4UUSA

Crystal structure of a ubx-exd-dna complex including the ubda motif
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
67
structure length
67
Chain Sequence
GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEIQAIKELNEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 25
structure length 67
sequence length 67
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uusA00
3H3VK 3OSGA 1OFCX 3GTQJ 1OJLA 4JX5A 2PMZN 3TP3A 1QRYA 4FCYA 1DU0A 2NVTJ 1I3QJ 2N8GA 3ZQHA 2ECBA 2JJ7A 5F1JA 3HDDA 1G2HA 4C3JJ 2LR8A 5C44J 5E3NA 1HLVA 1RPWA 1ENHA 1MBKA 1P7JA 2X48A 3JRAA 1MSEC 3ZQLA 4M3DA 2B63J 3JRGA 1RR7A 3B6AA 1JTXA 3MKLA 3BR3A 3S15J 4D7MA 3HGYA 2R5ZB 2EQRA 2LLKA 1JUMA 2XPUA 1JTYA 1S7EA 1WGXA 2L7MP 1HF0A 1MBGA 2K9NA 2XGEA 3ZQFA 3BR5A 4M3EA 2CJJA 2CQQA 3IH4A 3FISA 5F0CA 5F0HA 3Q0VA 5FLVA 5C4XJ 1OCTC 3BTLA 2WAQN 2COBA 1IUFA 1JKRC 3I4MJ 3CMYA 2DMUA 1LFUP 4DZJA 4IHYA 3BTCA 2XB5A 1RETA 2EZIA 3SDGA 1NK3P 2EH3A 2HDDA 5FKLA 3JRBA 1ETKA 3S16J 4MIMA 1LFBA 2M2EA 3JRIA 5J1UA 4XIDA 2YS9A 3A01B 4NDLA 2JK3A 3HM5A 2DA1A 2NS7A 3B6CA 1Y1WJ 2Y9ZA 1SANA 3A02A 1WI3A 4CYCB 4QIWN 2DMPA 5IPAA 4A3DJ 4GFBA 2O8KA 3HOWJ 3G1LA 5HODA 1U78A 3M3YJ 1ZKGA 1IV6A 3OSFA 3RQIA 1RESA 2HQ5A 5JLXA 2FQ4A 2MSYA 3JRHA 2VI6A 4BY7J 1MBJA 2L7ZA 4JX4A 4A69C 1I50J 2EZKA 2QCOA 2TRTA 4A3KJ 3GTGJ 3PM1A 5FKOA 5FJ8J 1U8BA 1ITYA 2L0KA 2CU7A 1NK2P 2E2HJ 1UHSA 1HDPA 2I10A 4HNVA 1QVUA 5J3LA 2XSDC 2KDZA 2YUSA 1F43A 2DMTA 2D5VA 3W6VA 2DA5A 2WV1A 2R93J 3S2DJ 3NARA 3PO2J 4W97A 4A3LJ 4BKXA 3BG9A 3UKGA 2ID3A 1A6IA 4MFEA 5M3MJ 4B4CA 3Q0WA 1JT6A 1JJ6C 5K7HA 1CQTA 1U9NA 2M0CA 2M34A 4S0HB 1FJLA 1POGA 3O8GA 2XPVA 1UG2A 4V2FA 1AU7A 1VFCA 3HOYJ 3TW7A 3I4NJ 1ETXA 2XGDA 2Y2ZA 4D5CA 4DYRA 1B72A 3S1NJ 3S1QJ 5EF6A 1ETQA 5F0FA 3BQYA 1P7IA 3ZQIA 3GTPJ 2EZLA 1A5JA 4IHXA 5M5XJ 3C2BA 1OCPA 2K40A 2R7ZJ 1JGGA 3TP0A 4EEFG 1YRNA 3QPLA 3HOUJ 3JRDA 3FK7A 1QPIA 3ZQGA 1JUPA 1IC8A 1X2NA 5EG0B 3GTLJ 3OOUA 2ECCA 5K7FA 3BR0A 3CDLA 2OF7A 1GDTA 3A03A 2DJNA 1VI0A 1FIPA 2IAIA 1TC3C 5M3FJ 2NOGA 1LE8B 3L1PA 3VPRA 5C4JJ 4M3BA 3JRCA 2R5ZA 4RDUA 1T56A 4W1UA 1X2MA 3CQZJ 1RKWA 1MNMC 4L5EA 4A3IJ 4MFDA 1JKQC 3PO3J 3LSPA 2MGQA 3LSGA 2O9LA 1FTZA 2GLOA 4C3IJ 3JRFA 1K61A 2X9DA 5IP7J 1QVTA 2WB1N 2VKEA 2TCTA 4C3HJ 3HOXJ 3QPSA 1H8AC 4FISA 4XRSA 1GV2A 4JX6A 1IJWC 4BXXJ 1ZR4A 3BQZA 2QF7A 1B8IB 5FLMJ 4J19A 3BR2A 3RZOJ 3WHBA 4B1RA 2HI3A 4A3FJ 2AO9A 1TWAJ 2FD5A 3DEWA 4A3CJ 5EGOB 5GP9A 2XPWA 2Y31A 4JP0A 5K7ZA 1NTCA 5DTDA 1EF4A 2E2JJ 4AYBN 1K83J 4ABZA 2JMWA 4CYCA 1ZGWA 4A3MJ 5IP9J 4IHVA 2JA8J 2CQXA 3HKZN 3S14J 3ZQCA 2R0QC 3LOCA 1AHDP 4IHWA 2XGCA 4UUSB 1TWHJ 1PUFB 3TW6A 2DA4A 3G1OA 1HDDC 4BY1J 3G1MA 3LSRA 2W48A 4A3EJ 4FE4A 4AC0A 5JLWA 1IDZA 1XC5A 1XS9A 3GTJJ 3O8HA 2HYJA 2KT0A 4C2MJ 5J1RA 3SJMA 1MH4A 2IEKA 2NS8A 5GPAA 2R5YB 1GUUA 1SFOJ 2LP0A 1FEXA 4IEJA 3S2HJ 4AUXA 1F36A 5F27A 2M8GX 5GPCA 3GTKJ 1TWCJ 3JREA 2LD5A 2ZB9A 2R92J 1TWGJ 1H89C 2H8RA 2LY9A 3GTOJ 3BG5A 4XRSG 2LFBA 5M5YJ 2OPTA 5E3MA 2H1KA 3M4OJ 1ETOA 1JKOC 2DTZA 3FIWA 3BTJA 2DA7A 3WHCA 2JA5J 2E19A 2K9QA 4I76A 2Y0SN 2Y30A 3RZDJ 4JYKA 2K9SA 1JT0A 1R9TJ 4M3FA 1MBEA 5IOZA 4A3GJ 2DMQA 3MN2A 1DU6A 2CRGA 3BR6A 1X58A 1AKHB 3NAUA 4DYCA 3JR9A 1GVDA 1Q1VA 1VNDA 5DS9A 4QSHA 4V2GA 2YU9J 1FTTA 5IYCJ 1TWFJ 4X1EA 2IBDA 5F08A 2GM4A 5F04A 3S1RJ 2LTPA 4XRMA 1YRNB 5EG0A 1U9OA 4D7NA 3E7LA 3MVPA 2GBYA 3ZOBA 1WCMJ 5M5WJ 4RBOA 1LE8A 1Z0XA 3RKQA 5E3LA 4UUTA 2DA6A 1JUSA 1JJ8C 2EBIA 2ME6A 1IGNA 1I6HJ 2NVQJ 3GTMJ 3S1MJ 5FKKA 5IP6A 5E3OA 2L9RA 1RKTA 1H88C 2EZHA 2XRLA 2ME0A 1GV5A 4M3GA 3LSJA 2DMNA 2FJ1A 3HB9A 4BBRJ 2JWTA 4FTHA 3Q3SA 1IG7A 2HOTA 1BW5A 2NVYJ 3S17J 2MW8A 1UMQA 4DZPA 4LOCA 1B8IA 2VKVA 3FKIJ 3A01A 3IV5A 4Y52J 2P81A 1E3OC 1MSFC 1VF9A 2O7OA 5BNGA 2LVSA 3BG3A 3TEDA 2DA2A 5EGOA 4DYQA 1GT0C 3DCFA 3HGGA 5EZGA 4BBSJ 1O4XA 2ELKA 5IYDJ 1WH5A 4M6VA 1HOMA 4A93J 2DA3A 4DW6A 1JKPC 2AHQA 1ORKA 3HOVJ 5C3EJ 1MH3A 3QQAA 5EYRA 3FK6A 4G12A 2M9HA 4I6ZA 1D5YA 3IH3A 2HOAA 4UUSA 1HCRA 1IDYA 1PUFA 1FIAA 3OIOA 3K2AA 5FKMA 2LKXA 1ZR2A 2DN0A 4FE7A 5IYBJ 9ANTA 3HEFA 1BL0A 2HXIA 1XG1A 1ETVA 2RAEA 3LNQA 3D1NI 5J1YA 5EEAA 5IOYA 4X6AJ 4MLOA 1APLC 2Y9YA 3SFIA 4B3AA 2XB0X 2R5YA 3CCYA 2E2IJ 3BR1A 4A3JJ 3IH2A 1IRZA 2HOSA 1T33A 3K7AJ 3H0GJ 1MBHA 3BT9A 3HOZJ 3GBGA 1BA5A 1W0UA 1WH7A 2NVXJ 1Y1VJ 4A3BJ 3BTIA 1ZTRA 3Q0UA 1BJZA 2CUEA 2JA7J 2JN6A 2LK2A 4Y7NJ 2L7FP 4QTRA 5FKNA 2JA6J 2E1OA 4XICA 1BW6A 3HBLA 1ETYA 1ZK8A 4MO7A 2G0EA 2HXOA 2FX0A 2MG4A 1B72B 1WPKA 4D5FA 1AKHA 2VPRA 2X6OA 2ID6A 1W0TA 5EZHA 1ZQ3P 2VUMJ 1ETWA 2CUFA 4XK4A 1Z77A 5EDNA 3F0CA 1MBFA
chains in the Genus database with same CATH superfamily
1I3AA 4A5MA 2PMZN 4DGWB 2N8GA 3BROA 2XC7A 5H6QA 1MD0A 2ECBA 2JJ7A 4Y17A 3EYYA 4C3JJ 5C44J 3K2ZA 1D0YA 5E3NA 1RPWA 1ENHA 2IA1A 2QKLB 2X48A 3JRAA 3F6OA 1MSEC 2Y69H 1R22A 1Z3YA 4IXAA 4ON0A 2B63J 1AWCA 3MKLA 2DO7A 4HEA2 5A2QZ 3S15J 1OCOH 1FBUA 3VWBA 1Y0NA 5E1ZB 3QPTA 1JUMA 4ZTFA 1OYYA 1JTYA 2IA0A 1S7EA 3DEEA 1AA7A 2G9WA 2KMUA 3E6MA 1H9TA 1J5YA 2ZNYA 1HF0A 1UG0A 2GIZA 4IQJA 1O57A 3BR5A 4M3EA 4CCJA 5LGTA 4I2OA 1T0FA 3Q0VA 1OCTC 1T8IA 2L4MA 1DP3A 3I4MJ 3ZMSA 2KIFA 2DMUA 5CVJA 1LFUP 2X6YA 4IHYA 5J4VA 1VQLI 5D5XB 3JW4A 2YX7A 4G6QA 1KU7A 1DP7P 1YS6A 2M2EA 3SZPA 3JRIA 4HF0A 2MD0A 1A04A 4F7ZA 3K4NA 2UV1A 2IS4A 2JK3A 5E8IA 3S2WA 1FLIA 2L9SA 4PGGA 3WGHA 4CCKA 1SANA 1SD4A 2XIGA 3FXRA 1IN8A 2ZXHA 3HL2A 5ERIA 5IPAA 4EJWA 1MKMA 2ZJ2A 5B1AH 3GYHX 3W2VA 5HODA 3CCEI 1ONVA 3M3YJ 2LY1A 4S05A 2QWWA 3TOAA 3ZN1A 5ICEA 4NBQA 3SYTA 2FQ3A 1OPCA 1H9GA 2MSYA 2VI6A 4BY7J 3I9V2 5D5VB 4A69C 1I50J 2EZKA 2TRTA 5LEJA 2ICWG 4A3KJ 3GTGJ 1Y6IA 2WV0A 5FROA 1U8BA 1VZ0A 4CCNA 1LEAA 2A3SA 3DEUA 2Z2SB 5J3LA 2R7FA 4XR6A 3OYHA 2FNPA 1F43A 3I5UA 3ZGKA 4ZH4F 2IGKA 1FC3A 2CV2A 1FYMA 4WK8F 3E3VA 1XMKA 3CC2I 3PO2J 2LH9A 2K3PA 1I5ZA 2JT1A 2NS0A 3HRTA 2DCEA 2ID3A 3OYFA 4YIFA 4OIRF 1QZZA 2M4GA 4B4CA 2XGXA 4LG0B 5K7HA 4JBAA 3Q5FA 1YHQI 2WAQA 1MJBA 1U9NA 2RQPA 5IT9Z 2ESNA 1D0ZA 2Z5UA 2ZMEA 4RS8A 4EATA 1N77A 3EUHC 2D2WA 2Q2EB 3LSIA 2XPVA 4QPQA 4V2FA 2VL8A 2L5QA 1T38A 1AU7A 3TW7A 2VJIA 3HSFA 2XGDA 4DYRA 3I53A 1KONA 4M72A 4GO1A 3S1QJ 3BQYA 3KEOA 4LB6B 1IRGA 2P8TA 5DEQA 3ROUA 3F6VA 3E6BA 1EV7A 1YOVB 2X1EA 3F8NA 5HDGA 3E97A 2EZLA 5EJCA 1W5SA 5M5XJ 2NRAC 2R7UA 3TDUC 2VBWA 1G3TA 2VN2A 3GLXA 2ISYA 4HNUA 4XOTA 2DOAA 4D1QA 1SD5A 1OCZH 2R7QA 3W6JB 5ICFA 1WVRA 4DQ2A 1OQYA 5DUKA 5EG0B 1ON1A 4EM2A 1B1BA 4PZJA 5K1YA 5D5WB 2ECCA 4MTEA 1ZGJA 4UVBA 4KYWA 1FOWA 4CCMA 1VI0A 1FIPA 4DIQA 2V9VA 2DLLA 2QQ9A 2R4GA 3FHNA 3L1PA 3G73A 5LHIA 4WXCA 4RDUA 2MD5A 1VQOI 2IPQX 3BOQA 2AS5F 5LD2C 5CVRA 1JKQC 2O9LA 2ZSIB 2W7NA 3DU6A 1FTZA 4PFPA 1Y0UA 1I1SA 2VXZA 3JRFA 2FBKA 1QVTA 3SEZA 2P0WA 1TT5B 1OLTA 1RRJA 3QPSA 3K6GA 3SEQA 3PL8A 1H8AC 1O7LA 4XRSA 1IJWC 1A36A 1B8IB 4XORA 1E0EA 2VOOA 1DQUA 4G7ZF 4J19A 3CP2A 3ML6A 5IT9K 3S3MA 1EJ9A 1BN5A 2HI3A 4HBLA 2CMPA 1RZ4A 4KMFA 4M73A 1TWAJ 5KHDA 2R7TA 2NOJB 1XGMA 1Y39A 1U6GA 1XSXA 4P96A 3CDHA 2HWVA 3H92A 2QUFA 5DTDA 3OIPA 1EF4A 3FMQA 4RM2A 4I7HA 1FYKA 5FB2A 2R7XA 2VKDA 4ABZA 2JMWA 1ZGWA 3FM5A 5K5QA 3CZ6A 3CD6I 3S14J 1R1VA 4II2A 3FBIB 1AHDP 4IHWA 2XGCA 3FXOA 3DTKA 3U2RA 4EJTA 1BR1A 1EH8A 2DA4A 3TW6A 5ICCA 5ED4A 3CCMI 1X19A 2P5LC 2JRTA 4BQNA 1TT0A 4EM1A 2QSHX 3A2KA 5AONA 4RAFA 3TOBA 5HDKA 1XMXA 2RQQA 1FX7A 1IDZA 4D9JA 1ZLJA 2V1NA 2RC4A 2BY1A 2VB6A 4C2MJ 4BDYA 1U3EM 3L2QA 1MH4A 4I02A 3RYRA 2LSOA 2EV6A 4A0ZA 2DPUA 3V4GA 2W00A 2LP0A 1Y56A 3K69A 4IEJA 1X4OA 5F27A 3AFHA 2DT5A 3ZQQA 2XKOA 4AIHA 2H6CA 1V4RA 4TV7A 1TWCJ 4MQ9F 2F5FA 3MKZA 3ZN0A 4ITVA 2EFPA 2GOXB 2JA2A 2EFNA 2H8RA 3GTOJ 3IUOA 2FE3A 3CTAA 4LG0A 1J59A 2BHZA 2BGCA 2GAUA 3LSKA 1YYVA 2LFBA 5M5YJ 4PFOA 3TKYA 3E5QA 1P4WA 1UAAA 3BTJA 2DA7A 5J8CA 2Q2EA 1R1UA 1ZRFA 2PI0A 2E19A 2OA4A 2K9QA 3GFLA 2E1MB 3WODF 3CCVI 2EK5A 2A6HF 3QPHA 5LRSA 1W5CC 3SDBA 5K5OA 2VT3A 4P9FA 1DU6A 1DPRA 4RLFA 4I98B 3KEYA 2CRGA 1AKHB 3KE2A 3PFIA 4DYCA 4BL0B 3T8TA 5DS9A 