4UUQA

Crystal structure of human mono-glyceride lipase in complex with sar127303
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
b'SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOGLYCERIDE LIPASE
molecule tags Hydrolase
source organism Homo sapiens
publication title Selective Blockade of the Hydrolysis of the Endocannabinoid 2-Arachidonoylglycerol Impairs Learning and Memory Performance While Producing Antinociceptive Activity in Rodents.
pubmed doi rcsb
total genus 107
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uuqA00
3ESAA 4B0PA 5CT8A 4CCWA 4UHCA 2XMRA 1CUUA 2CEKA 3R0VA 4X94A 5JAHA 3OG9A 3ZWQA 1J2EA 4X7BA 2QRUA 5AKEA 3KOOA 5HCUA 1W75A 1XKLA 4A5SA 3VKFA 1GZ7A 4AO6A 3O4JA 3KDAA 3PFCA 1XZJA 4BE9A 5AKZA 1CQWA 1ZOIA 3A70A 5IH7A 2H7CA 1W6RA 2QXUA 1HL7A 2OXEA 4LXIA 5BOVA 2ZVDA 4G8DA 4U2FA 4B84A 2XUFA 5BWBA 4MXDA 3FLAA 4UBMA 4TGLA 1P0PA 1EVEA 1E5TA 1F0PA 3AJAA 1CUIA 3MGAA 1VA5A 5AK4A 5CT5A 2LIPA 1XRLA 5AOCA 2HFKA 2VJCA 3IB3A 3Q0TA 4PSUA 4Y2TA 4HVTA 4DGQA 1QIHA 5YASA 1LPMA 1FFDA 2WQZA 3WI7A 1I6WA 2WHPB 4UUQA 3GBSA 3WA6A 3A2MA 3F97A 4GDMA 1Q83A 4QEKA 4G8BA 4LXGA 4E14A 1JKMA 3A2NA 3QMWA 4A16A 4FNMA 4HRYA 2XQGA 1AQLA 5IVDA 4B82A 1QOZA 5ALNA 5I9IA 4GBGA 1L7QA 4DMCA 2BUCA 3A6ZA 3DS8A 3WK8A 2X5XA 3AFIA 3K9BA 4MYDA 5D3ZA 3HACA 4MEBA 3ZV7A 3B3QA 4EY7A 2Y6VA 5ALMA 5C8VA 3ESBA 2RIPA 4OD0A 4B7ZA 1JU3A 3WK7A 3GA7A 3R40A 4FLFA 4Y2QA 1P0MA 3F67A 1J06A 4AMZA 5LLSA 3OURA 1QLWA 1Z68A 5ALLA 2XT0A 2UZ0A 1X2BA 3WMRA 5D7BA 3O9VA 1FFBA 3IUNA 3C8HA 5HF9A 3FVTA 3R3ZA 1ZI8A 2O7VA 1CUJA 1OILA 4K6GA 3HXKA 1UKAA 2V96A 1XQXA 2JIDA 5JD4A 3ZLTA 3E3AA 2ES4A 5C8XA 4WY5A 5K3AA 1Q0RA 5ALJA 4FOLA 3GUUA 4UHBA 1HKHA 4ZWNA 1BU8A 5I8PA 4FKBA 2WKWA 4FHZA 2XUAA 3PICA 1XZIA 1C7JA 4MQMA 2JBWA 2XUJA 4IH4A 2QTBA 4MWSA 5DTIA 2XMQA 4BTVA 2XLCA 5A2GA 2B4KA 1K5PA 2XMGA 5ALOA 3S2ZA 4KAFA 3KD2A 3CN9A 4QLOA 1SCKA 2HA3A 3HZOA 2ZSHA 5ALFA 2WG1A 4KE7A 1WPRA 5JARA 2OQVA 2QMQA 1XZLA 1EK1A 1L7RA 1TAHA 3G9TA 1ACLA 2YH2A 2I3DA 3H2JA 3IIIA 3BWXA 1MTZA 2PKYX 5K3FB 4WJLA 1QE3A 1YS1X 3C6BA 5JAUA 1X70A 2HM7A 5KBYA 1MU0A 4W9RA 3FYUC 3BDVA 1H23A 3P2MA 4Q3LA 4IH9A 4Q34A 1JMYA 1WCYA 3H1BA 5AICA 2OAGA 1E3QA 1CUZA 5LP1A 3DKKA 1VOTA 3H2GA 5D6OA 5SYMA 4H7KA 1XZAA 2VSQA 4G1FA 4PSCA 1DWQA 5AIBA 2I3ZA 1FJ2A 4UBNA 2EEPA 3WJ1A 1GQSA 5ALWA 2GZRA 4FFWA 2WLSA 4ZRDA 4IH1A 4D9JA 3X3HA 4QDTA 3R3WA 2WG0A 4GHWA 1DINA 4HRXA 2RAUA 4X71A 3DQZA 3LLCA 4W1QA 4FDMA 4OU4A 2HIHA 3PDCA 2PSFA 1YB6A 4N8DA 5LZ9A 2DHDA 4B83A 4IO0A 3WWOA 2ECFA 2PL5A 4H7IA 1XFDA 2GBFA 4DSAA 5ALIA 4A23A 3FYUB 4BCBA 5FOQA 3F9CA 4M0EA 4RNCA 5HQ3A 5E4YA 1BN7A 5DWDA 5JZBA 4UHEA 1N5RA 4M0FA 2J3DA 2PBLA 4H7DA 3FVRA 1VE7A 1R4ZA 3HC7A 3H18A 3G9ZA 1UOQA 1HDEA 3EBLA 2I78A 4L72A 3V1MA 4L9AA 2V97A 1QGED 1GT6A 4BP9A 4EBBA 1J07A 1YB7A 4EY5A 2HADA 3STWA 1QTIA 4B9EA 3JWEA 3KSRA 3DKRA 4HTAA 3QPCA 4J0GA 2W6CX 2VAXA 3H2KA 4BAUA 4AX4A 1GXSA 1Y7HA 4C6HA 5K3DA 1CUBA 2RI6A 2WG2A 5IVKA 1MN6A 2JGIA 1CPYA 3M3DA 4EY6A 4JNCA 3QMMA 5ALKA 3H19A 5AM1A 3IULA 1UOOA 2JEYA 2ORYA 3G9UA 1YS2X 4GLBA 2ONCA 4PW0A 4U2CA 1CUAA 1XZKA 1CR6A 5EIEA 1FSSA 2VATA 1ZGCA 1ODTC 3WKBA 4UHHA 1VXOA 5EHNA 2QZPA 5K3CA 4KE6A 2XB6A 4WFJA 1GKKA 2VT6A 4UBJA 5A7GA 1QZ3A 3G0CA 4J0DA 3ANSA 3N0TA 4H7JA 4C88A 5EI5A 1WOMA 1E66A 4QZVA 1XRMA 1LZLA 1DQZA 2PU5A 2PUJA 3PF9A 5CW2A 3S8YA 2C4HA 5E4TA 3WZMA 1R3DA 4OYLA 1R88A 3PF8A 3T52A 3WK9A 3FOBA 3H2HA 1UKBA 5LZ2A 3D5EA 3ZI7A 5AKYA 1G4HA 1CVLA 2WFMA 1CIJA 1DX4A 2YYSA 4FLEA 4JUIA 4C87A 1XZFA 1WM1A 3WA7A 5EFZA 3JYHA 4DMFA 4HS9A 4Q82A 1WB4A 5EHZA 2B20A 3GROA 3G0BA 1YA8A 1K4YA 2DQZA 4NS4A 4BATA 1BRTA 1GPKA 3HJUA 1QIFA 4CFSA 5ESRA 4DNQA 1XZEA 4KACA 3LIIA 1XZDA 1QFSA 1ORVA 2BFNA 1ZJ5A 3STVA 1JJFA 1EDDA 1QTRA 1A8QA 5LZ7A 4BCDA 2IITA 4MJ3A 4RE5A 5DNWA 1ZJ4A 2XQFA 4B80A 1XZCA 3HSSA 2WHPA 4ZGBA 1G66A 5DYWA 4DMKA 2DHCA 2NW6A 5CXXA 2Z3ZA 1ZD2P 2C0PA 4LIPD 3WK6A 3V9AA 5ALHA 4CCYB 2HA4A 4X3CA 4E15A 5AIAA 3WL5A 1JI3A 4XX1A 3CCBA 1CUHA 1CUYA 3ZLVA 2XMBA 2PM8A 5AP9A 5AI6A 2V9ZA 5AKGA 4BDTA 2WIKA 2XDWA 5ALQA 1XKTA 3O9MA 2XUDA 3UUFA 1WB5A 1W4LA 1E89A 1H2YA 4QDXA 5ALRA 5CRIA 1A8SA 1XRRA 2DCMA 4GECA 3OPMA 4OB8A 5J3JA 1XZHA 5KWIA 3QVMA 3VVMA 1T2NA 2GBGA 2PSHA 3STUA 1C7IA 1EK2A 3QITA 1XQVA 5ALYA 4DLNA 4UHFA 1BCSA 3D2AA 4ARAA 2BGNA 2ZYRA 5AKKA 2XQKA 1JJIA 3VJLA 1IUNA 1GGVA 3QPAA 5A6VA 1W76A 1MX1A 1ZIYA 1DT3A 3M82A 4I3FA 4H77A 1XZBA 2J4FA 2WTMA 5H3HA 1THGA 2OCIA 1M33A 5T4EA 3W2TA 2Z8XA 3BE8A 1TK3A 1VLQA 1HBJA 5JANA 2XUOA 2WHRA 3D3NA 4K6KA 2HDWA 3CXUA 4Y2YA 1QIDA 4MYSA 2B9VA 1WPXA 2OGZA 2OCLA 2P8SA 2FJ0A 4UPDA 5DYYA 5LZ8A 4BTLA 3WWEA 1QIKA 1UK7A 2QUAA 1GKLA 4AN1A 3AZPA 2CB9A 2R11A 3K2IA 3L1JA 3WQHA 4KAAA 2DR0A 3L1IA 4EY8A 3AILA 5CH5A 4P93A 2PVSA 5AI4A 2D5LA 3WYDA 4J03A 3I1IA 4N8SA 2QOEA 2J4CA 5JIBA 3WKAA 1UXOA 4DNFA 5K3FA 3LS2A 1UWCA 1H22A 3R41A 5EIAA 2Y2VA 1P0QA 4KRXA 4F5ZA 4CG1A 2PSDA 1FFAA 3KWJA 3KWFA 2VJAA 1PJAA 4X97A 1CRLA 4K6HA 3O95A 1QONA 3D2BA 4OPMA 3ESDA 1RWQA 2WJ4A 4X90A 3VXKA 1SCIA 1CV2A 4LXHA 3E0XA 3W06A 2WFLB 3OM8A 5A71A 1EI9A 1G5FA 2XUIA 1CUGA 3WIBA 4PQEA 1VZ2A 