA 3VZDA 1M9NA 4ZVLA 3UJBA 3BB3A 2RJOA 2AXPA 5G4KA 2YQ5A 4BQQA 4XGNA 3OAAD 2A0XA 2D5BA 2XRYA 1IJKA 2VJCA 3K4HA 2HZBA 4EJFA 1VCIA 3TTSA 3K09A 3PQDA 2RB4A 4BX9A 5K0BA 1HFWA 3S2IA 1KJ9A 1BFKA 1KBQA 4WZAB 2V55B 1TUIA 2ZUVA 2HK8A 3AJDA 3U6KA 3J7AC 3D6UA 1M8JA 2EFYA 1SBTA 2X19A 4PXYA 4R2IA 2I87A 3L7CA 5ALNA 4UTXA 1L8AA 3EEBA 1TC2A 4PCUA 1E0AA 4DGQA 1YONA 1KFBB 3OIFA 3BFKA 4BNHA 4E5NA 2ILTA 2X0FA 5CNJA 2A3NA 1Z37A 1A0OA 1ZMRA 2I4TA 4NOMA 5DNVA 1UFRA 1I0IA 1YK1A 5F76A 3A1NA 4C6SA 4GPZA 4UHFA 4DZRA 3QU7A 2VJYA 3LQFA 3IEMA 3LYHA 3JWHA 4N0PA 4WBNA 3BJEA 4E7PA 4HQNA 4GT1A 1HMPA 1NQUA 1YVRA 4DJEC 3TRFA 3A9WA 1D5CA 3RWOA 1ZXLA 3UYLA 4HMOA 4YJFB 1EIWA 4UDOA 1E20A 4DMGA 1DT3A 1UKAA 4I99A 1RMYA 3X1XA 1F0YA 2X9GA 1J7KA 4JI4B 4A2PA 4UNRA 2CNLA 4W5QA 2Q9AA 4HB2A 4GMKA 1ESNA 5JCPA 4Y98A 3GZNB 4BGUA 2NO7A 1IH8A 2PBZA 2YWRA 3B1VA 3CWQA 3ZZTA 1DIRA 1BMQA 1Y9ZA 2D0IA 4CDMA 5J4YA 4DR5B 5JS1A 5GOZA 5E4FA 2HU8A 1Z28A 4PQRA 4MKZA 2JCXA 5JSHA 3H1BA 4N6NA 5LJLA 3GPLA 2HR1A 1I51A 1T6YA 4WN3A 5BN1A 5AW0A 5BN5A 4X66B 3K0AA 4NBUA 1CDEA 2I3ZA 2LZ0A 1RE1A 3AR5A 3CMCO 1EXWA 2XE4A 4CPDA 3E05A 4CUKA 1GZ4A 2F9LA 2CVQA 2YJ5A 1EZZA 3NBYC 1Z2OX 3UN1A 2MCFA 3IP6A 2DJ5A 1G42A 1ZCJA 2IYLD 2PL1A 1N57A 3C3WA 3OESA 4INAA 3TSAA 3TQHA 3U3KA 1UFKA 3G8BA 1PVDA 4XSVA 3GHHA 1CDZA 4GUDA 4J7AA 5FADA 3EXFB 4K6OA 5CJJA 4K9OA 3VTAA 1ZIYA 1WO8A 2AUNA 1PK9A 4MR9A 5G0WA 5I7RA 4R0NA 4REQB 2QUKA 1O97D 5SZHB 1DWUA 3R0QA 4RK7A 1WW2A 2KS6A 5SY9A 1Z38A 4J0EA 1NNLA 1YMVA 4XOIA 2RJNA 5BV0A 3RUPA 3QXSA 2JGAA 2VUSA 3RFVA 3KSRA 5EZ5A 1UJBA 1M34E 3EFHA 4XR9A 4D74A 2BGMA 1YBVA 3OFJA 2XOKA 1QP7A 3TCNA 1E2IA 4D8YA 4ZICA 3N76A 3P9PA 1QRRA 3BERA 1YULA 2HGZA 4RKEA 4MYCA 1A1SA 3EMBA 2D8AA 4GWKA 4H1HA 3X2FA 5JNWA 5CVUA 3LFUA 1BXRA 2M32A 2P9EA 4QBIA 4KYVA 2F8LA 1W34A 2O4CA 4OHKA 1FMTA 3UB2A 1PL8A 3A3YA 3JQ9A 3QELB 4G0NA 2D5AA 4HNQA 4X95A 3K0HA 1CRPA 2NUTB 3N87A 3G88A 3Q87B 4HWOA 2KBEA 4HR7A 3J81k 1CLEA 1K89A 2YFQA 3R41A 1IN4A 1FMJA 5CBKA 1N6HA 5BSMA 1Z7WA 1EFVA 3IIIA 2A84A 5CM8B 1DJPA 5I9BA 4EF4A 4JR2A 2JW5A 2AYXA 1JG3A 4FR0A 2VATA 3CUKA 2IGTA 1OTXA 2PMFA 3ANYB 3JYHA 4KHZA 3TCXB 1K5GA 2YXNA 4DJAA 2AJTA 1ZI8A 3OMXA 4MA5A 1IL0A 4EW6A 2J3JA 4MYRA 3UT6A 4DNQA 5JXHA 4NX2A 1RXWA 1AMNA 1XCLA 2NACA 3NO4A 1RYBA 5KSPA 2XNCA 4FGWA 2UVPB 1P61B 3OF5A 2C04A 4PN7A 4D3ZA 5JCOA 1GJRA 5I8WA 1HYBA 2YICA 3AB3A 2EGGA 1XMJA 4UATA 4WNIA 1M73E 8AT1A 2P9GA 1EK0A 2RC6A 2ZRHA 3PC3A 2F3SA 2Z8ZA 2AOUB 3PRKE 2ID8A 4WADA 4NOKA 5EPEA 3A1VA 1DUSA 4F96A 2BV3A 5KWSA 1W73A 1PJRA 1BQEA 2WF9A 2W98A 2XUDA 3OMWA 3IAAA 3BRSA 4Y9UA 4BWFB 3THSA 3MMZA 4Y6PA 3UBMA 4N8DA 4QT4A 1UOEA 2P9HA 3DD5A 4GPD1 1SCUB 4V3BA 1P75A 4FCVA 1A9XA 1SK9A 1X39A 1RMTA 