4UUQA

Crystal structure of human mono-glyceride lipase in complex with sar127303
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective Blockade of the Hydrolysis of the Endocannabinoid 2-Arachidonoylglycerol Impairs Learning and Memory Performance While Producing Antinociceptive Activity in Rodents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MONOGLYCERIDE LIPASE
total genus 107
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uuqA00
1D07A 1DX6A 4MQLA 5CT4A 1QO7A 4I3FA 1GQRA 5AIAA 3M81A 3FYUC 3HJUA 5AO9A 3SK0A 4BVKA 5AKEA 1EK1A 2RHWA 1YCDA 2VAVA 2CEKA 1ORWA 5T4BA 3R40A 1E8MA 5JIBA 1P0PA 5SYMA 1P0QA 4GW3A 2CJPA 4U2EA 3H17A 2GZSA 3LIPA 5AKXA 1GKKA 2G5TA 2Z8XA 2BGNA 4M0MA 1CUJA 1QO9A 2WIKA 3AILA 5KWIA 2XQGA 3VJMA 5C7YA 4MJ3A 1W6RA 4BCBA 3VXKA 2JF0A 5HK9A 5CW2A 2XMSA 5ALVA 1EVQA 3DJYA 3MUNA 1ZIXA 3O0DA 1EDEA 4TVKA 3WJ1A 5JASA 4B80A 1VKHA 2QVBA 4BAGA 2Y1KA 2VEOA 1CLEA 2PSEA 3H2KA 5AM2A 3AIOA 1S8OA 5HKAA 2QOEA 4C01A 4P08A 5KBYA 4G5XA 4H7EA 2XUKA 4G8DA 3O95A 3BF7A 3IVMA 2JGFA 5FP0A 1GXSA 1XZLA 4X95A 4BTVA 1UOPA 4G9GA 4CCWA 2B4KA 4OB7A 4B9AA 3R0VA 1O6GA 4WY8A 1QIHA 4X71A 2WFLB 5CT9A 3P2MA 1LZLA 1B6GA 4ETWA 2YH2A 5ALKA 1E8DA 2XQJA 1FJ2A 5EHXA 3G0CA 3KSRA 4EHBA 3AZOA 4K5QA 4E46A 4B7ZA 3FYUB 3I2JA 3E3AA 1CUXA 1QJ4A 4OYYA 3F8SA 4GHWA 4BDSA 2QZPA 1K5PA 1EINA 3H1BA 3GFFA 3AIKA 5HFAA 3B12A 4GEGA 1WB4A 4X00A 5AI0A 3EIOA 3B3QA 3NWOA 4GECA 4C87A 1W4LA 1QFMA 4X7BA 3CCCA 1EDBA 4AZ3A 5ALUA 2RHTA 3CN7A 5H3HA 2VT6A 5JARA 2XUOA 1N5MA 1N5RA 1EVEA 3W9UA 3F98A 4WJLA 4YASA 1O6FA 2J3QA 2GYWA 2EEPA 5D3ZA 2PU5A 4UBJA 1QONA 3TEJA 4KRYA 3U0VA 5I8PA 4QE3A 4Y9SA 4Y2XA 5AP9A 2PKYX 5LZ8A 3ESCA 2VJBA 1UZAA 4BP9A 3H2HA 2RAUA 3BIWA 4B84A 2QUAA 3I1IA 5AK6A 3FSGA 4BRZA 1CUYA 2XUAA 1SCKA 1XZDA 1J1IA 3D3NA 3O4GA 4J0IA 1IZ8A 3NOXA 4J03A 2XI4A 1TKRA 4EUSA 1ZD4A 1A8SA 5EIHA 2G63A 2VTVA 1HKHA 3WK9A 2JGMA 3HZOA 2JEYA 3AZQA 5HZGA 1LLFA 3G8YA 4M0FA 1NX9A 3D2AA 5LP1A 4IO0A 3STVA 2OQIA 2DR0A 3DD5A 3G0GA 3SC2A 2XUGA 2C58A 4C4YA 1SC9A 5A7FA 5LZ2A 1FFCA 2XUJA 5K3EA 1UXOA 2RI6A 2XT0A 1XZIA 5AM4A 3VJKA 1ZGBA 2XUFA 1CUGA 3FCYA 4WFJA 1Q0ZA 2OXEA 4OYLA 1XZKA 2WTMA 3ESDA 2DSNA 2C0PA 1EX9A 3QH4A 1UKCA 1Y7IA 4AXBA 2XMBA 2C5FA 2IIVA 1ZI9A 5BOVA 3FCXA 4EY7A 2JGIA 3D2BA 5A7GA 1P0IA 3D59A 1OCEA 4QWMA 1YAJA 1AMNA 4H7KA 3IA2A 2WSLA 2ZSIA 5LLSA 3AIMA 4Y2PA 2OAGA 3JWEA 3AZPA 2H7CA 4HZGA 4E11A 1LBSA 3I6YA 1DX4A 3WKAA 3WZLA 1VXOA 1MJ5A 4H7HA 3DL7A 5IH7A 3DOHA 3AJAA 2PSJA 1XZAA 3STXA 2C7BA 4GWLA 3VJLA 1LPMA 1DWPA 1HLGA 1ZGCA 2ZYRA 1GQSA 1T2NA 3ANTA 4LXGA 5AH0A 3S2ZA 1B41A 3I1YA 1XFDA 4KE9A 3GROA 4Y2VA 5DJ5A 5DNVA 2V98A 3ICWA 1BRTA 2V9ZA 2O2HA 3WWCA 1DTEA 1SOMA 1TAHA 1L7RA 3O9VA 4AO8A 1HQDA 1H2XA 1M33A 2YXPX 4UBNA 1LPNA 2W22A 2WG2A 4AO6A 3FLAA 1WCYA 5ALDA 3FNBA 4FHZA 5ALGA 4L0CA 2R8BA 2O2GA 3WK4A 2O7RA 1VOTA 3IIIA 1WM1A 4RPCA 1RP1A 1K4YA 4CCYB 2XE4A 2XQFA 3B5EA 3HLKA 3JYHA 3ZWQA 1U8EA 4FFVA 2I3ZA 5C8VA 2PSDA 3G9TA 3C5VA 3C6YA 2R11A 2WIFA 1CUWA 3HXKA 2OCKA 4BAZA 3WK5A 3QM1A 4NZZA 1IUPA 1A8QA 1THGA 4XWGA 2I03A 3RKSA 1UFOA 3QMMA 2GBFA 2WQZA 4BCDA 4FWBA 3DYIA 4BAUA 3WIBA 2GZRA 5ALTA 5I7UA 4FBMA 2DFPA 2ECFA 4Q05A 3G0DA 1XQYA 1HDEA 4IQ4A 3FOBA 3IB3A 1R4ZA 4DSZA 1QGED 2QJRA 2VF2A 3KD2A 5LYYA 3M83A 4LYEA 3A70A 4PSDA 3PFCA 5K5EA 5JANA 3FYTA 1TK3A 2JGKA 4BZWA 1EB9A 4OD0A 2XLBA 1G66A 4D9JA 1CFJA 4LHEA 4RE5A 5CTAA 3GUUA 5A62A 4W1SA 2OGTA 2WFLA 1CUBA 4BE9A 2WU4A 3WL5A 7YASA 1XKTA 5KREA 5DYWA 2O7VA 1AZWA 2ZYSA 3AINA 5JAUA 2JBWA 3CXUA 5AM5A 5CXUA 4INZA 4LXIA 3H2GA 4B81A 4BE4A 4W1PA 1ETHA 1JJFA 3MGAA 2VJCA 5BWBA 4EY6A 1BROA 4DYHA 4KRXA 5JAHA 1UKBA 3WWEA 4MYSA 2VATA 4E15A 2HRQA 1LPPA 5K3FB 4IH1A 5CBKA 4DLNA 4X94A 1DWOA 3A2LA 1DQZA 2W6CX 5JD4A 2GBIA 1QE3A 5A2GA 3O4IA 4WDQA 2HFKA 4XVCA 4HRXA 3W2TA 1ZOIA 1SCQA 5AKYA 4AMYA 3STTA 1WPRA 2YYSA 4B6GA 4Q3LA 1CRLA 2DQZA 2VQ6A 1H23A 3WI7A 2Y2VA 4OSEA 4ZI5A 3WQHA 1H2YA 2HU5A 1F0PA 1VLQA 4H7IA 2Z3WA 1RWQA 2B20A 4JNCA 1EB8A 3STWA 3DOIA 3C6XA 1JU4A 4DSAA 1H2WA 2VSQA 4WY5A 4J3JA 4U2CA 5K3BA 2PL5A 4FLEA 5FLKA 3QVMA 5EGNA 5JD6A 5DYYA 3STUA 4DMHA 4AB1A 4LXHA 1OILA 3E4DA 5AK5A 4L3WA 1CV2A 3CN9A 4G4JA 4FKBA 1KEZA 3BF8A 4PQEA 4DMKA 1CUIA 3G9UA 2CB9A 3G0BA 1TRHA 2HA3A 2Y6VA 5CT8A 1GPKA 2OQVA 4X90A 3BDVA 5A7HA 4J0KA 1FFDA 3M3DA 1OXMA 3I2GA 1UKAA 4ZWNA 2HA2A 4PSUA 2BKLA 1ORVA 4MEBA 3TRDA 4CIBA 1MX9A 5JZSA 1P0MA 4G8CA 2P8SA 5JZBA 3OURA 1IUOA 3LP5A 3L1JA 4QDXA 4QWWA 2AJDA 3R3YA 2HADA 5T4EA 2FUKA 3C87A 2H7XA 5ALYA 2XUIA 2JEZA 4DM7A 1IMJA 3E1GA 5AI8A 1ODSA 1ZIYA 3IUMA 4J0GA 4HVTA 3Q8WA 1VA4A 3GA7A 5A71A 3R3UA 5E2IA 4Q82A 3WWPA 1QLWA 1J07A 3WYNA 2YASA 4EY5A 5AM1A 2RGUA 1VA5A 5ALXA 1AGYA 5AKGA 5HF6A 4I19A 1E5TA 1R88A 4U2DA 1W76A 1LPBB 4DMCA 2PVSA 6YASA 5ALMA 3V1KA 5ALRA 1LPSA 1XRPA 3ICVA 3QZUA 1DWQA 1TIBA 1SCIA 3ZV7A 3PDCA 4WFKA 4BYMA 1CVLA 3KOOA 3DS8A 3UUFA 2G5PA 3HI4A 1JMKC 1R3DA 1XQWA 4PNZA 2Y2UA 1MAAA 5AI6A 2ONCA 2GYUA 2VT7A 3M82A 2C0QA 3GBSA 5AKKA 2ZYIA 3ESBA 1CUSA 1THTA 1LZKA 4MYDA 4B83A 3DYVA 3I6ZA 4NVRA 2WHPA 3UMJA 1QIKA 2WG1A 1XZFA 1BU8A 1TCCA 4PO3X 4Q1VA 5K3AA 