1T4MA 2OGTA 4YX9A 4AZ0A 4M0MA 3AINA 1CLEA 3IA2A 1RP1A 5CXUA 3MUOA 5EHXA 4MQLA 1EDBA 1H2WA 1QIIA 1ZD4A 3IUJA 4WDRA 2Y6UA 2VEOA 4CG3A 3DEAA 2HA7A 4GXNA 2RHWA 3I1YA 3K6KA 1EB9A 1YCDA 7YASA 2RGUA 3T4UA 5A7HA 2XE4A 5FP0A 2HRQA 3FYUA 3QPDA 4V2IA 2WIDA 3C6XA 1PFQA 4QNNA 3C6YA 2OPHA 1OXMA 5AO9A 2AJCA 3V1KA 1CEXA 1CUFA 6YASA 4J0HA 3C5WP 4QLAA 5A7FA 3BJRA 1K63A 1LPOA 1MNAA 1KU6A 5ALPA 3UMJA 4EZIA 4ARBA 1MAAA 4C4XA 5CH8A 1AX9A 1GPLA 5FXMA 2XMSA 5ISMA 3QM1A 3FNBA 3B12A 4DNPA 3ZLUA 1JT2A 5DNUA 3F96A 2O2HA 4UFOA 2WSLA 5LZ4A 2OQIA 5C81A 3ESCA 3DYIA 2HFJA 1GPNA 5SYNA 4CI9A 3H17A 4DM7A 1BS9A 1W52X 1UZAA 4I4CA 2PU7A 5FKJA 3B5EA 3GFFA 2XMDA 1CUDA 4W63A 5AKHA 3W05A 1WB6A 4KRYA 3FBWA 4N5IX 4BAGA 5AK5A 4AXBA 3MVEA 2VJBA 3SWWA 2JF0A 2QVBA 4UBKA 1CUXA 1FFEA 3R3XA 2PSJA 1O6GA 5ALDA 1H2XA 2QR5A 2G5TA 3STTA 4EB0A 1LPNA 2CZQA 1DX6A 3D59A 2H9YA 3C6ZA 1XLWA 2WIFA 1MX5A 1YASA 2JGFA 3E1GA 3VVLA 3QMVA 1UKCA 4Y2RA 1TIBA 1UK6A 1N5MA 2VF2A 4B0OA 2JGKA 4Y2UA 3CN7A 2EDAA 3DLTA 1YAJA 3R3UA 4HXEB 4OCZA 3IUQA 2H7YA 4BC0A 3FSGD 1F0NA 3OTQA 4PO3X 1HPLA 4QDOA 5HKAA 1Y7IA 2WTNA 5I7UA 5FRDA 5ALXA 2WILA 4DIUA 3ZPXA 3BF7A 4BRSA 3ICWA 1CUSA 5AM2A 3LP5A 1VZ3A 4FNGA 3AIKA 1K8QA 2XUGA 4B81A 2H7XA 5AM5A 4Q3KA 4LHEA 4O08A 2E3JA 3W9UA 1AMNA 5K3BA 2ZJFA 4KE9A 4H7FA 1WHTA 2Z8ZA 5HK8A 4PV7A 2JEZA 1NU6A 4OYYA 5FLKA 3H1AA 1N8SA 3FYTA 3E4DA 4FLMA 1LBSA 1QIJA 4P92A 2OG1A 4F0JA 4P9NA 2WU3A 1ZICA 2HA5A 2G63A 2IIVA 1MX9A 4X95A 4EHBA 1ZI9A 5CMLA 4OUKX 2C0QA 3RK4A 5BWCA 5AJHA 1EINA 2C58A 1QFMA 1EXWA 1LPSA 5CTAA 3I28A 4J0KA 5AKXA 3WLAA 1DTEA 2XI4A 3A2LA 3I6ZA 2GZSA 4FFVA 1LZKA 5JASA 2VAVA 3LCRA 4F60A 3EQ9A 5CT9A 4QWWA 1IMJA 1XLVA 3V1NA 5LIPA 4BCCA 2OCKA 2HA6A 2ZSIA 1XROA 3FCXA 3BIWA 5JAOA 4EUSA 2AJBA 3OOSA 3RM3A 3WL6A 1VJ5A 1TKRA 1R1DA 4L0CA 2VTVA 2R8BA 2XQJA 3C70A 1DT5A 5BV7A 3HRHA 3DL7A 5CT6A 3UUEA 4OU5A 3FLEA 5T4HA 1NX9A 2HU8A 3G8YA 4BB0A 3O4IA 2G5PA 1MNQA 1YR2A 4FBLA 2Y2UA 2QKYA 1AURA 1QIGA 2ZJ7A 5JALA 1LBTA 1L7AA 1YA4A 2GBIA 2OLEA 5AHXA 4FWBA 3NUZA 3MUNA 3RKSA 5K5EA 1DU4A 5JYCA 1UK9A 3O4HA 2QS9A 4MEAA 2WJ6A 4U2BA 5AM4A 4KR0A 4ETWA 1TRHA 3BJMA 4C89A 1E8DA 2VQ6A 5DLPA 3I2HA 2WUEA 3DJYA 1ZD5A 4XIIA 1XZMA 2AXEA 3BXPA 3FWHA 5AM0A 4MWTA 4INZA 3VJKA 3GZJA 5AI9A 3QBJA 4WFKA 1K6EA 4KAJA 3BIXA 1IZ7A 5AM3A 5EHQA 5FUMA 3FCYA 4X92A 1O6FA 4BP8A 4Q05A 4HXGA 3WK4A 3STXA 1B6GA 3Q8WA 2BCEA 2CJPA 1SFRA 5LKRA 5ALGA 1SOMA 1TCBA 1WHSA 2GYVA 2GYWA 3R3YA 4K2AA 4H7HA 2BAGA 4IQ4A 5DJ5A 4HAIA 4TPKA 3F8SA 4LKOA 3C8DA 1XZGA 3R3VA 5LKAA 2ACEA 3ILSA 4QDUA 4Y9SA 1CQZA 1EB8A 4U2GA 3D2CA 1PV1A 2XLBA 4EY4A 5KREA 5IKXA 1X2EA 4W1RA 5FDFA 3U1TA 3EF3A 1XRPA 3KXPA 3QH4A 4J3JA 3SC2A 5JD5A 1KU0A 3QZUA 4QWMA 1ACJA 3JW8A 2WFLA 5HK9A 2VT7A 2PX6A 3TRDA 4PSDA 4GI1A 2V98A 1LNSA 3TJMA 4Y2VA 4AMYA 1LPAB 1CUEA 3RLIA 3NOXA 3NWOA 1VXRA 2ZYSA 1AGYA 4H0CA 3IBTA 1MAHA 1BE0A 5ALUA 3I2KA 4IHAA 4FBMA 4AQDA 1FFCA 2ZYIA 4S0XA 4W1SA 5AKJA 4EA6A 1ISPA 1S8OA 1EA5A 4YASA 3HEAA 4UBOA 5HZGA 4HXFB 1YSCA 1LPBB 5FPQA 3GELA 2I03A 2PSEA 3WK5A 1UFOA 3ANTA 3G0GA 3TEJA 2PUHA 1BROA 5D3KA 4KJXA 5C8ZA 3O4GA 2XUPA 4GEGA 5C7YA 4X6XA 5EGNA 5E4JA 2Z3WA 4BAZA 4Y7DA 1SCQA 2DHEA 1JJBA 1G42A 1F6WA 3YASA 2WHQA 3DD5A 2RONA 3CCCA 4DMHA 4PNZA 4TVKA 2WFZA 4X85A 5AI5A 5CH3A 3AUKA 5HFAA 4QDZA 3SX4A 1THTA 1D07A 4G4JA 1QIMA 5AI0A 4PF1A 4J0IA 3IVMA 4C01A 5ALZA 3H04A 3I2GA 1USWA 1TCAA 4CIBA 3DL4A 1U4NA 2YXPX 2JGLA 1H2ZA 3WZLA 4UHDA 2OCGA 1CUVA 3I6YA 2XUKA 1ZI6A 3DNMA 5KWJA 4OSEA 1HQDA 4KYVA 4YK7A 2H1IA 2VJDA 2XMZA 4BZWA 4C4YA 5K3EA 5HF6A 5HFNA 5T4BA 2XMCA 3FSGA 2DFPA 2QJWA 5AK3A 2GBCA 5ALTA 1TQHA 3FLBA 2ZYHA 4BVJA 4Y2PA 4H7EA 1XRNA 2Q0XA 4G8CA 5AI8A 1JMKC 3PE6A 3AZQA 5AKLA 2VA9A 3IUMA 2ACKA 4C4ZA 1VE6A 2BKLA 1VKHA 1ETHA 4K5QA 2PPLA 5DNVA 4XWGA 2J3QA 4CIAA 3EIOA 2JGEA 1BEEA 2WIJA 1TCCA 1SC9A 5JAPA 2Y1KA 1QO9A 3SK0A 3ED1A 3DYVA 4H18A 2HA0A 4UBIA 2FJPA 2D0DA 4OB6A 4Q1VA 4ZV9A 1AKNA 3WKEA 4WDQA 2CMFA 5HF8A 2AJDA 5CBKA 4NMWA 4QA9A 4KE8A 2X76A 3DOHA 3ICVA 4X93A 4CCYA 2WUGA 1XQYA 4G5XA 4BRZA 5LYYA 1MT3A 2GYUA 2QXTA 1EH5A 4AZ3A 4E46A 2WM2A 2WIGA 2YASA 4BYMA 1Q84A 5AOBA 4Z49A 1A7UA 1A8UA 4FTWA 4OB7A 3IURA 1AUOA 4AN0A 4GW3A 3U0VA 1BN6A 1IUPA 2QJRA 1QO7A 2WJ3A 4X6UA 4BVKA 5JATA 4JEIA 4CG2A 3C5VA 4QE3A 1E8NA 4HZGA 1XRQA 3PI6A 1CUCA 4L3WA 4LYDA 4N8EA 2WU4A 2JGMA 3PFBA 2XUQA 2HRRA 2RHTA 4XVCA 3G02A 1ZIXA 2HU7A 1EDEA 1U8EA 2CUTA 1QIEA 1UOPA 4B9AA 2QT9A 2C5GA 3EQ8A 2BUAA 1ZGBA 3C45A 1E8MA 1R9NA 2HU5A 4B6GA 5FPPA 3W9BA 4X91A 3WKCA 3N2ZB 4X00A 3V48A 2C5FA 4Y2SA 5ALVA 5LZ5A 4P08A 1C4XA 2X8BA 1ODCA 3D7RA 1BEZA 1Y37A 3H2IA 4F21A 4J0CA 5IVIA 2BJHA 1NU8A 2BUBA 3QYJA 1IVYA 1EX9A 1DWPA 1N1MA 3G0IA 5JZ9A 4UBLA 2DSNA 4W1PA 2CKMA 1UT6A 5CURA 4BVLA 5T4FA 1DQYA 4AO7A 3TGLA 1MPXA 3DOIA 3WWDA 2HL6A 3EQ7A 4UFNA 2Z5GA 3L1HA 2WUDA 2B61A 2EDCA 4B85A 4J0JA 3V1LA 3WJ2A 1DWOA 4G9GA 4ZXFA 3WKDA 5JD6A 1LGYA 2WUFA 2ROQA 4U2EA 4BBZA 5JZSA 5EIHA 3BF8A 3I6MA 3BL8A 4J7AA 5AOAA 3D4LA 1VA4A 4NZZA 1MO2A 2O2GA 4JYPA 2XQIA 5IVHA 1UK8A 1AZWA 5E2IA 4X6YA 1A88A 3WWPA 5AKIA 4YPVA 2O2IA 3WL7A 4ZREA 5HF5A 4AB1A 3FAKA 4ROTA 4N5HX 1CUWA 4RGYA 