4ER6A 1UXOA 2MSDB 4UJ3A 1OASA 1JALA 2Z5VA 3NYWA 2YY6A 2RGDA 1ZINA 2SKCA 1EFDN 1LI7A 2NT4A 3LG2A 4FKMA 2ZTSA 5EPUA 1KIMA 3D4LA 4F4HA 1JI3A 4RORA 1KI6B 3TL3A 1WQ4A 2AG1A 4F06A 4NEGA 2FX3A 3DHWC 4XWKA 2EJWA 3FDFA 5CFRA 2HPVA 2ZI9A 1E77A 1N6NA 3CX7A 3LHDA 2JGDA 5EGSA 3PCXA 2GB4A 3T3EA 4HSEA 4KNWA 3DE1X 1L7MA 1ZM7A 2BFCB 2OCIA 5HIJA 5CD1A 1FW8A 4YXWA 4GOKA 4OH7A 3Q6IA 4ZALA 1U8YA 4D41A 3KR2A 2OOSA 4FYJA 3WLIA 4YFVA 5KOYA 1KS9A 1L4HA 3A0UA 4G8DA 2G88A 1QBGA 2G8LA 4GSKA 4JMPA 2Z83A 3L7OA 3OJ0A 3KVVA 4GBGA 4Q0MA 4YJ2B 3BH6A 3KZCA 4FP9A 4X3CA 1Y3AA 2GN0A 2VAXA 3CNEA 1WCIB 3MWDB 3P0EA 4V1CB 3B7PA 1KAEA 1P19A 1U3VA 3AVOA 3DW3X 3KXIA 3N0VA 3IBCA 5KU1A 1UC4B 1VRWA 2R44A 2H1RA 4QRDA 5T6MA 2O2GA 1O8CA 3WRYC 2HRRA 2Q9CA 1NATA 1Y1LA 3GVCA 3IHTA 2I76A 4H35A 3SS8A 4AQDA 3VU0A 3ICVA 5CW2A 1D6NA 3ZTWA 3V1NA 4DVGA 3WNVA 1XN4A 1LBIA 3IDOA 4R84A 5E6SB 3DVAA 4JKYA 3ZDCA 1I9CA 1C14A 2XSZD 1OAKA 3WICA 4DWVA 3GRYA 3JVEA 4EW3A 1H0KA 2E9SA 3CFYA 1QO7A 2PT6A 3T3PB 4UEKA 5EZQA 4G4GA 2CY0A 4DQXA 1XMQB 2W70A 3ZGOA 2GZ3A 3ELWA 3GEDA 1LPBB 5E9AA 1VIMA 3GQBA 1NF8A 1FP1D 1UKVY 3AIIA 3O1JC 1HYGA 4JENA 3RUFA 4MGHA 1HZZC 2GARA 4R5MA 1XZKA 2Q1XA 3AI3A 3QVMA 4U3JA 1GTMA 3WBJA 2G9ZA 3WRWA 3KTOA 1HNZB 3UGJA 5LZ8A 4NCHA 1DJOA 1XPUA 1S2IA 2GN9A 5CEJA 3W5BA 1EAMA 1CUGA 1NMEA 4U2BA 1R6AA 3ETEA 2QMYA 3A2MA 2C00A 3GD7A 3WV4A 1IQ0A 1P4AA 2C9BA 2DTDA 4BDTA 4QTZA 3CUWA 4Y6OA 5EA2A 5BSUA 4O6VA 1FP4A 2V3CC 2C2WA 2B6NA 2XYPA 4OOEA 4S04A 4KLRA 1TAHA 2WZCA 2DPMA 1CZUA 4G63A 4MYDA 4MW1A 4Z0HO 3VI3B 4DUYB 3TAXA 3DLBA 3RD5A 3U3DA 4XWYA 1L4LA 2FQ1A 2I4RA 2HY7A 3F3KA 5KNCD 4ANFA 1DRVA 1CQJA 1R1DA 2XB6A 2PS9A 3HJGA 1VJRA 3IV6A 4HBGA 3VZPA 3WL3A 5LQCA 1GRQA 1PDOA 1U2DA 3QH4A 5TRTA 1E1MA 2H52A 2IELA 2H2FA 1O5TA 5GMOA 1Z6ZA 5F1OA 1OKKD 1M34B 3JZIA 3UWSA 1JXOA 1ZH0A 3LRTA 3HA3A 4CFSA 5CA1B 3G7NA 1Q7RA 1Z39A 2N46A 3VVBA 4OOFA 4EKDA 2BELA 3KOOA 1WXGA 3F7TA 1ISHA 3RBXA 2OCGA 5CIYA 4WACA 3F5DA 4YV2A 4BFZA 1E1DA 2GD1O 4PHTA 5JNRA 4DE5A 1NJFA 3R2JA 4LFBB 4RO0A 1VPVA 5KYWB 1HNNA 1VJ0A 1WHSA 3AMVA 3F7NA 2VHEA 2VYVD 3NTRA 4JLUA 4S0XA 1XJWA 3TR5A 3ZWVA 1GU1A 3N0TA 3OUUA 1HSZA 2NUBA 2YJTD 4HBZA 5KTNA 2OCXA 2OCPA 1NAHA 2PT7A 4FTWA 1C7FA 2AF4C 2HB6A 4NZ9A 3BXHA 2FLKA 1E2NA 1RFLA 4AVYA 4FC6A 4PGFA 2AEFA 6ADHA 1J0DA 1PUJA 7ADHA 1I8TA 3K5WA 3V4FA 3SU8A 2RBKA 4MAFA 1I6MA 3KIPA 5AHRA 3LVQE 5H9VA 2WFZA 3A05A 2C61A 1AKUA 3ILVA 3JZMA 4QOGA 4WCDA 4B75A 3FUUA 3OM8A 1YASA 2FK7A 1L4MA 3MINB 1AZWA 3QFRA 3ZNPA 5L3RA 3KPWA 2QMEA 1SU8A 3IOMA 1F3LA 1YHNA 3MYYA 2H9YA 1B8OA 3HJFA 1KP2A 4JFAA 3D4PA 4JA2A 2AN5A 2PH3A 4ZQBA 8GPBA 1FRVA 5E3HA 4XUDA 1VGRA 3UWPA 2VQ6A 2I66A 1HQYE 1OYVA 1O03A 2HI0A 3FPBA 2ZAIA 4UUMA 1F2UA 1UIRA 