3EQ9A 3ESAA 4UBIA 4I4CA 1XLWA 1Y37A 4HS9A 2X5XA 4XIIA 5HK8A 4Z49A 2ACEA 2XUDA 1XRNA 5ALOA 2WJ4A 3VKFA 3GZJA 1U65A 3WKBA 5D6OA 1MX5A 3A2MA 1LBTA 5AJHA 4CCYA 3H2JA 3QITA 4OB6A 3KWFA 4W63A 5ISMA 3ZI7A 4BATA 1F6WA 1MT3A 2WUEA 4UFOA 1CEXA 3C8DA 4J0JA 2WIJA 2BCEA 1N1MA 4G4GA 2DHDA 2HA6A 2RONA 4HTAA 5LZ7A 3IDAA 3PUIA 4UHHA 1QIEA 5JAPA 2JIDA 4U2BA 2PUHA 4X85A 1RYYA 4YK7A 1WB5A 2HHAA 2WIGA 5FOQA 2BGRA 4DMFA 4FMPA 1PJAA 5DWDA 3W05A 4H7DA 4ARBA 1CUFA 4BVLA 1PFQA 4C89A 2H9YA 3O4HA 2OAEA 1ODCA 1YA8A 4QZVA 5DTIA 3H0CA 5LZ4A 3C8HA 4GLBA 3F96A 4ROTA 5EIAA 3RK4A 2VAXA 4GDMA 3WIOA 1ZD2P 1YB6A 2XB6A 4J0DA 2WTNA 1XRMA 3H2IA 1LPOA 4W9RA 3IULA 4OU4A 4G4IA 4BB0A 3D0KA 1A8UA 3QYJA 2NW6A 2OGZA 2XMRA 1SFRA 2QKYA 3WKEA 1Q84A 1VZ3A 4H7JA 4KAAA 4X3CA 5CXXA 2ZSHA 5IVHA 3W06A 4ZV7A 4CFSA 1XQVA 2JGJA 4DGQA 1BN7A 2V96A 2PPLA 1DU4A 3EQ7A 4G9EA 4MWTA 4GI1A 2BUAA 1WHSA 1XROA 1JT2A 3K9BA 2HDWA 4DNPA 1JFRA 1A7UA 4IH9A 4F60A 5E4TA 1GPNA 1BE0A 1CUDA 1R9NA 4KACA 1QIMA 1C7IA 2I78A 1FFAA 5JATA 2DCMA 4RE6A 2XQIA 3HC7A 5AIBA 5ALWA 5K3FA 4NMWA 1XQXA 2PX6A 2WM2A 4TPKA 1XLUA 2AJBA 3C5WP 1XZMA 1VE7A 3KDAA 2OPHA 2DHEA 1HBJA 4AX4A 2WHRA 4Y2YA 3S8YA 1ODTC 3L1IA 4UBOA 1UK6A 4S0XA 4N5HX 4QDZA 4PF1A 2PM8A 3HRHA 1XZGA 4MQMA 4FBLA 2PBLA 4QA9A 5AI5A 2HA7A 3L1HA 1MO2A 4Q3OA 2OCIA 4F5ZA 1W52X 1CUHA 1R50A 5AKLA 2QXTA 3KXPA 3QMVA 3DEAA 4JEIA 4OU5A 4N8EA 1AUOA 4JUIA 4LIPD 5CT6A 2QM0A 5DNWA 3QBJA 3DKRA 2XMGA 5A6VA 5FPQA 1EDDA 2Q0XA 1LPAB 2QR5A 5K3DA 2J3DA 2AJLI 4DNQA 2CMFA 5SYNA 5AKZA 2AXEA 3OG9A 4BTLA 5E4JA 1GT6A 4B0PA 2HIHA 5ALZA 2WFMA 1ISPA 4JYPA 2Y6UA 4K2AA 2EDCA 4ZRDA 1XRLA 3R41A 2Z3ZA 4A23A 1GGVA 3QPCA 1XZCA 4XJVA 1X70A 3F67A 2WG0A 3BIXA 3WYDA 5ALHA 2ORYA 4B9EA 5FV4A 2HM7A 2XDWA 2Z5GA 3I2KA 4FLMA 1Q0RA 4F0JA 4AMZA 5BV7A 4F21A 4CI9A 2VJAA 4UBMA 3I2HA 3HSSA 1AKNA 3EQ8A 4X6XA 3G9XA 2G4LA 5KWJA 3LCRA 4EB0A 1CQWA 3I2IA 1JMYA 4X6YA 3A6ZA 5HQ3A 1XRQA 4MEAA 5LZ9A 3WZMA 5FRDA 5ALSA 1UOQA 4AZ0A 4QLAA 4FLFA 3TJMA 2X76A 5IVDA 2XMDA 4DNFA 4QDUA 4H7FA 1ZJ5A 5ESRA 1H22A 3STYA 4FTWA 5JAOA 4Y2RA 3RARA 4CG1A 4K6GA 5IVKA 3HACA 3IUJA 5YASA 4Y7DA 2RIPA 5AK4A 2ZJFA 4Y2JA 2C5GA 1BEZA 4PSCA 4BC0A 4BZZA 3JW8A 2QUBA 3WL8A 1AX9A 2WU3A 2CZQA 1TCAA 3X3HA 1QZ3A 4Y2UA 2HRRA 1G4HA 2O2IA 5AK3A 2PSFA 3G7NA 1E89A 4KR0A 5ALJA 1NU6A 4J0HA 1MN6A 1FSSA 1UT6A 4YPVA 1QIFA 2J4CA 5AICA 2B9VA 3ANSA 1XKLA 1QOZA 1BEEA 2XUHA 1EI9A 3T52A 1BCSA 4KAJA 4KE6A 4UFPA 3G9ZA 3D7RA 3WA7A 5HCUA 1CUCA 3TGLA 4EY8A 1J2EA 1A88A 2BUCA 3PFBA 1VZ2A 5AI9A 2XMZA 4AQDA 1EHYA 2AJCA 1CUZA 3FLEA 4FNMA 4C4XA 5ALNA 4PV7A 2GBCA 4KYVA 1GKLA 4ITVA 5FKJA 4HAIA 4BDTA 2QS9A 3FYUA 4WDRA 4B85A 2Z8ZA 4AN0A 3R3VA 1ACLA 5T4HA 2WUGA 2ZYHA 4B0OA 3WL7A 1DQYA 1QIIA 1QIGA 2OGSA 4J0CA 1QTRA 1XZHA 4CIAA 1UWCA 1MAHA 3I6MA 3BXPA 1WPXA 5FPPA 3BJMA 1LGYA 4UHFA 1XLVA 4L72A 5E4YA 5J3JA 1FFBA 5ALIA 2QRUA 4W1QA 4B82A 5ALFA 1CUAA 4Y2TA 3T4UA 4EBBA 1Z68A 1MNAA 4UHEA 2GBGA 2IITA 5CT5A 5EFZA 1USWA 2FJ0A 5LIPA 1ZD3A 1GPLA 1U4NA 3H19A 4Y2QA 4MXDA 4C6HA 2CUTA 4UUQA 5CURA 4HXEB 4RGYA 1ACJA 3QMWA 4X91A 1UK7A 3EBLA 2BUBA 3ZLTA 2AJ8A 1C4XA 1FFEA 4N5IX 1AC5A 3HYSA 5ALQA 3OOSA 3C70A 3FLBA 4H0CA 4TGLA 5JZ9A 2GYVA 3V9AA 5AKIA 1R9MA 1BCRA 4AO7A 3BJRA 1HPLA 3IUQA 3V1MA 2ES4A 3V48A 3DDUA 3O4JA 5I9IA 4E14A 3A2NA 3R3ZA 1CUVA 4IH4A 2XMCA 1E8NA 4P9NA 2XLCA 3MUOA 5HKBA 4LKOA 4BVJA 4W1RA 2QJWA 5HF8A 1K8QA 2XUPA 5C8XA 5BWCA 1TQHA 4A16A 2WILA 2QMQA 3ZPXA 1JKMA 5CH5A 3QPDA 2OCLA 5AOBA 2BJHA 4EZIA 5FDFA 5EHNA 1EA5A 2ACKA 1C7JA 2WIDA 1YASA 1E3QA 2D5LA 4KAFA 4QLOA 2HA0A 3D4LA 4DNOA 3KWJA 3FWHA 3VVLA 1W75A 3D5EA 5DNUA 4EA6A 4OCZA 3W9BA 3AFIA 5C8ZA 2WUFA 3WMRA 1MU0A 3WK6A 4YX9A 4H35A 4OUKX 2QT9A 1EK2A 3OTQA 4P93A 3VVMA 3RLIA 2X8BA 3OC0A 1ZICA 3G02A 3I28A 2K2QB 2WHPB 3FAKA 1TCBA 3IURA 3K2IA 2H1IA 1IVYA 4BC1A 1H2ZA 2LIPA 4UBKA 1ZJ4A 1NU8A 3HABA 4ZV9A 3D2CA 5T4FA 4Q3KA 1BS9A 1DT5A 3U1TA 1CR6A 2QXUA 5IVIA 1L7AA 1CQZA 3WL6A 4HRYA 4QDOA 5D3KA 5D7BA 4KE7A 4HXFB 3ILSA 1AQLA 3BL8A 3H1AA 2ZVDA 3SX4A 4ARAA 2XUQA 2HFJA 4QNNA 3WK7A 2PUJA 4XX1A 4A5SA 3DKKA 4U2GA 1F0NA 3WWOA 1ZI6A 3WLAA 4UHDA 3BDIA 1QIDA 1CIJA 1X2EA 3R3WA 2EDAA 3WJ2A 2D0DA 1W1IA 3E0XA 2FX5A 3ZLVA 3AUKA 4H18A 2OG1A 3C43A 1MNQA 4Q34A 1YB7A 1KU6A 4GXNA 2HU7A 3OPMA 5HQ3B 3BWXA 4UPDA 2FJPA 3MVEA 3R3XA 4X6UA 3SWWA 4RNCA 4KJXA 2OCGA 4G8BA 1XZBA 3FBWA 3RM3A 5CMLA 3HEAA 1IUNA 3BE8A 2WFZA 2DHCA 5AM3A 3K6KA 1L7QA 1JJIA 1U2EA 4H77A 4BBZA 3FVRA 2WLSA 1XRRA 5HF9A 1MX1A 3LS2A 4J7AA 5C81A 3G0IA 1G5FA 1EH5A 4X93A 4X97A 5CH3A 1MPXA 1YS2X 5JALA 4U2FA 4M0EA 4WFIA 1T4MA 3WA6A 3DCNA 4LYDA 1QFSA 4UBLA 1QIJA 2JGLA 3UUEA 3DNMA 3WKCA 1E66A 1ZI8A 3F97A 3VISA 4DIUA 3Q0TA 1JU3A 2ZJ7A 3PI6A 2IX9A 4KEAA 3LIIA 4JH0A 3WKDA 4HXGA 4EY4A 1XZEA 3ED1A 3PICA 4GBGA 5ALLA 1QTIA 5JYCA 4N8SA 3F9CA 4FFWA 1J06A 5JD5A 5EI5A 3DLTA 3H04A 3PF9A 4QDTA 3NUZA 5CRIA 2B61A 5EHZA 3IBTA 1R1DA 2BAGA 5AKHA 1IZ7A 1UK9A 1YAHA 1X2BA 2JGEA 2WHQA 4V2IA 4C88A 4BP8A 1F8UA 4P92A 5F4ZA 4UHBA 1JI3A 5CH8A 5K3CA 5AOAA 3I2FA 3CCBA 4ZGBA 4N8DA 1DT3A 2ROQA 1YR2A 2HL6A 4O08A 5AOCA 4KE8A 4CG3A 1WB6A 5AI4A 3NGMA 4UHCA 4K6HA 