3D0KA 1EVQA 4DNOA 4KEAA 4UFPA 3DCNA 2OAEA 1R50A 3AIOA 4RE6A 3I2JA 5A62A 2OGSA 5F4ZA 3PUIA 4AO8A 2AJ8A 3NGMA 5DTJA 3PUHA 3HLKA 4JYMA 3DDUA 2HHAA 3IDAA 4ZI5A 2BGRA 4LYEA 3AZOA 1EHYA 1XQWA 2ZJ6A 1U2EA 4BDSA 3BDIA 4DTCA 1LLFA 4NVRA 4WCVA 2IX9A 3M81A 3HYSA 3OC0A 4Q3OA 4DSZA 1ORWA 5HQ3B 4WFIA 2DQYA 4GWLA 1QJ4A 5ALEA 5ALSA 1Q0ZA 2HA2A 3WWCA 2K2QB 4Y2XA 3AIMA 3VISA 3W04A 2QUBA 4BE4A 2C7BA 1KEZA 1HLGA 1XLUA 3LIPA 3M83A 4H35A 2G4LA 1ZD3A 3C43A 3HABA 3G9XA 1JFRA 4XJVA 4BC1A 2O7RA 4E11A 2FX5A 4Y2JA 3WIOA 3I2IA 1J1IA 2JGJA 1JU4A 4FMPA 5AH0A 4JH0A 5FV4A 4RPCA 1W1IA 1R9MA 1IUOA 3VDXA 3C87A 5JADA 1AC5A 1BCRA 3HI4A 4ITVA 4G4IA 4G4GA 3H0CA 3VJMA 1IZ8A 4WY8A 1OCEA 2W22A 3O0DA 2AJLI 3RARA 2CBGA 4DYHA 1U65A 5CT4A 1MJ5A 1P0IA 3F98A 3WYNA 1ODSA 4U2DA 5HKBA 1RYYA 3G7NA 1LPPA 2QM0A 1CFJA 1F8UA 1YAHA 5AK6A 4I19A 2FUKA 3G0DA 4G9EA 5DYTA 1GQRA 4BZZA 4ZV7A 3STYA 1B41A 3WL8A 2XUHA 3I2FA
chains in the Genus database with same CATH superfamily
1JFSA 4S35A 4JWTA 2EV9A 3WDSA 4R01A 4OQ4A 4B0PA 3AP2A 3GO4A 1R12A 1FU8A 4UM5A 421PA 3WP0A 1JTEA 1Z5NA 4CCWA 5BWMA 3VC1A 3UGJA 2FQXA 3OESA 3GA5A 4PZLA 2VHTA 2GARA 4MCHA 2DBQA 3RVRA 1ZITA 5FL7D 3ODPA 5B57C 2G70A 2VYFA 2VCYA 3OG9A 1L6IA 4MPJA 4OUDA 3KQKA 2FZEA 1J2EA 5CEJA 4C6TA 1EFTA 3E15A 3G5LA 4GPZA 4IUYA 2UYGA 3GRPA 2WIAA 1J8FA 1CG6A 4X7BA 4QBHA 1D2HA 3IUBA 5AKEA 3ZIAA 4RIIA 2F8MA 5SYAA 3UNXA 1EG2A 3AV0B 3AW8A 1GRVA 4WA8A 1F2TA 1W75A 2OV1A 2J3HA 4BO6A 5A3QA 2CUNA 5C8YB 5FAKA 1N4DA 4QSMA 1SKAA 1I3NA 3P0HA 3SBDA 4NR0A 4AY4A 2ODEA 4AO6A 3RLFA 3TOXA 1KI2A 3K0EA 3ZCVA 1E9EA 4HL6A 3GNLA 2R6R1 3CR8A 1XAIA 1NBOA 4F93B 5CLIA 2NXCA 3PWKA 4YPFA 4NCXA 2IHZA 4O2BB 1E79D 3HPQA 2EF1A 4I2NA 2FEMA 2JHAA 5FAXA 3KYDA 4H0NA 4OP2A 3TB4A 2Z8YA 1N2IA 3V4SA 4ZCTA 1JBQA 1X6VA 1T3ZA 1W0JD 1M1YB 1X14A 4GUAA 5E8JA 1HL7A 3AMVA 4DCPA 1U5BB 1R4NB 1UT8A 2OXEA 2WE7A 2JFGA 4G8DA 1H66A 2R86A 2C20A 1RS0A 2B35A 4U2FA 3S2EA 4BKMA 5IPFA 5AOVA 1QKKA 2ZRIA 2V7PA 2XUFA 4I6JA 1J09A 4LDZA 5HX7A 5J2TA 2F90A 3F7MA 5CVEA 2L69A 4W4TA 1Z12A 1A96A 4MXDA 1GUBA 3FHCB 2YIVX 4UBMA 3E48A 1H9BA 1N5IA 4I1SA 1Q74A 1KSFX 1OZHA 4LJLA 4TGLA 4BQFA 1I36A 4JU8A 1U31A 1VKNA 1KFEB 3F6EX 2H16A 2FFAA 4GX5A 1E5TA 1YQXA 1YRQA 3GGSA 1UBSB 4ABTA 3DEJA 5TR9A 3N2GA 1G3RA 3QXHA 3EXG1 4EPVA 1SHJA 4IO1A 4KN8A 2ZE8A 3TQFA 2VF5X 1UXJA 3DVAA 5DBOA 2H63A 5BR8B 3PJRA 4ZT3A 1XEWX 2NT3A 3RT7A 3KETA 3EGEA 1AE1A 1XD2B 3PSAA 3ZHOA 3A6PC 2IU0A 1T2VA 4HT3B 1ZHFA 4FGZA 2IIQA 4DCVA 3VSAA 5HOEA 1M34B 4GUDA 3ZCQA 4EL0A 2LD4A 1CB7A 4MWCA 4EWLA 1P5ZB 3TM4A 1LPMA 3KTAA 3L7YA 3NHMA 2VNSA 3L8HA 4I4NA 3BMCB 1J8YF 2JFFA 5CIYA 2OV3A 4MB6A 4NATA 2JFWA 4UUQA 1RWMA 2G82A 4LXXA 1CJUC 3UGKA 2BL4A 3F97A 2Q8QA 2ZFUA 3ABOB 4M88A 2FSIA 2NAPA 4MYTA 5CCDA 3UWMA 1QGYA 4QPJC 4JC5A 2Y99A 4P7BA 4E14A 3A2NA 2F1IA 3QMWA 5EPUA 5I45A 1VHDA 4RCYA 3S0JA 3K6JA 5K45A 4B3BA 2WJGA 2XQGA 1TIPA 2FXVA 3RWOA 4ETNA 2VH1A 2EGUA 1YA6A 4QT0A 1W9MA 3AKCA 4BJHB 1B00A 3U7JA 3TQSA 3W90A 3ZOKA 4KNYA 4I55F 1EEXB 1N6RA 3LW8A 1Q7TA 4LGVA 4M1WA 3LLMA 4Z2YA 4F1KA 3EX7C 2C96A 2POQX 3EMDA 1KKMA 1QH9A 1Z5WA 2BMAA 2BUCA 1JSCA 2A5DA 2XWBF 2ZRLA 4LYJA 4DMCA 3ADDA 3UJ3X 2PQ0A 1BVYF 3DE2X 4ZU1X 2H3EA 1E0AA 3IV6A 4FFPA 5FWNA 2BFBA 3GV0A 5DNYB 1UM9A 1M2GA 4MEBA 3IMCA 1H8ED 4O3FA 1J7KA 4B09A 4K9SA 2GN6A 4QYMA 3ILHA 1T6YA 3B3QA 1JHYA 2CNNA 3DQPA 4L28A 4TKVB 1KZ7B 4ARZB 2X4DA 4BKQA 4DRZA 1G7TA 5C9ZA 1T1EA 2R1VB 2Y6VA 2YW9A 2R60A 4NECA 1Z06A 4S2EA 3AHIA 1BS2A 4MW1A 4L9SA 3TQTA 3DFKA 4WCDA 2QTGA 1WXEA 1M6HA 2RIPA 2QE7D 1ZGZA 4JDPA 4R16A 3WK7A 1Y89A 3SZUA 1KP9A 2I4OA 3WYCA 1PT7A 2R2GA 1WDWB 1E4EA 3GA7A 3V32A 5EJ9A 2EX0A 1JYSA 4OJQA 3F67A 4TLAA 4DA4A 2Z5LA 4NJOA 4LA4A 4F1WA 3OURA 4EF5A 1FVXA 1FTWA 2MSWA 3CNLA 5K8JB 1AMOA 2Z09A 2FHPA 1S3IA 2UZ0A 3CURA 3L06A 1DGQA 5MN5A 3MWDB 1H05A 4RKFA 3DOJA 1FLDA 4OKNA 5AYVA 1T5HX 2IVZA 3JQDA 2J33A 3M6FA 3D3EA 4XB6B 3JWHA 4RD1A 1A9PA 1VBMA 1A82A 1YRBA 2A5FA 2BI4A 2HPVA 2ZXEA 3EW7A 3IUNA 3O9VA 3P8ZA 3BTUA 4OOFA 4P80A 4RKQA 3PXEA 5HF9A 3T3OA 3R3ZA 1XCGB 3LDHA 4AG6A 1E2PA 4B6JA 3ZHRA 5CK4A 4DSUA 2R7AA 2ZUCA 4BNJA 3VBEA 5KEIA 3BSWA 1E18A 5L6LB 1MW9X 5ECDA 3KR1A 4TUYF 3WB0A 4BGDA 4YT4A 3VYUB 1T3HA 4K9QA 2ES4A 2X6QA 2ZBQA 2ZYTX 4WIAA 2X5OA 3FROA 4HNVA 5K3AA 3NOQA 2QL7A 1TEHA 2QPAA 1P2DA 1WBBA 3ZHXA 2C3UA 2VDWB 3DBHB 4KDRA 2VYNA 4JQZA 4YDSA 3TBKA 3UWSA 3WRWA 4BLQA 1DKUA 4IGKA 1EUQA 1D2AA 1OC2A 1RRMA 4DRXA 2QYSA 3D9QX 4HVCA 1UDXA 4BVGA 4UCFA 3OHMA 4QOSA 4FYPA 4Q02A 5BMVA 3QVGA 3REQB 4KK3A 1SQSA 4WZBE 3ZZTA 1VE3A 4DBZA 4RFVA 3RRZA 2GDJA 3G49A 3N2NA 4FHZA 2GETA 2OE2A 2EWWA 2PL3A 3PICA 1DBQA 2OVBA 4LS3A 2BHNA 1C7JA 3L8EA 4I7EA 1G6HA 3NDIA 5LDHA 3ILYA 3EPKA 1YRHA 3BHIA 1L5WA 4M98A 4QYIB 3TRKA 4UATA 4WKPA 3V9PA 4PCLA 1NVAA 5HBRA 4CV3A 2N46A 2XUJA 5ITSA 4HGQA 1RHQA 3NAZA 5F73A 4C04A 8LDHA 3VX3A 1P4SA 1FP7A 1ZK2A 2ASVA 3EG5A 3LM8A 2YWRA 3PX2A 3V8RA 3I45A 4BBJA 4W9MC 3W7AA 1G8YA 5A4KA 1YBMA 3W5BA 1M34E 1KWGA 3L77A 5IC6A 3CUVA 3FI9A 2B4KA 4N5MA 4Y6RA 2GZ1A 3BN3A 1NF8A 1QP0A 4MS1B 3M6AA 2HXSA 2H3HA 2PRZA 4NMXB 1C4OA 3E8XA 1VIYA 5ALOA 2RGNA 5BNTA 1DAPA 4L3VA 