4ZC3A 2HVQA 2KRFA 2IS2A 3G3ZA 2EIKH 4AYBA 2DU9A 1U2WA 3GCMA 1TWFJ 4L0ZB 4X1EA 5F08A 5L3FA 4NQWB 4CICA 1XSDA 3KZIC 5HS8A 5J8FA 5EG0A 1REPC 5L3DA 4QLCU 2GBYA 2MFZA 4NB5A 3SFZA 3ZOBA 3I54A 1JXSA 4PJLA 4UVCA 1B59A 1GVJA 1TQPA 4RBOA 4X0GA 3QYEA 2VBYA 5CYVA 5CVUA 3OL4A 4UUTA 3QWLA 4ESBA 2KIUA 3SZGA 5AIQA 1JJ8C 2ZO4A 1ODDA 4OWRB 2Y48A 3DXJF 5BOXA 2O8XA 3RKYA 2STTA 4LB5A 1RKTA 4KISA 1KQ9A 3PJRA 2XF5A 2FA5A 2EZHA 3CLQA 4HW0A 2MLKA 2VJ5A 2HVSA 2DMNA 3HB9A 5D6FA 4EVIA 1DGRM 1IG7A 4HNTA 3HZJA 1MMDA 2MW8A 1TL8A 3U1DA 1B8IA 3G2BA 2A5YB 3A4CA 4F3QA 1SAXA 4BE2A 3K4BA 3LSHA 5BNGA 1CF7B 1MJ9A 2A6EF 2BBYA 3WGGA 3BG3A 3G71I 2DPDA 3C3WA 2H1LA 3WU1B 3HGGA 5D8LB 3V42A 4BBSJ 3EPZA 4UV9A 5DV5A 3K70D 2DA3A 4DW6A 2AHQA 3IL2A 2PX9A 3S3NA 2MYSA 1HKSA 5C3EJ 1YQAA 3RKXA 4IL6C 3L09A 1X4PA 2LNBA 4G12A 1D8KA 3HYIA 4EJVA 1MMGA 3ZMZA 5EEHA 1N75A 1G3SA 1X3UA 1D5YA 3IH3A 1MW7A 3V7CA 2BXYA 3TO6A 4H4KC 1YTYA 1IDYA 1FIAA 2WA0A 2WY8Q 2QEXI 1RR8C 4LFUA 1VQ5I 2RDPA 3HSRA 2IP2A 4RGXA 2GWRA 3K2AA 1R5ID 2DN0A 1EA3A 4I99C 2ZJRF 1RI7A 4A0YA 2F4IA 1BL0A 5K5RA 2HKXA 1FY7A 5J1YA 2W57A 5IOYA 4X6AJ 3MZ8A 1LEBA 1J7KA 2HTJA 3M7GA 4XSZF 2Y9YA 3X2QH 1YX3A 2K9LA 3DBRB 2PQ8A 2W24A 2IGMA 2XB0X 4B3AA 2EFQA 1NG6A 4A3JJ 2RN7A 2CW0F 3CUQB 3H9QA 3H0GJ 3RKWA 1MBHA 1WJFA 3HOZJ 3OWTA 1S72I 3GBGA 5HNHA 5D4RA 2X6XA 4C2TA 2ZC2A 2DQRA 2H94A 4I01A 2LF8A 1U8RA 1KU9A 1QHGA 2ESHA 3N97A 2ZFWA 4LIVA 4YFNF 4U0VA 4IRGA 4EQQA 3CCRI 2CGPA 3EUAA 4KT6A 4GCVA 4Y7NJ 4ENKA 5CPRB 4XLHA 2X1DA 2VJ4A 4N9HA 1ETYA 2Z1DA 2CUZA 2G0EA 2HXOA 2VXDA 3H3ZA 1XCBA 3T1BA 2DYRH 1XPXA 1B72B 1WPKA 4M9ZA 1AKHA 2WBMA 2MH9A 3ECHA 4YELA 2CYYA 4WXHA 1WZ2A 2PMHA 2CUFA 2GIVA 4IJAA 1FP1D 2CFOA 3WTSC 3H3VK 2ELHA 4ZDPA 2D1VA 5FO5A 4ASNA 1W7PB 2JTVA 4HX8A 4NQWA 4FCYA 1EH6A 2NVTJ 4AVPA 4PSXA 3PFYA 1G2HA 2LDUA 3LMMA 1HLVA 1P7JA 2PJPA 1Z6TA 2HZTA 3EUHA 3WU2C 3ZQLA 3MMYB 3FXMA 1RR7A 3B6AA 3JRGA 2ETHA 5ILUA 2IVMA 2DFIA 2PJRB 1BBYA 2L3DA 3K1MA 3BY6A 3HGYA 2L02A 3Q9VA 3S8PA 3ZMTA 4RA2A 3BG6A 3OV8A 3H36A 1X1DA 4KJZA 5LRRA 4KDPA 1T98A 4N4NB 3H35A 4KFCA 2V9KA 2K7LA 2BEOA 4UHTA 4XLNF 3VDXA 2XGEA 4A5NA 2EJRA 2CQQA 2IXSA 3ABLH 3FISA 3ERMA 5F0CA 3HOSA 6PAXA 2O61A 5C4XJ 3I55I 3BTLA 3HG9A 3CO7C 3JCUC 5JHFA 1JKRC 4A6EA 2VODA 3WGIA 3BG7A 1RETA 2BZTA 2J5PA 3CF5F 3E6DA 2HKOA 1ZHFA 2H6BA 5FKLA 3JRBA 1ETKA 4PDKA 4CH7A 4OMYA 3S16J 2JPBA 1CF7A 3K9TA 5KNLA 1LFBA 1YITI 1USSA 3A01B 4RGRA 3NQOA 4QWQA 2ZXIA 5JHUA 3WTTC 1TLHB 2V1DA 1MGTA 2DMPA 1VQ9I 2O8KA 3G1LA 4KIFA 4UB8C 4C30A 1U78A 4AIDA 4NUBA 3I59B 2R7WA 2HQ5A 5JLXA 2FQ4A 2QENA 2M5WA 2WC2A 5GADJ 3RPQA 1R5GA 1PDNC 2FBHA 2QCOA 3KP6A 4FX4A 1IW7F 1B4AA 1U5TC 5HLHA 3H5AA 2L0KA 2CU7A 4A2UA 1UHSA 5ICGA 1QVUA 1E17A 3L2WA 2XSDC 4E7SA 3REOA 2HR3A 4GGGA 1X1PA 3CUQA 2D5VA 2C6YA 2DA5A 3DWLE 2QKMB 3FDYA 3R0AA 5BPIA 1D1BA 3K1PA 1A6QA 2DBBA 4OU0A 5B1BH 3NARA 2R93J 4W97A 2K4JA 2XAUA 4A3LJ 1IZ1A 1O7FA 1BJAA 1Z3XA 3BG9A 3WE3A 3UKGA 1A6IA 5M3MJ 3H1CA 4CSWA 4IX7A 1JT6A 3K10A 4ANJA 1CQTA 1MNEA 4S04A 1LPQA 2M0CA 1R23A 2M34A 4OIPF 1KQ8A 2E1NA 4IKFA 4S0HB 1POGA 3QOEA 3O8GA 4U0YA 1UG2A 4M6XA 3RDIA 2HQRA 1VFCA 4ZDLA 1ETXA 4CGZA 3FXUA 3IC7A 1IXRC 1J0RA 5LHGA 1I6XA 1B72A 4Y33A 3S1NJ 2MLGA 4CZZA 3KP7A 1QNTA 1VQNI 2KZGA 3M8EA 1G8XA 3I0TA 3ZQIA 3GTPJ 1B9NA 1FWZA 3J7ZI 3HUGB 4AIJA 1OCPA 2K40A 2R7ZJ 3TP0A 3M07A 1P9QC 2DODA 3QPLA 1BC7C 5FRNA 3HOUJ 3LSTA 3FK7A 4WF2A 4E6KG 2F2EA 3GTLJ 3OOUA 5CVIA 1S7OA 3OS1A 2DT6A 1OMIA 2R3SA 2Y0MA 5FGMA 3BR0A 3CDLA 4DBRA 1F5TA 5HLIA 2DJNA 1D0XA 4A6DA 5M3FJ 3F9KA 2PJRA 1IF1A 3O6BB 3PUBA 5JI6A 4M3BA 1T56A 1IO2A 2DDAA 3LFUA 2CV0A 2ZNZA 4B43A 3AG4H 3KEQA 3C7JA 4F93B 1TZLA 3QU6A 4RGSA 5CQGA 3LSPA 3LSGA 3AG3H 3CC4I 3AG2H 2GLOA 3PUFA 2H27A 4HV6A 1UHWA 2QQAA 3MZHA 1LKXA 2P5KA 1E3HA 4V19K 1LUJB 4BXXJ 5D4SA 1ZR4A 2BOLA 3AG1H 4J00A 3RZOJ 3BR2A 4XKWA 1T08B 3I58A 1HXDA 4AVZA 3DEWA 5CJ9A 5GP9A 2XPWA 3OYAA 3UNGC 1V55H 2Y31A 1HSTA 1JI8A 1O3SA 3FXJA 3NWTA 2KPMA 2E2JJ 1TP4A 3KX2A 1K83J 2LOOA 2OAZA 4NHJA 4Q48A 2F5CA 2PFBA 4BXFA 2VC0A 3KYCB 3BPVA 2A07F 4LLNA 5LHHA 3LQQA 5CLSA 2R0QC 3I59A 2KLOA 1Y8RB 4UUSB 1YJNI 1BOBA 2K5CA 1PUFB 4HX7A 4CXFA 3H9GA 1T2KA 4KIGA 3P9IA 1S8NA 5D5UB 4M9SA 1KYZA 5D6EA 1G4DA 4F52A 4Z6YA 4AC0A 3LA7A 2PMUA 2DW4A 2EA2A 5A2QK 1XS9A 3M8FA 2ACJA 1J75A 2HEOA 1B9MA 3H5NA 1N78A 4E7IA 1FNNA 2HYJA 3SJMA 3R61A 2NS8A 2ZXWH 5GPAA 2R5YB 1SFOJ 2LC2A 2PBIA 2BHYA 3CUOA 2G7HA 4EJOA 2HYFA 4ZYDA 1UFMA 4OIOF 2JVHA 1OR7C 3FKJA 1LDJA 5DD8A 5E3MA 2VE9A 1ETOA 1JKOC 1W36C 1IV8A 4PJJA 3K4CA 1QBJA 1IRXA 2A05A 3K4LA 1KQ0A 2LKSA 3GZNB 1U5TB 2EPFA 4IO9F 1QA6A 2DFFA 4XLPF 3LL7A 4KA4A 2XASA 2LMDA 4PSWA 1HSJA 3NAUA 3JR9A 4NC7A 1SFKA 1X3WB 3ECOA 3BJ6A 4CDGA 5HVQC 4LK1F 4KT5C 2JSPA 2Z33A 3L2VA 2ZCWA 3GFIA 3HUGA 5LBQA 3IAM2 2BV6A 2IBDA 2V9PA 1CGPA 2GM4A 4HLYA 3H5RA 2DK5A 3S1RJ 1GHCA 4KUMA 4I09A 1YRNB 3BZCA 3FXLA 3E7LA 4A0XA 3IKTA 2E7WA 4HDUA 1XGSA 1BIAA 2HNHA 2CFXA 3CJQB 2LF7A 4YIIA 1PJRA 3RKQA 4JK1X 2XVCA 3BPXA 4MGRA 2YR2A 1ON2A 2ZKZA 2XRNA 4PGHA 2EBIA 3HXLA 4XSXF 2NVQJ 4HZFA 3M9AA 3I4PA 1UCRA 4G7OF 4KITB 3DFGA 5IP6A 3OYMA 2VLAA 1R58A 2L9RA 4XOPA 3JAMZ 1MMSA 1H88C 2XRLA 4B44A 4FT8A 4LMYA 2V79A 2OV7A 3HTUA 4BBRJ 4P5OA 3TBIA 2EIJH 3OOPA 3Q3SA 1R1TA 2VQLA 2WAEA 3J80Z 2HOTA 1T6SA 2E5NA 1FYLA 4CO8A 3S17J 1P4AA 1UMQA 4YEJA 2VKVA 3IV5A 1SEUA 3EQLF 5J6XA 4BJ5C 2DYSH 2KIMA 3W3CA 1JHHA 3ZMDA 3LAJA 3L2CA 4DYQA 1R5HA 1R4NB 2VIXA 3DCFA 5EZGA 3S93A 4ZZDA 1OYIA 5KK1A 1IXCA 4IQ4A 1JKPC 4GYIA 1ORKA 5DM7F 1UB9A 3QQAA 5HS9A 4ZYHA 3DBLB 2WWYA 3E0JB 2F5DA 4RB1A 2KRHA 2YU3A 4UUSA 2V6CA 1S6LA 2XAHA 1HCRA 4BAYA 1PUFA 3MFKA 1K6YA 3RPUD 2GQQA 1IRFA 3OIOA 3TL4X 1OISA 1PUEE 3HRMA 2FSWA 3GZ5A 1LDKB 4IVNA 3RYPA 3WG7H 1G3WA 5DM6F 1XG1A 4RM3A 2VASA 1YX5A 2QGUA 2E35A 5BS6A 4UVAA 3CMEI 3VODA 2R5YA 1SMTA 1UZCA 4KIBA 3BR1A 1IRZA 1XX5A 1T33A 1USTA 4XNFA 1R6RA 3F8FA 1VQMI 1N25A 1UELB 3BT9A 1B6AA 1J2XA 1BI1A 1WH7A 2WB1A 3OYIA 4OMZA 3BTIA 2OTLI 1ZLKA 3HSEA 4LJZF 4GYGA 4CHUA 3JAMK 1BJZA 2COMA 2OCEA 3ZR8X 4BU2A 4A12A 3ESWB 3OYDA 3RPUA 2JA6J 4XICA 1S3JA 2XAGA 1ZK8A 2KFDA 4Y3OA 2OZUA 3AAFA 1U5TA 3BDDA 3K0LA 1FOKA 4M74A 2DTRA 1IN5A 2IJLA 2MG4A 3I71A 3NRVA 3OR2C 4BS9A 3AL0C 4ENJA 4D5FA 3OYKA 1S5LC 5B5EC 2X6OA 2BE5F 3TQNA 3L9FA 3WU0A 3ABUA 4G9YA 1ETWA 1VQ4I 4XK4A 2CV1A 4MQVA 3B73A 1K78B 4PK4A 3F0CA 5H6RA 2UZKA 1R00A 3WTVC 1I1GA 1OJLA 4WX9A 3HC7A 1Z6RA 1DU0A 1FMWA 1I3QJ 2VBZA 3F72A 3ZQHA 4BXUA 1T0FC 1R49A 2XV4S 3HDDA 1KA8A 2LR8A 4O6JA 1TBXA 1IUYA 3A1YA 3IKVA 1MBKA 4WCGA 3VEPA 3WG9A 4M3DA 3F21A 5FFZA 5B66C 4E70A 3BR3A 2XAQA 1X1AA 1TTYA 4UNOA 4UY8I 3OL3A 1DUXC 2EQRA 4L18B 2XPUA 3VSLA 5B3SH 3LFKA 3CLOA 3OR1C 3VOEA 2JRMA 5IY5H 1MBGA 3EDPA 4G6DA 4PCQA 3JSPA 2HDCA 5KAFC 2JVGA 4YRVA 3OYGA 5F0HA 3ZP5A 2WAQN 1IUFA 4KN7X 4KN4X 2YPRA 4XL9A 2E34A 4DZJA 3CCLI 3PIPF 2GXGA 1E3PA 2EZIA 1NK3P 3E1SA 4L5JA 2F5EA 1XB4A 2UXNA 3GO5A 3RSNA 2DOFA 3V7SA 2OCCH 3HRSA 3I64A 3VYSB 4OAYA 4MIMA 1YO5C 4UUVA 4IPAA 5J1UA 1NG7A 2MA3A 4XIDA 1FT9A 2YS9A 1TQMA 1K79A 3TO7A 4NDLA 3JSOA 3R60A 3GX4X 1UHMA 2M45A 2Y9ZA 1Y1WJ 2CQKA 2M7AA 3ZQ7A 1WI3A 4CYCB 4QIWN 2VT2A 3A0HC 3HHHA 3CO6C 4GFBA 4RLQA 1Z05A 3QRFF 3HOWJ 3HTSB 2XAFA 2M30A 1RESA 2XROA 2M3AA 4Q47A 1X3ZB 3JRHA 3HHGA 2EIMH 4K2EA 3G6EI 2L7ZA 4BHPA 1FMVA 3DPUA 2CO5A 3OMYA 3PM1A 3FMSA 5FJ8J 1BI0A 1ITYA 1NK2P 2W84A 5KCMA 1HDPA 4RB3C 4HNVA 1H0MA 3JTHA 2IRFG 3MZYA 2H09A 3T8RA 3MAJA 2YUSA 4P9UA 2KL4A 4EMSA 1YI2I 2NYXA 1TNSA 1ZN2A 4ZTJA 1ZRDA 1R7JA 2DI3A 2QSFX 2MH2A 1PP8F 1S29A 2WV1A 4L9VA 3CCQI 4KNYA 4NNJA 1PP7U 2B7EA 3VYUB 2RGVA 1NH3A 2HQNA 1KU3A 4MFEA 4CUGA 4ENNA 4BE0A 1JJ6C 2JUCA 2NXNB 4UXNA 3D5LA 4IRHA 2QVOA 1FJLA 4BE1A 4R79A 3LQRA 3HOYJ 2WADA 3WTUC 5BQTA 3HOTA 2HVRA 2KJCA 2F4OB 2Y2ZA 4XLAA 3HJEA 5E17F 1ZG1A 4XQFA 3ABTA 1R71A 2GA2A 5EF6A 1IN6A 1ETQA 1WI9A 1IN7A 2ADUA 2ELJA 4RB0A 3ZPLA 2I5UA 1D1CA 4OAZA 5LLQA 1HBXG 1K78A 4XKBA 3MKWB 4YFXF 2XKPA 1JGGA 1XDUA 5E18F 2YX4A 