5EIEA 2J4FA 4OB8A 1LNSA 4FDMA 1XZJA 3OM8A 3DQZA 4ZREA 1AURA 2WUDA 4AN1A 5IKXA 2XQKA 1HL7A 4DTCA 1K63A 5HFNA 1BN6A 2PU7A 1ZD5A 4JYMA 2WKWA 4FNGA 4G1FA 1CPYA 3N2ZB 3QPAA 5LZ5A 1EXWA 4X92A 2UZ0A 2HA4A 3V1LA 4L9AA 5JADA 5AM0A 1VXRA 3VDXA 3WK8A 3PF8A 3EF3A 2XMQA 3PE6A 1WHTA 5AHXA 5LKAA 1VE6A 3FVTA 3V1NA 3YASA 2WJ6A 1PV1A 1K6EA 1I6WA 4MWSA 2ZJ6A 1DINA 5DYTA 1YS1X 3WWDA 2QTBA 1Y7HA 3C6ZA 5HF5A 2OLEA 1KU0A 1YA4A 2CBGA 5DTJA 3FSGD 1G42A 1Q83A 4WCVA 4PW0A 4ZXFA 3LLCA 3N0TA 4UFNA 2BFNA 2WJ3A 1CUUA 1GZ7A 4CG2A 5EHQA 2DQYA 3DL4A 1N8SA 3C6BA 3H18A 4K6KA 2VJDA 5AKJA 2H7YA 1MTZA 1VJ5A 5LKRA 5FUMA 1WOMA 5DLPA 4IHAA 2HA5A 4Y2SA 5ALEA 3ZLUA 2PSHA 4C4ZA 4QEKA 1UOOA 2HU8A 4BCCA 1CUEA 2VA9A 3C45A 2C4HA 1UK8A 2V97A 3O9MA 4BRSA 2I3DA 3IUNA 1YSCA 3W04A 4OPMA 5ALPA 1JJBA 5FXMA 2CKMA 4NS4A 4FOLA 2E3JA 3GELA 3PUHA
chains in the Genus database with same CATH superfamily
1NIPA 1RKUA 2JAWA 4EF6A 5A5FA 5D3MB 1L0BA 4UOQA 2CL0X 4H4EA 1GQRA 3VX4A 1MFZA 4EQ6B 1IPHA 2IVZA 3ZCTA 1DAOA 3LRPA 1JQLB 2GKSA 2AKAB 3EEBA 3HCBA 4MQEA 4A2PA 5L3SB 1GARA 4C6TA 1G38A 4WZBA 3DOEA 1SWVA 2YHIB 1ZIPA 3C1AA 2X0EA 3MGBA 5IZ4A 4CT5A 5DWVA 3PIIA 2OFXA 2CEKA 4MULA 4RA9B 1ORWA 1R6VA 5BW6B 2C04A 2XXAA 2AD1A 2C3YA 1JHZA 3PPWA 2PN1A 3H2BA 4YDSA 5EPOA 1ZGJA 4XIJA 3ZWWA 4CMCA 2YYYA 1P0QA 1PFVA 1WCIA 4BO2A 4URXR 2L18A 3MB5A 5B7QA 3D6MA 3FPFA 3HB7A 2ZUBA 4PWYA 2JCGA 4IICA 1ISIA 2IYAA 1X39A 3LRXA 4OJYA 2GCGA 3TI9A 2GZSA 2A0UA 4E7PA 2IOHA 3SVLA 2HLNA 2PWAA 1T5BA 1AZTA 2O6HA 1DS6A 5BT9A 3U7HB 3H5VA 4KO8A 1X7ZB 2Z8XA 4CI0B 4C0XA 4M0MA 1VL6A 2JDIA 4E6EA 4RVCA 3EDYA 4TS9A 1CUJA 2BVNA 1E63A 1DBWA 1A04A 1DO8A 1K06A 2XVZA 3ZR4B 2GPYA 2PH3A 3ZK9A 3AILA 5IKEA 3ZU4A 4BO0A 2C4NA 1XVIA 2N3ZA 3VJMA 1JIIA 2IV7A 3CLKA 1VI5A 3VR3D 4FOSA 1G3UA 3KBOA 2OG2A 4OI4A 1E2LA 1RQPA 2DVMA 1U3TA 1UBOS 2XNJA 2JF0A 1DQNA 1SJ9A 1ZK4A 2A1IA 2A9JA 2QAIA 1ONPA 5IULC 2ZJ0A 1PT5A 1RKXA 1COWA 2I66A 4M8NE 1XL1A 2FZGA 3AEZA 3PNQA 3OT1A 2IODA 5EJ8A 3KUKA 4DUYB 2Z3VA 3K1AA 4DF3A 1L5OA 2DUJA 5HKLA 1B2RA 2ZAOA 3OMLA 3GFTA 3SKVA 1MA0A 3UWPA 4IIUA 4Q4JA 4D7AA 4TVKA 1QFXA 4DG5A 3H5WA 2ZXEA 4K3UA 2BFAA 1MB0A 2E4WA 3WJ1A 3L5KA 2WV9A 5JASA 3GJ7A 2BI7A 2BSXA 4DIDA 3GZNB 3W7VA 1ODFA 4LFAB 3P45A 6ABPA 5BN3A 1QGDA 3S68A 1PQPA 1RAEA 3GJ5A 3H0KA 3DF9A 1E3WA 2P1ZA 1BVRA 2X19A 1PK7A 4QSHA 1N7IA 2J3HA 3Q5EA 1SXPA 2O5EA 2XCRB 5DLQC 5K01A 1X1CA 3AHFA 5U1PA 2GS9A 5KS2A 2DAPA 4QRDA 4XE5A 2WJGA 4ER0A 3M49A 3AIOA 1EM8B 1KFKB 3KX2A 3WDMA 4C1NA 5KMGB 4ALMA 5C51B 2D1SA 2I4TA 2C1XA 3DDSA 3EMDA 3KZNA 4KLNA 3K9HA 4LWZA 4AWXA 4GMXA 1XPRA 3MHTA 3H3JA 4H7EA 1VBNA 1R9JA 2QORA 2Q7DA 3V55A 1UDXA 1NQ5A 3BRSA 4MB0A 3VA7A 2D7DA 4LF5B 1VYUA 5BP7A 2BPOA 1YBHA 2WD8A 2QX6A 3A3KA 1OLSB 4Y98A 1A8PA 1XZLA 2WMOB 2Y1XA 4Z4HA 3DO8A 5LQUA 2QTNA 3KC2A 2B4KA 2HLDA 4OB7A 3H8JA 1D7AA 3GAMA 3UA4A 4MRAA 1UCFA 5H80A 1CNEA 3T3NA 4GGMX 1QIHA 2WFLB 1SBZA 4ON9A 1CEQA 1B6GA 2AR0A 1Z5ZA 2WLTA 3HGTA 4ETWA 4FGJA 5CVTA 1JSZA 1JECA 2Z5FA 3I8XA 2C3OA 3JQ8A 2PL1A 4E03A 3KQMA 3T9CA 4F6RB 1PR5A 5BNIA 3PT9A 5C3UA 1W0KD 1T6BY 2Y92A 2OAQ1 3BMNB 5B3JA 4XCXA 3RVLA 3AEQA 3G0CA 1F8FA 3R7AA 4EHBA 2J3KA 3GQVA 4CKZA 1QB8A 1WX1A 4BQOA 4YXWA 1TM4E 4LZAA 3NKFA 2BN4A 1V45E 1BDHA 2X1VA 4GI5A 4UULA 3JZIA 1QKJA 4K6OA 4NBKA 1YKSA 1ILWA 1JA9A 4RQBA 2WOJA 3L6OO 3AUAA 1Z37A 2Q0HA 2HJ9A 3PYXA 4IW3B 5FNZA 4AJEA 1WIWA 2IGTA 4DSOA 3RBVA 1GIAA 2WA1A 5FUYA 3C8ZA 4X8MA 5THKA 5FQNA 5KKAA 3THOA 3VYRB 1XPUA 1Y9DA 1UBHS 5F5NA 2ZWVA 3RU7A 4R1LA 3QEMA 1CU1A 1XSEA 2NN3C 2YZNA 5LCXA 3C2QA 1IK4A 3QF4B 1E0AA 4MKZA 3S7TA 5DW0A 3EIOA 3KQQA 1IIBA 2IU6A 4QGBA 3T15A 3TI7A 2QSYA 3ZGVA 5A4JA 3PE3A 1J0XO 3AKCA 1N2OA 1T3SA 3JD3A 4TZKA 5CYPA 5KTYA 1VGRA 1M1YA 4BMPB 4C87A 1EUQA 1KNXA 1R0YA 1LSOA 3PGLA 4XPZA 1CRZA 4GX5A 1CHNA 2I7VA 4PZUA 4KFTA 3B53X 4CQMB 5BURA 1RAHA 4K1LA 5A3RA 5AVRA 2PGDA 1XEWX 5BVHB 3SQLA 2YZGA 5K8LA 3BRWA 1QFJA 2FHSA 3EXFA 3NGLA 2FH5B 1DQRA 4YRMA 2IYNA 3OP4A 2QRGA 1EJ6A 3DDOA 4IF6A 4IV0A 3ZZ0A 3OCYA 2CXOA 1QF7A 1UPFA 4OJNA 5TRTA 2PEZA 1SQFA 5BQFA 4EYKA 2YX1A 1JA0A 1HT0A 2O5VA 4QHYA 1N5RA 2KBEA 3NCTA 3TLCA 1N2SA 1SHKA 1J9GA 4GOKA 4PYLA 4OQFA 4RXTA 3SQOA 4E7OA 2CNKA 1OROA 5TY0A 4ZALA 3U60B 2UKDA 5CFZA 3KZCA 3BD6A 3DZGA 2P6NA 2Z2ZA 3TE7A 2FW1A 2X4GA 5FIUA 4V1CA 4FKZA 2J0SA 1XYGA 4KN5A 4AIRA 4HB0A 2Q9CA 2ZR8A 2GYWA 4NU6A 5LMUB 2HQBA 3L4SO 3MHPA 4RWEA 3R7NA 1LDYA 4CKWA 2JFHA 2EEPA 3L8DA 3Q9NA 4NABA 1Z56C 3P7MA 5FCDA 5ARBA 1MOPA 4O59O 1RXIA 4PC3A 1QONA 2EJTA 4HWTA 4PZPA 3G2QA 4ZOBA 1K2WA 4NZ9A 4KRYA 5H59A 3N2NA 5KCMA 2NUTA 3AF2A 3SJ7A 3U0VA 3UGTA 5CCXA 3E5HA 1WXIA 3PR1A 4P2GA 3I9JA 1KAGA 4MLDA 1JBEA 3O73A 3PC6A 2ONJA 5AP9A 4QQRA 4CMKA 1IEVA 1O95D 3ESCA 3ODGA 1AIPA 3PT5A 5ITWA 2EARA 5H82A 1NFFA 4IMIB 4MS4A 1W36B 4N48A 3I9NA 3GA5A 5DCYA 3AEXA 3EXHB 5JE8A 3GDFA 2J7PA 1GPBA 5J1SB 1DWUA 1W4ZA 2BFEA 1QGOA 2NQTA 2VHZA 2Z09A 3PHHA 1U81A 1WUKS 4J1QA 4B84A 4ZDIA 1QP7A 5COBA 3D4NA 4E5KA 2HZBA 3LUKA 1B4DA 3P4UA 5I5EA 1I36A 1YE5A 3SHTA 3ORHA 3B3JA 1QUEA 2ZRDA 3SC2B 4M1QA 1UC8A 2CDNA 1MHPA 5IS2A 2Q5LA 2XUAA 3UK7A 4LWPA 4EEXA 3WGJA 1SCKA 