5BVHA 4E5SA 4F9TA 2YHAA 1GGHA 3GCZA 3EJ6A 3S1SA 2XXAB 4HNHA 3SXUA 2W6JD 1SCKA 2HA3A 1D7AA 2ZSHA 4L76A 4BX9A 4ZYWA 4MIKA 4NEGA 4AYWA 5DSTA 4O4LB 3ABZA 4YDRA 1G4AE 3IXLA 3NIFB 4JL8A 2VQ3A 1YDFA 3ZC3A 1O95C 5JARA 2IS4A 3HB7A 3TI7A 5HXAA 4LXQA 2QMQA 2PCLA 3UAOA 5KYUB 5DN6A 5FI5A 2FP4A 3FDXA 2BY4A 4IXWA 1KE1A 4WKBA 2FN4A 1FP1D 3VPFA 4HR7A 2YWCA 1CSEE 5EWMB 4O2RA 4PC3A 3ZCUA 4MB0A 4IIXA 4JNKA 4H4EA 1M0SA 5JAQA 2X0DA 4FFBB 3S2SA 4ZT2A 3FE2A 5BSHA 1N78A 1SXJE 3WMFA 4CHGA 4JQSA 5KYYB 2E4WA 2X7HA 2QRVB 2Y0CA 4UTVA 2OV6A 1Z0UA 2OOKA 2P9GA 4KIWA 4WXRA 8MHTA 1KMIY 2EX1A 5IWCA 1QP7A 2GX6A 1MU0A 3MMZA 2GNAA 2GRJA 3DBRA 2YW2A 5FUYA 2EZ4A 4GMGA 2JLUA 4EIWA 2VSOA 4HZUA 4N40A 1X9GA 4OTZA 2TMDA 3O4FA 1EP2B 4KGDA 2D62A 1Y4ZA 3IOBA 1SVOA 2WSMA 3H5WA 3PEFA 4AF8A 1E3QA 1GHTA 1KAGA 1KMNA 1XDBA 3BULA 3NW9A 3WL4A 3SX0A 4BFZA 2QGZA 4MUGA 3ZDRA 1G8JA 4WZAE 2IOQA 3VGJA 1I0IA 5D6OA 3MJSA 3B2NA 4PLZA 3MBIA 3TD6A 4H7KA 1T24A 4GM1A 1Y42X 1Y8CA 1CY0A 3N87A 4RK0A 3PDUA 5DI3A 3HB1A 2H85A 3M33A 4PSCA 3KVRA 3K0HA 4TN1A 1BXGA 3AFGA 3P2EA 1NRJB 3OM0A 4QGBA 2C7OA 2GBLC 4JHLA 4GX2A 5CHYA 1F6BA 2YWDA 3SE0A 4B6EA 1KBQA 3FIUA 1NTOA 5ALWA 5HIIA 1H6AA 3B8HA 1XBTA 3JSAA 4IIHA 5K05A 3N5CA 4EYEA 4FFWA 5JLAA 4E4RA 1W85B 4NPAA 3QG1A 4ZQFA 1RMQA 2AD1A 1HZZC 5IF3A 4KGXA 2Q5OA 4ZZIA 4UDNA 3IKJA 3W78A 4Y1GA 5K03A 1T4DA 2W11A 4D9JA 1BWPA 1SU8A 4ZK6A 2YOHA 2QPOA 4IRMA 1B0ZA 1N2BA 1NXPA 1ZUHA 2JFNA 4RVNA 4U02A 5EQFA 5DCLA 2AN1A 3ONVA 4N12A 4X71A 3DQZA 1UODA 1XU4A 2WYIA 3LLCA 4B40A 2DERA 4D25A 2C5AA 3K5WA 4DF3A 4FDMA 4IKPA 4DJEC 1FDOA 2HIHA 3UC5A 4LFBB 5A9TA 1JR3A 1TF7A 2PZKA 3K0CC 2JL1A 4N8DA 5G4KA 3UJBA 1JWLA 3AF6A 1AKEA 4DR7B 2GPNA 1Z25A 2O1EA 2ZRCA 4B83A 2C4MA 3T35A 2CJWA 4QREA 3U5ZB 3IP9A 1X1RA 2IP4A 4D9GA 3ZDZB 4W5HA 2P0YA 3PZRA 4IQFA 3ZEAA 5GJWC 4EGCB 1MQSA 5EYPB 3MTGA 2L2QA 3RAFC 4H7IA 4IZ6A 4B3CA 3WNZA 1QX4A 3U60B 4CQLB 5I7EA 5IM4F 4UEQA 5D8DA 2H65A 3P0FA 3NHBA 4J07A 1I2DA 4B31A 4C7MA 4BCBA 2J9GA 1KJWA 3F9CA 4KSCA 5JPIA 2WK1A 4DCJA 4CTMA 2IUYA 3QMPA 4L8LA 3DMDA 1IHXA 1D6MA 1WXDA 1KMQA 1X1BA 2QG9A 1YNSA 3AX6A 4GXRA 3T5BA 1RYHA 1AUQA 3AQIA 1Z3IX 5DWDA 3WR5A 1BDHA 5JZBA 4KB5A 4RPGA 1N5RA 3MBKA 3NIBA 2O57A 4LJSA 2NO7A 3NP7A 2FPUA 5B6JA 4H7DA 3SDBA 1VLLA 2AFIB 3GBVA 4URFA 4DXDA 3IBCA 4ZI2A 5I5EA 2YQ5A 1VE7A 5FORA 5FBQB 5EJ5A 3AR3A 3C14C 3G9ZA 5KNBD 1ATZA 3RABA 2O9JA 3SLKA 2Z5VA 1HDEA 1KFBB 3IP1A 1JEEA 4QXAA 3TCNA 5L53A 4DUYB 1P4AA 1Y3AA 2JLBA 2GI4A 1E3LA 4L72A 5KKAA 3A6EA 4MJXA 2R6DA 3S99A 4XWTA 3SBOA 1G3IA 3ZH9B 3HYRA 1QGED 1QH8B 4BP9A 4PC1A 1UKYA 5CX1B 1OI2A 1UUFA 2KPOA 2NAFA 4GOLD 3CVUA 2O19A 1KYZA 1U9IC 2W90A 3EQ2A 5JH7F 3GXOA 4EY5A 1IIRA 5L45A 3H7AA 4C05A 5DBHX 4DAOA 4DM3A 3STWA 1SVNA 2VP4A 3NPMA 3WGGA 1G5RA 1FPQA 3UHAA 3A6HA 4OXRA 1U0EA 2EFDB 4B9EA 4OJNA 1ZIOA 2XMPA 4NBKA 5IJ9A 1RKXA 3DO6A 3OQBA 3CLRC 3L49A 2Z9BA 1QF6A 1PZGA 1T15A 4C4TA 3OKAA 2OB2A 4DWJA 1Q20A 3QA3E 4EECA 3LCVB 4YCLA 4H6XA 2XQVA 1MB2A 1V45E 4Y1EA 3ONDA 4LHXA 3FNGA 1JR4A 2W6CX 3W5DA 2QMZA 1O8BA 3TAHA 3H2KA 1A72A 4Q3AA 1YR7A 1CLUA 5EXEA 1UIRA 2JCBA 3HMKA 4YR7A 5CIQA 4PHGA 4ASUA 4AX4A 1Y7HA 1EXVA 4C6HA 4R8MA 5E0OA 2RI6A 3WGLA 2XCRB 3TLGB 3VPHA 5HGJA 5IVKA 3JQPA 3FFAA 1LFDB 3FYDA 1YIOA 3HGMA 2AXQA 4UQLA 2IUFA 5CLLA 1LRJA 1Z5ZA 4RK5A 3LCUA 3DBIA 4BPRA 1VMKA 1FRFS 1BKSB 1ZINA 1M73E 4JBXA 4LNAA 2BTQA 2SKCA 3UHFA 1ZD8A 4ZT7A 1FJGB 4JNCA 4RDIA 3QMMA 4EGFA 2A9QA 5CFRA 1JJAA 4PHCA 5J2TF 3UK7A 3FRJA 1BHQ1 1PTKA 1UOOA 4ATNA 3ILXA 5FPSA 3Q8LA 1YS2X 2VI5A 8ABPA 2YXDA 4QU8A 4RKWA 5AW5A 1XZKA 4YHBA 2NM0A 1IONA 4BO0A 1CR6A 2OM2A 4L0MA 4LRUA 3QKSA 3KSUA 3UQZA 2BHSA 2Y93A 1ODTC 2FFJA 2Z3VA 3AKEA 1T34A 2XT9A 4OK5A 1WUKS 1QGZA 4H2DA 4UVGA 2DQ4A 5EHNA 3QUBA 2UDPA 1JEQB 1QWSA 3O3CA 3T1NA 3ROGA 1A50B 1J0EA 2ZREA 1LF5A 1TM3E 4KE6A 5DIZA 3T34A 2BHRA 1U3GA 2R6JA 3FCUB 4P2GA 2IWHA 2YR0A 2XB6A 1KRHA 3JTMA 5A7GA 3Q8XB 5LMUB 5F2KA 4N9WA 4LXYA 3QY0A 1H1DA 1X87A 2IYZA 2XV1A 3OPXA 4J7XA 2Z4TA 3ANSA 1VYTA 1HEUA 5CB4F 4KQIA 3U4AA 5EI5A 3G17A 3AERB 1GLGA 2NZUG 1VCIA 3I52A 3FG9A 4X61A 1QC5B 1XRMA 3VSBA 2C3PA 4TTSA 1PWYE 2PU5A 3LWDA 3S8YA 3VR6H 4UTOA 2WTUA 1J90A 4YP9A 1HRDA 2UZ1A 1KORA 1BMDA 4M49A 4BBPA 3DAGA 4MWBA 1YK1A 3KKQA 4BLSA 4ZKDA 2P2NA 3DMPA 1X1EA 2FZKA 4D74A 1PBNA 2IYQA 1KK2A 3FZYA 3K73O 3RAJA 1AKTA 2DAPA 2FPIA 2Y92A 3V2HA 4YT2A 5LZ2A 3VM6A 2YJ5A 1EP9A 3G79A 2Z57A 1QFJA 1DHTA 3OFJA 3PD7A 4HQLA 4PO1A 2GHQA 3M5WA 4HPJB 1WS6A 3PXAA 3ZI7A 3G5MA 1CVLA 1E9DA 1QQ5A 1Y4AE 4F92B 2YN4A 3KWLA 2BJVA 1V11B 2YWEA 1LBQA 4FGUA 4MQ6A 2WE8A 3THOA 3DC2A 5TQ0B 5JSUA 1WM1A 2W43A 1PS8A 1X1DA 3JYHA 1LVGA 3KL4A 1M1UA 3FOAA 3LH5A 3RW9A 1XPRA 1V3TA 3JR7A 1Q0HA 1LI7A 1PT9A 3BWMA 3ZDAA 2F3SA 1SUDA 4MGEA 4TTPA 4L73A 2PVCA 3BJEA 3K9LA 3QX9A 1AY0A 1O03A 4HC4A 3CMCO 3OTWA 2GN4A 4W8GA 5EE5B 4PEVA 1J97A 1SOWA 2ZUUA 3EXIA 3O82A 3OCVA 1F1BA 1MJFA 2JLRA 4MYCA 3GX1A 4TQUS 3UVEA 2C9BA 2HV8A 1SK8A 3QOWA 1E1RD 3KXLA 2PH3A 4UUAA 1FQOA 1TK2A 1QIFA 1G9XA 4CFSA 1M76A 3CT6A 1C41A 1WZCA 1XQ9A 1GSAA 4G6ZA 1TUIA 1ORIA 1TQ6A 5B37A 3MXOA 3G88A 4FZ3A 3Q8MA 10MHA 3RSGA 3IT0A 4Y9TA 4C5BA 1L3CA 