1K4SA 3JRDA 2F4MB 1QPIA 4HV5A 1JUPA 1A35A 1X2NA 2ZBKA 1KYWA 3DTIA 1HW5A 3BJAA 4O5VA 1Z67A 4IRIA 1WJEA 3VYRB 3RCOA 3BJOA 3OIQA 2NOGA 3SZTA 2F5VA 2ZJQF 3ULQB 1FP2A 3VPRA 5AIPA 3GUDA 4KMUX 3QYFA 3AL0B 1X2MA 2K85A 4YIRX 2IS1A 4A3IJ 4O3MA 5L3EA 4MFDA 2MGQA 2K27A 1BOAA 1SD7A 2A61A 4XLCA 3GWZA 2V1XA 4C3IJ 2HFHA 2ISZA 5IP7J 2WB1N 2JPCA 2TCTA 3T5XA 1FPQA 1WHUA 5L3BA 1V3FA 4Z2YA 3CJRB 1I39A 4B47A 1GV2A 2E36A 1WKMA 1MMAA 4E7HA 3BQZA 2QF7A 4JQFA 4XONA 3W2AA 3RQ4A 5FLMJ 1QHHD 3R6SA 2A6TA 4N4OB 4A3FJ 2QZ8A 2R7DA 1DDNA 3OYLA 2AO9A 1F4KA 2X6WA 1UJ8A 2K86A 4HQMA 3QAHA 5KAIC 3GEZA 2HPMA 2VKHA 4CCOA 3KYDB 4JP0A 2IGOA 3H3UA 2G7UA 1NTCA 3GVAA 5ILSA 4LG3A 3UR3C 4N0BA 2EILH 5LEKA 5HDNA 3ZMUA 2W1OA 3WE2A 3J81Z 3BZ6A 2P5VA 4AYBN 4DJAA 3MD2A 1R4MB 4CYCA 1VQ7I 3PNYA 2V26A 2PG4A 2FF4A 3FF5A 4EJUA 5DCMB 1Z9CA 3LOCA 4XMYA 2GOMA 2P6TA 2RNGA 2EA4A 3BLYA 1XCVA 2YSRA 1BIBA 3RIRA 3KYLA 1ACIA 3CCUI 3BCAA 3DKXA 3PNVA 4FX0A 4FQGA 1HDDC 3KP5A 4BY1J 1JHFA 3G1MA 1YS7A 3LSRA 1X1BA 2W48A 4A3EJ 3KP4A 4FE4A 3DF8A 2L2OA 2UUZA 2XUBA 2JUGA 3DBHB 1XGOA 3IWFA 2HU9A 3A0BC 2KT0A 5J1RA 2R7RA 2HGCA 2AXTC 2E5ZA 4IZZA 1MNDA 3S2HJ 1PVEA 4AUXA 2IW5A 1W7PD 1F36A 1BI2A 5GPCA 1WJ5A 3GTKJ 2LRDA 5L3CA 3JREA 1QPMA 2LD5A 2ZB9A 2A5WA 2FEZA 2OQGA 2R92J 2QBYB 4HLXA 3RI4A 3BG5A 4CYDA 4BQOA 1V5GA 1P4XA 3M4OJ 2OPTA 3FIWA 3BP8A 3BWGA 3D5RC 3DLLF 3WHCA 2EINH 2BY3A 1KU2A 1YW9A 4I76A 2Y30A 3RZDJ 3OYBA 2Y75A 4U7DA 1R9TJ 3QP5A 5E79C 4AD9A 1Z91A 2K4BA 4D0PA 4C2UA 5IOZA 1L0OC 4XKVA 4A3GJ 2VOPA 2DMQA 3MN2A 1ZRCA 3L2RA 4XN3A 2XF6A 1HW1A 1Q1HA 1X58A 1Q1VA 1VNDA 4IF4A 1L3LA 4QSHA 2YU9J 2M8EA 1W7PA 2O5RA 3CF2A 3KP3A 1PYVA 1W5TA 2FMYA 3LA3A 3SHFA 3J81K 5IYCJ 1BR4A 5E8GA 1TW3A 4FETA 1MIJA 1ZG5A 2OZ6A 3K1NA 5JVTA 5CQEA 1V54H 5F04A 2NNYA 4II3A 5GAEJ 1W1WE 2CWEA 2KP6A 4XRMA 1U9OA 5CVVA 1LB2A 2HQAA 1HQCA 4OINF 1WCMJ 4HSRA 3SXYA 1AOYA 1GXQA 2GXAA 1Z0XA 2R7VA 4BQAA 2LY2A 2DA6A 1JUSA 1IGNA 5GTHC 4M9XA 3GTMJ 2OQRA 5FKKA 3ZCOA 2OJED 4AWXB 1HKQA 5E3OA 1RUNA 3TO9A 1P2FA 4HF2A 3F8BA 1FOYA 4ENMA 1SVMA 4M3GA 2FJ1A 3VYTB 3H0DA 2JWTA 4DNCA 2XHKA 3V8LA 3QYBA 3CJNA 4UV8A 2KKOA 4EGYA 4LOCA 2L54A 2STWA 2KHMA 4RMNA 4OIQF 3A01A 2L4AA 4Y52J 2P81A 4BH9A 5LFAA 1Z7UA 2PN6A 3PNTA 2DAOA 2DA2A 2IS6A 3GFJA 4HRIA 4C9YA 5IYDJ 2KIQA 2MBFA 3JTGA 1O3RA 4G6TB 1WH5A 3E5UA 4M6VA 2D45A 4UB6C 4HOBA 4MNUA 4BNCA 3F3XA 3HOVJ 2A69F 2L9VA 4IHTA 1SD6A 3FK6A 4Y13A 2M9HA 1Z7LA 2BW3B 4I6ZA 3K70C 1ZG3A 3EYIA 4EM0B 5DCMA 1J9IA 3L00A 1FSHA 5E1WA 2HOAA 4HA8A 3D0SA 2LKPA 4AU7A 1S9HA 1A31A 4E7ZA 3QODA 5CKTA 1DGWY 2R7SA 5HS7A 4ZYGA 3CDIA 4XM3A 5FRMA 2LKXA 1TQIA 1ZR2A 2Z9OA 4FE7A 3U9GA 2VQCA 9ANTA 4L9JA 2O0YA 1ETVA 2ZFUA 3D1NI 3LAPA 5EEAA 2E1MC 3TGNA 1APLC 2NNNA 2FNAA 4HSTA 3O3KA 3OS0A 2V7FA 1BI3A 4F91B 3CCYA 3CCJI 2L01A 4KICA 3CJTB 2HOSA 3W2WA 5FLXZ 2P7VB 3KFWX 2P7CB 3GXOA 3DU5A 2X51A 2FOWA 1ZTRA 4PJNA 1ZREA 2EV0A 3Q0UA 3QOPA 2QBYA 1FBQA 4E7KA 5GTIC 3ZMVA 2JA7J 2JN6A 2LK2A 2CSOA 2L7FP 4J01A 1W4MA 3M8JA 4QTRA 5FKNA 2RNJA 2E1OA 2BVMA 3IP4B 3HBLA 4AIKA 1SFEA 5TRDA 2XAJA 3C2HA 4MO7A 5J40A 4ZDOA 2FRHA 2W82A 2K9MA 1ZAOA 2FX0A 1SFUA 1ZARA 4E7LA 1YLFA 2OD5A 3PSFA 2UXXA 2VPRA 3TDZC 3U1KA 3F8MA 5EZHA 3U21A 2VONA 2VUMJ 3CC7I 1SAUA 4E4HA 5TGTA 2LG4A 4Y15A 2LYCA 3HKZA 3DP7A 3ONQA 3OSGA 1OFCX 4M71A 3GTQJ 4JX5A 3TP3A 1QRYA 3FHZA 3R0JA 1LVKA 4HPQA 4HYEA 1K7AA 1XN7A 5F1JA 3FXKA 1KGSA 5HOOA 1O3QA 4HX4A 2KDOA 2ZJPF 3W6KB 2K3FA 4G8XA 1IAWA 2RVCA 4Y4RA 1JTXA 4RGUA 2VBXA 2EWNA 4G94A 2LBFB 1MJAA 1SMYF 2VQGA 4GXOA 4D7MA 3F8CA 3ZXSA 2DK8A 4EGZA 2R5ZB 3S3OA 4GDFA 2LLKA 4ZJZA 4F92B 4RAGA 1WGXA 2L7MP 3SQNA 2LREA 1T95A 1HA8A 3J7AY 4IOAF 2K9NA 1OKRA 1LJ9A 2X0LA 5DDGA 2HZDA 3ZQFA 3MKYB 3N05A 2CJJA 3IHUA 5FLXK 4U0WA 3IH4A 1YE9A 5FLVA 2CQ7A 2XF7A 1LQ1A 2COBA 4LK0F 3K4MA 3DPLC 2M4KA 3CMYA 1MDMB 3BTCA 2XB5A 2B0LA 2KISA 3ABMH 4E7JA 3B02A 3SDGA 3D5SC 2Y0SA 3P9KA 4HDVA 2EH3A 2HDDA 3CP8A 5DD4A 2MC3A 3VB2A 1YJWI 1P92A 1IN4A 2DT7B 2CG4A 2E60A 4HQEA 2HOEA 1WFXA 3IAS2 2JQ7A 3KIOA 1WRJA 1QZEA 3HIFA 3HM5A 2DA1A 1Z21A 2NS7A 3OYNA 3B6CA 2MABA 4BGDA 3WTZA 3A02A 1MMNA 3FXQA 5TISC 4H0EA 3F22A 3GFMA 4R8HA 3HPGA 3MEXA 3PIOF 4A3DJ 3CUQC 2Q8KA 5IT3A 4BACA 1RC9A 2BW3A 2ZXJA 5GAGJ 3DTEA 2OC6A 1LDDA 2WAFA 1ZKGA 1IV6A 3OSFA 3RQIA 4BJ6C 1O3TA 3WTYC 1FSEA 3EETA 4XRFA 3CMAI 1MBJA 4FHTA 3CCSI 4JX4A 3GZ6A 3ERED 1P6RA 1BC8C 1OYWA 5HLGA 5FKOA 2E2HJ 3ASNH 5HLTA 1XDSA 2I10A 3BC8A 1WWXA 3DKYA 3DQVC 5E1XA 4WWCA 2CUJA 3FWEA 2F48A 2KDZA 3L2UA 1NHAA 2R7OA 1Z1DA 2DMTA 3L7WA 3CMMA 3W6VA 4HAMA 2FU4A 1ZGAA 1YFHA 3S2DJ 3J7YJ 3ZRGA 4BKXA 3ABKH 3E6CC 2NAZA 2DQLA 5H20A 2I8DA 3DKWA 3Q0WA 3HRUA 3V8JA 2W85A 4BJTA 5EEGA 3J80K 1SC7A 2F6CA 3AKZA 2QQ8A 3VFZA 4R1HA 1YJ9I 3I4NJ 1EH7A 2M0MA 2HYGD 2VJJA 4D5CA 3IRQA 2VQHA 1SVOA 2DFHA 1C0WA 1RUOA 5F0FA 4MEXF 4M6YA 3PQJA 1WJBA 1EKEA 1RIOH 2RREA 1P7IA 5DCFA 4BEHB 1F1ZA 5FD6A 2WTEA 1A5JA 2KJBA 1FBSA 4BUPA 4IHXA 3C2BA 4CCLA 2DDBA 2K02A 2JZYA 4P1WA 2CW7A 3KP2A 3GMEA 4F55A 1F9NA 2HDWA 4EEFG 1YRNA 1J09A 2EV5A 2E7XA 3ZQGA 5L3GA 2AQEA 3ISPA 1IC8A 4IHSA 4BYYA 5DYMA 3PQKA 5K7FA 3P9CA 2BY2A 2OF7A 1GDTA 3A03A 1R36A 2IAIA 1LNWA 1TC3C 1ZH5A 3ELKA 1LE8B 1YW8A 2LBFA 3BCBA 2EB7A 5C4JJ 3JRCA 2R5ZA 5BPDA 1XTAA 4W1UA 2IT0A 2AXLA 4LD5A 4B3XA 3CQZJ 3IRRA 1RKWA 1MNMC 1D8JA 4L5EA 2Q0OA 4LLGF 3R4KA 2EFOA 3FM3A 4IOCF 2A68F 3PO3J 3QU3A 4MEYF 5J4YA 1YIOA 4BQQA 2O03A 4U7BA 2JSCA 4Q5SF 1K61A 2CQNA 2X9DA 2FOKA 2RKHA 2VKEA 1X1CA 4C3HJ 1XSVA 3HOXJ 2KZVA 4FISA 1MDMA 3GF2A 3LSMA 4JX6A 2XDVA 3MCZA 4QPOA 2X4HA 4B8XA 1QU3A 3WHBA 3T0YA 2XSJC 4U88A 2DXIA 4B1RA 5DUIA 4B09A 2FD5A 1D1AA 4YFKF 4A3CJ 5EGOB 2E71A 3GW2A 2Z99A 5K7ZA 1G6NA 3KZYA 3ASOH 2DFEA 3C2GA 2V1UA 2GXBA 1V5FA 2BVLA 1OCRH 2VE8A 1QQIA 4A3MJ 2PMZA 2GA1A 5IP9J 4IHVA 2JA8J 2CQXA 3HKZN 3ZQCA 4CZCA 1TWHJ 1XMAA 1YW7A 1U0JA 2ZMEC 3WTXC 3GLLA 1VTNC 3IWZA 3G1OA 1STZA 2FXAA 1T39A 2UWMA 2B9SA 1TNTA 3K4KA 4XBFA 5JLWA 4I0BA 1XC5A 5H2FC 5GAHJ 2OBPA 2ZSHB 3GTJJ 3O8HA 5HNFA 3V8KA 1LFPA 1SVLA 2FUG2 2IEKA 4HF1A 1FEXA 1GUUA 1GXPA 1IXSB 4XN0A 1FOXA 4I0AA 2PEXA 2M8GX 2M1BA 1JGSA 3CESA 1QO0D 1YG2A 5F6FA 1ZELA 2OTJI 3V7RA 2GZWA 4P55A 3MWMA 5E20A 4B48A 1TWGJ 3M1CA 1W36D 4LITA 1H89C 5F1RA 1YIJI 2LY9A 4ZZLA 4LLLA 3VSKA 4XRSG 2H1KA 2DTZA 4G7HF 3S32A 2JA5J 4U87A 3RJPA 3OYJA 2Y0SN 2L7KA 4JYKA 2K9SA 1JT0A 2CW8A 3KETA 4M3FA 1MBEA 2QM3A 1VQKI 2QSGX 3FBNB 4DOZA 2Q1ZB 4LIUA 3BR6A 5LGUA 2BY0A 1GVDA 2NVUB 4V2GA 1VQ6I 2J5OA 4BEHA 4DBQA 1FTTA 1HC8A 2E1CA 3DPTA 4NC6A 3N4MA 3OYEA 4MHGA 2Z16A 3C18A 1OR7A 4FASD 4PUSA 1RNLA 1WJDA 5LGNA 1SFXA 4RB2C 1S7AA 1WQ2A 4CA0A 2QLZA 1M1EB 2LTPA 3I3LA 4D7NA 3MVPA 2WY7Q 5TJJA 1WJAA 3COAC 2KQRA 1Y8QB 2HPIA 5M5WJ 3I56I 3KLNA 1LE8A 3WTWC 1D3YA 1VQPI 3FZVA 5E3LA 4AM3A 3C1DA 4ESFA 2ME6A 1I6HJ 2CS3A 3KCCA 3K4JA 4NC8A 2V4JC 2W25A 3S1MJ 2EFWA 2HS5A 3OS2A 4L5IA 5BMZA 2L9NA 3OY9A 4Q4ZF 3J7AO 2O3FA 2ME0A 2H8WA 1TW2A 3P7NA 2V6EA 1GV5A 3LSJA 5JFRA 3P5JA 4FTHA 1XGNA 1ERDA 2QQBA 1BW5A 2NVYJ 3NWSA 4DZPA 2QYOA 5D8KB 3FKIJ 3PSIA 4L9TA 3H9JA 1BR2A 2IA2A 1E3OC 1MSFC 1VF9A 3FX3A 2O7OA 4BHCA 3M1EA 3O2PE 2LVSA 5JR3A 2P6SA 4PJMA 3TEDA 1WSUA 1K4TA 5EGOA 2KRCA 1QZYA 2MC4A 3FMRA 1GT0C 2OU2A 4BHBA 3EUKL 1O4XA 2ELKA 1DPUA 5ILVA 3LA2A 1D5VA 1HOMA 4A93J 1E2XA 1MH3A 1ZYRF 3G4SI 3DLAA 4BDZA 5EYRA 4L0YB 4LGWA 4MTDA 2DJIA 4PJ0C 2X1CA 4N9IA 2QA4I 2TDXA 2O6GE 2VC1A 1WJCA 2FMLA 2OUMA 2PLYA 2HTSA 5FKMA 1QGPA 5IYBJ 3HEFA 2HXIA 2RAEA 3LNQA 2VPLA 5JVGF 5FFXA 2X85A 4MLOA 3RTRA 1HKTA 1MZBA 3KPHA 4ETSA 1LVAA 5J47A 3SFIA 2E2IJ 1G3YA 4EV0A 3IH2A 3F23A 3BZKA 3K7AJ 4JOMA 4ZYAA 1GLNA 3NEUA 1BM9A 2FBIA 5F64A 3E5XA 3KLOA 1BA5A 1V5EA 1W0UA 2NVXJ 1Y1VJ 4A3BJ 4L9NA 3DV8A 3LWFA 1VQ8I 4RAYA 3OYCA 4OOIA 2CUEA 2M87A 4XKCA 1XD7A 3Q9SA 4GRIA 2D1HA 2ZMEB 1BW6A 4XLFA 1KZHA 2W4SA 4RAZA 3KZZA 2BXZA 3QP6A 3HPHA 1I27A 2M7BA 2P4WA 1OCCH 4HG2A 2AQFA 2CH0A 4XLEA 1G59A 2Z3YA 4ESJA 1FZPB 4ZYEA 2ID6A 2RV8A 4YG2F 1W0TA 1K6OA 1JE8A 1ZQ3P 2BYVE 2DOEA 2IGNA 3MQ0A 1Z77A 4WXDA 3TMOA 5FD5A 5KVRA 5EDNA 1HW2A 1ULYA 1MBFA