2D00A 4GQBA 4EZBA 1ITZA 4NEHB 3GJRA 4JLSA 3KOUA 2BGWA 4FYMA 2GBLC 2UV8A 3SEAA 1SPBS 5CLFA 1CFZA 1ORVA 2A88A 2GSWA 4KB5A 1ZMOA 1HQCA 2AG6A 2DHQA 1WXHA 4GOLD 2JRCA 4HWPA 4ZVUA 5FUMA 1ZBDA 1SBZA 1Y1SA 2A0FA 2RHOA 4R8VA 4FM9A 3U4QA 3KWMA 2Q62A 3S27A 3H4TA 2IDKA 4NS1A 1U0BB 5C9ZA 4NCJA 2A1TS 3QOFA 2CL5A 3DB1A 3BK1A 2X4DA 4UUBA 1OBOA 3K72B 2VF7A 3CF0A 3NFRA 1QMGA 5JS2A 4BNXA 4WKOA 1WF6A 1OLSA 4D4GA 2VPTA 4ENVA 2VDVE 3S2FA 1G3UA 3UCXA 1VSQA 1M76A 1T3ZA 5I9TA 2IYOA 3ZHCA 3HFJA 2D1YA 1GZ3A 1XJ0A 2CJPA 4L6AA 4UE2A 3QOYA 1CY6A 2SNIE 4YAGA 1PT7A 1A3CA 4XCXA 3ZZ0A 1M8PA 1TJ5A 1NJ8A 1C0PA 4UU1A 3HA7A 1Q7TA 5JY6A 2VT7A 1KPHA 1C7EA 2RI0A 3NC0C 1BMFD 2INGX 1N2JA 1Q0HA 1WCWA 3NHLA 5FL7A 1FMLA 2C5AA 4FZ5A 3LIPA 5GY7A 3NAZA 5CDFA 1WXIA 3R9XB 2PWAA 3NDRA 4UC0A 3TIXB 3E9MA 3RSLA 4CM5A 4YT8A 5LNK1 3PD7A 4I8IA 2ZAMA 3L6UA 5DLYA 3TE7A 1V8DA 2I7DA 2FGKA 3NJ8A 2HJWA 5BSRA 3N2YA 3P9KA 4UVHA 4WZAA 2W6ZA 4E5DA 2BGGA 3ZDYB 1VYVA 1YFZA 2Q3JA 4K9SA 1SZDA 3IAEA 4ZT7A 5H0IA 2IS1A 3W90A 2R6DA 2HCTA 3LLUA 3MK31 3IBSA 2NTEA 1GSAA 2PO5A 3FWZA 2QVLA 1DBVO 3I5XA 1KBZA 3TRKA 1SOMA 1F17A 3JASB 4RABA 5CFMA 1JFRA 3SFZA 4MITA 5B1EA 4WY5A 1BU5A 3OEYA 5GONB 2Y1WA 2QJFA 3K96A 1YV9A 3H18A 3PBKA 1QSGA 4NCXA 1DEHA 3IB3A 2BSQA 4WLNA 1T8YA 1W0CA 4JXJA 1XLUA 4YJFA 4IIEA 1EHYA 3PUIA 2P2SA 4HLQB 4Q9NA 3LUCA 4IS3A 3IEUA 2EGUA 4MTLA 5LNK6 1G8HA 3OD1A 1XL1A 4PYLA 3PUXA 1IY2A 3L6OO 2HU7A 4E4YA 3Q7QA 3VA7A 3GZNA 3IP7A 2NSLA 2BZ0A 1Z6AA 4H08A 2J9XB 3T06B 3EVZA 5A7FA 1NI3A 4C78A 3A70A 2QK4A 4D6PA 3R7SA 5JSQA 1V1MB 1SUFA 3W7BA 1OB5A 1FYWA 3O9VA 4A0SA 5DOZA 2HMTA 2WIKA 1P9WA 5THXA 4KO1S 2Z6AA 3ZK7A 4DWJA 5KOHB 4X64B 1ZFNA 1JDNA 1FVXA 4KWTA 3HWRA 3D4BA 3PI6A 4NZOA 3CXUA 3OQBA 3R3YA 4FE7A 5G40A 1U2PA 4DEVA 3I61A 3A7DA 5DX0A 3O93A 2R68A 5D7BA 2NO1A 3U7EB 4DSTA 4RF3A 2HTEA 2GYVA 1E1LA 4JBYA 4WFIA 1ZSNA 3SHTA 121PA 4DPKA 5EIHA 1UXJA 3EXFA 3PD1A 4RIEA 4U7HA 1INLA 1QWOA 3D31A 1L5RA 3QVWA 1V1JA 5AI0A 3TI9A 2XGJA 3NC4A 4REQA 3LV8A 1PNOA 2YIDA 1ST3A 1W52X 2OGTA 5KNCA 4EQZA 2KHZA 1R0XA 4MKGA 4DTIA 1U1GA 2ZU6A 3A58B 3F96A 521PA 5K8UA 3IKTA 1GDTA 1YBAA 2OLKA 1H6BA 2X1LA 3EVGA 3OICA 3X2SA 1U8AA 1VDZA 2WAXA 4EO7A 4YV7A 1HE3A 4OFXA 1JE1A 1T6NA 3A3OA 3OLVA 4KYTA 2Q41A 4UDXX 1HLPA 1L5GB 2IS2A 2Y66A 1RVV1 3C3MA 3CKKA 2JLRA 5F3RA 1I01A 3QXXA 4IOJA 4UREA 4DM7A 5EJ4A 1RU3A 2E5FA 1NBWB 3EY9A 1YDEA 2C9CA 3KS9A 1FA9A 4PYOA 1PZMA 2OQRA 5E3IA 4UZEA 5C80A 3II6X 3I9LA 2EW1A 3WGZA 5ALMA 1Y1QA 3VKVA 4C0KA 1ESEA 3QELA 4RPIA 4UNSA 4WV3A 1MAHA 4RJKA 4YCCA 2DM6A 2FFQA 1TQ6A 2NUTA 4E32A 3TMAA 3ESBA 4PC6A 4E51A 2DUNA 1GHTA 5T6BA 1J0BA 4EGQA 1RC0A 1GTVA 2JGLA 1I7LA 1Z6GA 4FOOA 1KK1A 2NO5A 4N48A 4KBFA 4KAJA 3DE3X 4YB8A 