2JNWA 2NVOA 1V26A 1WHTB 2CVOA 3E6AA 4RY8A 2BFNA 2D2XA 1VMEA 4RENA 1I1OA 1ZJ5A 4NYIQ 4B2YA 4AKHA 4GM4A 4P4LA 5LZ7A 4O4JA 3SHTA 4BCDA 3L02A 4RE5A 4TWRA 4LK3A 3IE2A 3GPCA 1YTLA 2M2IA 2CL7X 2FU5C 2B4AA 4FYKA 3TOSA 3A1NA 1IZ9A 5REQB 2YL2A 4R2IA 3DR5A 4IOJA 4RKYA 2Q21A 5HOQA 1GUDA 3OWXA 4B73A 5HIKA 1WUIS 1JHUA 4DMKA 2NW6A 1QBGA 5JROA 5H4GA 3HV2A 3RANA 1YUNA 2J9RA 3V9AA 2F43A 5ALHA 1H2EA 3LO8A 1LS6A 2YJTD 3OOEA 1VFNA 1Y3FE 4X3CA 4E15A 5B6IA 4DQUA 1FDRA 4KX5A 1AKUA 3MHPA 3PC8C 3RROA 3CCBA 3QWFA 4MUFA 5IJZA 2CK3D 3CY6A 1Y63A 4EHDA 3R9WA 2ID8A 4KQHA 1VG1A 4KIUA 4TTAA 3NT4A 3RS7A 3T1QA 3ZLVA 4ZJUA 4G1VA 5H81A 4DKXA 5CAEB 4E2FA 3PXGA 3U9TA 1W0KD 4O6VA 5AI6A 5AKGA 1Z75A 4LSZA 4RVFA 3OIUA 3UT6A 1MKYA 4C14A 3EXAA 3FGOA 5ALQA 3VZRA 4EHFA 2O8EB 4ESHA 2VP9A 1SBZA 4AJLA 1XKTA 2J1LA 1MIHA 2R6AA 1CVIA 2VF8A 4Z8XA 3L7KA 2GVDC 3AM4A 1WB5A 3QSYA 2YVUA 1E89A 1H2YA 1YZFA 3OT5A 5ALRA 3VR6A 1II8A 3JRWA 4HWGA 1FU7A 1IG0A 2IYFA 4ZO8A 3R9KA 3U4QA 3AUYA 1D3AA 2DCMA 3DZDA 1K88A 3ZWPA 3C85A 3HK2A 3ZW7A 5G3ZA 5J3JA 3D6JA 5L3RA 3EEBA 1Z28A 1FXSA 3KXIA 4WKGA 1JFLA 2PX4A 3FWYA 4JK3A 1HLPA 3KX2A 5ELXA 1ES9A 2CNKA 4TM8A 4FE4A 2ZKLA 3VVMA 1JA1A 3M2PA 3AVVA 1M8KA 5JNUA 1GA1A 4RULA 4DA9A 5EXSA 5HZKA 1U94A 1N34B 3JASB 2KLBA 3EOAI 2G4VA 4E94A 4CV1A 3OJ0A 2OC4A 3TPZA 1UF9A 3P45A 4O4HF 1RJGA 4OQNA 1PWXA 4WPGA 4US2R 4WY2A 5ALYA 3SLRA 1KEPA 4CT5A 5CK5A 3SMQA 4CU2A 2G77B 1BMTA 3MAJA 3P9SA 4AL4A 3TFOA 1OWLA 5TGTA 4UHFA 4ZO9A 4MRVA 1Z17A 4MYRA 1Y80A 3UOGA 4E7OA 1TB4A 1IATA 2BGNA 4YC7A 4CMIA 2XNJA 3G6KA 1D2RA 3KOUA 5AKKA 4B6PA 5EZQA 4LRSB 2QM8A 3KQTA 2NPOA 2OBXA 4AY6A 1T0BA 3DTTA 4WXMA 4YB8A 3PFNA 2CHEA 1EFUA 3CEAA 3IRUA 4KQ6A 5EEHA 8GPBA 1MX1A 4L51A 1ZM2A 2IFTA 1ZIYA 1RWPA 2IZZA 4MWZA 3GRVA 2PKXA 5TDHA 4QFCA 4M6WB 4BMXA 4MROA 5J5AA 4PS1A 2J4FA 2CDRA 3DE3X 2PR7A 4RK7A 4ZC8A 4HF7A 2NNWB 1P91A 4IDHA 4XQGA 4ND4A 1EGAA 1YV9A 3W2TA 4ENSA 3BE8A 5FHRA 1TK3A 2AMLA 4QTZA 2NTVA 5JSZB 3LCJA 4QUEA 3SQXA 1SG9A 1VLQA 1MJGM 3PR2B 4Y0VA 2R97A 1HBJA 1IHYA 2BFCB 1B8NA 2XGMA 5E6RA 4QVIA 1H4QA 3GCDA 4F6CA 2XB9A 4HFMA 2YXEA 3BK2A 4G5HA 4NABA 3JWJA 1L9XA 4JQOA 2IHKA 3S2GA 2DT5A 4NBRA 1YZKA 3UJCA 1BJRE 1JKIA 2QDXA 2IS6A 3SQLA 1MJGA 5BW4A 4V3BA 3CUEF 1YQTA 3WNBA 4B87A 5K2MA 2OGZA 2OCLA 1U9IA 2C1ZA 2FJ0A 5C34B 2X2PA 1N3YA 2XYHA 3DBLA 4LMBA 2EJCA 1MJNA 5BP7A 5LZ8A 1P1HA 2XCQA 1ORRA 3CPJB 2GPBA 1E63A 4FIZA 4FS3A 5FO1A 3VTKA 2G8NA 4QHSA 1H69A 1CFZA 1QIKA 1YRYE 4JLSA 1OW3B 1XK6A 1EMDA 2OT3B 1DC8A 4JB8A 3RBZA 2PIDA 2QTMA 1ZH4A 1EGMB 2AI1A 1W4ZA 2CVPA 3PR1A 1B0AA 2GK6A 3NYQA 4OHVA 2I6UA 4QUJA 5G1PA 4C5AA 1K75A 2R11A 3LUFA 1Y8ZA 5K01A 2YMPA 4M54A 3TLCA 1FSGA 1RPNA 3H05A 4KAAA 1OLXB 2O3TA 5LU8A 2BMVA 4V0SA 2NU9B 1T10A 3TDMA 1BXKA 2R8ZA 2A9KA 4M9SA 1F3LA 4X20B 3U31A 4WLEA 2NUAA 4DQ0A 1RFLA 3EJWA 4D9BA 1U5CA 1UXHA 1R6DA 4P93A 1Q1AA 4AJ9A 3B6IA 3SS9X 1E5VA 2NV0A 2HC9A 1T2UA 4OF4A 5AHRA 5I7AA 2PVSA 4AG3A 2XITA 5TQ2B 4JVMA 3U37A 2D5LA 2EKLA 3ZDYB 2HEGA 5HE8A 4RPIA 4J03A 3E03A 4KMMA 4N8SA 4PYMA 1SA0A 2J4CA 2QOEA 2Z6AA 4BWGA 1YOVB 4OQXA 1PBTA 2C1EA 5DKFA 3LS2A 1NWHA 1H22A 1QG2A 2QZ4A 3ABIA 1T4GA 1KBZA 1U1GA 3P9YA 3R41A 4L2IB 1L5LA 4BNIA 4RTKA 3DF9A 1RQPA 3EGIA 5FOUA 1R10A 2Y2VA 2DQSA 3D3WB 3VX4A 4EATA 4KRXA 3EFOB 4H08A 5HMLA 4ZCSA 5SZHB 4BLTA 2R7MA 3OAAA 4JI3B 2PSDA 3JYQA 1ZEJA 2A59A 1HNWB 5CIWA 1WPQA 4CGZA 4JYCA 3EGCA 1PR9A 2Q4EA 4EKIA 3FIJA 3GIDA 3WLNA 1OBVA 4N0EA 4OBEA 1V3VA 3EXHB 3T54A 4NY1A 3KB8A 5DULA 3NBFA 1CRLA 1NRXA 5CD9A 3NEAA 2Q3DA 3GFRA 3K05A 2VN8A 1L1FA 4A03A 2R5NA 3QLEA 3X1XA 1T13A 2IZ7A 2JHFA 4AF6A 4B1FA 3CVYA 3VXKA 1SCIA 3QIAA 2W2QA 1OAOA 1CV2A 2WJAA 2C9MA 2H2WA 3OFNA 3PS9A 3QEMA 3WLPA 3K92A 5A71A 2P9JA 3OLZA 2Q4OA 1QF7A 5BOSA 3O26A 1X7HA 3BE5A 3PD1A 3PNQA 1GTG1 2XUIA 4KFSA 5EG5A 3OO1A 1CUGA 4HYTA 3WIBA 4PQEA 3JV7A 4FZVA 3IPYA 4GX0A 2B7CA 2HYDA 2WVGA 3IX7A 4AZ0A 1C1XB 1OSNA 1WXIA 5DP1A 5B3AA 3UMSA 1NURA 3GLFE 1QZUA 2JFBA 2DTEA 3ZYCA 3NASA 3EC2A 1NYRA 3DUWA 3P4XA 2DB3A 1G4UR 4YRTA 3WGUA 1DKQA 3C6MA 1PLJA 1SUEA 1SPBS 1ILEA 5EHXA 5SY9A 1E58A 4MMXB 1JVNA 4DIBA 2ODBA 3IUJA 1Z0SA 3V80A 3T5AA 2P9EA 1OV6A 3E81A 2VEOA 4F12A 2AQ8A 2QX6A 4Q1EA 1P7PA 3C5HA 4FU0A 2P2DA 4FXOA 3UAGA 2HA7A 2QWXA 3EIQA 5BT9A 1W8DA 2ADFA 2JKYA 4BN5A 5IFLA 4JJEA 1K7YA 3K70D 3A1UA 4ENVA 1P9WA 2XDAA 3UUGA 3K5HA 2NTEA 2FK8A 3COZA 3CUYA 3NJRA 1U6JA 3D2LA 4XW2A 4RTMA 1SD1A 1F2UB 2I6FA 2X2OA 3R8FA 3DVLA 5DBIA 5FP0A 3AVUA 5AVZA 4DMHA 3OPVA 1U3WA 4K3UA 1KPIA 2BBTA 4UVIA 3QPDA 3K31A 4HBZA 1QGUA 4RHYA 5KJEA 3SCZA 1G2QA 1Z16A 4ZOLB 5IAGA 1PLLA 4PX5A 5FL7A 5LA6B 4A8TA 1RQ7A 4FZJA 5HA5A 1QOQB 5A5FA 5KVCA 4QNNA 3L6UA 1QANA 4ZOLF 2HHCA 1U0HC 1ONOA 5COQA 4YAUA 1LVUA 1AB6A 3EUFA 1CEXA 2NVBA 1UIMA 2IGTA 3UB3A 4F5DA 5TC4A 5TQJA 5KNCA 1M2FA 1S7GA 4D56A 6YASA 3TB6A 2WF5A 2ZU0C 2WJYA 2F3UA 3C5WP 5A7FA 5JCXA 3S1LA 5FJIA 5C53B 4EVRA 1DRKA 1K63A 1CDDA 5SY4A 1SXJC 4R1QA 4AIIA 2PUAA 3DKIA 2DWQA 2VAMA 3L3BA 2HKIA 1MAAA 2EBUA 3NJ4A 2CVQA 4HQFA 3ZWNA 3V8QA 2XKAA 4MWGA 3DFFA 1T4CB 4DJ5X 1W47A 3OCXA 3AGPA 3R24A 1V2HE 1SQFA 3PBKA 2OHOA 4TSFA 2Q7XA 2LV8A 3G2NA 3QM1A 1JYEA 