2AYYA 3OCJA 3TDKA 2BGMA 3EXIA 2NUAA 3FUUA 2AK3A 3B7GA 3BPSA 3RC7A 1C9EA 3RSLA 3AHIA 3O4GA 2NPIA 1C9DB 1ZOLA 2IWHA 2J33A 3C5HA 5AXAA 4Z7JA 3QFSA 4LZZA 3L01A 4OFBA 2DCUA 1BHSA 1XP8A 2XCQA 2C9BA 5LPNA 4H9GA 2FMKA 4MUEA 4TKVB 5CGZA 3DEZA 4I5DA 2VTVA 4JT8A 4RORA 1EAYA 3KFVA 3SM9A 4YIHA 4JOCA 4UDNA 5IFLA 2IYTA 5IT0A 2JGMA 5AXBA 4BB6A 1PX0A 4C4AA 4CMEC 4FR2A 4TS1A 4UNSA 2IHJA 4OHXA 3LBYA 3LHFA 2OO7A 1VSVA 2CN1A 1KQFA 3IEVA 3FOCA 1IXKA 3GJ8A 4RJLA 4EG1A 3NBUA 3PC3A 3WLFA 3REQB 1CIPA 4FC6A 3N6XA 3ZWVA 1YZVA 1E9BA 2AMYA 1AKEA 1WPQA 3D2AA 3A1DA 3H97A 3P8ZA 2ZRJA 5C5CA 1P4RA 2VWPA 2IXBA 1RD4A 4W8OA 2JLCA 5LU8A 2IS2A 2YXEA 4DZZA 5CLFA 1E1NA 4JP2A 4YO7A 1N2XA 2DE0X 4AAYA 3MTBA 2WYWA 4ZO9A 5HA5A 3GLHA 1WKVA 3JCZA 5KOJB 3HN7A 2XUJA 3H5AA 2JGDA 4IIFA 5K3EA 3JWHA 1UXOA 3QEAZ 1TFRA 4KNYA 3GRCA 3JVDA 4AECA 4H59A 5AM4A 1A8HA 3PGXA 5KQLA 3PUJA 4GUDA 3UJ8A 1K4MA 3AW9A 5F7OA 4Z0HO 1AGRA 4MGYR 1GYPA 4RVFA 3AU8A 2A5YB 2V6JA 3IB6A 4CMHA 1WETA 3CX4A 3ESDA 2DR2A 1NPDA 3UPDA 4GRDA 1L7XA 2C0PA 5MDHA 3Q4GA 2YIJA 1ZSYA 5FLXA 1K6XA 3NFYA 3HRIA 2C8KA 4GM0A 4B6FA 3BB1A 2XMBA 4J9VA 3V8MA 1VIDA 1FYEA 4NBRA 4X1KB 1Z5PA 3GI1A 1XDWA 2XAUA 1PCXA 4E08A 1CR1A 4RD2A 1T8RA 3X1XA 2O8FB 2IIVA 1VL8A 1ZI9A 1AHPA 1WEKA 3SJUA 3EISA 2O8BA 2Q5HA 3TB6A 4EI2A 2FR8C 4G5OA 2OHFA 1ID8A 1F5NA 1D8AA 1T5LA 3TG2A 2JGIA 4RIEA 2RGRA 4RK5A 1P0IA 3M9WA 1GRQA 2PWBA 1GZSA 4O3MA 4LS3A 4CDMA 3D6NB 4AJNA 4G1EB 4OI0A 1C9NA 1DPFA 1OVMA 3CZPA 4IOKA 3T9AA 2M32A 3UANA 4NBSA 3RVBA 2WSLA 3V8QA 3WNZA 1M1NB 2I2FA 4YRRA 1R5JA 4BECA 1Y63A 4DWJA 3ESRA 1TU4A 1FFXB 1J7JA 4LHYA 4CKBB 3MJFA 4NYIR 2Q41A 3SR4A 5IASA 1O0CA 1U8AA 3QVLA 4EO9A 1I6KA 3NXKA 4INJA 2H7CA 1U63A 2ZSUA 3MRVA 3S1AA 4QREA 4OGFA 1NN5A 2DM6A 3UJDA 2I4MA 4E11A 5LYJF 1EA7A 3L92A 5FO0A 2PWZA 1DX4A 1E62A 3A6LA 4MS1A 2J59A 3WSTA 3HB1A 3I9LA 3SN6A 1NJ6A 3FHCB 3MTAA 3IR6A 4TTRA 3MG9A 1O97D 1OASA 5LUBA 2XOXA 2JCBA 2VNKA 1ANKA 4IYJA 3AJAA 3RKUA 1R6UA 4DIKA 3ZTYA 1XZAA 5LP6F 4M54A 5JFGA 5B4TA 2OLJA 3GYGA 4GWLA 3DZDA 4UJ5A 1I4TD 3HA3A 3L0OA 3I3OA 1GZ5A 4JXKA 4YCAA 1LPMA 3E2MA 4KPUB 4L16A 1YR1A 4I4NA 2P11A 3TK1A 1ZGCA 4G86A 2ANBA 3OFNA 1ZK3A 2QP9X 1Q0QA 1D1SA 2BISA 4GPBA 4RJKA 4DLZA 4ER5A 3W7AA 4LXGA 4PZYA 4QARA 1RRFA 5K45A 1U31A 1B41A 1H2BA 2XKAA 1ECCA 3E3OA 1TQ2A 5DEIA 3RC9A 1ZAKA 2VAWA 4Y2VA 1PJBA 5DNVA 1W7AA 3M6VA 3DMYA 3ICWA 5CU7A 3RIMA 4ND4A 3U48A 4RD1A 2CLMB 2JCSA 2WJPA 2FFBA 3RVQA 4DCNA 3UPUA 1XMPA 3OZFA 1OU4A 2ACWA 4ETMA 2YFKA 1D2EA 4WH0A 4ER3A 5K3OA 4ND5A 4RKWA 5DHAA 2P5TB 1WMBA 2FUEA 4BJHB 5CAEA 1FMCA 4KXFB 1FPMA 1PW7A 1QE5A 1TAHA 1KERA 4NFSA 1P6UA 4D0LB 4HVLA 1Y48E 4LSWA 4AO8A 1IEQA 1X42A 3H9JA 3KSZO 2GARA 3L6EA 3UMYA 3CG4A 3U7IA 4EATA 1H2XA 1F20A 1K3TA 1NP3A 4WSOA 5I5GA 4AU1A 4D1YA 3PL1A 4UBNA 4EA7A 3R5JA 2W22A 5ADUS 3IUSA 1XELA 3LSYA 4IPTA 4FYIA 3SICE 3IEMA 4HJXA 4IINA 5ALDA 4XW2A 4OKIA 1KAQA 1C7EA 4COKA 1TZKA 3KG2A 1RWXA 1R5OA 4G5FA 3DWFA 1Y82A 4ZYZA 2AOXA 5GIPE 4KIJA 1QOPB 5KYGA 3KE9A 2GASA 1VOTA 2P6MA 1GKUB 2JLZA 3IIIA 2VCEA 4PLYA 4EDFA 3HKEA 1WMDA 1QM5A 3H42B 3UT5A 2C59A 1WM1A 4KKXB 2JZOA 1K4YA 4PFQA 1U4OA 4GOLD 5EZ5A 3TQCA 4CCYB 4DGSA 1FDWA 1D6SA 2Y9MB 4TUYB 1YWGO 1FVOA 5T5QA 3QQPA 1V3TA 4A4DA 1V9LA 4DCPA 1GPYA 2ZBEA 2GFHA 3WAJA 4QTZA 3W2IA 1ZS9A 3CUTA 2B7CA 4N6GA 4LOAA 2JPDA 3TVYA 3BKWA 2WJWA 2WY2D 4KMSA 3T06B 4CM8A 2IIPA 3G3EA 1KH2A 3K94A 2R84A 3C5VA 1B76A 4MVXA 4WXMA 4DBLC 4F3KA 2GTIA 1CUWA 2VP6A 2WNHA 3G9QA 5EIWA 3UK2A 3ZHUA 4DLLA 2OCKA 2VDVE 4FMBB 4YRFA 3VHXB 3WK5A 3LFTA 4IHJF 2RB4A 9LDTA 2HR1A 1XQ9A 2NO1A 2IYUA 1RXWA 1Y3BE 3QM1A 4D41A 4EJFA 1EZ1A 1RDFA 4NZZA 5ARDA 2UXCB 3OJFA 3TX6A 1S2DA 5IMBA 2PKQP 1QCYA 1TYDE 2R44A 3K8QA 3LMKA 3RI3A 2V9CA 2YNMD 4HDMB 4JT4A 4YC7A 2JARA 2HV8A 3KHUA 5EJEA 2AMJA 1L7VC 5FBLB 1VMIA 2GBFA 3S27A 3X1DA 1A7KA 1MF7A 2AZ4A 2HSWA 4MX8A 4HLQB 3J81A 4K8RB 2ZU6A 4RYLA 5ERGB 2O5RA 3PXBA 4WV3A 2VHJA 1GUAA 2V0CA 4PTLA 2GZRA 6REQA 2V59A 1U1DA 3H6GA 3EVEA 4H60A 5ALTA 2QNBA 4ZHQA 3ROPA 3IA7A 3WFJA 4BFYA 3BM5A 5B1HA 1M0TA 3G0DA 2DTDA 4FWTA 3FUCA 4PYRA 3H1TA 1XQYA 4NPHA 1LCIA 3ROTA 1BKSB 3AM1A 1ZU4A 2PMKA 1VLLA 3IO3A 4TVBA 5AW0A 4KQ1A 2R6JA 4XR9A 3LBFA 3HGMA 5JI3E 2W6IA 4DZTA 4NCAA 1QNFA 4YQEA 1M72A 2VCHA 2PCLA 4NE9A 4F8EA 3BVPA 3ETNA 1KSJA 2V7GA 1ULBA 2YCBA 1FSGA 2LVBA 2Y1CA 4IQ8A 4LYEA 2EIXA 4RW0A 3RIHA 1OLXB 3UUWA 1YJBA 2BWJA 2OCBA 3KWMA 3P4YA 3VR5H 5KTNA 4DXDA 2JGAA 1RMYA 3FYTA 2F67A 4M1WA 2OBBA 3D1LA 3GFVA 4FYYA 3PWSA 2RHRA 4ZOLF 2G9QA 5ELXA 2YIVX 3EVAA 3F5MA 2AXPA 4D26A 3PHCA 1A2BA 2IPAB 5DEOA 3OQHA 2PMWB 1T0PA 2QVLA 2PDAA 5EY5B 5M29A 1CFJA 4OA8A 2Z6AA 4DG8A 2JLBA 2VP5A 4JBWA 4DJFC 3HBFA 3ZE2B 5FOWA 1N1EA 1HDYA 4BFLA 2YR0A 3OQJA 4JLOA 3RVOA 1LLQA 2WU4A 4AQ7A 1KMNA 3RUPA 1XKTA 4MPPA 1PJ3A 2ERXA 2GHQA 1KI6A 3CLHA 5DYWA 1JH9A 3TH5A 3UY4A 2QZSA 3P5SA 3CXUA 4INZA 5F2OA 4BIIA 1XR3A 2XZLA 1A2KC 3C1OA 2FRDA 2GO7A 3OICA 1OJLA 5KOYA 2NZUG 3O6VA 2VJCA 4R1SA 1EFRA 1L8XA 5BWBA 5E8RA 4EY6A 3BRCA 5C18A 4Z1MA 4EDHA 3IP5A 5DLDA 4ALNA 5FFMA 1MVLA 2HSDA 1A5AB 4KR9A 4CMAA 1P9RA 3AVQA 4ZQGA 3T0IA 4DRXA 4KRXA 3T7RA 2FF7A 1QHEA 