4RQBA 2WB2A 2GUWA 1JR2A 4PTLA 2AR7A 2QDXA 1QDUA 1X86B 2WPNA 1JKMA 1PFQA 3QTBA 4PSAA 4TQ9A 3LFHA 2IA5A 2VA9A 4MVJF 5IVIA 4AULA 1G7SA 1O4WA 1Z4NA 3IC5A 4BMYA 2ZPUA 4D9EA 5K0FA 1NJ6A 2OGSA 2UVPA 2OCDA 1H2RS 2TMGA 1C50A 1QGZA 1F8YA 2QYOA 4TUYF 4JUCA 4PLVA 1F38A 4WOPA 2AFRA 3KOYA 1Z0JA 4US1R 3H9QA 2AOUA 2YZNA 3OETA 3D8SA 2PUTA 2HC9A 1DMRA 1Z7YA 3JSAA 3RKRA 5LL6P 5IP5A 4CI0B 5IMSA 6YASA 1QH0A 4TTIA 4UEOA 1XZJA 4MS1B 2IYVA 2QX8A 3ZZ1A 2Y1LA 1QU3A 5AVVA 3AU9A 3N05A 5BWLA 2WT8A 3HJNA 5B6JA 3GFSA 2W2NA 3MM4A 1GSIA 4YAEA 4TMXA 5DTIA 1SCUA 2W6NA 4RH1A 1GWNA 3OT1B 5T41A 4D9CA 4CV2A 4BQFA 2ZYTX 2XWBF 4JSRA 3LL7A 3FI0A 5AQ1A 1E2QA 3CG4A 3L1VA 2J4CA 2AJDA 4YCDA 5EFZA 5TEWA 1T5LA 2IVZA 3K1TA 3OHMA 4MUEA 3DR5A 4QLOA 1COWD 1KDTA 1NI4B 1UDCA 2Z1MA 3CGGA 4FFOA 2LTAA 3H2BA 1KI6A 2F4NA 1USWA 3ANMA 4QT0A 1GPBA 2VZEA 4UOQA 5IC6A 3TJRA 3N7AA 3NHJA 1NC1A 4M6WB 5FBWB 4GECA 4KTTE 1AQIA 2P3SA 4AL4A 1KJJA 1YQEA 4BFLA 4NMHA 4CN8A 4AY2A 4YAFA 1K6MA 3PPIA 4W9MC 2BFCA 1WXFA 5B1YA 3EHEA 1AZTA 1QC5B 2JZOA 3Q0TA 4LJAA 4ARUA 5JHHB 6GPBA 1N2BA 1NBIA 1SEPA 3L5OA 1II8B 4ZAYA 4GOXA 5KVSA 3WLSA 1OT3A 1BMFA 4RV5A 1DHRA 1NWCA 4YJ2A 1C8KA 1LJLA 2BI7A 2FHPA 2XUJA 3MWDA 1WCIA 4V1CA 3PKIA 4ZV7A 5ENZA 2P2LA 3HWX1 4MVJH 4P4LA 1KOLA 3TQFA 1TVKB 3PNKA 2XYQA 3UMJA 1WMDA 1QPBA 4MPJA 5THKA 1ZK4A 5K1ZA 3BDAA 4GVPA 1VE7A 1FS4A 4RF5A 2GD2A 3EGDB 5E4JA 5M29A 1UJCA 5E6SA 2H7YA 4OQQA 2ZSEA 4BX0A 1MO3A 1JECA 2GPYA 1OWNA 1CW2B 2Z43A 3UWKA 4E94A 4ZOQI 5BRJA 3OQOA 2X4GA 1VCOA 1TJPB 2V8OA 4O59O 4CLXA 1PJ8A 1VP9A 1ULSA 3HCPA 5DLEA 3CF6R 3L1JA 3AO0B 4ZTBA 2O5RA 4YRTA 1OUMA 3DG9A 2W4MA 3ROGA 3HY6A 1QQBA 3PXCX 3ZDXB 1TOAA 5AI8A 3LK7A 3ZCXA 1YRHA 221PA 3O8OB 1PS9A 4WH0A 1A9OA 2MTBA 1Q84A 2ZUTA 2OILA 3K5PA 4N0DA 2GBFA 5SV2A 1E2JA 4K1XA 4CFZA 2I5PO 3D7RA 1VPDA 3GUUA 3FBGA 4Y6SA 3K6SB 3UBTA 3S2UA 4KO2S 4JBXA 2V6BA 4YDRA 3WK4A 2NXWA 3RTEA 5JEEA 1WW8A 3FTNA 5KNBH 1LUAA 1MB9A 1KQGA 3OZUA 2BCEA 5KYNA 2EZ9A 4W5OA 3HXMA 1YT5A 2X41A 1BE1A 3ZWAA 3O74A 4NXMB 1EG7A 2RCNA 2WD9A 5M34A 1JBQA 2ZJ0A 3IVCA 1ZSVA 2QTLA 1D1PA 5JANA 3PC8C 4B4VA 1DX4A 2QPLA 2MU1A 1TTTA 3K71B 4MRMB 1D4OA 3RHTA 2ZSBA 3WMRA 3MAAC 3WNZA 3CRRA 2RK4A 2EERA 4YHHB 1W85B 2H1SA 5FWYB 3IMGA 2O0JA 2ABWA 4N8SA 2W6OA 1HDGO 3MLBA 1EUDB 1RZRD 1TT5A 3HU1A 2WNSA 4PZCA 4BO4A 4A03A 4YRLA 3SC3A 1HT2E 3VKUA 1FX0B 2CEKA 3PDJA 4KQMA 1PNRA 4J43A 5CA1A 3GG9A 5DBIA 4FYYA 2ZI7A 1BHQ1 1YIDA 2ODWA 4UFOA 2FJUA 1H6CA 1OFUX 1N0VC 3ECSA 1NW3A 2FOXA 4QDXA 3SJUA 3KK0A 1I4TD 3COPA 2GJKA 3F2IA 2QTZA 4NQZA 5F5NA 2AFHE 3IA7A 3C7AA 2GHIA 2XVMA 2C4KA 3EH1A 3I01M 1W93A 3NPAA 5DWDA 3K2QA 3ND7A 4FGLA 4B3CA 1SOAA 5CYGA 5KYWA 1N5JA 4E5VA 4RCVA 5GTDA 3PCTA 1PN3A 5K0ZA 2IBSA 1GQSA 