1HZZA 1V1JA 3ZJYA 4BO3A 4IICA 1IOWA 4ZMRA 5CXQA 1Z4MA 3B12A 4EELA 1G59A 2O50A 1TA4A 1K2WA 3BRCA 3PFKA 4FILA 2QTAA 3GA0A 4J8PA 3M8KA 3EK2A 3RU7A 1GYQA 2FSUA 3KOYA 3TZEA 4AJ1A 1OWPA 1ZHOA 1L7VC 1E3WB 4Y30A 1SZJG 3RCBA 4LY6A 4MLDA 1X38A 3O8OB 4Y8VA 3LPAA 3ZHYA 3S6JA 2H48A 1W9HA 2FRDA 1PEYA 1WP4A 1O4VA 1T6XA 3H9EO 2JCYA 2DPMA 3ER6A 3H97A 1G8AA 3MRTA 4OFZA 5C81A 1HEIA 4U3JA 1U8XX 5DX8A 2KS6A 2O2ZA 1GPNA 2J7PD 5SYNA 3V46A 3GI1A 1GXSB 1FRNA 4MITA 3ZZNA 4CEJB 1OGYA 3A27A 3HV0A 4ED9A 5SZJA 1YGPA 4TL9A 2APJA 3LY5A 1G2IA 1Q77A 4RPJA 5U1PA 4I4CA 6LDHA 2GERA 3AEKA 1I7SB 1P44A 4BQPA 3IMKA 4QIHA 1JEJA 2R8XA 1SIBE 4EYGA 2W6ZA 4KREA 1I80A 1PZNA 4IUCS 4P22A 2QEQA 3OY7A 5FKJA 3ES9A 4HGRA 3CLSD 4HPXB 5F9MA 1XVIA 5BYBA 3TK1A 3TL6A 3FCEA 2Z2KA 1P17A 4G0YA 2P5UA 5IDWA 4W63A 3Q7RA 4HH4A 3UG6A 5CA0B 4N5IX 2ZWPA 4BBAA 3ZBPA 4YLEA 3GCXA 4IF6A 2MSEB 2VJLA 4AXBA 1IXYA 3MVEA 2ZYUX 4U6SA 1NQAO 1KDOA 3DSRA 2PO7A 2JF0A 1DAFA 1XD8A 3I04A 3X1KA 4A2PA 1NXQA 3G1TA 2OXTA 3RJTA 2Q5IA 5D86A 2WT4A 2IF2A 4FFRA 3AQ4A 1I4WA 1V5EA 2R3SA 4V0ME 4COOA 4KO8A 1E4OA 1ZJZA 2OMKA 4M9XA 4KXLA 3OJOA 5IZCA 3GRYA 1JXQA 1SXJB 2XBUA 2NYRA 3UOAB 3QUSA 4DG8A 5T8KA 2GA9A 4Q3NA 3VUFA 5JY6A 4KV9A 1ID8A 5EIBD 4PFJA 4N0PA 4WXHA 5AD1A 4ZCPA 2GUWA 3ICEA 2WIFA 3IVGA 4OO3A 1HE3A 2HDNB 2NPFA 1NMQA 4JI4B 4R98A 4JMPA 2GPWA 3FCCA 1XAHA 1YASA 2JGFA 2ZVPX 2Q62A 3F5DA 4NARA 4ZODA 3IC5A 5D51S 2VLBA 5EWLB 1H4SA 4D3YA 4Y2RA 4OMCA 1WF6A 2VF2A 1PL7A 5DGXA 1ZOLA 4RFSA 1O2DA 5EINA 5D5HA 4DT1B 4EX7A 5KWEA 2DE0X 2PRIA 3AHGA 4Y2UA 2WMYA 4Q4AA 4F7DA 2EDAA 3I4LA 1YAJA 2BRUC 3CLTC 3FMFA 4HXEB 4W7HA 5F3DA 3UKJA 1R6TA 1KDTA 1SIOA 1VL0A 3IUQA 4IXMA 4JOQA 4PQFA 1RBZA 4PYOA 4QQ8A 4C3ZA 2B5VA 1JBEA 2FQYA 4FYJA 1NNUA 1XO1A 3FSGD 3MTJA 4TXMA 3T3EA 1U5BA 4KKXB 2BE9A 1RQNA 2GHIA 5CGQB 2OCAA 1VJRA 1F0NA 1ZZEA 4QM6A 2R00C 4JJKA 1B2RA 2R4QA 2O8BB 1PDOA 2WWGA 1TQ4A 1WSAA 3JATB 3K1YA 1R4AA 3VSDA 3AHHA 3WRYA 5B4UA 5BN4A 3HUDA 3VMMA 5HKAA 3SKVA 4PLTA 1SKYE 4YJ2A 3LG2A 3EG9B 1K3TA 1EJBA 1WUTA 2NQTA 3RAGA 1ORDA 1Q1ZA 3PLAE 1H9CA 2EZ8A 2WILA 3W5HA 5FBRB 1DOZA 4BRSA 4IGFA 3N2GB 1F9EA 2BP7A 4FMCB 5K0JA 1YR1A 2GILA 1CUSA 4W5QA 5AM2A 2HPZA 2XBLA 3EB9A 4TL6A 2H5IA 5BYAA 3ESRA 4I9GA 4BVHA 1WV0A 4QG7A 2H2IA 5G0VA 4MI3A 3TVTA 3DOOA 3S1AA 4O59O 1RQ2A 1M34A 2B9EA 3LKBA 1WB9A 4PG8A 1B8UA 1XD9A 4LHEA 4O08A 1YL7A 1VBNA 4YDHB 1KAQA 4RHEA 3BMCA 4DM4A 3T1OA 3W9UA 1X39A 5BSTA 3U3JA 4ZHSA 1W7AA 1NI4A 3ACBA 3JD1A 3NOVA 3E22A 3U3MA 4EGAA 3AUUA 1BXRB 4Q18A 2J7KA 4E08A 4E21A 1NJ2A 2B36A 3TW8A 2A58A 1H65A 3SM9A 2IUTA 3DEKA 3O83A 1QMGA 3HY3A 1DIHA 1ZYUA 4KIFA 4OYYA 4PZ9A 3JQGA 1IHUA 4MHSA 4LF6B 1Y7LA 5DLEA 4ARUA 3ND8A 1QIJA 1WSBA 2OG1A 1CZRA 1E3IA 1WEKA 2XEDA 3GL9A 3HEMA 3LU1A 3MCWA 4P9NA 2WU3A 1ZICA 3IMEA 3PHCA 3ULKA 4ZYUA 1QUEA 3LUDA 3NEYA 4RZXA 2IPAB 4Z9BA 5JMOA 3HU2A 3CUTA 3HCCA 1Q7RA 4YDQA 1FNBA 3P2OA 5AJHA 4C0QC 1CNFA 1E64A 1ONNA 3LXMA 1XYGA 1Z3CA 4S12A 2ECKA 4YJGB 1T6NA 2LWIA 1LBEA 2BFAA 5FPYA 3VZSA 3F5SA 3KQVA 3NHZA 4JGIA 5ENZA 2HYIC 2OBMA 2AN4A 3NHSA 4RJLA 1J0BA 1S6YA 4OLJA 3P96A 1XDZA 3BHJA 3SSOA 3QPBA 5C1OA 3I1FA 4IIBA 2GN0A 3A2LA 4EO4A 1IY1A 3EMBA 2GZSA 4FFVA 4RL4A 5A4AA 4BNDA 2GFIA 2J5KA 2WJVA 3EH2A 2X0NA 2E1RA 3ZOZA 4KNVA 4RKEA 2X41A 4R6XA 2J59A 2EW8A 2HF8A 4E2XA 4F60A 3FMVA 1C30B 3I6IA 3DHYA 1IWOA 3EVNA 3HN7A 3BFXA 1NVEA 3LK7A 2WOJA 5LIPA 4X54A 2OCKA 3N7AA 3C1UA 4G0WA 1GVNB 2HA6A 1XROA 2ZJ0A 5FUBA 1DJOA 1EGVB 3K4PA 5JAOA 2HD4A 5DU2A 4BMSA 1A2QA 4KQKA 3CM0A 1A97A 1G20E 4X66B 1RWNA 2FPSA 3OOSA 3PRHA 2CL6X 1OREA 3W1VA 3KM0A 4KR3A 3H8WA 3VYTB 3R9IA 2M1ZA 3B82A 2PUTA 4NBLA 2R8BA 1E79A 2XQJA 4FSHA 4X1YA 3NC4A 1DT5A 3DOUA 1MC5A 3I8SA 2QIPA 2JZCA 4QSHA 3DAHA 2H31A 4EHJA 4DDVA 3T9AA 3KLBA 3NOOA 1KH1A 1V4BA 3I01A 1QNLA 3DL7A 5LUBA 5TMDA 4ONEA 3WRYC 4EK9A 1K27A 2O5VA 2IZ1A 3UO8B 821PA 2V4MA 2YWGA 1HRKA 2HHJA 4HB0A 4QEZA 1P39A 2H29A 2Q3HA 3FLEA 4XPZA 3LUKA 3TMKA 4JLBA 3PENA 3K8YA 1NX9A 4W82A 1UJ4A 2QD5A 3I09A 3LYAA 4M0CA 4NQRA 2QJFA 3G8YA 1GL6A 3BGOS 3RRXA 1LDEA 1PYOA 3PEEA 1NC3A 3DMTC 1M7GA 2G5PA 3O4IA 4WNAA 2JBHA 4AKGA 2QYTA 1NIJA 3EW9A 3FYCA 3HI6A 3Q0IA 3Q7SA 4XQ9A 2V4ZA 2PIAA 4QHTA 3T94A 2C97A 2QPTA 2YFHA 3PDIA 2N75A 1OTYA 4W9NC 2C3MA 2DETA 3GEIA 3F5MA 3LVRE 3M5CA 4Z0TA 3RS8A 1ZK0A 2D06A 1YA4A 2CLMB 1WTCA 2XRFA 4HFJA 3B3GA 4B6SA 1D4ZA 1OXVA 4XAQA 5BQ5A 4NULA 4UVEA 2GKOA 3GXBA 2WP0A 5TARA 3CE9A 1X8XA 2O23A 4JFAA 1A9SA 3RKSA 3SEFA 3LY8A 1DQPA 1VLMA 2J09A 2K87A 1B8OA 2FX2A 2W83A 1DU4A 4MLPA 1G1MA 1CZLA 4YQZA 1UK9A 1T2DA 4WN9A 3O4HA 4YCJA 2BR4A 4NIMA 3RS2A 5LP6F 4EG6A 2WJ6A 3UB2A 3NBKA 4LYGA 3CRNA 4Q9JA 5AFSA 1ZRHA 2RG7A 1ZSNA 2IYWA 3N8NA 3HE3A 3DWEX 3KQWA 2ZDHA 3OBIA 5AM4A 4UPVA 3ROZA 4AUNA 1FMCA 1ZNYA 1TRHA 1K3UB 2FPKA 3B1JA 1NQTA 2H2DA 5GJBA 1MHTA 4MPDA 4KVZA 4JJFA 2GEUA 2C78A 1BJKA 4G1CA 1XR3A 4LOAA 2O8NA 5ITZB 3LQ1A 2X0FA 2PS3A 1BVUA 2IYSA 3N53A 1FIUA 4HNGA 2D2EA 1JILA 1HFKA 2WT8A 3EOZA 3ZWWA 3DHWC 3ORQA 1P8AA 3F1KA 3MJTA 2AXEA 1JJ7A 3GZJA 5AI9A 3V4PB 4B8YA 4WFKA 2JAHA 1K6EA 1CIVA 4WE3A 3MMXA 1QYCA 2EQ5A 4K40A 4F4JA 4MS4B 1NQUA 3WDMA 3DJFA 1E3TA 