2J9FB 3T5TA 4UM5A 3U17A 5KTTA 3IJRA 2QPLA 5EKTA 3ZDXB 1TPYA 5AUNB 1QQ6A 4RF4A 2PR2A 3E5NA 2R4QA 4MYSA 1QWOA 1SRRA 1BCSB 2F1HA 1QCCA 5GPBA 5K3FB 5CBKA 1ZEJA 2XR1A 4XJXA 1RWMA 3FNFA 4X94A 4DVJA 3TFOA 1YS9A 3OMXA 2CDAA 3KDPA 3MWFA 1CQJB 4C21A 1K9VF 3C7DB 1UIRA 2G82A 4LZOA 2HYDA 1RM3A 1KO7A 2PQMA 1CVRA 5A2GA 5JJ5A 4WDQA 1U3WA 4WGFA 4F5DA 4QPNA 8MHTA 4L4XA 3EW9A 5FI5A 3FRHA 1XZ8A 4NV1A 5GY7A 2OYRA 4D3ZA 1RAFA 4U00A 3W3AD 1Z06A 3CZCA 2VNAA 2YBEA 5JCOC 2I7CA 3DL0A 4FK8A 4BX3A 2AD5A 1LX6A 3ICCA 5AKYA 2FPMA 5C7LO 4B6GA 1E6KA 2D6FA 2DQZA 1O5OA 2BFMA 2L82A 3AP3A 1JR2A 1RQGA 3JD0A 4WD3A 5CM8B 5L3RA 3SHFA 1NI4B 3DM5A 3MJHA 4W5RA 2V0GA 4JP1A 1KVQA 2YJZA 1TMKA 3KYJB 1GCIA 1RR6A 1OAOA 1VSBA 1ESMA 4E21A 1Y1TA 5C4IA 4MV9A 4TZTA 1F0PA 2PIAA 3QKUA 4KDCA 1RWQA 1C7ZA 2WU1A 3HB5X 4UREA 1JFSA 1L4YA 1MHTA 3OIVA 4C0WA 2PD3A 2JJYA 2IYPA 2CJYA 3K92A 2WNSA 1XKXA 1MQSA 3BC1A 5L3QB 5MFPA 4MQUA 1H2WA 4REOA 1W1UA 4M1KA 2B8JA 4P5DA 4N5NA 4U2CA 4M6WA 3SMVA 4YJ2A 1FNBA 3QU9A 5FLKA 3W6PA 1B26A 2NU9B 4M7OA 3WP0A 2HBQA 1RJ9A 3QVMA 4WL0A 3IL2A 1TE2A 5AHOA 5DPMA 1YFJA 2O3SA 3TWOA 3EPLA 4DMHA 4FGUA 4FDAA 3DZIA 3VO1A 2EKDA 2O0KA 1WBJB 4XWYA 1Z35A 1UZNA 3B6EA 4KQMA 2H54A 3CPHA 2PWYA 4P33A 3UMVA 1N2CB 1NVAA 2XAAA 4I1YA 4WJKB 4WA7A 1Y6RA 4TS4A 5J47A 3BCUA 2ADFA 1T8TA 2YJ4A 2YXNA 3DB2A 2AGVA 3Q6NA 3SX2A 4Q4HB 1FX1A 2UUCB 2H48A 5KVVA 5B1IA 2B94A 4NKRA 1JTVA 3DPIA 3T7IA 3BF8A 1KY5A 1Q91A 2CLHB 1CUIA 1XVUA 5HIAA 4KVZA 2EWWA 1LRJA 2HV9A 3G2NA 3R1IA 1DKPA 4NCBA 3T3OA 1F3LA 4FC7A 4P0TA 1W36C 4B3IA 5A9SB 3F5FA 5LOVB 3VKGA 5GWXA 1FLNA 1USIA 3IMFA 5JG7A 4ZYTA 4PE5B 3TQIA 3TLKA 4X90A 1LQTA 2PLFA 2VJKA 3BDVA 3UV3A 1FFDA 1GV0A 3R0QA 3I2GA 2AS0A 3BB3A 1RXUA 3P2YA 4MUFA 1ZW1A 2MR6A 2OZVA 4AYTA 1SQSA 1OW3B 1KDRA 1XHFA 3LPMA 1FMTA 4CR8A 1C8KA 4E1BA 5FYDA 1V9SA 1KMQA 2WABA 2WA2A 1F2VA 1N9ZA 2I55A 2X9VA 4AP5A 3N8HA 2NSDA 2V7WA 1TT5A 1T36B 2WAYA 4OBBA 1YR9A 3ED5A 3HUUA 1K6MA 2HGSA 5HG0A 2ZB8A 3FFTA 5GJCA 4WE3A 5KYUA 4BWYA 4XRGA 1E6WA 5F2EA 1UC4B 1SZJG 3A1VA 4FZ5A 1R4AA 3B78A 3T7KA 3SG0A 5L7TA 4OLJA 4FE7A 2Y0CA 3QY0A 1F2UA 2Q21A 3D0OA 3D6HA 4YALA 3VPFA 5D7NA 1P0MA 2DP4E 4HPJB 1LSSA 1P6XA 2HH9A 3B60A 4G8CA 2P8SA 4KTTE 5TQ2A 3JU3A 3KALA 3TB4A 4TLDA 5JZBA 3UHOA 1PZNA 3A6FA 3BCRA 3PHLA 4CR7A 1IWOA 1Q0TA 2HAEA 2QJFA 4UNIA 3R6WA 4YJ3B 3RRBA 3NBXX 3OURA 1XF1A 4ABYA 3JQFA 3E4CA 4G0ZA 1N34B 3EF1A 4BZPA 1H9AA 4BNWA 4YRBA 5CIWA 2MSEB 3DYBA 3F0TA 3A7DA 3O1HB 4PZAA 2GBPA 1JLHA 2ZRNA 5CDGA 1VJRA 1A77A 1DIAA 4KXYA 4G5QA 4JB2A 2CFSA 3BULA 4BLSA 2UXBB 4TOIA 4BX0A 1PK9A 5CD9A 1OWOA 4BJ6A 3C3AA 5M3BA 5IDQA 5ALYA 1CJMA 2JEZA 5B1YA 5AI8A 1ODSA 4RCZA 4ZTBA 4LK3A 1PD1A 3LSTA 5FLEX 4S1TA 3R20A 4YAOA 1BCRB 4RL6A 5J9FA 1XPJA 1N3BA 1P18A 5JCOA 3KYDB 1NUHA 4FCVA 1YC5A 2PQ2A 4UEWA 2W2XA 3RRMA 4CFZA 3PWTA 2X0KA 3Q8WA 2VPIA 4OL0A 1RYZA 4G3XA 2HQOA 2Z43A 4Q82A 1NYLA 3WWPA 5IANA 1H2FA 4UTNA 3ILXA 5T64A 1A9ZA 1KEPA 2QLTA 4HD8A 5EKXA 3ZGNA 4TVOA 4IHKA 4MI1A 5A02A 3NHWA 1AQNA 1YQXA 2F48A 4FFLA 3R0JA 4K8OA 5B1SA 3BL5A 2ZIAA 2RGUA 3OLWA 4QBFA 4X84A 1QUFA 1VA5A 3OCZA 3IAUA 1G2PA 1LTQA 3T38A 5K0FA 2I87A 3VI3B 5E6UA 3WMXA 1AGYA 4PXAA 2HMTA 3NETA 1NNUA 1YCHA 4I46A 4M2LA 1D2MA 1E5TA 1RM0A 2BDTA 4UE2A 1Q2UA 3O1LA 1M54A 3MJCA 3SSMA 3DFMA 1IH8A 3OZUA 4IF4A 1R88A 5CVJA 4U2DA 2F7SA 2OY0A 2RI0A 4F6CA 3DVAA 2ZJAA 2L17A 2PVSA 3BMQA 1IL0A 1E3LA 4LDNA 1DIBA 3TD2A 5ALMA 2CCJA 2GJ4A 3W34A 1VLMA 2QWXA 5JJIA 3BB4A 5ALRA 5BWLA 1LPSA 5TQ0A 3SFVA 1XRPA 4GNKA 3TXAA 4DHWA 1DWQA 3UEOA 1CULC 3S2YA 2GJAA 3GLGA 4DPMA 3P2KA 3DE1X 2ZKIA 3QX7A 3GN2A 1YNSA 1FP4B 2JIZD 1B1CA 1PE0A 1Z8HA 2X9NA 2OVBA 4KR3A 1AGXA 1DJPA 1U9IA 4W9NC 5E6RB 5KOHB 3ID6C 3LHKA 1WKBA 1OI2A 2G5PA 2OM2A 2GA8A 3PWKA 4ACBA 1EEXB 5CFMA 1JMKC 1R3DA 1XQWA 3CURA 3WO1A 1HXHA 4K6CA 4N7MA 4PNZA 3MFYA 5C3MA 4LFCB 4MKFA 3AB3A 5ER6A 3VR5D 4QXRA 3WTCA 2D2EA 5AI6A 1E4OA 3GJRA 3RRJA 5ITVA 3AEUA 1SKUA 4JJKA 1MAWA 1D4ZA 1GFIA 2OK8A 5EP1A 3TZLA 2R6R1 3IJEB 1U2DC 1GA4A 4ARSA 4DR7B 4K2HA 1CT9A 1L4UA 1W9HA 4L1KA 4TRMA 4F8JA 2OO5A 1JPVA 4TTAA 5EXPA 4V0LA 1XFAA 3SYRA 1THTA 2GVNA 3IQHX 3NYRA 3PEUA 3ZY6A 1YFLA 1GPAA 3U1VA 3DYVA 2PMCA 2FEPA 1YZKA 1GPDG 3C14C 2Q6LA 2PRSA 2X7HA 2FSSA 1QIKA 4L51A 5IXSA 2FG6C 2WG1A 3DL2A 4EEKA 3VMMA 3HYTA 3RGWS 2V03A 4YPFA 4YREA 4DLSA 1L8AA 5C80A 3E22B 3WB9A 1NUAA 1BU8A 4D80A 4PO3X 2V58A 4RDXA 5H1YA 1OGYA 5KNCA 1E7YA 2ZJ1A 2FKNA 1MRZA 5I7SA 1IONA 1MORA 3THWB 4XIIA 1E2NA 2FGJA 1LXCA 4O2LA 4PC6A 1R8YA 3MJVA 2FMFA 2VRCD 2YXLA 5HK8A 3BDAA 2FETA 4RX1A 1F6DA 4JLJA 4XSHA 4HWKA 1UKEA 2NVBA 3R8XA 4QGFA 4HYYA 3IE1A 1M76A 2B1GA 3UJBA 1U65A 3OOYA 2XE7A 2VPZA 3DE7X 2NWQA 3WKBA 4C08A 1Z2CA 2OXTA 4I4LA 1L5KA 3T0GA 1LBTA 2BGTA 2DPGA 1GG2A 3BHNA 3KB8A 1H42A 3OX2A 1JQEA 1KJJA 5U4XA 2FYTA 3A14A 4QT4A 3QITA 4OB6A 4WACA 3KWFA 4HYQA 4M83A 2OBYA 4KQXA 4QL3A 4B75A 4KGDA 4R2LA 5I7RA 3O9ZA 4N12A 1HTTA 3NBFA 4WBNA 4Z7QB 1B1AA 1RPTA 1XALA 5EZQA 4ZO6A 3P71T 3ZI7A 1J00A 1F6WA 1VP3A 2ILVA 2WUEA 2ZCVA 4J0JA 4UFOA 4FJ0A 5KDOA 1I2MA 2WIJA 3LQQA 5M2QA 1N1MA 1WLSA 2HA6A 2R8RA 2ZE7A 3BK2A 3IKLA 4IIYA 1YFKA 4NPAA 