3LKZA 3L6EA 1LDMA 1E66A 1U2GA 4IFTA 4MVJG 4Q3NA 5LQKA 5FUVA 4D9MA 4OHCA 1IHUA 3I9V1 3QNWA 5IFLA 3SSOA 2ZE5A 1Z5ZA 5GAJA 5A4AA 5FAKA 3BXGA 2O2DA 1Q11A 2XIQA 2OWEA 4U9HS 1PV1A 2HYDA 3M33A 4YUVA 1SGWA 3FCSB 4OFBA 5BUCA 2R8ZA 2FZ4A 1NJ2A 4L57A 4MGYR 3RG8A 5IKXA 2J0EA 3EVBA 1E5XA 3ZU4A 1ZITA 2GM5A 5DBHX 3KXLA 1QE3A 2WYWA 4NE9A 2JZCA 2GX6A 3BG5A 3FYSA 4L72A 5C34B 4GP9A 2ZI3A 3MINA 1T1SA 3EAGA 2YMQA 3N8GA 4EPXA 1XDGA 1MLDA 2VDOB 4EHNA 3AEZA 3HL4A 4I4LA 3L01A 4EHFA 4JEHA 2FYTA 1P81A 3ESXA 2XI4A 2IUUA 1PJLA 1EK6A 1E5VA 2FG5A 3V4SA 3IKLA 5AXBA 3NRBA 3AG5A 3CYFA 2UYYA 5EG5A 3ZV7A 5MN4A 2XEXA 3IT2A 1TAGA 2O50A 2DPGA 2ZIZA 4PGMA 4ICIA 3WNCA 5BMVF 1TCVA 4EZIA 1XNHA 2ZG6A 3QHPA 3I9V6 4HDMB 4MUHA 4C04A 4WDRA 5T3YA 3G9QA 2WJJA 4EW1A 3UG6A 3C74A 3RYFA 1WIWA 1Z2PX 2FEKA 1O0BA 1IOVA 5DM4A 2NP6A 4UQLA 1Z8NA 4BQPA 1PV4A 2CEAA 2EFEB 3VUFA 3VTZA 2TMKA 3EARA 1C7ZA 1EVJA 3DPSA 4DWOA 1YJ8A 4RKFA 3ZGXA 3QX7A 4L4YA 2B8JA 1QHFA 1Z08A 1H2EA 2JJ1A 3MJ4A 4MI3A 4RM2A 3MG9A 4WVLA 3R7WB 3OLCX 5I4IA 4HFRA 2OBXA 1JP7A 3W5UA 1S9DA 2OAQ1 5HCIA 4HXGA 3EQ6A 2VTKA 3W6UA 5CCEA 1G4UR 2V7EA 4TN5A 4ZC8A 4W7IA 3A9UA 1SK8A 4QPCA 3RUEA 4CTMA 5B7PA 2QM0A 3LQ4A 6ABPA 2QRLA 1Q77A 1D8TA 4BVJA 2NO6A 5LQUA 1RHUA 3SN6A 1DO0A 1ZMBA 2O0HA 4BP3A 3HV2A 621PA 5L4LA 1JNYA 4WKNA 4HH0A 1QG2A 2VAVA 3B8EA 4XEUA 2VSNA 3QKRB 4LHSA 1GKYA 1SIUA 3WSWA 3PC4A 1FU8A 1ONNA 4UMDA 4AN4A 3HADA 3R9XA 4GQAA 4BJ1A 1WW3A 4JZKA 1E1KA 1SB9A 2QL7A 3IXQA 4O2AF 5JZVA 1XZEA 1XQXA 1ZO8A 1BCSB 3GBVA 1X8KA 4RKWA 4H0FA 3RRMA 1FFCA 1OQAA 5IAOA 1SHLA 3L8ZA 2PKRA 4YUXA 4BNNA 2G25A 1FVFA 4S1TA 2AS0A 2LUOA 4PX5A 3V7UA 4PX3A 2HCBA 3G8CA 2ZCVA 3BPSA 4L73A 4LW8A 3GLQA 3BGDA 5WRFA 4DCPA 3F7OA 1NLZA 1JHDA 1YTLA 2BFPA 2PZ8A 3C3AA 2YWCA 3JASA 1JJIA 4PPGA 4WFKA 4ACAA 1YDMA 2X3UA 4PAWA 4F0JA 4I46A 3IUJA 5GONA 1NTOA 1HPLA 3AONB 3D8BA 3ZE2B 4EP1A 3RWMB 3ZGNA 4DXAA 3AL3A 4TV9F 2GBGA 1VB5A 3ZDEA 2W8BA 4QXRA 5CX1B 1NW8A 1TRHA 2VHWA 2YCBA 1EESA 2I6TA 5KO2A 4TXHA 3KPYA 5HM6A 3ZDBA 5E95A 1DXQA 1JKIA 1NMSA 1OHHD 3NNNA 3W6OA 3QEJA 3LJKA 3ESCA 3PUKA 4BNDB 5MDHA 1DE0A 1FMFA 4IP0A 4Q6BA 1Q3TA 1VBFA 4DRXB 5IS2A 4DAEA 3KZOA 3FLBA 4CQNA 1KOJA 3KZ1E 3R3SA 3C7CB 1F8XA 3W9YA 5IZCC 1V1MA 3E7XA 5C51B 5JTUA 1QR6A 1MORA 4PSCA 3U7FB 4XB1A 3HMQA 2GETA 5CXQA 1RWPA 3BDVA 2BGUA 5KOHA 1TA4A 1UINA 3QEOA 4I8DA 4V1CI 2OORC 5GGYA 2I99A 3U6BA 5AXCA 2H11A 3RI3A 5KC8A 4DV7B 4IDCA 5KQSA 2OAEA 4LZJA 1I7NA 4GKBA 1R0SA 3FZYA 3OF3A 3VKHA 3OHPA 1I4DD 1TYEB 2VN8A 4KVZA 4RTNA 1H2ZA 4B82A 2GZMA 2JIRA 3H99A 4PZEA 4A6DA 5K8LA 5LFAA 3G0HA 1SUEA 3LO5A 4M3NA 3ZHBA 1YUBA 4UE6A 5ENVA 5EESA 3U26A 2A78A 3ONVA 4DYHA 3M6WA 1KYYA 2D13A 4B5KA 1ABBA 2FE1A 3GARA 4LHVA 3LP6A 2HEIA 