chains in the Genus database with same CATH topology
3H3VK 3OSGA 1OFCX 3GTQJ 1OJLA 4JX5A 2PMZN 3TP3A 1QRYA 4FCYA 1DU0A 2NVTJ 1I3QJ 2N8GA 3ZQHA 2ECBA 2JJ7A 5F1JA 3HDDA 1G2HA 4C3JJ 2LR8A 5C44J 5E3NA 1HLVA 1RPWA 1ENHA 1MBKA 1P7JA 2X48A 3JRAA 1MSEC 3ZQLA 4M3DA 2B63J 3JRGA 1RR7A 3B6AA 1JTXA 3MKLA 3BR3A 3S15J 4D7MA 3HGYA 2R5ZB 2EQRA 2LLKA 1JUMA 2XPUA 1JTYA 1S7EA 1WGXA 2L7MP 1HF0A 1MBGA 2K9NA 2XGEA 3ZQFA 3BR5A 4M3EA 2CJJA 2CQQA 3IH4A 3FISA 5F0CA 5F0HA 3Q0VA 5FLVA 5C4XJ 1OCTC 3BTLA 2WAQN 2COBA 1IUFA 1JKRC 3I4MJ 3CMYA 2DMUA 1LFUP 4DZJA 4IHYA 3BTCA 2XB5A 1RETA 2EZIA 3SDGA 1NK3P 2EH3A 2HDDA 5FKLA 3JRBA 1ETKA 3S16J 4MIMA 1LFBA 2M2EA 3JRIA 5J1UA 4XIDA 2YS9A 3A01B 4NDLA 2JK3A 3HM5A 2DA1A 2NS7A 3B6CA 1Y1WJ 2Y9ZA 1SANA 3A02A 1WI3A 4CYCB 4QIWN 2DMPA 5IPAA 4A3DJ 4GFBA 2O8KA 3HOWJ 3G1LA 5HODA 1U78A 3M3YJ 1ZKGA 1IV6A 3OSFA 3RQIA 1RESA 2HQ5A 5JLXA 2FQ4A 2MSYA 3JRHA 2VI6A 4BY7J 1MBJA 2L7ZA 4JX4A 4A69C 1I50J 2EZKA 2QCOA 2TRTA 4A3KJ 3GTGJ 3PM1A 5FKOA 5FJ8J 1U8BA 1ITYA 2L0KA 2CU7A 1NK2P 2E2HJ 1UHSA 1HDPA 2I10A 4HNVA 1QVUA 5J3LA 2XSDC 2KDZA 2YUSA 1F43A 2DMTA 2D5VA 3W6VA 2DA5A 2WV1A 2R93J 3S2DJ 3NARA 3PO2J 4W97A 4A3LJ 4BKXA 3BG9A 3UKGA 2ID3A 1A6IA 4MFEA 5M3MJ 4B4CA 3Q0WA 1JT6A 1JJ6C 5K7HA 1CQTA 1U9NA 2M0CA 2M34A 4S0HB 1FJLA 1POGA 3O8GA 2XPVA 1UG2A 4V2FA 1AU7A 1VFCA 3HOYJ 3TW7A 3I4NJ 1ETXA 2XGDA 2Y2ZA 4D5CA 4DYRA 1B72A 3S1NJ 3S1QJ 5EF6A 1ETQA 5F0FA 3BQYA 1P7IA 3ZQIA 3GTPJ 2EZLA 1A5JA 4IHXA 5M5XJ 3C2BA 1OCPA 2K40A 2R7ZJ 1JGGA 3TP0A 4EEFG 1YRNA 3QPLA 3HOUJ 3JRDA 3FK7A 1QPIA 3ZQGA 1JUPA 1IC8A 1X2NA 5EG0B 3GTLJ 3OOUA 2ECCA 5K7FA 3BR0A 3CDLA 2OF7A 1GDTA 3A03A 2DJNA 1VI0A 1FIPA 2IAIA 1TC3C 5M3FJ 2NOGA 1LE8B 3L1PA 3VPRA 5C4JJ 4M3BA 3JRCA 2R5ZA 4RDUA 1T56A 4W1UA 1X2MA 3CQZJ 1RKWA 1MNMC 4L5EA 4A3IJ 4MFDA 1JKQC 3PO3J 3LSPA 2MGQA 3LSGA 2O9LA 1FTZA 2GLOA 4C3IJ 3JRFA 1K61A 2X9DA 5IP7J 1QVTA 2WB1N 2VKEA 2TCTA 4C3HJ 3HOXJ 3QPSA 1H8AC 4FISA 4XRSA 1GV2A 4JX6A 1IJWC 4BXXJ 1ZR4A 3BQZA 2QF7A 1B8IB 5FLMJ 4J19A 3BR2A 3RZOJ 3WHBA 4B1RA 2HI3A 4A3FJ 2AO9A 1TWAJ 2FD5A 3DEWA 4A3CJ 5EGOB 5GP9A 2XPWA 2Y31A 4JP0A 5K7ZA 1NTCA 5DTDA 1EF4A 2E2JJ 4AYBN 1K83J 4ABZA 2JMWA 4CYCA 1ZGWA 4A3MJ 5IP9J 4IHVA 2JA8J 2CQXA 3HKZN 3S14J 3ZQCA 2R0QC 3LOCA 1AHDP 4IHWA 2XGCA 4UUSB 1TWHJ 1PUFB 3TW6A 2DA4A 3G1OA 1HDDC 4BY1J 3G1MA 3LSRA 2W48A 4A3EJ 4FE4A 4AC0A 5JLWA 1IDZA 1XC5A 1XS9A 3GTJJ 3O8HA 2HYJA 2KT0A 4C2MJ 5J1RA 3SJMA 1MH4A 2IEKA 2NS8A 5GPAA 2R5YB 1GUUA 1SFOJ 2LP0A 1FEXA 4IEJA 3S2HJ 4AUXA 1F36A 5F27A 2M8GX 5GPCA 3GTKJ 1TWCJ 3JREA 2LD5A 2ZB9A 2R92J 1TWGJ 1H89C 2H8RA 2LY9A 3GTOJ 3BG5A 4XRSG 2LFBA 5M5YJ 2OPTA 5E3MA 2H1KA 3M4OJ 1ETOA 1JKOC 2DTZA 3FIWA 3BTJA 2DA7A 3WHCA 2JA5J 2E19A 2K9QA 4I76A 2Y0SN 2Y30A 3RZDJ 4JYKA 2K9SA 1JT0A 1R9TJ 4M3FA 1MBEA 5IOZA 4A3GJ 2DMQA 3MN2A 1DU6A 2CRGA 3BR6A 1X58A 1AKHB 3NAUA 4DYCA 3JR9A 1GVDA 1Q1VA 1VNDA 5DS9A 4QSHA 4V2GA 2YU9J 1FTTA 5IYCJ 1TWFJ 4X1EA 2IBDA 5F08A 2GM4A 5F04A 3S1RJ 2LTPA 4XRMA 1YRNB 5EG0A 1U9OA 4D7NA 3E7LA 3MVPA 2GBYA 3ZOBA 1WCMJ 5M5WJ 4RBOA 1LE8A 1Z0XA 3RKQA 5E3LA 4UUTA 2DA6A 1JUSA 1JJ8C 2EBIA 2ME6A 1IGNA 1I6HJ 2NVQJ 3GTMJ 3S1MJ 5FKKA 5IP6A 5E3OA 2L9RA 1RKTA 1H88C 2EZHA 2XRLA 2ME0A 1GV5A 4M3GA 3LSJA 2DMNA 2FJ1A 3HB9A 4BBRJ 2JWTA 4FTHA 3Q3SA 1IG7A 2HOTA 1BW5A 2NVYJ 3S17J 2MW8A 1UMQA 4DZPA 4LOCA 1B8IA 2VKVA 3FKIJ 3A01A 3IV5A 4Y52J 2P81A 1E3OC 1MSFC 1VF9A 2O7OA 5BNGA 2LVSA 3BG3A 3TEDA 2DA2A 5EGOA 4DYQA 1GT0C 3DCFA 3HGGA 5EZGA 4BBSJ 1O4XA 2ELKA 5IYDJ 1WH5A 4M6VA 1HOMA 4A93J 2DA3A 4DW6A 1JKPC 2AHQA 1ORKA 3HOVJ 5C3EJ 1MH3A 3QQAA 5EYRA 3FK6A 4G12A 2M9HA 4I6ZA 1D5YA 3IH3A 2HOAA 4UUSA 1HCRA 1IDYA 1PUFA 1FIAA 3OIOA 3K2AA 5FKMA 2LKXA 1ZR2A 2DN0A 4FE7A 5IYBJ 9ANTA 3HEFA 1BL0A 2HXIA 1XG1A 1ETVA 2RAEA 3LNQA 3D1NI 5J1YA 5EEAA 5IOYA 4X6AJ 4MLOA 1APLC 2Y9YA 3SFIA 4B3AA 2XB0X 2R5YA 3CCYA 2E2IJ 3BR1A 4A3JJ 3IH2A 1IRZA 2HOSA 1T33A 3K7AJ 3H0GJ 1MBHA 3BT9A 3HOZJ 3GBGA 1BA5A 1W0UA 1WH7A 2NVXJ 1Y1VJ 4A3BJ 3BTIA 1ZTRA 3Q0UA 1BJZA 2CUEA 2JA7J 2JN6A 2LK2A 4Y7NJ 2L7FP 4QTRA 5FKNA 2JA6J 2E1OA 4XICA 1BW6A 3HBLA 1ETYA 1ZK8A 4MO7A 2G0EA 2HXOA 2FX0A 2MG4A 1B72B 1WPKA 4D5FA 1AKHA 2VPRA 2X6OA 2ID6A 1W0TA 5EZHA 1ZQ3P 2VUMJ 1ETWA 2CUFA 4XK4A 1Z77A 5EDNA 3F0CA 1MBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V K;  3OSG A;  1OFC X;  3GTQ J;  1OJL A;  4JX5 A;  2PMZ N;  3TP3 A;  1QRY A;  4FCY A;  1DU0 A;  2NVT J;  1I3Q J;  2N8G A;  3ZQH A;  2ECB A;  2JJ7 A;  5F1J A;  3HDD A;  1G2H A;  4C3J J;  2LR8 A;  5C44 J;  5E3N A;  1HLV A;  1RPW A;  1ENH A;  1MBK A;  1P7J A;  2X48 A;  3JRA A;  1MSE C;  3ZQL A;  4M3D A;  2B63 J;  3JRG A;  1RR7 A;  3B6A A;  1JTX A;  3MKL A;  3BR3 A;  3S15 J;  4D7M A;  3HGY A;  2R5Z B;  2EQR A;  2LLK A;  1JUM A;  2XPU A;  1JTY A;  1S7E A;  1WGX A;  2L7M P;  1HF0 A;  1MBG A;  2K9N A;  2XGE A;  3ZQF A;  3BR5 A;  4M3E A;  2CJJ A;  2CQQ A;  3IH4 A;  3FIS A;  5F0C A;  5F0H A;  3Q0V A;  5FLV A;  5C4X J;  1OCT C;  3BTL A;  2WAQ N;  2COB A;  1IUF A;  1JKR C;  3I4M J;  3CMY A;  2DMU A;  1LFU P;  4DZJ A;  4IHY A;  3BTC A;  2XB5 A;  1RET A;  2EZI A;  3SDG A;  1NK3 P;  2EH3 A;  2HDD A;  5FKL A;  3JRB A;  1ETK A;  3S16 J;  4MIM A;  1LFB A;  2M2E A;  3JRI A;  5J1U A;  4XID A;  2YS9 A;  3A01 B;  4NDL A;  2JK3 A;  3HM5 A;  2DA1 A;  2NS7 A;  3B6C A;  1Y1W J;  2Y9Z A;  1SAN A;  3A02 A;  1WI3 A;  4CYC B;  4QIW N;  2DMP A;  5IPA A;  4A3D J;  4GFB A;  2O8K A;  3HOW J;  3G1L A;  5HOD A;  1U78 A;  3M3Y J;  1ZKG A;  1IV6 A;  3OSF A;  3RQI A;  1RES A;  2HQ5 A;  5JLX A;  2FQ4 A;  2MSY A;  3JRH A;  2VI6 A;  4BY7 J;  1MBJ A;  2L7Z A;  4JX4 A;  4A69 C;  1I50 J;  2EZK A;  2QCO A;  2TRT A;  4A3K J;  3GTG J;  3PM1 A;  5FKO A;  5FJ8 J;  1U8B A;  1ITY A;  2L0K A;  2CU7 A;  1NK2 P;  2E2H J;  1UHS A;  1HDP A;  2I10 A;  4HNV A;  1QVU A;  5J3L A;  2XSD C;  2KDZ A;  2YUS A;  1F43 A;  2DMT A;  2D5V A;  3W6V A;  2DA5 A;  2WV1 A;  2R93 J;  3S2D J;  3NAR A;  3PO2 J;  4W97 A;  4A3L J;  4BKX A;  3BG9 A;  3UKG A;  2ID3 A;  1A6I A;  4MFE A;  5M3M J;  4B4C A;  3Q0W A;  1JT6 A;  1JJ6 C;  5K7H A;  1CQT A;  1U9N A;  2M0C A;  2M34 A;  4S0H B;  1FJL A;  1POG A;  3O8G A;  2XPV A;  1UG2 A;  4V2F A;  1AU7 A;  1VFC A;  3HOY J;  3TW7 A;  3I4N J;  1ETX A;  2XGD A;  2Y2Z A;  4D5C A;  4DYR A;  1B72 A;  3S1N J;  3S1Q J;  5EF6 A;  1ETQ A;  5F0F A;  3BQY A;  1P7I A;  3ZQI A;  3GTP J;  2EZL A;  1A5J A;  4IHX A;  5M5X J;  3C2B A;  1OCP A;  2K40 A;  2R7Z J;  1JGG A;  3TP0 A;  4EEF G;  1YRN A;  3QPL A;  3HOU J;  3JRD A;  3FK7 A;  1QPI A;  3ZQG A;  1JUP A;  1IC8 A;  1X2N A;  5EG0 B;  3GTL J;  3OOU A;  2ECC A;  5K7F A;  3BR0 A;  3CDL A;  2OF7 A;  1GDT A;  3A03 A;  2DJN A;  1VI0 A;  1FIP A;  2IAI A;  1TC3 C;  5M3F J;  2NOG A;  1LE8 B;  3L1P A;  3VPR A;  5C4J J;  4M3B A;  3JRC A;  2R5Z A;  4RDU A;  1T56 A;  4W1U A;  1X2M A;  3CQZ J;  1RKW A;  1MNM C;  4L5E A;  4A3I J;  4MFD A;  1JKQ C;  3PO3 J;  3LSP A;  2MGQ A;  3LSG A;  2O9L A;  1FTZ A;  2GLO A;  4C3I J;  3JRF A;  1K61 A;  2X9D A;  5IP7 J;  1QVT A;  2WB1 N;  2VKE A;  2TCT A;  4C3H J;  3HOX J;  3QPS A;  1H8A C;  4FIS A;  4XRS A;  1GV2 A;  4JX6 A;  1IJW C;  4BXX J;  1ZR4 A;  3BQZ A;  2QF7 A;  1B8I B;  5FLM J;  4J19 A;  3BR2 A;  3RZO J;  3WHB A;  4B1R A;  2HI3 A;  4A3F J;  2AO9 A;  1TWA J;  2FD5 A;  3DEW A;  4A3C J;  5EGO B;  5GP9 A;  2XPW A;  2Y31 A;  4JP0 A;  5K7Z A;  1NTC A;  5DTD A;  1EF4 A;  2E2J J;  4AYB N;  1K83 J;  4ABZ A;  2JMW A;  4CYC A;  1ZGW A;  4A3M J;  5IP9 J;  4IHV A;  2JA8 J;  2CQX A;  3HKZ N;  3S14 J;  3ZQC A;  2R0Q C;  3LOC A;  1AHD P;  4IHW A;  2XGC A;  4UUS B;  1TWH J;  1PUF B;  3TW6 A;  2DA4 A;  3G1O A;  1HDD C;  4BY1 J;  3G1M A;  3LSR A;  2W48 A;  4A3E J;  4FE4 A;  4AC0 A;  5JLW A;  1IDZ A;  1XC5 A;  1XS9 A;  3GTJ J;  3O8H A;  2HYJ A;  2KT0 A;  4C2M J;  5J1R A;  3SJM A;  1MH4 A;  2IEK