3PA8A 4PZDA 4W99A 1DIAA 1PJ2A 3T5GA 3E1SA 3N2EA 4DC0A 5AM3A 3FCYA 4NBNA 1O6FA 3EAFA 2PMCA 3SZRA 4BP8A 4EQZA 5KYUA 4R2HA 4YRQA 5ARBA 1J5PA 1Z2AA 1CQIB 2ODWA 3K7EA 1UBRS 3RYIA 3MWEA 4KXMA 2GGSA 1ECFA 3CR3C 1IQPA 2VDQB 1NUTA 2PN1A 1QE5A 2FDXA 1R6VA 1TVEA 2NO1A 4K87A 2R79A 3FSJX 5JVDF 4I8XA 4ZVVA 5LKRA 3HLTA 1UP7A 3AEYA 3OUZA 5FI3A 3WFZA 3MINA 3OTIA 5ALGA 4B34A 4CG0A 4YV1A 1CY4A 2NXWA 3FFBA 4FUQA 4JD5A 1M2WA 2XGSA 4UW9A 3GJ7A 1V6AA 2YJGA 3D64A 4K2AA 5KYYA 3GLIA 5I7RA 4CL0A 3EGWA 4BB9A 3VDQA 3O47A 2R25B 4BX0A 3KQUA 3ME5A 2CBXA 2QAIA 2GEJA 3B9PA 1TMKA 2QE6A 2HIGA 4BOYA 1ZN2A 4R84A 1Q21A 1ECCA 1DBRA 4XM1A 1EWRA 3Q72A 4DG5A 4HZUB 1X3LA 4TPKA 4WKCA 1H85A 5FOWA 3F8SA 5AVXA 2YY6A 3ED5A 4W5RA 5ELLA 2YXNA 1C1HA 1V0JA 4ZZ3A 5ER9A 1G7SA 1REQB 3IIMA 2E4UA 3UXHA 3AVWA 5LKAA 1QGAA 4JR0A 4YAOA 4UZEA 4BZXA 1FB5A 4QDUA 1U3TA 4K3VA 1RTTA 2P4EA 4TZKA 1CQZA 5E0KB 4X1IB 3G7UA 1HE8B 1L4GA 1MZVA 1TTTA 1X7ZB 4Z5XA 4RJJA 4CM9A 3S29A 1PV1A 3LY7A 4HDRA 3JQ8A 4PXAA 4V39A 1VLZA 2XLBA 3RV4A 3LDGA 5CD1A 2C2BA 1U4OA 5LFAA 4LSMA 2WPDD 3F6PA 1KY3A 2IYRA 1JXMA 3LHSA 2FKAA 3O4VA 4OIMA 4UAVA 5B3LA 3AM1A 4JLPA 1A2OA 2J0SA 5FDFA 2XNCA 1L8AA 2RGYA 4P2BA 2Y3IA 3GDFA 4K81B 2V54A 3R0QA 2QQ0A 3DLPX 5FBKA 4J3JA 4QFDA 3SC2A 1C3XA 2DLCX 4UOZA 2HI0A 2I0FA 5B3KA 4YS6A 3RC7A 2QRPA 3WLLA 2FE1A 3R6TA 2GAOA 3H8VA 4KO4S 1XHLA 1FNCA 3JVVA 1FDIA 1HTWA 1Z0FA 2AS0A 3F78A 3ZXYA 5JH7B 1XXLA 1XJ5A 1R64A 1ACJA 2W98A 2Q49A 2W93A 3OH8A 3JW8A 5A03A 3VR5D 3WHPA 3UV3A 4F86A 2VT7A 5B7NA 2PQ6A 1K4MA 2X9GA 3CF2A 3R6GA 3WWZA 3VVBA 4HAWA 1XB2A 2QTFA 2FUG1 4B7UA 1QV6A 3Q6IA 1FLAA 1EQ2A 4QYWA 1ML3A 3F3KA 2V98A 1DOAA 4YAKA 2WNHA 3KJGA 4M36A 3DP7A 4R5HA 1SBYA 4Y2VA 1LPAB 2PGXA 1MABA 4KFTA 4LF5B 2RHBA 3ETEA 3U9SA 3ICQB 2UXBB 4Z7QB 2P69A 4I1VA 2ZJYA 1FNSA 4ZHQA 4UU7A 1U0LA 2VJPA 2CB0A 2P6UA 4II2A 1VXRA 4FE3A 3RVPA 1YL5A 3E3NA 2Q0HA 1F4PA 1GU1A 1JTVA 4OEHA 5JZMA 4ZYYA 4JI2B 2KSQA 2LDXA 3EEOA 2QT1A 2ZAOA 4ZU3A 3L0BA 1QNFA 2BMWA 3OE7A 4MPTA 1UMCB 1JJVA 1JSXA 1LBIA 1NTRA 2GXSA 4FEAA 4IHAA 4AVYA 2NWQA 4HN9A 4QOIA 1VIAA 3OZIA 2WA2A 3PKIA 4O4HA 4HMOA 1WTAA 4F9EA 3LLUA 3JR3A 4JN6B 2O2XA 1NULA 4PXSA 4WK4B 4W1SA 4RABA 2MSNA 3BPSA 1YZHA 1E9SA 3D54D 3SZGA 2OBBA 3ESYA 4FYHA 4QXPA 3I53A 4CT0A 1SVLA 1QH1B 1S8OA 3K35A 1Z2CA 3L5OA 1NMXA 3LCCA 3QLVC 4GP7A 2FZCA 1C3OB 2M6KA 2Q5CA 2ZE7A 3N2YA 4ND2A 3IKTA 1JECA 2OXIA 1KJJA 3U7EB 1O87A 2IXDA 1GGMA 1QHIA 3L7IA 5KDLA 3ZUPA 1JDBC 2ZWVA 4J1TC 1BDMA 5FPQA 1LPBB 3IVAA 2X40A 3B8EA 1NV9A 3GELA 2ZBPA 1A7JA 4PZYA 2CV1A 2I3GA 4FDAA 4OFWA 1JP7A 4O8CA 1P7VA 1IOZA 3ANTA 3FKSA 3G0GA 2AT1A 1YB1A 3NBMA 4PTYA 2Q2NA 3QSGA 4KJXA 4KXQA 1EFVA 3UJPA 4IS2A 2D6FA 4ND3A 3RSOA 1AG9A 3CLSC 4MWEA 2PLFA 2Y05A 3PNLA 5KSYA 4KQWA 2VIIA 5B1DA 3L7DA 2SECE 4ERNA 1KC3A 3DEIA 3OP1A 3ZJTA 2H17A 4HGOA 4MRNA 1ZBQA 1MDFA 4KJZA 1U3UA 3E5MA 5C8YF 1A98A 1SQ6A 3BMNA 1OMOA 4GNRA 3DE5X 2NTJA 4HGYA 3U62A 1G42A 2AW3A 5D5QA 4DIKA 3EZLA 4KLNA 3YASA 2WHQA 1NFRA 3AU8A 4EB6A 2Q46A 2XVAA 1IY0A 2PZLA 4FXPA 4S1OA 4BEVA 1IBCA 4I0WB 4DLYA 4YJ3A 4ZPXA 3BAZA 3UV6A 2ACWA 1PJZA 3A26A 2WFZA 4TVKA 3H65A 1FS4A 4RM2A 1S2NA 4MQ5A 2VSFA 2FCRA 3OIFA 3OEWA 1DTWB 2GOYA 3ETLA 1WEHA 3DXYA 4ZVKA 3GZNB 2XHEA 5C51B 2GZDA 1K4KA 1N8TA 2KI5A 2X6RA 4F4CA 3TLGA 4LZJA 1GADO 4GQAA 3GHYA 1T8TA 5EIBC 5JJIA 5HFAA 1SEVA 4DUPA 5MN4A 4QDZA 1KO1A 4TWBA 2A14A 3A7EA 3EPPA 4D4IA 2D4AA 4PNEA 1Z18A 2AQHA 3K0AA 5DYGA 1CHDA 4ZOBA 5D7NA 3GUVA 3HBAA 3MTBA 3PXCX 2BTQB 2WFAA 4C01A 4WT7A 4JBGA 1QHGA 1RE1A 1V5FA 2BLNA 1HGXA 2OYCA 5DHPA 3QXSA 3BRWD 4KOAA 1OWOA 3ZDEA 1USWA 2RAFA 1YF3A 1U4NA 3OA0A 5L7YA 1JG3A 2GFQA 3IJPA 3MN1A 1S9HA 1ZNWA 1FOEB 9LDBA 2D5IA 2XJ4A 3U2QA 1I9CA 2OORC 4ZCMA 4D0NA 3PFWO 1IZYA 2K7ZA 4D9CA 5K09A 3MT8A 1Z4KA 3VAZA 3MOGA 3PLRA 3QKSB 1TRKA 2B1IA 4FPXA 1ZJJA 3KT6A 3ZNPA 2BN4A 5IULC 1P31A 1Z26A 3PQDA 2H1IA 1B2LA 1DC3A 2XMZA 4BZWA 4ZEVA 5HF6A 2BVNA 3BKWA 5GIOE 2WAAA 3ASYA 1JAXA 1F20A 1T2FA 3RR2A 2GMWA 2V3WA 3F5FA 3FSGA 1H8HD 5G0WA 5B30A 2WLTA 3ASZA 2ET6A 2VK2A 3VR1A 4Q7EA 3RYFB 4Q24A 2ZYHA 1C9JA 3WL3A 4EHKA 5EHGA 3RTBA 2VG8A 3UAXA 4YACA 4EHNA 5LMZA 4HRAA 4MIYA 2XCLA 1K8XB 1GTJ1 1XRNA 1JMKC 3DYBA 1P1IA 2VA9A 2PL1A 3FUXA 4AAYA 2YRFA 2ZT7A 3D6MA 4D6YA 2UZ1B 1V1RB 2I54A 1H1TA 3CNOA 1CY2A 1CY8A 3PX7A 4OYHA 4PG6A 2OUKA 3TQOA 3C4VA 2R8OA 4LY9A 3VU9B 4CW7A 2BKLA 4YYEA 1MB0A 3T95A 1ETHA 1RRPA 1ST2A 2JFZA 4K5QA 2OM6A 2RK3A 1QG6A 1S2LA 2VYCA 1P4RA 1QHEA 3X1MA 5C7LO 1T9GS 1TCCA 2QXYA 5K0CA 1SC9A 1RAIA 2OCDA 1NPYA 2Q4BA 1KEEB 3OZWA 9GPBA 1CBUA 1YU6A 4H18A 1PSZA 2FJPA 2PGJA 4OI0A 1V48A 4MGZR 4GBED 2QNRA 4MV1A 2XAUA 3OJCA 1E1CA 1CJCA 2NU6B 2CMFA 4RYDA 4I1YA 4CMKA 1BO6A 2XKJE 5I9SA 4HUJA 2VP5A 2PRSA 2EXXA 3KLNA 4COKA 3VDNB 3U61B 3M4ZA 1WZ2A 4IAOA 5HF8A 1QO0D 1NE2A 2JI6A 1GPYA 4TV8B 2OO5C 1GFWA 2IU4A 4QA9A 4IOMA 4DMUB 3RWMB 1DSSG 4XCQA 3OTOB 2CLSA 2X76A 1W2WB 3RREA 1K6IA 2AC2A 4DLPA 3BMXA 3QOXA 4M46A 4D4MA 3HVRA 2CHVA 4PNHA 4ER6A 2W4IA 2UU9B 1A4UA 2JKVA 5A6SB 2WYOA 3I8OA 1XQYA 3AJ8A 4G5XA 2F9FA 4KP7A 2WABA 3THYB 2PZFA 2QXTA 1XT6A 5A02A 3QEBZ 3BZBA 4NDAA 1B76A 1EP1B 2WM2A 5DEIA 3LP8A 