4HTAA 5LZ7A 4C0HA 2AE1A 3M4XA 2IX3A 2I1QA 4QULA 1MT0A 1QORA 2PAFA 4KDRA 5AJWA 5KNBD 2G83A 2NACA 3R5HA 4KK4A 4OSPA 3WHIA 4DCUA 4EW6A 4U5XA 4MUXA 2FK7A 2P3OA 4J16A 5BR4A 1IUKA 2JVJA 4YQFA 1RKQA 4YK7A 5K03A 1J1ZA 5NLLA 4DY6A 1IRIA 1ZUIA 4FFNA 1FXWA 2FW9A 4ISCA 2Y4OA 3LL7A 1XVLA 5FOQA 4N40A 2VDUE 4WBSA 1MG0A 2Z4SA 1GWNA 4DMFA 3CVWA 1SXJD 3BWVA 3UF0A 1G1AA 1B0UA 1BXGA 3D6JA 1OBCA 2JLAA 3FTNA 3PX3A 5DRTA 1NI3A 5F9HA 4I6GA 3GP3A 2VF7A 2RC5A 5AXDA 4BVLA 1KKUA 5J59A 1PFQA 1YHYA 1M7HA 1YDMA 4KFUA 1FP1D 4PU0A 3CZMA 2PRIA 3I01M 2YWFA 1KJZA 2RJNA 3QSGA 1UANA 2NYVA 4OHWA 4YRJA 4EWLA 4PN7A 5CEJA 1NM5A 4F2DA 1RXVA 3THXB 4DIFA 3JQBA 3AOEA 1DKQA 1YA8A 1SXHA 2CJWB 4OBWA 4CMEA 3DM9B 3U13A 4B8ZA 2VSNA 5MN6A 1XWWA 3H0CA 5DHSA 5HMLA 2IUSA 2AG8A 2XNDA 4GLBA 1RC8A 3T8YA 5EIAA 3P9CA 4C5CA 1WHSB 1GTJ1 3EFOA 1RQXA 5EYPB 3UK0A 4F38A 3O8CA 2C7OA 4Z54A 3KJNA 1IPEA 1U0TA 2PMBA 4MH0R 5HVNA 1L5RA 4M1OA 1C3OA 1ODKA 1XRMA 2QTHA 3H2IA 1DXHA 1GGMA 3U3ZA 3GWZA 4EFKA 3MOSA 3Q8MA 1LPOA 4W5NA 1RCFA 4W9RA 4Z1OA 3UO8B 5D3QA 3NDBB 3KHKA 2VBIA 4KODA 4BB0A 4UNRA 3HVRA 3LRTA 3PJEA 2I2AA 521PA 4IMRA 3KLPX 2ONZA 2OGZA 4L5BA 3UOWA 5GMOA 2XMRA 1UUFA 4J4TA 1SFRA 1XDZA 1NI5A 2QKYA 3HO6A 1NNLA 5FBKA 4AJJA 6PFKA 4H7JA 2W6MA 3O8OA 4JL6A 4PXYA 4F5EA 1PNRA 2HWWA 1XTTA 3W5SA 1AKYA 4FR0A 5CXXA 1GNLA 1FYXA 1KMMA 3EDRA 2X8LA 3QEMB 1PFYA 4YRAA 1FJXA 4TTVA 5IVHA 4PBRA 2IH4A 4CFSA 5JSZB 4LVCA 4K3VA 1V5IA 1VBFA 4DGQA 4HUJA 4C22A 5MN5A 1ZVJA 3KXKA 4I1PA 1W49A 4X8LA 3RIXA 5FPKA 1CEYA 2DWQA 1Y9JA 1WV0A 4FILA 4MEJA 3S2UA 1KDOA 4XPIA 3DEHA 4GOOD 1H5UA 3BSWA 4O4IF 1GDDA 3KV3O 3M9XA 3K9BA 1TTHA 2ZT6A 5INTA 2H4WA 1PJSA 1QH0A 4DV6B 5REQA 5I4IA 3OOWA 1ZRMA 3S2SA 1PQ4A 1P2SA 1CVIA 4B3SB 1GPNA 2VT2A 3JYQA 3HA2A 2I80A 1LVUA 4UE3S 5HMMA 4XEHA 1KAOA 1QIMA 1NMZA 2XEXA 4GM4A 1IN5A 4OQPA 5F51A 1MMFB 2XOEA 4B7XA 5I51A 2EJWA 4YXWD 8OHMA 1O97C 2H52A 2I0FA 2PUWA 1E4EB 3FSJX 3N0XA 3ZWBA 4CV3A 1JHVA 2WT9A 4D3FA 3CR3C 3HC7A 1NVKA 5AIBA 5DNAA 1JAYA 2I4OA 5ALWA 3C4QA 4G24A 2DYKA 4GS5A 4JQZA 1JDBB 3AR5A 4L0QA 4RVGA 3EA4A 2X0DA 4BUCA 4TKMA 3AKZA 1WNFA 1BC5A 1IZZA 2FPOA 3ZVLA 4ND2A 1XQXA 1Q74A 2LDXA 1MXFA 5CVEA 2PX6A 5IUJC 1VC2A 4OMFG 2Y93A 2EZ4A 1XLUA 4ZVLA 1XZMA 1VE7A 2P6OA 1N2ZA 4DE5A 2VFAA 2IHTA 2D8MA 1IN6A 3H1EA 5CB4B 3RS2A 4IDDA 4E5PA 1HBJA 5JAZA 5HJ7A 2QGFA 3LUHA 1VL0A 2GDZA 1GPWB 1JH8A 2G25A 4HGNA 2YV5A 4Y2YA 1KC3A 4JZYA 3ZH9B 4IO1A 3IR7A 3CX6A 1EE1A 3L1IA 1G0NA 1UK6A 4KQKA 5F64A 4KPEC 4QDZA 3QK7A 5CLHA 1T4CA 5ES4B 1X1AA 1A5BB 4MQMA 5F52A 5HHTA 1Y1QA 2PBLA 4FBLA 4M1YA 4XASA 3RSSA 4EG7A 2HA7A 3I4LA 2BEKA 4TXNA 3MMXA 4MR7B 4IVPA 4Q15A 2HOQA 2OCIA 3H2ZA 3O8DA 1PFGA 4LNHA 1H69A 1R8XA 4RLQA 1P77A 2BM9A 2J41A 3HM2A 3QMVA 4GIBA 3EOZA 4E1AA 2OD7A 3G5MA 1SUSA 5FFFA 2H65A 4U7DA 3L4BC 2QUZA 4GVPA 4N8EA 2ATIA 2WP8J 1AUOA 5E6SB 3HZRA 5A05A 5L7YA 4HQNA 3MUEA 4MDEA 4PZDA 2QM0A 4R2MA 3U4QA 2HWKA 1XA0A 3OMWA 4RY0A 4UTOA 3V4LA 3NVKI 5ES3A 4LN1A 1C0PA 4IWXA 3L7KA 4C4RA 2Q5JA 1SVOA 2XGOA 4XH9B 5DIZA 1UEIA 1EDDA 1MEJA 2BFCA 4HGPA 5F23A 5KTRA 2UYQA 3IQIX 3KVVA 3WYBA 1ATIA 5JS8A 2BI8A 4QPJC 3WLMA 2OPBA 3BGWA 4XIYA 1KGSA 1TD9A 2A92A 2EFHB 3FSEA 1D0IA 1ZQ9A 4Y9DA 5SYNA 3UMBA 2FZ5A 1R27A 1ORTA 1NPTO 1XTVA 2AXEA 3C3KA 2VPYA 3PUZA 5E4JA 2O3QA 1BRMA 1AOXA 2QQ0A 3ZKWB 2R68A 3NUQA 3V2UA 3V97A 1U2QA 4B0PA 1WMAA 4FGSA 4F3NA 1SN7A 2WYVA 3LT2A 3N0VA 3PJDA 4J1TC 4RF3A 3BMOA 1K1EA 5AWFC 4UVDA 3DFUA 5FA8A 5EE1A 3CNEA 4MGHA 3LY8A 2YQZA 2OQRA 4BQRA 4IDFA 1C30B 1ADGA 1VPTA 2G76A 2QF7A 2MDTA 4QBIA 1ZHOA 1TNDA 5BR8B 2V6FA 1DG9A 3JQCA 4URVR 2EDCA 3QE3A 1WHTB 2WEKA 2GPWA 4QJ3A 2C97A 1KDZA 4ZAWA 4BO7A 3BZBA 3U4CA 1T2UA 3A25A 2YWJA 4C2BA 1XZCA 2LXNA 1X70A 4B34A 4I2VA 5K99A 1XMJA 3O74A 4LRTB 2AMLA 3O2JA 4RJ2A 1NSFA 5JHHB 4YLEA 4RYDA 3V8VA 1NASA 1FLDA 1UF9A 1XXHE 4LYFA 5ALHA 4OXXA 4YECA 3OPNA 4OGKA 2AVNA 2JJ2A 3DTVA 5FV4A 3PXDA 3O3CA 2HM7A 1QR2A 4RABA 4CU2A 5KTKA 3U6BA 3IQWA 2Q9BA 2RC6A 1Q0RA 2IUTA 1L4EA 1YB5A 2HO5A 3ABOB 3CGGA 3UMMA 1GLNA 2VK8A 2AC7A 3H1PA 1P7VA 3RYHB 2EF1A 3DFZA 4CI9A 4HQRA 5IJ9B 5JW6A 4FZVA 1I4OA 5B6IA 2F59A 1OT3A 2HJHA 3I2HA 4UBMA 1JNYA 3PRKE 2YWEA 3IBSA 2IOFK 5AMXA 3HSSA 3VO8A 2VC2B 2I2XB 2YMMA 3HR7A 1UDWA 3UT0A 5BUQA 1ZL2A 2VPPA 2W2KB 2ZTVA 3LCRA 3X2FA 4N6OA 1QGYA 3R5TA 2VH5R 4NDAA 5DX8A 2WTEA 3A6ZA 4HMQA 3PIRA 4N1AA 4EABA 4Q3DA 1MIHA 3KOUA 4KG7A 4II3A 4MEAA 5EQDA 2QP3A 2ZTUA 3C8MA 4ONEA 4F4JA 3A4TA 1EVZA 4AZ0A 4QLAA 4KWCA 1PJQA 4RELA 2LW7A 3TZCA 5JQGF 2H4ZA 4WZZA 3IV7A 4P83A 1M6WA 2MMGA 4DNFA 2AG6A 5KX5F 3EGDB 4ZARA 4CLHA 1GG5A 3RCBA 3SYKA 1Y0BA 2JFWA 3GEMA 3LKVA 5KU1A 3LT5A 1OYWA 5KNDH 3JVUA 5BVGA 1KE1A 1P1RA 1CY7A 2ZZKA 2R1VA 1T9HA 2KPOA 4R01A 5BV2P 1I2ZA 4D4JA 5IVKA 1KS2A 1NYTA 4ZRMA 3RBAA 1SEVA 2A9KA 2F1IA 4YCDA 3OPVA 5YASA 721PA 5FWYA 2FOXA 3DHYA 3ANLA 3M8KA 4L4UA 3OCUA 1OZFA 3GRYA 5AK4A 3V1UA 3ZDZB 1KVRA 4PY2A 3FM9A 1T1RA 1ZOPA 3O47A 1X9IA 2C5GA 4OJTA 1QQ5A 3P9QA 4RPJA 2QBYA 1ZM3A 1DUSA 1RPAA 3JW8A 4LNUA 3Q3CA 4AZSA 1KDPA 4ZCMA 3W5DA 5I3ZA 621PA 1YOVA 1R6DA 3TTWA 3FTEA 3QSYA 5GV7A 2QVGA 2PLRA 4C78A 2B3TA 3QKRB 4NXNB 