A;  2NS8 A;  5GPA A;  2R5Y B;  1GUU A;  1SFO J;  2LP0 A;  1FEX A;  4IEJ A;  3S2H J;  4AUX A;  1F36 A;  5F27 A;  2M8G X;  5GPC A;  3GTK J;  1TWC J;  3JRE A;  2LD5 A;  2ZB9 A;  2R92 J;  1TWG J;  1H89 C;  2H8R A;  2LY9 A;  3GTO J;  3BG5 A;  4XRS G;  2LFB A;  5M5Y J;  2OPT A;  5E3M A;  2H1K A;  3M4O J;  1ETO A;  1JKO C;  2DTZ A;  3FIW A;  3BTJ A;  2DA7 A;  3WHC A;  2JA5 J;  2E19 A;  2K9Q A;  4I76 A;  2Y0S N;  2Y30 A;  3RZD J;  4JYK A;  2K9S A;  1JT0 A;  1R9T J;  4M3F A;  1MBE A;  5IOZ A;  4A3G J;  2DMQ A;  3MN2 A;  1DU6 A;  2CRG A;  3BR6 A;  1X58 A;  1AKH B;  3NAU A;  4DYC A;  3JR9 A;  1GVD A;  1Q1V A;  1VND A;  5DS9 A;  4QSH A;  4V2G A;  2YU9 J;  1FTT A;  5IYC J;  1TWF J;  4X1E A;  2IBD A;  5F08 A;  2GM4 A;  5F04 A;  3S1R J;  2LTP A;  4XRM A;  1YRN B;  5EG0 A;  1U9O A;  4D7N A;  3E7L A;  3MVP A;  2GBY A;  3ZOB A;  1WCM J;  5M5W J;  4RBO A;  1LE8 A;  1Z0X A;  3RKQ A;  5E3L A;  4UUT A;  2DA6 A;  1JUS A;  1JJ8 C;  2EBI A;  2ME6 A;  1IGN A;  1I6H J;  2NVQ J;  3GTM J;  3S1M J;  5FKK A;  5IP6 A;  5E3O A;  2L9R A;  1RKT A;  1H88 C;  2EZH A;  2XRL A;  2ME0 A;  1GV5 A;  4M3G A;  3LSJ A;  2DMN A;  2FJ1 A;  3HB9 A;  4BBR J;  2JWT A;  4FTH A;  3Q3S A;  1IG7 A;  2HOT A;  1BW5 A;  2NVY J;  3S17 J;  2MW8 A;  1UMQ A;  4DZP A;  4LOC A;  1B8I A;  2VKV A;  3FKI J;  3A01 A;  3IV5 A;  4Y52 J;  2P81 A;  1E3O C;  1MSF C;  1VF9 A;  2O7O A;  5BNG A;  2LVS A;  3BG3 A;  3TED A;  2DA2 A;  5EGO A;  4DYQ A;  1GT0 C;  3DCF A;  3HGG A;  5EZG A;  4BBS J;  1O4X A;  2ELK A;  5IYD J;  1WH5 A;  4M6V A;  1HOM A;  4A93 J;  2DA3 A;  4DW6 A;  1JKP C;  2AHQ A;  1ORK A;  3HOV J;  5C3E J;  1MH3 A;  3QQA A;  5EYR A;  3FK6 A;  4G12 A;  2M9H A;  4I6Z A;  1D5Y A;  3IH3 A;  2HOA A;  4UUS A;  1HCR A;  1IDY A;  1PUF A;  1FIA A;  3OIO A;  3K2A A;  5FKM A;  2LKX A;  1ZR2 A;  2DN0 A;  4FE7 A;  5IYB J;  9ANT A;  3HEF A;  1BL0 A;  2HXI A;  1XG1 A;  1ETV A;  2RAE A;  3LNQ A;  3D1N I;  5J1Y A;  5EEA A;  5IOY A;  4X6A J;  4MLO A;  1APL C;  2Y9Y A;  3SFI A;  4B3A A;  2XB0 X;  2R5Y A;  3CCY A;  2E2I J;  3BR1 A;  4A3J J;  3IH2 A;  1IRZ A;  2HOS A;  1T33 A;  3K7A J;  3H0G J;  1MBH A;  3BT9 A;  3HOZ J;  3GBG A;  1BA5 A;  1W0U A;  1WH7 A;  2NVX J;  1Y1V J;  4A3B J;  3BTI A;  1ZTR A;  3Q0U A;  1BJZ A;  2CUE A;  2JA7 J;  2JN6 A;  2LK2 A;  4Y7N J;  2L7F P;  4QTR A;  5FKN A;  2JA6 J;  2E1O A;  4XIC A;  1BW6 A;  3HBL A;  1ETY A;  1ZK8 A;  4MO7 A;  2G0E A;  2HXO A;  2FX0 A;  2MG4 A;  1B72 B;  1WPK A;  4D5F A;  1AKH A;  2VPR A;  2X6O A;  2ID6 A;  1W0T A;  5EZH A;  1ZQ3 P;  2VUM J;  1ETW A;  2CUF A;  4XK4 A;  1Z77 A;  5EDN A;  3F0C A;  1MBF A; 
#chains in the Genus database with same CATH topology
 1I3A A;  4A5M A;  2PMZ N;  4DGW B;  2N8G A;  3BRO A;  2XC7 A;  5H6Q A;  1MD0 A;  2ECB A;  2JJ7 A;  4Y17 A;  3EYY A;  4C3J J;  5C44 J;  3K2Z A;  1D0Y A;  5E3N A;  1RPW A;  1ENH A;  2IA1 A;  2QKL B;  2X48 A;  3JRA A;  3F6O A;  1MSE C;  2Y69 H;  1R22 A;  1Z3Y A;  4IXA A;  4ON0 A;  2B63 J;  1AWC A;  3MKL A;  2DO7 A;  4HEA 2;  5A2Q Z;  3S15 J;  1OCO H;  1FBU A;  3VWB A;  1Y0N A;  5E1Z B;  3QPT A;  1JUM A;  4ZTF A;  1OYY A;  1JTY A;  2IA0 A;  1S7E A;  3DEE A;  1AA7 A;  2G9W A;  2KMU A;  3E6M A;  1H9T A;  1J5Y A;  2ZNY A;  1HF0 A;  1UG0 A;  2GIZ A;  4IQJ A;  1O57 A;  3BR5 A;  4M3E A;  4CCJ A;  5LGT A;  4I2O A;  1T0F A;  3Q0V A;  1OCT C;  1T8I A;  2L4M A;  1DP3 A;  3I4M J;  3ZMS A;  2KIF A;  2DMU A;  5CVJ A;  1LFU P;  2X6Y A;  4IHY A;  5J4V A;  1VQL I;  5D5X B;  3JW4 A;  2YX7 A;  4G6Q A;  1KU7 A;  1DP7 P;  1YS6 A;  2M2E A;  3SZP A;  3JRI A;  4HF0 A;  2MD0 A;  1A04 A;  4F7Z A;  3K4N A;  2UV1 A;  2IS4 A;  2JK3 A;  5E8I A;  3S2W A;  1FLI A;  2L9S A;  4PGG A;  3WGH A;  4CCK A;  1SAN A;  1SD4 A;  2XIG A;  3FXR A;  1IN8 A;  2ZXH A;  3HL2 A;  5ERI A;  5IPA A;  4EJW A;  1MKM A;  2ZJ2 A;  5B1A H;  3GYH X;  3W2V A;  5HOD A;  3CCE I;  1ONV A;  3M3Y J;  2LY1 A;  4S05 A;  2QWW A;  3TOA A;  3ZN1 A;  5ICE A;  4NBQ A;  3SYT A;  2FQ3 A;  1OPC A;  1H9G A;  2MSY A;  2VI6 A;  4BY7 J;  3I9V 2;  5D5V B;  4A69 C;  1I50 J;  2EZK A;  2TRT A;  5LEJ A;  2ICW G;  4A3K J;  3GTG J;  1Y6I A;  2WV0 A;  5FRO A;  1U8B A;  1VZ0 A;  4CCN A;  1LEA A;  2A3S A;  3DEU A;  2Z2S B;  5J3L A;  2R7F A;  4XR6 A;  3OYH A;  2FNP A;  1F43 A;  3I5U A;  3ZGK A;  4ZH4 F;  2IGK A;  1FC3 A;  2CV2 A;  1FYM A;  4WK8 F;  3E3V A;  1XMK A;  3CC2 I;  3PO2 J;  2LH9 A;  2K3P A;  1I5Z A;  2JT1 A;  2NS0 A;  3HRT A;  2DCE A;  2ID3 A;  3OYF A;  4YIF A;  4OIR F;  1QZZ A;  2M4G A;  4B4C A;  2XGX A;  4LG0 B;  5K7H A;  4JBA A;  3Q5F A;  1YHQ I;  2WAQ A;  1MJB A;  1U9N A;  2RQP A;  5IT9 Z;  2ESN A;  1D0Z A;  2Z5U A;  2ZME A;  4RS8 A;  4EAT A;  1N77 A;  3EUH C;  2D2W A;  2Q2E B;  3LSI A;  2XPV A;  4QPQ A;  4V2F A;  2VL8 A;  2L5Q A;  1T38 A;  1AU7 A;  3TW7 A;  2VJI A;  3HSF A;  2XGD A;  4DYR A;  3I53 A;  1KON A;  4M72 A;  4GO1 A;  3S1Q J;  3BQY A;  3KEO A;  4LB6 B;  1IRG A;  2P8T A;  5DEQ A;  3ROU A;  3F6V A;  3E6B A;  1EV7 A;  1YOV B;  2X1E A;  3F8N A;  5HDG A;  3E97 A;  2EZL A;  5EJC A;  1W5S A;  5M5X J;  2NRA C;  2R7U A;  3TDU C;  2VBW A;  1G3T A;  2VN2 A;  3GLX A;  2ISY A;  4HNU A;  4XOT A;  2DOA A;  4D1Q A;  1SD5 A;  1OCZ H;  2R7Q A;  3W6J B;  5ICF A;  1WVR A;  4DQ2 A;  1OQY A;  5DUK A;  5EG0 B;  1ON1 A;  4EM2 A;  1B1B A;  4PZJ A;  5K1Y A;  5D5W B;  2ECC A;  4MTE A;  1ZGJ A;  4UVB A;  4KYW A;  1FOW A;  4CCM A;  1VI0 A;  1FIP A;  4DIQ A;  2V9V A;  2DLL A;  2QQ9 A;  2R4G A;  3FHN A;  3L1P A;  3G73 A;  5LHI A;  4WXC A;  4RDU A;  2MD5 A;  1VQO I;  2IPQ X;  3BOQ A;  2AS5 F;  5LD2 C;  5CVR A;  1JKQ C;  2O9L A;  2ZSI B;  2W7N A;  3DU6 A;  1FTZ A;  4PFP A;  1Y0U A;  1I1S A;  2VXZ A;  3JRF A;  2FBK A;  1QVT A;  3SEZ A;  2P0W A;  1TT5 B;  1OLT A;  1RRJ A;  3QPS A;  3K6G A;  3SEQ A;  3PL8 A;  1H8A C;  1O7L A;  4XRS A;  1IJW C;  1A36 A;  1B8I B;  4XOR A;  1E0E A;  2VOO A;  1DQU A;  4G7Z F;  4J19 A;  3CP2 A;  3ML6 A;  5IT9 K;  3S3M A;  1EJ9 A;  1BN5 A;  2HI3 A;  4HBL A;  2CMP A;  1RZ4 A;  4KMF A;  4M73 A;  1TWA J;  5KHD A;  2R7T A;  2NOJ B;  1XGM A;  1Y39 A;  1U6G A;  1XSX A;  4P96 A;  3CDH A;  2HWV A;  3H92 A;  2QUF A;  5DTD A;  3OIP A;  1EF4 A;  3FMQ A;  4RM2 A;  4I7H A;  1FYK A;  5FB2 A;  2R7X A;  2VKD A;  4ABZ A;  2JMW A;  1ZGW A;  3FM5 A;  5K5Q A;  3CZ6 A;  3CD6 I;  3S14 J;  1R1V A;  4II2 A;  3FBI B;  1AHD P;  4IHW A;  2XGC A;  3FXO A;  3DTK A;  3U2R A;  4EJT A;  1BR1 A;  1EH8 A;  2DA4 A;  3TW6 A;  5ICC A;  5ED4 A;  3CCM I;  1X19 A;  2P5L C;  2JRT A;  4BQN A;  1TT0 A;  4EM1 A;  2QSH X;  3A2K A;  5AON A;  4RAF A;  3TOB A;  5HDK A;  1XMX A;  2RQQ A;  1FX7 A;  1IDZ A;  4D9J A;  1ZLJ A;  2V1N A;  2RC4 A;  2BY1 A;  2VB6 A;  4C2M J;  4BDY A;  1U3E M;  3L2Q A;  1MH4 A;  4I02 A;  3RYR A;  2LSO A;  2EV6 A;  4A0Z A;  2DPU A;  3V4G A;  2W00 A;  2LP0 A;  1Y56 A;  3K69 A;  4IEJ A;  1X4O A;  5F27 A;  3AFH A;  2DT5 A;  3ZQQ A;  2XKO A;  4AIH A;  2H6C A;  1V4R A;  4TV7 A;  1TWC J;  4MQ9 F;  2F5F A;  3MKZ A;  3ZN0 A;  4ITV A;  2EFP A;  2GOX B;  2JA2 A;  2EFN A;  2H8R A;  3GTO J;  3IUO A;  2FE3 A;  3CTA A;  4LG0 A;  1J59 A;  2BHZ A;  2BGC A;  2GAU A;  3LSK A;  1YYV A;  2LFB A;  5M5Y J;  4PFO A;  3TKY A;  3E5Q A;  1P4W A;  1UAA A;  3BTJ A;  2DA7 A;  5J8C A;  2Q2E A;  1R1U A;  1ZRF A;  2PI0 A;  2E19 A;  2OA4 A;  2K9Q A;  3GFL A;  2E1M B;  3WOD F;  3CCV I;  2EK5 A;  2A6H F;  3QPH A;  5LRS A;  1W5C C;  3SDB A;  5K5O A;  2VT3 A;  4P9F A;  1DU6 A;  1DPR A;  4RLF A;  4I98 B;  3KEY A;  2CRG A;  1AKH B;  3KE2 A;  3PFI A;  4DYC A;  4BL0 B;  3T8T A;  5DS9 A;  4ZC3 A;  2HVQ A;  2KRF A;  2IS2 A;  3G3Z A;  2EIK H;  4AYB A;  2DU9 A;  1U2W A;  3GCM A;  1TWF J;  4L0Z B;  4X1E A;  5F08 A;  5L3F A;  4NQW B;  4CIC A;  1XSD A;  3KZI C;  5HS8 A;  5J8F A;  5EG0 A;  1REP C;  5L3D A;  4QLC U;  2GBY A;  2MFZ A;  