4IG4A 2WIGA 4NS1A 1SXGA 2FQQA 2QR2A 3R23A 4ISBA 4J6EA 4P34A 4BYMA 3KFLA 4MVJI 3DTYA 1Q84A 1NR1A 2GNOA 2VVTA 3EXEB 4XIJA 1B23P 1Q3TA 1M8JA 2BM1A 3K1AA 5KNCH 2IHJA 2P4SA 3CA8A 3J80A 2B69A 3FPJA 3SX2A 1A8UA 4NE2A 3G2KA 5K8CA 2ADMA 3ZCPA 1ETUA 4UKDA 1GQOA 4AN0A 4GW3A 2Q1TA 4NQZA 3MIIA 4NFSA 4WWHA 5FNVB 3KKZA 1QO7A 2H8KA 5IZCC 4XARA 3FTPA 2H1CA 2BEUA 3BFVA 4IWNA 1JSRA 3LRXA 4GG1A 1N6LA 2WWXA 3GEPA 1Y48E 4BVKA 1HQYE 3WGVA 4JBLA 3HUTA 1DVRA 3BJZA 4QE3A 4NV3A 3UBTA 1AXEA 1TT5B 4XLLA 4NENB 1DZIA 1O9HA 1B8VA 3AUFA 2OECA 4CV0A 1CIPA 1CUCA 2F1HA 4N8EA 4AKSA 1X7YB 2YC2C 4G5FA 1NW3A 2FOXA 3WXMA 2XUQA 2VO1A 4KGVA 2RGBA 4RQAA 3R44A 4FS8A 5E1OA 5GVSA 1I32A 2HRRA 4GVLA 1R0XA 1ZD1A 2XVYA 3BMQA 1GCOA 4N54A 3QNWA 4XVCA 3MGBA 4A3SA 4QQRA 2NGRA 1T0JB 2RKOA 3OZCA 1T1RA 4RL6A 4TQGA 5EOVA 4A9AA 4BO7A 3F6CA 3SJUA 2P6OA 4F5WA 2OXFA 1U7DA 4K03A 2OXRA 4KDFA 2RAVA 3IBSA 3IV7A 1U8EA 3CISA 2QN7A 4R7GA 5EUBA 1FSPA 4WESB 1NYLA 2PXAA 2QLJA 2IE0A 1PT6A 2AV6A 2WIBA 3F0TA 4DB2A 2IX3A 1NBIA 3DZJA 4LE2A 3ZTWA 4J6FA 2DLDA 3ER9A 3R5SA 3C45A 2WJWA 4B6GA 3GLGB 4DV0B 4DANA 4L16A 5FD8A 3W6PA 4AF7A 2E5FA 3A7DA 4WBNB 4X7RA 3NETA 3ZVLA 2ZSEA 3WKCA 2QM7A 3V48A 1JYFA 3WDKA 4PYJA 3SQWA 5DHQA 1R00A 5B1HA 4YCNA 3B9BA 2RI0A 4QUKA 5AHOA 5F23A 4JXZA 4TUYA 2RHCA 4RSHA 3UF0A 3FHOA 3IR6A 4OAOA 4F96A 2OR3A 2X15A 5K6TA 1PK7A 4X1KA 5KOHA 5A3JA 3NALA 2B21A 2OHXA 1MV5A 5EC8A 1GR0A 1AIPA 2X8BA 5FQNA 5FJJA 3JZAA 2CSXA 1H2BA 1R6XA 2J3IA 2LKDA 4MI9A 1KVRA 3B6MA 4PANA 1YIAA 3R4CA 1BA3A 2GD6A 1Z5OA 3H2IA 2YUTA 4XGNA 3U1VA 3MM4A 4LMRA 3ZW9A 5CFQA 1PT5A 4XGKA 2ZS9A 2B94A 4J0CA 4EQ6B 5IVIA 2Q2OA 2GCPA 4GOXA 4OQYA 1OI7A 5FI0B 3W8EA 4BU1A 1SVKA 1N77A 2BUBA 3K0SA 1SXJD 4CNQA 3K96A 1HDIA 4L27A 2HXGA 1G18A 2DSNA 1IL0A 4B4VA 4BVBA 4DPKA 3OLVA 2EKDA 3NH6A 5DISB 4K6OA 3LNTA 1RI2A 4RVHA 1Z5VA 2X0RA 3FR8A 4XWKA 1G38A 2JI8A 5CURA 1LV8A 2X7JA 5T4FA 1V6CA 4D5EA 3AG6A 5JMTA 2Z1NA 2FW6A 3B3FA 4RIHA 5BUSA 2P0EA 2FMKA 3GR6A 4IDPA 2AFHA 5GZ6A 2Z5GA 1BG6A 1KI7A 1RZUA 2CJYA 4Z4EA 4POAA 2H9IA 2B61A 3RVDA 2H11A 1A8HA 4FC7A 4DLSA 4WJKB 3L7MA 1SKQA 2LCFA 4J0JA 1PJRA 4AKTA 4QL3A 1S9DA 1TA0A 1L7EA 1DE0A 1XEXB 1ZCFA 4G9GA 4ZXFA 1DAHA 1TPZA 1XRJA 2CLCX 4XUCA 3D4PA 3WGZA 1YZVA 2J7PA 4A4DA 1WMEA 3H1PA 3I9NA 1XALA 4AUKA 3AXSA 1XMVA 4Y6OA 5JD6A 5JR3A 2WUFA 3GEMA 5IASA 2CZGA 3BMOB 3C7DB 2GXUA 3GFSA 4IDNA 2I22A 4U2EA 4XQCA 2EFGA 3GJ3A 3F7TA 5JDCA 2NP7A 1WLYA 3MERA 3WGNA 3QHPA 2QVGA 3P0JA 3I6MA 2AXNA 3LPDA 2VXCA 2PNJA 3U19A 2HLHA 4LQCA 4YMHA 1U3DA 4GSYA 3ITNA 2HBYA 1VA4A 4Y6LA 4CR8A 3HVUA 4XFDA 2Y1LA 3FJYA 3ZUGA 1ONSA 3NJ8A 4J2HA 1AOXA 3THSA 2BEWA 2XQIA 4A8HA 3R6WA 4HVLA 2B5WA 1B6TA 3VSCA 3A9TA 4X6YA 1L7BA 2QN1A 3F46A 4OHKA 1XYYA 2WB2A 3I62A 4GPTA 1PN3A 1YS6A 1ID1A 3BL6A 3HCFA 3N6XA 2NV2B 5HF5A 1DRWA 1GRCA 1NYTA 1L7OA 2AEJA 4OXIA 4UMVA 4AB1A 3I9OA 4MKXA 4TRRA 1JLLB 1I01A 5I51A 2AOTA 1IEQA 2ZWAA 1X7WA 1E1KA 2R6FA 3DTNA 3H3JA 2Z0MA 4BX2A 5DTMA 4XEUA 1QV7A 4Q4LA 1MQ8B 3F7OA 4JIGA 1C5KA 2WUVA 2OAEA 1SBIA 4PZ0A 3O84A 2ZQZA 3HM9A 5H3LA 4LTNA 4BASA 3KYCA 1PCXA 1XV5A 3QNMA 4QARA 4BKRA 3N7UA 1ZU4A 5F4ZA 4F71A 2P8JA 2FLKA 5CYPA 3MWYW 2I5PO 1IJBA 1I7LA 2M6SA 4ZEMA 3TUZC 1AZTA 3PFIA 4UD2A 4TTVA 3PXXA 1BGXT 3VPCA 1I3KA 2AJ8A 3W8NA 4AO8A 4C21A 4DVJA 1T2AA 1JQ3A 4K8RB 5JI2E 3L6OO 1Y8RB 3IOYA 3PUHA 3HLKA 5EJ8A 1D8TA 2HHAA 3UMMA 3WWYA 5BYKA 1DEAA 4I4TA 4NI5A 3IDAA 2PGDA 4RJ2A 4FFSA 5DASA 4ENUA 4YQFA 5E3JA 5KO2A 4I1UA 3LFHA 4CLOB 1K7EB 4OL0A 4BGIA 5KI6A 1EHYA 3R74A 1L7NA 3AF1A 3TW4A 3UJ9A 1G7CA 1U9ZA 1I2AA 2C57A 2HF2A 4I6EA 4RY2A 1RPTA 1H6CA 3AR2A 3NATA 3B9RA 3PT9A 1JNYA 1I1HA 4WCVA 2PLWA 2YRXA 3BGVA 3R8XA 1W4CA 2IOHA 4N6GA 5JYDA 3KR9A 4M37A 3QEOA 4UUOA 4EP1A 2ODNA 5KAPA 3WHKA 1LDMA 1H9AA 3I4CA 4HDKB 4DSZA 1JBKA 3O03A 3C7KA 2DQYA 4GVXA 3RSCA 1GTL1 3V8VA 3Q3VA 1JR6A 2VP0A 2H2GA 1V6SA 3CUSA 3INNA 2F64A 1A9OA 2ZBDA 2I4IA 3OF5A 3EIUA 1M2NA 3UJ7A 3RHSA 1SC4A 3W04A 1P7WA 2UUCB 3R0XA 2QUBA 3AFHA 1NVBA 3MTQA 1A2BA 1W73A 1NVUQ 4L9RA 1D9ZA 4B3XA 3D6NB 4JKYA 2MT9A 4C7JA 1XLUA 3ABRB 3LIPA 3D31A 3HYCA 3M83A 3R09A 1MOQA 5ES4B 2G4LA 1V2GA 1ZD3A 3EHDA 1RHKA 5C52B 1T25A 4ER5A 4R83A 4CF7A 1IOVA 4E31A 4Z51A 4D8VA 4HEJA 1GD1O 5HJ2A 3D43A 4N03A 1IHDA 4HYQA 4KI7A 4MRMB 4XJVA 1NL3A 5DTQA 1WU7A 1I51A 3LNCA 3TX2A 1CR2A 5HQTA 1TD1A 4Y2JA 4EX6A 4NAHA 4WZ6A 4QFMA 3D4OA 4G97A 2OESA 3EARA 4A0RA 3Q9NA 1PJQA 3UFXA 1SBCA 1VJCA 1R5JA 1RVDA 2C8KA 4RPCA 4TKVA 2PBZA 4JSRA 4LW8A 4WV3A 2C9DA 2CNOA 2I4TA 3Q41A 3TZLA 3L6RA 2H2AA 3Q2IA 1Q17A 3HJAA 4TYYA 3PVZA 5HCNA 1CEYA 2DP4E 3LUJA 5B1IA 4X8LA 1WMBA 3A05A 2I9KA 4EGJA 1BEUB 1G8GA 2D8MA 1BCRA 3GJ5A 4RTSA 2UZAA 2YZ7A 4LVOA 5FCDA 4BZPA 5BUQA 5AW1A 1I4LD 4HDMB 4G4IA 4PHTA 3VJMA 1IZ8A 2E89A 2QX8A 5CUQA 2ZGVA 3G59A 1VMAA 3PPWA 4GI5A 3WFJA 5K7SA 5EFOA 1N5OX 3I01M 1F8YA 4LDNA 1YS9A 2E82A 2BDTA 5F52A 1S3GA 5F4BA 2W22A 4C2AA 3TGPA 4XZ3A 3B6ZA 3R0IA 3QFTA 3LHIA 4CCSA 3KJEA 1JGTA 1OF1A 2D1TA 1M1YE 3QE3A 1ADGA 1MJ5A 4HMPA 5GPBA 1OGJA 2X2FA 1QH0A 4U2DA 4F9FA 4JLMA 4V2UA 4E6PA 3IBFA 4MV4A 1FF9A 3G7NA 4DTIA 2QM0A 4RJIA 5THQA 3KHUA 4Q01A 1CFJA 3CTMA 3QQPA 1BDIA