1IN7A 1W7AA 4JVNA 4KLAA 4XD7D 2AFHB 2OMKA 1VA5A 3G59A 2XUGA 3R24A 4BKPA 3TR0A 3BXFA 1PGJA 1U8XX 4QAQA 3CZQA 2Q1TA 2XODA 1IUNA 2VO1A 3SVLA 5F3DA 4YCJA 4YMLA 4ZQCB 5C53B 4ROTA 1H0RA 1KJZA 2XCQA 5FO1A 5EWLB 2GNPA 2ZYRA 1WHTB 2WHXA 4EBFA 1U7ZA 1UMDB 4L6CA 4ALLA 2DY1A 1IQPA 1YDHA 2H65A 3FCXA 3RSGA 5CDUA 1YF3A 1E58A 1N9GB 2PXXA 1Q0RA 3DL2A 1FNBA 5AJYA 3I9NA 4MDYA 2VVTA 4DCMA 3V8MA 2ZI6A 3SEFA 1E62A 1P9LA 2EJCA 1GKIA 3ISJA 3Q1LA 4NVRA 3WL7A 2Z3VA 3CNQS 1NC3A 3DS8A 2W11A 1LBHA 5IW8A 4HTAA 1GDHA 2H2HA 1QTQA 2H4XA 1MOZA 2XADA 3WRYA 2L19A 1PT8A 3BGIA 4NWIA 4IJMA 2QUBA 3QKIA 2IW3A 4XRRA 3RTDA 2IY8A 2G5TA 2R7LA 1CLUA 3DFKA 3FDZB 3H83A 3MTEA 2QDKA 4CU2A 3C0KA 1HKUA 2OOKA 5DPMA 5DBFA 4Y2RA 1N5KA 4Q39A 2PU7A 3A37A 4V0KA 5EPOA 2ATIA 5JCZA 1J2EA 3DMDA 3OOSA 3QX9A 1Q1ZA 1WUJS 1MO5A 3MUFA 3ORQA 4RIIA 2DFLA 1T25A 4YC7A 1YR6A 3UHPA 3H5RA 2FLWA 2A0WA 4KPFC 2O6HA 4B83A 1ZOSA 4LWPA 4EB3A 5L8VA 3HXOA 3T3DA 3ZIUA 4LF4B 1R50A 1G5IA 1PBNA 2QWXA 3KO8A 2UXCB 4BTVA 5AJHA 4J3JA 1G55A 2QLJA 3ENZA 4BVEA 1AQYA 4P1ZA 3MWEB 5C4GB 3WGGA 2HEGA 2R5FA 4G23A 4GDMA 4I5GA 3LVFO 2ZRJA 4MS1A 1J20A 5HJEA 5AW5A 1G63A 1RWNA 2JS7A 1Z5PA 3B1KA 3K1ZA 4WN9B 2P62A 4OP3A 2I6SA 4I5EA 1PWXA 3SHQA 5LDHA 3BKWA 1CRWG 2HHAA 1RP1A 1BQ3A 2QI9C 4EKEA 3UJDA 3OT1A 2GK3A 1VE9A 2LIPA 5CPBA 1MN6A 3KM0A 4QXOA 5D51S 3GLSA 3ZI0A 1M1NB 4DCSA 1SZCA 1C9NA 2DFDA 2REOA 3GGSA 3HYNA 3DBHB 4EGSA 4LPSA 3AQ4A 1C3VA 3C14C 3P9XA 2PSHA 2XTAA 5FFMA 2H7XA 4R40A 2EJTA 3AUKA 4IDAA 1UPAA 1NI4A 1QHGA 1ZIDA 5D5QA 3TR6A 3HB4X 3VI4B 3WYEA 3GP3A 1QIGA 2IPNA 3JD4A 1M2OB 4WIAA 1H05A 3TBFA 2MSNA 2EG9A 4M6WA 4YJGB 1RAHA 1GLVA 1NVAA 1U7UA 3G8AA 4N3NA 3UMMA 2DETA 2ZRCA 2MINB 4L15A 3RUHA 3R0IA 2ZB8A 2O19A 4EGJA 2NSJA 4JLVA 4EYSA 4D4HA 3UAOA 2XE6A 3GLTA 4KQCA 1QC5A 3GP8A 4OYYA 2QAJA 3UXYA 1SBQA 1E64A 4C01A 3O2SB 1II8A 4MVJE 4G0WA 2EW8A 4L5AA 1E2KA 5KTTA 3NM5A 1W581 4K6KA 2TRSB 3ZU5A 4K2HA 4LF8B 3TXYA 3DAPA 1GNLA 1A7UA 3KU1A 3L8CA 1NR1A 4ARCA 4EFMA 3AOEC 4K9DA 2CLSA 2XVZA 4YCBA 3WZ2A 2FN9A 5CMLA 4KNYA 1TVKA 4KPEC 4ILKA 5LZ9A 4FVTA 5EIEA 1ADFA 1JYSA 2KLHA 1JHPA 1H2BA 1H93A 4IUYA 2FPPB 4DQUA 3NR2A 4MUYA 5IH7A 1KSJA 1WOMA 2P6PA 3EGDA 3DAOA 1JGTA 3M6VA 4URFA 4ZT5A 1UP7A 2QTHA 4BBJA 1VG8A 4XWWA 2CDBA 5DNUA 3VTKA 3TYXA 1N5OX 3E5HA 3KD2A 2GZ2A 4BVGA 2VF2A 1QANA 3BXZA 2K2WA 2VPWA 2YINC 4A92A 3QPCA 1S8NA 2Z2IA 3U7GA 5A4JA 3VR6H 5IWCA 3GJZA 4MLPA 1H9BA 3O8OA 3L6DA 3QLTA 3H05A 2C0QA 4IHQA 5ALWA 4C7BA 1LDNA 4FU0A 4TL6A 3K6SA 1DWQA 1FIUA 4YROA 1KK3A 2IL1A 3VYTB 4V03A 4A0FA 4IZHA 1P5HA 2P35A 3K05A 1E6WA 1VLVA 1DKNA 2OV8A 2QROA 2RJ3A 3LUKA 3ORFA 4YVFA 3TPZA 5DGTA 1TIKA 4F2PA 2Q0SA 2WP8J 4AKIA 1E1RA 4JT9A 3U3XA 1NU8A 1QV7A 4N0EA 4DR6B 4G0MA 