4NB5 A;  3SFZ A;  3ZOB A;  3I54 A;  1JXS A;  4PJL A;  4UVC A;  1B59 A;  1GVJ A;  1TQP A;  4RBO A;  4X0G A;  3QYE A;  2VBY A;  5CYV A;  5CVU A;  3OL4 A;  4UUT A;  3QWL A;  4ESB A;  2KIU A;  3SZG A;  5AIQ A;  1JJ8 C;  2ZO4 A;  1ODD A;  4OWR B;  2Y48 A;  3DXJ F;  5BOX A;  2O8X A;  3RKY A;  2STT A;  4LB5 A;  1RKT A;  4KIS A;  1KQ9 A;  3PJR A;  2XF5 A;  2FA5 A;  2EZH A;  3CLQ A;  4HW0 A;  2MLK A;  2VJ5 A;  2HVS A;  2DMN A;  3HB9 A;  5D6F A;  4EVI A;  1DGR M;  1IG7 A;  4HNT A;  3HZJ A;  1MMD A;  2MW8 A;  1TL8 A;  3U1D A;  1B8I A;  3G2B A;  2A5Y B;  3A4C A;  4F3Q A;  1SAX A;  4BE2 A;  3K4B A;  3LSH A;  5BNG A;  1CF7 B;  1MJ9 A;  2A6E F;  2BBY A;  3WGG A;  3BG3 A;  3G71 I;  2DPD A;  3C3W A;  2H1L A;  3WU1 B;  3HGG A;  5D8L B;  3V42 A;  4BBS J;  3EPZ A;  4UV9 A;  5DV5 A;  3K70 D;  2DA3 A;  4DW6 A;  2AHQ A;  3IL2 A;  2PX9 A;  3S3N A;  2MYS A;  1HKS A;  5C3E J;  1YQA A;  3RKX A;  4IL6 C;  3L09 A;  1X4P A;  2LNB A;  4G12 A;  1D8K A;  3HYI A;  4EJV A;  1MMG A;  3ZMZ A;  5EEH A;  1N75 A;  1G3S A;  1X3U A;  1D5Y A;  3IH3 A;  1MW7 A;  3V7C A;  2BXY A;  3TO6 A;  4H4K C;  1YTY A;  1IDY A;  1FIA A;  2WA0 A;  2WY8 Q;  2QEX I;  1RR8 C;  4LFU A;  1VQ5 I;  2RDP A;  3HSR A;  2IP2 A;  4RGX A;  2GWR A;  3K2A A;  1R5I D;  2DN0 A;  1EA3 A;  4I99 C;  2ZJR F;  1RI7 A;  4A0Y A;  2F4I A;  1BL0 A;  5K5R A;  2HKX A;  1FY7 A;  5J1Y A;  2W57 A;  5IOY A;  4X6A J;  3MZ8 A;  1LEB A;  1J7K A;  2HTJ A;  3M7G A;  4XSZ F;  2Y9Y A;  3X2Q H;  1YX3 A;  2K9L A;  3DBR B;  2PQ8 A;  2W24 A;  2IGM A;  2XB0 X;  4B3A A;  2EFQ A;  1NG6 A;  4A3J J;  2RN7 A;  2CW0 F;  3CUQ B;  3H9Q A;  3H0G J;  3RKW A;  1MBH A;  1WJF A;  3HOZ J;  3OWT A;  1S72 I;  3GBG A;  5HNH A;  5D4R A;  2X6X A;  4C2T A;  2ZC2 A;  2DQR A;  2H94 A;  4I01 A;  2LF8 A;  1U8R A;  1KU9 A;  1QHG A;  2ESH A;  3N97 A;  2ZFW A;  4LIV A;  4YFN F;  4U0V A;  4IRG A;  4EQQ A;  3CCR I;  2CGP A;  3EUA A;  4KT6 A;  4GCV A;  4Y7N J;  4ENK A;  5CPR B;  4XLH A;  2X1D A;  2VJ4 A;  4N9H A;  1ETY A;  2Z1D A;  2CUZ A;  2G0E A;  2HXO A;  2VXD A;  3H3Z A;  1XCB A;  3T1B A;  2DYR H;  1XPX A;  1B72 B;  1WPK A;  4M9Z A;  1AKH A;  2WBM A;  2MH9 A;  3ECH A;  4YEL A;  2CYY A;  4WXH A;  1WZ2 A;  2PMH A;  2CUF A;  2GIV A;  4IJA A;  1FP1 D;  2CFO A;  3WTS C;  3H3V K;  2ELH A;  4ZDP A;  2D1V A;  5FO5 A;  4ASN A;  1W7P B;  2JTV A;  4HX8 A;  4NQW A;  4FCY A;  1EH6 A;  2NVT J;  4AVP A;  4PSX A;  3PFY A;  1G2H A;  2LDU A;  3LMM A;  1HLV A;  1P7J A;  2PJP A;  1Z6T A;  2HZT A;  3EUH A;  3WU2 C;  3ZQL A;  3MMY B;  3FXM A;  1RR7 A;  3B6A A;  3JRG A;  2ETH A;  5ILU A;  2IVM A;  2DFI A;  2PJR B;  1BBY A;  2L3D A;  3K1M A;  3BY6 A;  3HGY A;  2L02 A;  3Q9V A;  3S8P A;  3ZMT A;  4RA2 A;  3BG6 A;  3OV8 A;  3H36 A;  1X1D A;  4KJZ A;  5LRR A;  4KDP A;  1T98 A;  4N4N B;  3H35 A;  4KFC A;  2V9K A;  2K7L A;  2BEO A;  4UHT A;  4XLN F;  3VDX A;  2XGE A;  4A5N A;  2EJR A;  2CQQ A;  2IXS A;  3ABL H;  3FIS A;  3ERM A;  5F0C A;  3HOS A;  6PAX A;  2O61 A;  5C4X J;  3I55 I;  3BTL A;  3HG9 A;  3CO7 C;  3JCU C;  5JHF A;  1JKR C;  4A6E A;  2VOD A;  3WGI A;  3BG7 A;  1RET A;  2BZT A;  2J5P A;  3CF5 F;  3E6D A;  2HKO A;  1ZHF A;  2H6B A;  5FKL A;  3JRB A;  1ETK A;  4PDK A;  4CH7 A;  4OMY A;  3S16 J;  2JPB A;  1CF7 A;  3K9T A;  5KNL A;  1LFB A;  1YIT I;  1USS A;  3A01 B;  4RGR A;  3NQO A;  4QWQ A;  2ZXI A;  5JHU A;  3WTT C;  1TLH B;  2V1D A;  1MGT A;  2DMP A;  1VQ9 I;  2O8K A;  3G1L A;  4KIF A;  4UB8 C;  4C30 A;  1U78 A;  4AID A;  4NUB A;  3I59 B;  2R7W A;  2HQ5 A;  5JLX A;  2FQ4 A;  2QEN A;  2M5W A;  2WC2 A;  5GAD J;  3RPQ A;  1R5G A;  1PDN C;  2FBH A;  2QCO A;  3KP6 A;  4FX4 A;  1IW7 F;  1B4A A;  1U5T C;  5HLH A;  3H5A A;  2L0K A;  2CU7 A;  4A2U A;  1UHS A;  5ICG A;  1QVU A;  1E17 A;  3L2W A;  2XSD C;  4E7S A;  3REO A;  2HR3 A;  4GGG A;  1X1P A;  3CUQ A;  2D5V A;  2C6Y A;  2DA5 A;  3DWL E;  2QKM B;  3FDY A;  3R0A A;  5BPI A;  1D1B A;  3K1P A;  1A6Q A;  2DBB A;  4OU0 A;  5B1B H;  3NAR A;  2R93 J;  4W97 A;  2K4J A;  2XAU A;  4A3L J;  1IZ1 A;  1O7F A;  1BJA A;  1Z3X A;  3BG9 A;  3WE3 A;  3UKG A;  1A6I A;  5M3M J;  3H1C A;  4CSW A;  4IX7 A;  1JT6 A;  3K10 A;  4ANJ A;  1CQT A;  1MNE A;  4S04 A;  1LPQ A;  2M0C A;  1R23 A;  2M34 A;  4OIP F;  1KQ8 A;  2E1N A;  4IKF A;  4S0H B;  1POG A;  3QOE A;  3O8G A;  4U0Y A;  1UG2 A;  4M6X A;  3RDI A;  2HQR A;  1VFC A;  4ZDL A;  1ETX A;  4CGZ A;  3FXU A;  3IC7 A;  1IXR C;  1J0R A;  5LHG A;  1I6X A;  1B72 A;  4Y33 A;  3S1N J;  2MLG A;  4CZZ A;  3KP7 A;  1QNT A;  1VQN I;  2KZG A;  3M8E A;  1G8X A;  3I0T A;  3ZQI A;  3GTP J;  1B9N A;  1FWZ A;  3J7Z I;  3HUG B;  4AIJ A;  1OCP A;  2K40 A;  2R7Z J;  3TP0 A;  3M07 A;  1P9Q C;  2DOD A;  3QPL A;  1BC7 C;  5FRN A;  3HOU J;  3LST A;  3FK7 A;  4WF2 A;  4E6K G;  2F2E A;  3GTL J;  3OOU A;  5CVI A;  1S7O A;  3OS1 A;  2DT6 A;  1OMI A;  2R3S A;  2Y0M A;  5FGM A;  3BR0 A;  3CDL A;  4DBR A;  1F5T A;  5HLI A;  2DJN A;  1D0X A;  4A6D A;  5M3F J;  3F9K A;  2PJR A;  1IF1 A;  3O6B B;  3PUB A;  5JI6 A;  4M3B A;  1T56 A;  1IO2 A;  2DDA A;  3LFU A;  2CV0 A;  2ZNZ A;  4B43 A;  3AG4 H;  3KEQ A;  3C7J A;  4F93 B;  1TZL A;  3QU6 A;  4RGS A;  5CQG A;  3LSP A;  3LSG A;  3AG3 H;  3CC4 I;  3AG2 H;  2GLO A;  3PUF A;  2H27 A;  4HV6 A;  1UHW A;  2QQA A;  3MZH A;  1LKX A;  2P5K A;  1E3H A;  4V19 K;  1LUJ B;  4BXX J;  5D4S A;  1ZR4 A;  2BOL A;  3AG1 H;  4J00 A;  3RZO J;  3BR2 A;  4XKW A;  1T08 B;  3I58 A;  1HXD A;  4AVZ A;  3DEW A;  5CJ9 A;  5GP9 A;  2XPW A;  3OYA A;  3UNG C;  1V55 H;  2Y31 A;  1HST A;  1JI8 A;  1O3S A;  3FXJ A;  3NWT A;  2KPM A;  2E2J J;  1TP4 A;  3KX2 A;  1K83 J;  2LOO A;  2OAZ A;  4NHJ A;  4Q48 A;  2F5C A;  2PFB A;  4BXF A;  2VC0 A;  3KYC B;  3BPV A;  2A07 F;  4LLN A;  5LHH A;  3LQQ A;  5CLS A;  2R0Q C;  3I59 A;  2KLO A;  1Y8R B;  4UUS B;  1YJN I;  1BOB A;  2K5C A;  1PUF B;  4HX7 A;  4CXF A;  3H9G A;  1T2K A;  4KIG A;  3P9I A;  1S8N A;  5D5U B;  4M9S A;  1KYZ A;  5D6E A;  1G4D A;  4F52 A;  4Z6Y A;  4AC0 A;  3LA7 A;  2PMU A;  2DW4 A;  2EA2 A;  5A2Q K;  1XS9 A;  3M8F A;  2ACJ A;  1J75 A;  2HEO A;  1B9M A;  3H5N A;  1N78 A;  4E7I A;  1FNN A;  2HYJ A;  3SJM A;  3R61 A;  2NS8 A;  2ZXW H;  5GPA A;  2R5Y B;  1SFO J;  2LC2 A;  2PBI A;  2BHY A;  3CUO A;  2G7H A;  4EJO A;  2HYF A;  4ZYD A;  1UFM A;  4OIO F;  2JVH A;  1OR7 C;  3FKJ A;  1LDJ A;  5DD8 A;  5E3M A;  2VE9 A;  1ETO A;  1JKO C;  1W36 C;  1IV8 A;  4PJJ A;  3K4C A;  1QBJ A;  1IRX A;  2A05 A;  3K4L A;  1KQ0 A;  2LKS A;  3GZN B;  1U5T B;  2EPF A;  4IO9 F;  1QA6 A;  2DFF A;  4XLP F;  3LL7 A;  4KA4 A;  2XAS A;  2LMD A;  4PSW A;  1HSJ A;  3NAU A;  3JR9 A;  4NC7 A;  1SFK A;  1X3W B;  3ECO A;  3BJ6 A;  4CDG A;  5HVQ C;  4LK1 F;  4KT5 C;  2JSP A;  2Z33 A;  3L2V A;  2ZCW A;  3GFI A;  3HUG A;  5LBQ A;  3IAM 2;  2BV6 A;  2IBD A;  2V9P A;  1CGP A;  2GM4 A;  4HLY A;  3H5R A;  2DK5 A;  3S1R J;  1GHC A;  4KUM A;  4I09 A;  1YRN B;  3BZC A;  3FXL A;  3E7L A;  4A0X A;  3IKT A;  2E7W A;  4HDU A;  1XGS A;  1BIA A;  2HNH A;  2CFX A;  3CJQ B;  2LF7 A;  4YII A;  1PJR A;  3RKQ A;  4JK1 X;  2XVC A;  3BPX A;  4MGR A;  2YR2 A;  1ON2 A;  2ZKZ A;  2XRN A;  4PGH A;  2EBI A;  3HXL A;  4XSX F;  2NVQ J;  4HZF A;  3M9A A;  3I4P A;  1UCR A;  4G7O F;  4KIT B;  3DFG A;  5IP6 A;  3OYM A;  2VLA A;  1R58 A;  2L9R A;  4XOP A;  3JAM Z;  1MMS A;  1H88 C;  2XRL A;  4B44 A;  4FT8 A;  4LMY A;  2V79 A;  2OV7 A;  3HTU A;  4BBR J;  4P5O A;  3TBI A;  2EIJ H;  3OOP A;  3Q3S A;  1R1T A;  2VQL A;  2WAE A;  3J80 Z;  2HOT A;  1T6S A;  2E5N A;  1FYL A;  4CO8 A;  3S17 J;  1P4A A;  1UMQ A;  4YEJ A;  2VKV A;  3IV5 A;  1SEU A;  3EQL F;  5J6X A;  4BJ5 C;  2DYS H;  2KIM A;  3W3C A;  1JHH A;  3ZMD A;  3LAJ A;  3L2C A;  4DYQ A;  1R5H A;  1R4N B;  2VIX A;  3DCF A;  5EZG A;  3S93 A;  4ZZD A;  1OYI A;  5KK1 A;  1IXC A;  