4NJEA 1DAPA 3CH4B 4IVRA 1KJ9A 1FYFA 1HE4A 4EAAA 3FTFA 4Q3CA 2O2IA 2NLOA 3PDHA 1JEYA 2VYVA 1ZRSA 2PSFA 2V7UA 2YVLA 3AKYA 5F1OA 4G89A 3OPQA 4XYLA 1TK9A 2FKAA 3NGXA 1FSSA 4LE2A 3VZQA 3L49A 1TM5E 3CF4G 3PGKA 4FVTA 5EZ6B 3VSAA 9ABPA 2B9VA 1XKLA 1KI4A 3FGPA 1OBVA 1QOZA 3PFHA 4OYRA 1A9YA 2XUHA 5ENZA 1C3XA 3AVTA 3N39C 5A9RA 2ILTA 4KLZA 4NENB 1NUTA 4CIVA 3IVRA 4KAJA 3A9SA 1KSGA 3ST7A 2NVUB 1L9KA 2DFDA 3VYVA 4CUJA 4CVNA 2VHVA 3WA7A 1SKYB 2G72A 2YIDA 1CZHA 4RIGA 4U9HS 3SQXA 2O1EA 4QDJA 1RIIA 4PR3A 4Y0NA 2AZMA 1H6BA 5EWLB 4BU1A 3DR3A 3KKQA 3ZH2A 3D3KA 3TO5A 2I33A 3Q7IA 2NNWB 2XNDD 1N0IA 1SPXA 2XMZA 2X2OA 4AQDA 1CLUA 3ASUA 1EHYA 1CUZA 2H1RA 2P3QA 3L18A 2G5CA 3GY0A 2O7NA 5FL7D 4U02A 4AF8A 1NMQA 3SE0A 4F97A 3JASA 3O75A 1OWPA 4LDJA 3Q7QA 4KYVA 2PH7A 1R15A 1WP9A 3DE4X 5FKJA 3TM4A 1ZBDA 1FL9A 5CA1B 1CZKA 4HAIA 4CEHA 4Z4CA 3GNQA 2C4VA 5HRUA 1KZYC 4WDRA 5KVQA 1PR2A 1OB2A 4WUTA 3KEGA 1SPBS 2VBCA 4URUR 3VYWA 1K5GA 1IY1A 1U1IA 1O4VA 4JLVA 1MD9A 3TFQA 3GJ6A 2FWPA 4BQNA 3KKLA 4ZI7A 3E53A 4P7JA 2ZPUA 4JU9A 5T4HA 1ECBA 2ZREA 1TTTA 3EZ2A 1W5TA 4Z9YA 5KOIA 1ZUNB 5ADWA 2WUGA 2AL7A 4B0OA 3K1AB 2XE8A 1U0HC 1VKRA 3P9IA 3RWMB 3WL7A 5AW6A 1DQYA 1KI2A 1OLUA 3R8FA 2KJQA 1L7MA 4AICA 2CVFA 1K27A 2B69A 5EUCA 3ZHTA 3WLNA 1AO0A 3V2GA 3L7BA 3LT0A 3I39X 4J0CA 1QTRA 2G1KA 3D5TA 1FLVA 2VP3A 4FBGA 4JA0A 4WAUA 5GM1A 5B3LA 3I6MA 1KZ7B 1M8FA 3PUWA 3URKA 2Z2KA 1JHQA 3FZQA 3LC0A 1BH6A 3PVZA 4JQCA 2ZLBA 3LCCA 4FGKA 1OFHA 3WGNA 4EI7A 4P3PA 4UHFA 4G41A 2IUUA 5E1MA 2JHGA 2PKQO 3O93A 5G1PA 3J81k 3ZXSA 3RODA 3FROA 1J0EA 5EWJA 3VBEA 4BO3A 4F4DA 5JSUA 2IS6A 4H6XA 1DTWA 3CF6R 5CLJA 1EFAA 2R1UA 5J3JA 2BT4A 4AJ4A 4D74A 4H27A 4IDQA 4K9RA 1M1XB 4MVJP 3CMCO 4MWZA 1R16A 2WF8A 3I23A 3L6RA 4DWWA 1XP5A 2QAGC 3MLEA 3PVCA 5ICEA 4L8LA 1JS1X 2GPAA 2LZ0A 1U7OA 4OXYA 5KNBA 1N7GA 2QRUA 1JAXA 3AT1A 4O1MA 1CUAA 1U28A 4CCAA 1YMUA 3V9PA 5HJEA 1FNMA 4J2TA 2BRUA 2V3VA 3SS9X 1Z62A 1WUHS 2OV1A 3GXOA 3IJPA 3EGOA 2OC4A 3P27A 4IGEA 1PG0A 1DEHA 1QK4A 1ZXBA 2JI6A 4O25A 2IU3A 2ZIGA 1P4AA 1RLMA 4MI6A 1BWSA 4F3TA 5EFZA 4G1MB 1O77A 3BXEA 4OQNA 5BW4A 1ZH4A 3TLGB 2PR7A 5ICCA 1M2OA 1ZD3A 4KX5A 2VYND 1GPLA 1D09A 2POCA 2KM1A 1TQDA 1TKBA 3BMNA 3LJKA 4LMRA 5TX7A 4Z6KA 3H19A 2J0UA 1W47A 2AR7A 3GCDA 2CUTA 3GFQA 3IMCA 4WT7A 3R6TA 4QATA 4DDTA 1L8OA 3HKCB 2HMUA 4DIOA 3ET4A 3JATB 4QODA 2GETA 3CUYA 3CRNA 4BO4A 4WEQA 3IT0A 1U9JA 3WDKA 4JEUA 1S2OA 1ADYA 1V35A 2AI2A 1KKLA 4YWHA 4Q1EA 3WV4A 1E1RA 1H0KA 4X91A 1O58A 2Q4RA 1M6VA 1RI2A 1U9CA 1XDGA 1WPGA 1H8EA 4NK4A 4R9SA 2CUNA 4WVLA 3S5JA 3QWIA 3VKWA 3DMGA 3KXIA 2JFZA 3IP7A 5I9NA 1P5HA 4U39A 4AG5A 3WBBA 2AI3A 4DLBA 1IQPA 2AFHB 2CC2A 2IPOA 2M1ZA 3K15A 2GPSA 6ADHA 3CJRA 1N7HA 4B6PA 2VDRB 5LDHA 2LP4Y 1O4WA 2QSJA 4N5IX 2D1TA 4NZNA 2W5UA 2ZI4A 3N75A 4OIMA 3EZ7A 4KMOA 5ALQA 2ODPA 3KT3A 1RZ3A 3NTVA 3CT4A 2QRJA 3WR5A 3L6DA 3KR1A 3RS4A 1U99A 3KAJA 4B4DA 5K4GA 1PYOA 2D7JA 2WYHA 4MW9A 3W9SA 2WUWE 3KO8A 3IP8A 1YRAA 1A4IA 2GYVA 3V9AA 4P4SA 3K0BA 4OMDA 1M66A 4PYMA 4D9MA 1F3OA 2ODBA 3ZOKA 2J08A 3PE4A 1Q2XA 4AO7A 5IG2A 1N1DA 3WE7A 5JUWA 3NYQA 2ES4A 3LA6A 1ATZA 3NEJA 1HQKA 3IDFA 4MUMA 2X86A 3LM8A 1KJIA 1Q6ZA 3BKXA 1NVWQ 1VMKA 1UM9B 2JNWA 5E4FA 2IXDA 3A2NA 4OOEA 1CUVA 4R51A 5HOQA 3OM1A 5HXAA 1U0BB 4KFCA 1ZMXA 1TUIA 2B9EA 4QHTA 4BNIA 5LD2C 2XMCA 5DX0A 2VQFB 1FP7A 4DLKA 1N6RA 2BFFA 4PHFA 4D2IA 2V4MA 4X1IA 3LP8A 5KQSA 4TSRA 4M21A 1Z4QA 3MUOA 3FVQA 4KUHA 2OILA 4TX1A 5HKBA 5HKKA 1KK1A 1QZXA 4W1RA 2NXWA 2H6EA 1SHUX 1EGAA 4P84A 1ENYA 4R8RA 2A9RA 3PSAA 3DUFA 5C8XA 2FRVA 2PUAA 2ZUFA 1E64A 2VRCA 3GGOA 1X74A 1QGUB 2VZEA 4LCEA 4R2WA 5TS3A 3U7RA 2K5UA 3ZX5A 4MV8A 4X3OA 3R6DA 6AT1A 2AFIE 1ZA1A 2FR8A 2F9FA 3EXG2 4FOPA 3ZPXA 1O87A 4O1HA 1ZH0A 1ZWKA 5CH5A 1JR3D 5GONB 2CHUA 1E9SA 4RMIA 3HCOA 1ZESA 2BJHA 1LWOA 1CTQA 4NG5A 2C4KA 4ZOLA 5DI3B 2GT1A 4MCHA 5EHNA 4M60A 3SKYA 3W6UA 1FU7A 5I9BA 1BDMA 1B3RA 1CQXA 1UBMS 4HX9A 1EA5A 4KQCA 3RS8A 3T4PA 3KTAB 3G79A 3AJDA 3GT4A 1Q1GA 2ZRLA 3H4MA 1NURA 2W58A 1US8B 4Y1FA 2OBNA 5B37A 1MCZA 221PA 3N6RA 3QNMA 1GUBA 5HRAA 4KAFA 3UBTA 4Z9FA 4BB9A 4IZHA 2BEVB 2HA0A 2Q5OA 4PGAA 4BN5A 4B17A 2QR2A 2XUZA 2ZVPX 4XSVA 1E4YA 1NRIA 2R6CA 3FWHA 4LJ6A 3AK4A 4UHKA 3ZVRA 5KHOC 1A9OA 4UQPA 4X24A 2Z1DA 2OWDA 1U2PA 4A1FA 3UXMA 2O1SA 1LDEA 4URZR 3ZD6A 1EG2A 1YQ9A 3CX7A 5FYQA 3RUEA 2D2IA 3RLFA 2BL4A 2IDKA 3IGFA 2QLMA 4HDNA 3ML1A 3KKNA 2EG5A 3W9BA 3HK2A 1UWVA 3PNMA 1RRVA 1NV9A 1MU0A 4MR8A 1PV2A 4KLCA 5J4KA 3ONWA 4RJIA 3QI7A 3CUSA 3ZW7A 2NTYC 3FI9A 4GPTA 3F9IA 4MK4A 4NY1A 6LDHA 1NN1A 3EA0A 4HLUC 3OTQA 1PHRA 2OZLB 3K16A 4O4HB 1PFWA 2A7QA 4P93A 3UHJA 4OGLA 3VVMA 1O0BA 3K2EA 4AYXA 2NU7B 3OC0A 4BBJA 5CP8A 2VHXA 1FRNA 1RCUA 4LGMA 3FRIA 5FEMA 4CDGA 3JD4A 2J09A 3AVYA 5EWMB 2E82A 1OBFO 2CNWD 1P81A 1RI3A 1TCBA 3FAKA 3UNXA 5KKCA 1B0PA 2C2MA 2DERA 3Q72A 5JNSA 4LMBA 1DCTA 3T94A 4ZANA 4LRUA 4ZQCB 3DV0B 2PS0A 1TF2A 5T8KA 3W90A 4M9QA 2A5FA 3DZFA 4FHEA 1V71A 1E2PA 1VE3A 2BMJA 2QRZA 3NHPA 4IHJA 4OAOA 2YCLA 4OF4A 4BNVA 2L42A 3E18A 5E0KB 4L6IA 1QVVA 2QMUA 3M6WA 3SZOA 4DNXA 1RTTA 2CLSA 1NU8A 1LEHA 3HABA 3K73O 3D2CA 3MRSA 4ZV9A 