4C5AA 4OQFA 5C8DA 5EIXA 2ETXA 4DHEA 1G3RA 4ZA2A 4K28A 3H1PA 2KJQA 1NXOA 1NY5A 4W5NA 5HKLA 1FS6A 3ZDAA 1UK8A 1DPGA 1L4GA 2IOHA 4U2EA 1TW2A 4FHFA 3OZIA 3RIXA 3PEWA 1ZRSA 4MRMA 4NV0A 2QBYB 5L4NA 4XWTA 1N33B 4POOA 1FXUA 3E81A 1KMNA 2AEJA 3LQQA 1W85A 3PP8A 4PFKA 1SKBA 3GT7A 5ALSA 4ARAA 5FWYA 5SZKB 2C5SA 1GNPA 2R8XA 3EIQA 4RCYA 1EUDA 2G40A 1ZD8A 5ALTA 1XZQA 1JTEA 3FLMA 3HDHA 4Z8XA 5TGTA 3V32A 1JT2A 1GGKA 2YWXA 2AC2A 1VE3A 5LSAA 4ZO4A 1FX0A 4M7RA 2F3RA 2Q7XA 2O7NA 1G8GA 1N5RA 3DXFA 4LNUB 1I6LA 3BWCA 4IFBA 4UUQA 3KB8A 1K4YA 3OURA 3LXMA 2OCAA 2WFLB 1K6IA 2J87A 3BZUA 2WF8A 4PHHA 3I01A 2NUAB 1P45A 2ZYVX 5HJ7A 2Q7OE 4AMUA 3OM9A 3BWVA 4Y67A 3UJ8A 4OP2A 3I2YX 1Y81A 4XD7A 1XA4A 3L79A 1DAGA 1GUZA 3S8MA 2QM8A 3EMVA 1SJ9A 4YRDA 3SC2B 2IZ7A 4R7TA 3WK5A 3FVQA 3GMDA 3NOVA 4JT4A 2MJLA 4PSDA 5J40A 1P7VA 2N0SA 2PZFA 3VVCA 3HRIA 3WGUA 5KYGA 2OUKA 2MT9A 1KFKB 1J1IA 2DLNA 3H0CA 1T24A 2E7ZA 2IFTA 2RBEA 1R0YA 3PFFA 4ER5A 3U1BA 1HFEL 5J2TB 1YFKA 1W49A 4IKEA 3BHJA 4M60A 4U2KA 3U7QB 4ALNA 1KMMA 1DO2A 3LBAA 4Z3KA 4KR2A 1HDOA 4YQYA 3E9ZA 1POXA 3HNRA 4MP6A 2DPHA 3QX8A 3L8FA 4WNCA 3FNEA 4FS3A 4P82A 2B1IA 4MQFB 3FCEA 2BGLA 3F97A 3ASYA 4MKXA 4CEHB 3IERA 4K46A 4FR5A 4AYWA 3I4FA 1RLJA 1XRPA 5CB6A 3Q7TA 2PGJA 4EI2A 3MB5A 2DLCX 3THWB 2Q99A 2DERA 4BO3A 4CL8A 1RSZA 3WISA 2EAUA 4I8XA 1Q0ZA 5FBRB 1HOXA 2NIPA 4NG4A 3DWFA 1JKJB 5DCLA 4MQMA 2PPVA 2X0KA 1VSUA 2X0IA 5HHTA 4LWQA 3EDOA 1K6EA 2PL5A 1QIFA 3DBLB 4RZQA 4Y0AA 3SZ3A 2PMEA 1Q50A 3OTQA 2X15A 3CTMA 3V8QA 2OSVA 1DXOA 2BGKA 2WOOA 5F1KA 2J5XA 3FGOA 4JKIA 1Z0KA 2JD1A 2LIVA 4JZYA 4ZHQF 4HDMA 4UBKA 3WIUA 2K4MA 1IEXA 1HL3A 3OO0A 3TFQA 2W6MA 2EV9A 3EF0A 1TK2A 3QY0A 1SCAA 1UJ6A 2IHJA 3WL8A 1M2VB 4M83A 3G1TA 4NMXB 3STHA 3C1AA 1S4QA 1PL0A 3ZWOA 4QNRA 1ZIPA 3I92A 2GZDA 1H23A 3ZYCA 4C0BA 3BWDD 1UAYA 3T1NA 4W8GA 2QG9A 1ZJYA 3I5MA 1SUBA 2PG3A 1EHIA 3PE6A 1L4KA 2RG1A 5DE3A 4L50A 1U2QA 5EMJA 4AG5A 4B0OA 4QJIA 5MFPA 1TXGA 1KRWA 2Q6KA 3R7WA 3TPCA 3H4MA 1S3GA 5GGXA 2MR5A 1N6RA 4E5YA 1OYWA 2BRUC 2JASA 5K8TA 4KK4A 1AS0A 3OHSX 2QBYA 2RGUA 4WOKA 3UVEA 3BE8A 4G07A 2PGDA 2XUZA 3PXEA 4G3XA 4EAAA 5DRTA 1MRZA 2P75A 4LJ9A 4B73A 4JLOA 4QE3A 3DDSA 3PVCA 1D2GA 3KZKA 4MRVA 2WSSD 4QUGA 4AB1A 3QKRA 5KTMA 4DEYA 3RUAA 2AZXA 3J81A 3L7DA 1PHRA 3HU5A 1UQUA 4S1VA 4TUYB 4IVPA 1YI1A 3IHWA 3IUQA 3NGLA 4IAOA 1X2EA 3E2PA 5I01A 1OA1A 4MVJM 4M53A 5C5CA 2VNSA 1DI0A 5KJEA 1TJ4A 4AG6A 1ZDMA 1BCSA 4ZYVA 1PYDA 3NKFA 5G0UA 4AZ0B 3TQIA 3EISA 4EPTA 2XQKA 5HNKA 1UPXA 3C70A 1XLWA 4TXNA 3SHOA 4O1HA 1IVSA 1CUEA 1L4UA 3QXHA 4L7VA 1DPFA 2LBPA 3CRMA 3F4LA 1YUMA 2XGSA 1A82A 2AXQA 4X1IB 4QBKA 1P0QA 1VBNA 3Q2IA 4B6RA 5ICSA 3BE5A 2BMEA 4BNMA 4KOEC 3CVJA 1GG5A 3NP9A 2W6JD 5AQEA 