4IQ4 A;  1JKP C;  4GYI A;  1ORK A;  5DM7 F;  1UB9 A;  3QQA A;  5HS9 A;  4ZYH A;  3DBL B;  2WWY A;  3E0J B;  2F5D A;  4RB1 A;  2KRH A;  2YU3 A;  4UUS A;  2V6C A;  1S6L A;  2XAH A;  1HCR A;  4BAY A;  1PUF A;  3MFK A;  1K6Y A;  3RPU D;  2GQQ A;  1IRF A;  3OIO A;  3TL4 X;  1OIS A;  1PUE E;  3HRM A;  2FSW A;  3GZ5 A;  1LDK B;  4IVN A;  3RYP A;  3WG7 H;  1G3W A;  5DM6 F;  1XG1 A;  4RM3 A;  2VAS A;  1YX5 A;  2QGU A;  2E35 A;  5BS6 A;  4UVA A;  3CME I;  3VOD A;  2R5Y A;  1SMT A;  1UZC A;  4KIB A;  3BR1 A;  1IRZ A;  1XX5 A;  1T33 A;  1UST A;  4XNF A;  1R6R A;  3F8F A;  1VQM I;  1N25 A;  1UEL B;  3BT9 A;  1B6A A;  1J2X A;  1BI1 A;  1WH7 A;  2WB1 A;  3OYI A;  4OMZ A;  3BTI A;  2OTL I;  1ZLK A;  3HSE A;  4LJZ F;  4GYG A;  4CHU A;  3JAM K;  1BJZ A;  2COM A;  2OCE A;  3ZR8 X;  4BU2 A;  4A12 A;  3ESW B;  3OYD A;  3RPU A;  2JA6 J;  4XIC A;  1S3J A;  2XAG A;  1ZK8 A;  2KFD A;  4Y3O A;  2OZU A;  3AAF A;  1U5T A;  3BDD A;  3K0L A;  1FOK A;  4M74 A;  2DTR A;  1IN5 A;  2IJL A;  2MG4 A;  3I71 A;  3NRV A;  3OR2 C;  4BS9 A;  3AL0 C;  4ENJ A;  4D5F A;  3OYK A;  1S5L C;  5B5E C;  2X6O A;  2BE5 F;  3TQN A;  3L9F A;  3WU0 A;  3ABU A;  4G9Y A;  1ETW A;  1VQ4 I;  4XK4 A;  2CV1 A;  4MQV A;  3B73 A;  1K78 B;  4PK4 A;  3F0C A;  5H6R A;  2UZK A;  1R00 A;  3WTV C;  1I1G A;  1OJL A;  4WX9 A;  3HC7 A;  1Z6R A;  1DU0 A;  1FMW A;  1I3Q J;  2VBZ A;  3F72 A;  3ZQH A;  4BXU A;  1T0F C;  1R49 A;  2XV4 S;  3HDD A;  1KA8 A;  2LR8 A;  4O6J A;  1TBX A;  1IUY A;  3A1Y A;  3IKV A;  1MBK A;  4WCG A;  3VEP A;  3WG9 A;  4M3D A;  3F21 A;  5FFZ A;  5B66 C;  4E70 A;  3BR3 A;  2XAQ A;  1X1A A;  1TTY A;  4UNO A;  4UY8 I;  3OL3 A;  1DUX C;  2EQR A;  4L18 B;  2XPU A;  3VSL A;  5B3S H;  3LFK A;  3CLO A;  3OR1 C;  3VOE A;  2JRM A;  5IY5 H;  1MBG A;  3EDP A;  4G6D A;  4PCQ A;  3JSP A;  2HDC A;  5KAF C;  2JVG A;  4YRV A;  3OYG A;  5F0H A;  3ZP5 A;  2WAQ N;  1IUF A;  4KN7 X;  4KN4 X;  2YPR A;  4XL9 A;  2E34 A;  4DZJ A;  3CCL I;  3PIP F;  2GXG A;  1E3P A;  2EZI A;  1NK3 P;  3E1S A;  4L5J A;  2F5E A;  1XB4 A;  2UXN A;  3GO5 A;  3RSN A;  2DOF A;  3V7S A;  2OCC H;  3HRS A;  3I64 A;  3VYS B;  4OAY A;  4MIM A;  1YO5 C;  4UUV A;  4IPA A;  5J1U A;  1NG7 A;  2MA3 A;  4XID A;  1FT9 A;  2YS9 A;  1TQM A;  1K79 A;  3TO7 A;  4NDL A;  3JSO A;  3R60 A;  3GX4 X;  1UHM A;  2M45 A;  2Y9Z A;  1Y1W J;  2CQK A;  2M7A A;  3ZQ7 A;  1WI3 A;  4CYC B;  4QIW N;  2VT2 A;  3A0H C;  3HHH A;  3CO6 C;  4GFB A;  4RLQ A;  1Z05 A;  3QRF F;  3HOW J;  3HTS B;  2XAF A;  2M30 A;  1RES A;  2XRO A;  2M3A A;  4Q47 A;  1X3Z B;  3JRH A;  3HHG A;  2EIM H;  4K2E A;  3G6E I;  2L7Z A;  4BHP A;  1FMV A;  3DPU A;  2CO5 A;  3OMY A;  3PM1 A;  3FMS A;  5FJ8 J;  1BI0 A;  1ITY A;  1NK2 P;  2W84 A;  5KCM A;  1HDP A;  4RB3 C;  4HNV A;  1H0M A;  3JTH A;  2IRF G;  3MZY A;  2H09 A;  3T8R A;  3MAJ A;  2YUS A;  4P9U A;  2KL4 A;  4EMS A;  1YI2 I;  2NYX A;  1TNS A;  1ZN2 A;  4ZTJ A;  1ZRD A;  1R7J A;  2DI3 A;  2QSF X;  2MH2 A;  1PP8 F;  1S29 A;  2WV1 A;  4L9V A;  3CCQ I;  4KNY A;  4NNJ A;  1PP7 U;  2B7E A;  3VYU B;  2RGV A;  1NH3 A;  2HQN A;  1KU3 A;  4MFE A;  4CUG A;  4ENN A;  4BE0 A;  1JJ6 C;  2JUC A;  2NXN B;  4UXN A;  3D5L A;  4IRH A;  2QVO A;  1FJL A;  4BE1 A;  4R79 A;  3LQR A;  3HOY J;  2WAD A;  3WTU C;  5BQT A;  3HOT A;  2HVR A;  2KJC A;  2F4O B;  2Y2Z A;  4XLA A;  3HJE A;  5E17 F;  1ZG1 A;  4XQF A;  3ABT A;  1R71 A;  2GA2 A;  5EF6 A;  1IN6 A;  1ETQ A;  1WI9 A;  1IN7 A;  2ADU A;  2ELJ A;  4RB0 A;  3ZPL A;  2I5U A;  1D1C A;  4OAZ A;  5LLQ A;  1HBX G;  1K78 A;  4XKB A;  3MKW B;  4YFX F;  2XKP A;  1JGG A;  1XDU A;  5E18 F;  2YX4 A;  1K4S A;  3JRD A;  2F4M B;  1QPI A;  4HV5 A;  1JUP A;  1A35 A;  1X2N A;  2ZBK A;  1KYW A;  3DTI A;  1HW5 A;  3BJA A;  4O5V A;  1Z67 A;  4IRI A;  1WJE A;  3VYR B;  3RCO A;  3BJO A;  3OIQ A;  2NOG A;  3SZT A;  2F5V A;  2ZJQ F;  3ULQ B;  1FP2 A;  3VPR A;  5AIP A;  3GUD A;  4KMU X;  3QYF A;  3AL0 B;  1X2M A;  2K85 A;  4YIR X;  2IS1 A;  4A3I J;  4O3M A;  5L3E A;  4MFD A;  2MGQ A;  2K27 A;  1BOA A;  1SD7 A;  2A61 A;  4XLC A;  3GWZ A;  2V1X A;  4C3I J;  2HFH A;  2ISZ A;  5IP7 J;  2WB1 N;  2JPC A;  2TCT A;  3T5X A;  1FPQ A;  1WHU A;  5L3B A;  1V3F A;  4Z2Y A;  3CJR B;  1I39 A;  4B47 A;  1GV2 A;  2E36 A;  1WKM A;  1MMA A;  4E7H A;  3BQZ A;  2QF7 A;  4JQF A;  4XON A;  3W2A A;  3RQ4 A;  5FLM J;  1QHH D;  3R6S A;  2A6T A;  4N4O B;  4A3F J;  2QZ8 A;  2R7D A;  1DDN A;  3OYL A;  2AO9 A;  1F4K A;  2X6W A;  1UJ8 A;  2K86 A;  4HQM A;  3QAH A;  5KAI C;  3GEZ A;  2HPM A;  2VKH A;  4CCO A;  3KYD B;  4JP0 A;  2IGO A;  3H3U A;  2G7U A;  1NTC A;  3GVA A;  5ILS A;  4LG3 A;  3UR3 C;  4N0B A;  2EIL H;  5LEK A;  5HDN A;  3ZMU A;  2W1O A;  3WE2 A;  3J81 Z;  3BZ6 A;  2P5V A;  4AYB N;  4DJA A;  3MD2 A;  1R4M B;  4CYC A;  1VQ7 I;  3PNY A;  2V26 A;  2PG4 A;  2FF4 A;  3FF5 A;  4EJU A;  5DCM B;  1Z9C A;  3LOC A;  4XMY A;  2GOM A;  2P6T A;  2RNG A;  2EA4 A;  3BLY A;  1XCV A;  2YSR A;  1BIB A;  3RIR A;  3KYL A;  1ACI A;  3CCU I;  3BCA A;  3DKX A;  3PNV A;  4FX0 A;  4FQG A;  1HDD C;  3KP5 A;  4BY1 J;  1JHF A;  3G1M A;  1YS7 A;  3LSR A;  1X1B A;  2W48 A;  4A3E J;  3KP4 A;  4FE4 A;  3DF8 A;  2L2O A;  2UUZ A;  2XUB A;  2JUG A;  3DBH B;  1XGO A;  3IWF A;  2HU9 A;  3A0B C;  2KT0 A;  5J1R A;  2R7R A;  2HGC A;  2AXT C;  2E5Z A;  4IZZ A;  1MND A;  3S2H J;  1PVE A;  4AUX A;  2IW5 A;  1W7P D;  1F36 A;  1BI2 A;  5GPC A;  1WJ5 A;  3GTK J;  2LRD A;  5L3C A;  3JRE A;  1QPM A;  2LD5 A;  2ZB9 A;  2A5W A;  2FEZ A;  2OQG A;  2R92 J;  2QBY B;  4HLX A;  3RI4 A;  3BG5 A;  4CYD A;  4BQO A;  1V5G A;  1P4X A;  3M4O J;  2OPT A;  3FIW A;  3BP8 A;  3BWG A;  3D5R C;  3DLL F;  3WHC A;  2EIN H;  2BY3 A;  1KU2 A;  1YW9 A;  4I76 A;  2Y30 A;  3RZD J;  3OYB A;  2Y75 A;  4U7D A;  1R9T J;  3QP5 A;  5E79 C;  4AD9 A;  1Z91 A;  2K4B A;  4D0P A;  4C2U A;  5IOZ A;  1L0O C;  4XKV A;  4A3G J;  2VOP A;  2DMQ A;  3MN2 A;  1ZRC A;  3L2R A;  4XN3 A;  2XF6 A;  1HW1 A;  1Q1H A;  1X58 A;  1Q1V A;  1VND A;  4IF4 A;  1L3L A;  4QSH A;  2YU9 J;  2M8E A;  1W7P A;  2O5R A;  3CF2 A;  3KP3 A;  1PYV A;  1W5T A;  2FMY A;  3LA3 A;  3SHF A;  3J81 K;  5IYC J;  1BR4 A;  5E8G A;  1TW3 A;  4FET A;  1MIJ A;  1ZG5 A;  2OZ6 A;  3K1N A;  5JVT A;  5CQE A;  1V54 H;  5F04 A;  2NNY A;  4II3 A;  5GAE J;  1W1W E;  2CWE A;  2KP6 A;  4XRM A;  1U9O A;  5CVV A;  1LB2 A;  2HQA A;  1HQC A;  4OIN F;  1WCM J;  4HSR A;  3SXY A;  1AOY A;  1GXQ A;  2GXA A;  1Z0X A;  2R7V A;  4BQA A;  2LY2 A;  2DA6 A;  1JUS A;  1IGN A;  5GTH C;  4M9X A;  3GTM J;  2OQR A;  5FKK A;  3ZCO A;  2OJE D;  4AWX B;  1HKQ A;  5E3O A;  1RUN A;  3TO9 A;  1P2F A;  4HF2 A;  3F8B A;  1FOY A;  4ENM A;  1SVM A;  4M3G A;  2FJ1 A;  3VYT B;  3H0D A;  2JWT A;  4DNC A;  2XHK A;  3V8L A;  3QYB A;  3CJN A;  4UV8 A;  2KKO A;  4EGY A;  4LOC A;  2L54 A;  2STW A;  2KHM A;  4RMN A;  4OIQ F;  3A01 A;  2L4A A;  4Y52 J;  2P81 A;  4BH9 A;  5LFA A;  1Z7U A;  2PN6 A;  3PNT A;  2DAO A;  2DA2 A;  2IS6 A;  3GFJ A;  4HRI A;  4C9Y A;  5IYD J;  2KIQ A;  2MBF A;  3JTG A;  1O3R A;  4G6T B;  1WH5 A;  3E5U A;  4M6V A;  2D45 A;  4UB6 C;  4HOB A;  4MNU A;  4BNC A;  3F3X A;  3HOV J;  2A69 F;  2L9V A;  4IHT A;  1SD6 A;  3FK6 A;  4Y13 A;  2M9H A;  1Z7L A;  2BW3 B;  4I6Z A;  3K70 C;  1ZG3 A;  3EYI A;  4EM0 B;  5DCM A;  1J9I A;  3L00 A;  1FSH A;  5E1W A;  2HOA A;  4HA8 A;  3D0S A;  2LKP A;  4AU7 A;  1S9H A;  1A31 A;  4E7Z A;  3QOD A;  5CKT A;  1DGW Y;  2R7S A;  5HS7 A;  4ZYG A;  3CDI A;  4XM3 A;  5FRM A;  2LKX A;  1TQI A;  1ZR2 A;  2Z9O A;  4FE7 A;  3U9G A;  2VQC A;  9ANT A;  4L9J A;  2O0Y A;  1ETV A;  2ZFU A;  3D1N I;  3LAP A;  5EEA A;  2E1M C;  3TGN A;  1APL C;  2NNN A;  2FNA A;  4HST A;  3O3K A;  3OS0 A;  2V7F A;  1BI3 A;  4F91 B;  3CCY A;  3CCJ I;  2L01 A;  4KIC A;  3CJT B;  2HOS A;  3W2W