5G4KB 3ZIDA 4Q3KA 2FE4A 1BS9A 2ZRMA 2RHGB 3GLHB 1RLJA 1PTKA 3GLRA 3A8TA 2C9YA 4B32A 2OP0A 4TKUA 2ZROA 5IVIA 1Q3TA 4CIYA 1U3VA 2WMNB 2OHGA 4N0MA 3VU8A 4HDQB 4EI9A 1BXZA 2XWQA 3D64A 2DX7A 3H9EO 2CXXA 1P31A 3Q8XB 2VJMB 3ZHBA 1SBYA 1QWSA 2G4VA 5D3KA 3TCKA 4RHYA 3VR2D 3W4IA 4KE7A 1WJGA 1KY3A 1YQEA 4HXFB 5JDIA 3HXOA 4MKGA 4M99A 2XUQA 3WK7A 1DKOA 4RSMA 2PUJA 1UBEA 2C00A 4R5MA 4TTJA 3RC1A 4BN0A 4Z4GA 3DOCA 2FF5A 5DCUA 1WA5A 4XX1A 4A5SA 1N7JA 2BHSA 4B3MB 2W9XA 1JQJC 2B0JA 4D8UA 1R8QA 6CHYA 4KPYA 2R7NA 1IDOA 2R751 3IQFA 4DQVA 3V33A 3WLAA 4PM4A 1K66A 3UC9A 2IY9A 4DY4A 2ZOSA 3KWLA 2IL1A 2GN1A 3ELUA 4BV2A 4UMEA 2Q5EA 2V7TA 4JJFA 2Q45A 3T9DA 5A5EA 1M34A 2EDAA 4F7DA 2DH5A 2EW2A 5CBPA 1DZ3A 2G28A 3DD1A 2H4HA 2Y1WA 3WRYC 1D5WA 4EUNA 4MSUA 1SZCA 1IEXA 1P1KA 1VHLA 3ON5A 1NY6A 5EE5B 3NAMA 4GPIB 5GJBA 1NTRA 2ACVA 3L46A 2FX5A 4XUGB 4C1BA 4BMSA 3AUKA 1T25A 3NDRA 3V7NA 3KL4A 4TN5A 4D5GA 3LKZA 4GXNA 4QUGA 2F4NA 1VDMA 3QE9Y 5FV7A 3ICOA 3A3NA 4KUGA 3HKDA 5JSYA 3W5VA 1EIWA 1I80A 2R7LA 3G2HA 4QUBA 1EAMA 4RSHA 3ER6A 1RACA 2XYVA 3K3PA 3BWXA 5FHRA 1MRNA 4JB8A 3V7YA 3MVEA 3E9YA 3R3XA 1Z22A 3CBGA 3RVRA 3FCEA 1N3LA 1XAGA 3OOJA 3C15C 4G8BA 3Q2IA 2RHOA 4R9RA 4CMBA 1A0OA 1XZBA 2Y76A 3RM3A 3V1YA 4A9AA 5JNTA 4WASA 4JJZA 3X2SA 5TT1A 4MKIA 1ZM7A 4GL4A 4QG3A 4BPRA 5DHQA 4E6PA 1D6MA 5AT1A 1DCKA 5AW5A 5TMDA 1L7QA 3BIJA 3B85A 4YUVA 1NFRA 4H77A 4ZO8A 4RLSA 1BJRE 2HWXA 3S81A 4LTDA 4PX9A 1GZVA 4ND1A 2AG0A 1OTXA 5BNFA 3VSEA 4NDNE 4WTOA 4X93A 3PNLA 4X97A 3GFOA 2E4ZA 1G6Q1 1CETA 1K8XB 2DOKA 2WZCA 3ORQA 4JVNA 4NZMA 4QUJA 5D1NA 4BO8A 3ZU5A 4DDHA 2IXEA 3AXTA 5JALA 5FJIA 4AQYB 2F17A 4U2FA 5JQGA 1E9EA 3V2IA 1PYGA 3PPXA 2QY9A 1KYVA 2W4QA 3N74A 2YMQA 4GZLA 3GLFB 1NXQA 2WNIA 5EGSA 1X7YA 3ASVA 5E8JA 1BAPA 1QOQB 2VO1A 4LYDA 3HN6A 4B46A 3TJRA 1SAYA 2ONKA 1SVIA 3ZG6A 3N8DA 4A82A 2CE7A 3B89A 1PQUA 4ZYYA 1T4GA 2X0IA 1C9YA 5MF6A 4NULA 4OX9B 1MJGA 3PPYA 3OZGA 4NBUA 3U3OA 1NP7A 4D44A 2ON6A 1UDBA 3F97A 3MTEA 2R8XA 2FJUA 4FFBA 3U7GA 1F7UA 1IIRA 1E7SA 4DW8A 2DBQA 2ZJ7A 4KEAA 4V0QA 5JYBA 1E94E 1P61B 3AESA 5IFKA 5K6RA 4JH0A 1DBSA 5I9MA 3P9YA 3WKDA 3K8YA 4ZTZB 4BQEA 3WYAA 3BAZA 3C6KA 4HH4A 4JBLA 3NI2A 5DI9A 4CQLA 4EF4A 1OA0A 3ETCA 1XZEA 3PICA 4G1BA 5IJXA 1YRLA 5CDYA 2QX4A 4MQ5A 2X0FA 1RMQA 3H5IA 4P7BA 4V0NA 2WVHA 4B33A 1V7PC 1PR3A 3JQAB 1XWFA 2BBSA 2CZCA 2X1MA 3VDMA 1FDRA 1XMIA 2RK4A 3F9CA 3PENA 4PO9A 4ALJA 4K9PA 2QRHA 2DZDA 4BMNA 4I7EA 5KWJA 1MC5A 3H5NA 1Y8RA 1E5LA 4J2HA 4LDPA 1B43A 4TTIA 4WESA 2FZCA 2QPTA 5J4VA 1X1QA 3U09A 1TI7A 1KPIA 1QDUA 1BE1A 1G16A 1R4MA 3NLLA 2XBLA 3OAAD 3QVWA 5CRIA 5TGDA 1D4FA 3ZW8A 2H07A 4PYQA 1KXZA 3HJBA 2WSIA 3IBTA 1Z29A 3F49S 4ALIA 3D6AA 3FTQA 1CK4A 3QVXA 1C81A 1UK9A 4WHMA 4GO1A 1X2BA 2JGEA 4V2IA 5DCLA 1N6NA 2AFIA 2JAOA 3LPDA 4R68A 2NU8B 3DNFA 4U8HA 3OJOA 2X5OA 3R5KA 4TQAA 3RRFA 1L5QA 5DOVA 1QHSA 2C4MA 4P92A 4W4TA 2C9DA 5F4ZA 4Q1CA 1TLLA 3FMOB 4P4TA 3CIOA 3Q9LA 1XC7A 4CLOA 2UZ1A 5K3CA 4HDKA 4B31A 5B4UA 5CGQB 5AVSA 4FHDA 3VSCA 3N2GB 4MR9B 1CQIB 3L07A 4WGGA 3VU9A 5IT9A 1VHDA 1OI4A 2GN6A 5GINE 4A15A 1ELOA 2I9KA 4DLXA 2ZSDA 1PFUA 1N92A 5J5CA 2CXQA 3TR5A 5I45A 1JNXX 1XKQA 2BFOA 4FN5A 4M53A 5AOCA 5BWOA 2XNKA 1XMXA 4CG3A 2R96A 2UDPA 3KJFA 1QZUA 5BSRA 3D54D 4JXJA 4QYMA 1V1MB 2NO9A 5E9AA 4WOJA 1QF9A 3ZJUA 1K2VN 1GT91 2J5BA 3WRXA 3ZE0B 4S1NA 3LOUA 3IALA 4FDMA 4E94A 1NF8A 1YRBA 2OCAA 2OV8A 3OM8A 3DQZA 2HD4A 4TXLA 4E33A 5CDTA 4K9LA 4RK1A 3A3PA 2W2VA 4AN1A 1UMDA 2XQKA 3RTEA 4B44A 2PAAA 2X58A 4HN9A 1HL7A 3COJA 1T1SA 3HP4A 3HA5A 5K2MA 4DTCA 1XWIA 1U7HA 3FBGA 2H08A 5IT4A 5IAAA 3JARB 4FQ5A 1K63A 1QO0D 4OA5A 1Z3IX 3EGXA 3ZCUA 3T99A 3SBOA 1DDIA 3RUDA 1H3FA 1O89A 4FUQA 5JDCA 2Y0EA 2P35A 1MIOB 1PWXA 1CPYA 2GAAA 3KIPA 3KUXA 3LPCA 1V7CA 3RKSA 3DONA 2IOYA 3VZRA 1TJNA 1JG4A 3G7UA 1E2UA 1RZUA 1FTQA 1ONBA 4OFXA 5LZ5A 3IV6A 3SEZA 3VAZA 1EXWA 4ZYUA 5K8JB 4MINA 4JKOA 4X92A 3REOA 3UAGA 5KYKA 2K2WA 1GYRA 2OBFA 1SEPA 3D4BA 1BHQ1 3M2TA 3PSHA 1BVUA 2C83A 4D0NA 4Q6BA 4HCJA 4AS1A 1QVWA 3IKJA 1VXRA 1YQGA 2B7BA 4M1EA 5KYWB 4DQUA 2FUCA 1SOVA 1NM5C 2XMQA 3I9V1 3PE6A 3NB0A 4BNLA 3RADC 2BKVA 4BMDA 1X7HA 4F06A 2WSSA 3AETA 5LKAA 1TEZA 1G7TA 4UC0A 4NEGA 1GJRA 1XTIA 2N75A 1MC4A 3N3BC 3ANMA 3CSUA 5J1TB 3FDJA 5SZKB 3OU2A 1OH6A 2IBTA 1J70A 4I6JA 1ISFA 2PTHA 2IZ0A 2ZUSA 3LCMA 4NYIQ 5PGMA 2P2SA 2WHXA 3JRXA 4HZIA 4CF6A 4ECEA 5J63A 1MQAA 1ONSA 3MCZA 1PW5A 1THZA 1WVIA 5EESA 1I30A 4HNRA 1LK7A 4MQ4A 4Q4LA 1JG7A 3R9WA 1BFKA 3I3SR 1A96A 5IBCA 4GR5A 4XLZA 4I6EA 5EKDA 3F6YA 1UZLA 2G9UA 2NUBA 1AB5A 1YS1X 2G7MC 3GFPA 4I9UA 5EFOA 5FOTA 5GONF 1NKTA 3TKYA 3WWDA 2YY5A 1J0AA 2QTBA 4CM5A 4R9UC 3L6BA 3NH9A 4BX8A 4F4HA 1KNQA 1OQAA 1ISHA 3BA6A 4PINA 4UM7A 1GG9A 1O1YA 2P0YA 3FE2A 1S8FA 3KAPA 4C07A 4CMJA 4R4JA 3H0EA 1H66A 1VP9A 1G42A 3FSGD 3MS4A 1SNYA 5JSFA 2JDID 2V4ZA 3AJ9A 2CVQA 3CUUA 4WCVA 3LLCA 5LQAA 4LMPA 3OECA 5D01A 1Z0SA 2LE0A 5L6MB 1IQRA 1OT5A 5ECGC 2BFNA 5C46F 2BELA 3BK7A 5A03A 4X3PA 1XRSB 5AHRA 1E1CA 2DKFA 2GGSA 2I6QA 1GZ7A 5AVQA 4K0RA 4XYBA 1DRJA 4JR0A 5DB4A 2E21A 3QWFA 4DADA 5JH7B 1QV6A 5CK4A 3T5DA 3IFSA 1N77A 1N2EA 2R1TA