4LE2A 3F9CA 4GXRA 1XU4A 3ZC3A 1XZIA 2EKDA 1K3UB 2L2QA 2WTEA 4KC0A 2ZBFA 3RPEA 4NBKA 4REOA 4B8ZA 4ZAGA 3UAXA 5AKEA 1ORDA 1V4BA 3HGMA 5CX1A 1TFRA 1I32A 2LGJA 1ZXBA 3G2KA 3I2FA 3REGA 3O2QB 5DMHA 3H9BA 1AK9A 1F0KA 1R0KA 3A6ZA 4M0KA 5AKJA 3VNSA 3BIXA 3UAZA 4ALIA 2WRZA 1JQBA 5BYAA 5SICE 4IIYA 4KV9A 1TADA 1O94C 3HJHA 3IMKA 4JMLA 5DGIA 4BNDA 3PGA1 2XUIA 2FPSA 4MGZR 4CDNA 4RSRA 4DRXA 3BWXA 4EG7A 5ALVA 3PXAA 1XTBA 4N7BA 1NPYA 1B14A 1WS6A 3T4PA 4ZYXA 1I6KA 2RHCA 3KTAB 3WADA 2B82A 4M9CA 4QTXA 4DRYA 2P90A 4AUNA 4NFHA 4LSGA 5FWAA 1GTZA 5G0SA 1IZ7A 2HXSA 3DVQX 1BYIA 1SURA 2YZKA 3QXJA 1DOHA 1Z74A 3QJGA 4YIKA 2BMFA 1QIJA 4RW0A 4QM7A 2PX4A 4YAIA 3L46A 4DPLA 2I03A 2BKXA 3V42A 1YQTA 5A4KA 3TW6A 1E4EB 3L5KA 4L4RA 5C1OA 2W8ZA 1N34B 5F5XA 2XTZA 3MQ2A 3SXPA 3GJ3A 5COBA 4DBLC 2IXGA 2ZRFA 4P3OA 1IUPA 4JI2B 2B2NA 2WIFA 2N9UA 3AVPA 2J5KA 5BUZA 5B4TA 1KR2A 1RW4A 2GDJA 3V7WA 2C5GA 5C8ZA 2I9PA 4D9NA 3O94A 1XU7A 2BBTA 2P11A 3DLHA 2H59A 3A11A 5IBCA 3F7MA 1DEKA 4KOAA 5AKXA 3ZEAA 4GL4A 1F3OA 2AFHA 3UOWA 2CNNA 1AC5A 4QRHA 6PFKA 3IDAA 3MJHA 1Q0PA 4WTOA 4MJXA 5K4HA 3EFOB 1KTVA 4TRNA 4E1VA 1J56A 1RYNA 3HWWA 3SKVA 4B7ZA 1AHPA 4N9WA 1U1IA 1YCHA 1U8UA 3DMPA 2YUTA 4ZAVA 2XMBA 3MWYW 5EWLA 1Q95A 4W6QA 1WHTA 2XRZA 1IY8A 1KQ3A 1UMDA 1NFQA 4WBXC 3RLIA 4B4OA 5H9WA 3AYZB 4IX1A 5CTAA 1N9GA 3WLJA 4F5YA 2HXGA 2D3TA 4U1RA 1KI3A 3PQFA 1U02A 2XXJA 5CXXA 5IMBA 3S1LA 3WKCA 4AIRA 4QLAA 1AHNA 3EFEA 5C3UA 4TMKA 1QH8B 2M1XA 1ADJA 3DMGA 5GJCA 1PEKE 5D6NA 4JP8A 1OBFO 3WTCA 2ZROA 1EQAA 3PNSA 4PANA 5BSVA 1PG0A 4Z99A 4YGXB 3SYRA 3GEIA 3TKAA 4IZ6A 3K5HA 1XZBA 2TS1A 2QXYA 4KMRA 3FSRA 4WCVA 3I0MA 4X6UA 1AURA 5CLQA 2QN1A 2XW6A 1Q1NA 4D2IA 4EYEA 3FDZA 3O26A 4EY6A 1C29B 4RDHA 1L7RA 4M1MA 3RS4A 4D02A 4EH1A 4BBZA 1SCJA 4BO1A 2P9QA 1EU1A 1IG3A 2EZUA 4DJJA 2FZEA 2Y05A 1ACJA 1U4NA 3CRQA 2RHBA 3U49A 1GL9B 1A77A 4BO5A 1UMCB 1QTRA 1XMIA 4L8GA 1DCMA 3WRXC 2YKGA 2YFKA 4F3KA 1PJTA 1KKUA 1IXSB 4FNMA 5KTYA 3ML1A 2IUTA 5AK5A 3JRXA 5JRJA 1T9GR 2F8MA 2IYQA 4YJKA 4MWCA 2F1KA 3L02A 1GRVA 3QMWA 3SYMA 3EGEA 3JQAD 3ZQKA 2UUPA 1F1JA 2EJBA 3R3HA 4Q1AA 2JLQA 3VBEA 2CXOA 2R87A 5IUJC 2D4AA 3N2KB 3JAWB 3TEJA 3SQXA 3MWEA 3OM0A 1B16A 5L6MB 2UAGA 2ZYWX 1F12A 1A5AB 2OHGA 1EFUA 2QB5A 5T8KC 1NM5A 2QRJA 3FVRA 5BV1A 4WN9A 3E3NA 1J33A 5HKKA 3AUJB 1LI5A 3DL0A 4NNJA 3A4IA 3I8XA 4FBGA 2P3LA 3LF2A 1CT9A 1Z6PA 2I1VB 3O84A 1H1LB 1S3IA 2CMHA 5EKDA 2JPDA 3PHJA 1M1NA 3RO7A 3TTVA 2FEPA 3DBHA 3GFBA 3ZY2A 1OWOA 2MOKA 2WICA 4Q3OA 2ZGVA 3CE6A 2EX0A 1ONSA 4BO7A 1TEVA 4MAMA 4MVJD 1W2GA 3EG5A 3Q10A 1GKUB 2C84A 1M2OA 2DQYA 3OQVA 4GRDA 1WA5A 4C7OB 2P1DA 3KKKA 4MS3B 3U4GA 1HX7A 4P80A 1G3QA 4YJGA 3IMCA 4XGKA 3HE3A 2MINA 4M0CA 3QYPA 4U8HA 5ALHA 2F64A