A;  5FLX Z;  2P7V B;  3KFW X;  2P7C B;  3GXO A;  3DU5 A;  2X51 A;  2FOW A;  1ZTR A;  4PJN A;  1ZRE A;  2EV0 A;  3Q0U A;  3QOP A;  2QBY A;  1FBQ A;  4E7K A;  5GTI C;  3ZMV A;  2JA7 J;  2JN6 A;  2LK2 A;  2CSO A;  2L7F P;  4J01 A;  1W4M A;  3M8J A;  4QTR A;  5FKN A;  2RNJ A;  2E1O A;  2BVM A;  3IP4 B;  3HBL A;  4AIK A;  1SFE A;  5TRD A;  2XAJ A;  3C2H A;  4MO7 A;  5J40 A;  4ZDO A;  2FRH A;  2W82 A;  2K9M A;  1ZAO A;  2FX0 A;  1SFU A;  1ZAR A;  4E7L A;  1YLF A;  2OD5 A;  3PSF A;  2UXX A;  2VPR A;  3TDZ C;  3U1K A;  3F8M A;  5EZH A;  3U21 A;  2VON A;  2VUM J;  3CC7 I;  1SAU A;  4E4H A;  5TGT A;  2LG4 A;  4Y15 A;  2LYC A;  3HKZ A;  3DP7 A;  3ONQ A;  3OSG A;  1OFC X;  4M71 A;  3GTQ J;  4JX5 A;  3TP3 A;  1QRY A;  3FHZ A;  3R0J A;  1LVK A;  4HPQ A;  4HYE A;  1K7A A;  1XN7 A;  5F1J A;  3FXK A;  1KGS A;  5HOO A;  1O3Q A;  4HX4 A;  2KDO A;  2ZJP F;  3W6K B;  2K3F A;  4G8X A;  1IAW A;  2RVC A;  4Y4R A;  1JTX A;  4RGU A;  2VBX A;  2EWN A;  4G94 A;  2LBF B;  1MJA A;  1SMY F;  2VQG A;  4GXO A;  4D7M A;  3F8C A;  3ZXS A;  2DK8 A;  4EGZ A;  2R5Z B;  3S3O A;  4GDF A;  2LLK A;  4ZJZ A;  4F92 B;  4RAG A;  1WGX A;  2L7M P;  3SQN A;  2LRE A;  1T95 A;  1HA8 A;  3J7A Y;  4IOA F;  2K9N A;  1OKR A;  1LJ9 A;  2X0L A;  5DDG A;  2HZD A;  3ZQF A;  3MKY B;  3N05 A;  2CJJ A;  3IHU A;  5FLX K;  4U0W A;  3IH4 A;  1YE9 A;  5FLV A;  2CQ7 A;  2XF7 A;  1LQ1 A;  2COB A;  4LK0 F;  3K4M A;  3DPL C;  2M4K A;  3CMY A;  1MDM B;  3BTC A;  2XB5 A;  2B0L A;  2KIS A;  3ABM H;  4E7J A;  3B02 A;  3SDG A;  3D5S C;  2Y0S A;  3P9K A;  4HDV A;  2EH3 A;  2HDD A;  3CP8 A;  5DD4 A;  2MC3 A;  3VB2 A;  1YJW I;  1P92 A;  1IN4 A;  2DT7 B;  2CG4 A;  2E60 A;  4HQE A;  2HOE A;  1WFX A;  3IAS 2;  2JQ7 A;  3KIO A;  1WRJ A;  1QZE A;  3HIF A;  3HM5 A;  2DA1 A;  1Z21 A;  2NS7 A;  3OYN A;  3B6C A;  2MAB A;  4BGD A;  3WTZ A;  3A02 A;  1MMN A;  3FXQ A;  5TIS C;  4H0E A;  3F22 A;  3GFM A;  4R8H A;  3HPG A;  3MEX A;  3PIO F;  4A3D J;  3CUQ C;  2Q8K A;  5IT3 A;  4BAC A;  1RC9 A;  2BW3 A;  2ZXJ A;  5GAG J;  3DTE A;  2OC6 A;  1LDD A;  2WAF A;  1ZKG A;  1IV6 A;  3OSF A;  3RQI A;  4BJ6 C;  1O3T A;  3WTY C;  1FSE A;  3EET A;  4XRF A;  3CMA I;  1MBJ A;  4FHT A;  3CCS I;  4JX4 A;  3GZ6 A;  3ERE D;  1P6R A;  1BC8 C;  1OYW A;  5HLG A;  5FKO A;  2E2H J;  3ASN H;  5HLT A;  1XDS A;  2I10 A;  3BC8 A;  1WWX A;  3DKY A;  3DQV C;  5E1X A;  4WWC A;  2CUJ A;  3FWE A;  2F48 A;  2KDZ A;  3L2U A;  1NHA A;  2R7O A;  1Z1D A;  2DMT A;  3L7W A;  3CMM A;  3W6V A;  4HAM A;  2FU4 A;  1ZGA A;  1YFH A;  3S2D J;  3J7Y J;  3ZRG A;  4BKX A;  3ABK H;  3E6C C;  2NAZ A;  2DQL A;  5H20 A;  2I8D A;  3DKW A;  3Q0W A;  3HRU A;  3V8J A;  2W85 A;  4BJT A;  5EEG A;  3J80 K;  1SC7 A;  2F6C A;  3AKZ A;  2QQ8 A;  3VFZ A;  4R1H A;  1YJ9 I;  3I4N J;  1EH7 A;  2M0M A;  2HYG D;  2VJJ A;  4D5C A;  3IRQ A;  2VQH A;  1SVO A;  2DFH A;  1C0W A;  1RUO A;  5F0F A;  4MEX F;  4M6Y A;  3PQJ A;  1WJB A;  1EKE A;  1RIO H;  2RRE A;  1P7I A;  5DCF A;  4BEH B;  1F1Z A;  5FD6 A;  2WTE A;  1A5J A;  2KJB A;  1FBS A;  4BUP A;  4IHX A;  3C2B A;  4CCL A;  2DDB A;  2K02 A;  2JZY A;  4P1W A;  2CW7 A;  3KP2 A;  3GME A;  4F55 A;  1F9N A;  2HDW A;  4EEF G;  1YRN A;  1J09 A;  2EV5 A;  2E7X A;  3ZQG A;  5L3G A;  2AQE A;  3ISP A;  1IC8 A;  4IHS A;  4BYY A;  5DYM A;  3PQK A;  5K7F A;  3P9C A;  2BY2 A;  2OF7 A;  1GDT A;  3A03 A;  1R36 A;  2IAI A;  1LNW A;  1TC3 C;  1ZH5 A;  3ELK A;  1LE8 B;  1YW8 A;  2LBF A;  3BCB A;  2EB7 A;  5C4J J;  3JRC A;  2R5Z A;  5BPD A;  1XTA A;  4W1U A;  2IT0 A;  2AXL A;  4LD5 A;  4B3X A;  3CQZ J;  3IRR A;  1RKW A;  1MNM C;  1D8J A;  4L5E A;  2Q0O A;  4LLG F;  3R4K A;  2EFO A;  3FM3 A;  4IOC F;  2A68 F;  3PO3 J;  3QU3 A;  4MEY F;  5J4Y A;  1YIO A;  4BQQ A;  2O03 A;  4U7B A;  2JSC A;  4Q5S F;  1K61 A;  2CQN A;  2X9D A;  2FOK A;  2RKH A;  2VKE A;  1X1C A;  4C3H J;  1XSV A;  3HOX J;  2KZV A;  4FIS A;  1MDM A;  3GF2 A;  3LSM A;  4JX6 A;  2XDV A;  3MCZ A;  4QPO A;  2X4H A;  4B8X A;  1QU3 A;  3WHB A;  3T0Y A;  2XSJ C;  4U88 A;  2DXI A;  4B1R A;  5DUI A;  4B09 A;  2FD5 A;  1D1A A;  4YFK F;  4A3C J;  5EGO B;  2E71 A;  3GW2 A;  2Z99 A;  5K7Z A;  1G6N A;  3KZY A;  3ASO H;  2DFE A;  3C2G A;  2V1U A;  2GXB A;  1V5F A;  2BVL A;  1OCR H;  2VE8 A;  1QQI A;  4A3M J;  2PMZ A;  2GA1 A;  5IP9 J;  4IHV A;  2JA8 J;  2CQX A;  3HKZ N;  3ZQC A;  4CZC A;  1TWH J;  1XMA A;  1YW7 A;  1U0J A;  2ZME C;  3WTX C;  3GLL A;  1VTN C;  3IWZ A;  3G1O A;  1STZ A;  2FXA A;  1T39 A;  2UWM A;  2B9S A;  1TNT A;  3K4K A;  4XBF A;  5JLW A;  4I0B A;  1XC5 A;  5H2F C;  5GAH J;  2OBP A;  2ZSH B;  3GTJ J;  3O8H A;  5HNF A;  3V8K A;  1LFP A;  1SVL A;  2FUG 2;  2IEK A;  4HF1 A;  1FEX A;  1GUU A;  1GXP A;  1IXS B;  4XN0 A;  1FOX A;  4I0A A;  2PEX A;  2M8G X;  2M1B A;  1JGS A;  3CES A;  1QO0 D;  1YG2 A;  5F6F A;  1ZEL A;  2OTJ I;  3V7R A;  2GZW A;  4P55 A;  3MWM A;  5E20 A;  4B48 A;  1TWG J;  3M1C A;  1W36 D;  4LIT A;  1H89 C;  5F1R A;  1YIJ I;  2LY9 A;  4ZZL A;  4LLL A;  3VSK A;  4XRS G;  2H1K A;  2DTZ A;  4G7H F;  3S32 A;  2JA5 J;  4U87 A;  3RJP A;  3OYJ A;  2Y0S N;  2L7K A;  4JYK A;  2K9S A;  1JT0 A;  2CW8 A;  3KET A;  4M3F A;  1MBE A;  2QM3 A;  1VQK I;  2QSG X;  3FBN B;  4DOZ A;  2Q1Z B;  4LIU A;  3BR6 A;  5LGU A;  2BY0 A;  1GVD A;  2NVU B;  4V2G A;  1VQ6 I;  2J5O A;  4BEH A;  4DBQ A;  1FTT A;  1HC8 A;  2E1C A;  3DPT A;  4NC6 A;  3N4M A;  3OYE A;  4MHG A;  2Z16 A;  3C18 A;  1OR7 A;  4FAS D;  4PUS A;  1RNL A;  1WJD A;  5LGN A;  1SFX A;  4RB2 C;  1S7A A;  1WQ2 A;  4CA0 A;  2QLZ A;  1M1E B;  2LTP A;  3I3L A;  4D7N A;  3MVP A;  2WY7 Q;  5TJJ A;  1WJA A;  3COA C;  2KQR A;  1Y8Q B;  2HPI A;  5M5W J;  3I56 I;  3KLN A;  1LE8 A;  3WTW C;  1D3Y A;  1VQP I;  3FZV A;  5E3L A;  4AM3 A;  3C1D A;  4ESF A;  2ME6 A;  1I6H J;  2CS3 A;  3KCC A;  3K4J A;  4NC8 A;  2V4J C;  2W25 A;  3S1M J;  2EFW A;  2HS5 A;  3OS2 A;  4L5I A;  5BMZ A;  2L9N A;  3OY9 A;  4Q4Z F;  3J7A O;  2O3F A;  2ME0 A;  2H8W A;  1TW2 A;  3P7N A;  2V6E A;  1GV5 A;  3LSJ A;  5JFR A;  3P5J A;  4FTH A;  1XGN A;  1ERD A;  2QQB A;  1BW5 A;  2NVY J;  3NWS A;  4DZP A;  2QYO A;  5D8K B;  3FKI J;  3PSI A;  4L9T A;  3H9J A;  1BR2 A;  2IA2 A;  1E3O C;  1MSF C;  1VF9 A;  3FX3 A;  2O7O A;  4BHC A;  3M1E A;  3O2P E;  2LVS A;  5JR3 A;  2P6S A;  4PJM A;  3TED A;  1WSU A;  1K4T A;  5EGO A;  2KRC A;  1QZY A;  2MC4 A;  3FMR A;  1GT0 C;  2OU2 A;  4BHB A;  3EUK L;  1O4X A;  2ELK A;  1DPU A;  5ILV A;  3LA2 A;  1D5V A;  1HOM A;  4A93 J;  1E2X A;  1MH3 A;  1ZYR F;  3G4S I;  3DLA A;  4BDZ A;  5EYR A;  4L0Y B;  4LGW A;  4MTD A;  2DJI A;  4PJ0 C;  2X1C A;  4N9I A;  2QA4 I;  2TDX A;  2O6G E;  2VC1 A;  1WJC A;  2FML A;  2OUM A;  2PLY A;  2HTS A;  5FKM A;  1QGP A;  5IYB J;  3HEF A;  2HXI A;  2RAE A;  3LNQ A;  2VPL A;  5JVG F;  5FFX A;  2X85 A;  4MLO A;  3RTR A;  1HKT A;  1MZB A;  3KPH A;  4ETS A;  1LVA A;  5J47 A;  3SFI A;  2E2I J;  1G3Y A;  4EV0 A;  3IH2 A;  3F23 A;  3BZK A;  3K7A J;  4JOM A;  4ZYA A;  1GLN A;  3NEU A;  1BM9 A;  2FBI A;  5F64 A;  3E5X A;  3KLO A;  1BA5 A;  1V5E A;  1W0U A;  2NVX J;  1Y1V J;  4A3B J;  4L9N A;  3DV8 A;  3LWF A;  1VQ8 I;  4RAY A;  3OYC A;  4OOI A;  2CUE A;  2M87 A;  4XKC A;  1XD7 A;  3Q9S A;  4GRI A;  2D1H A;  2ZME B;  1BW6 A;  4XLF A;  1KZH A;  2W4S A;  4RAZ A;  3KZZ A;  2BXZ A;  3QP6 A;  3HPH A;  1I27 A;  2M7B A;  2P4W A;  1OCC H;  4HG2 A;  2AQF A;  2CH0 A;  4XLE A;  1G59 A;  2Z3Y A;  4ESJ A;  1FZP B;  4ZYE A;  2ID6 A;  2RV8 A;  4YG2 F;  1W0T A;  1K6O A;  1JE8 A;  1ZQ3 P;  2BYV E;  2DOE A;  2IGN A;  3MQ0 A;  1Z77 A;  4WXD A;  3TMO A;  5FD5 A;  5KVR A;  5EDN A;  1HW2 A;  1ULY A;  1MBF A; 
#chains in the Genus database with same CATH homology
 3H3V K;  3OSG A;  1OFC X;  3GTQ J;  1OJL A;  4JX5 A;  2PMZ N;  3TP3 A;  1QRY A;  4FCY A;  1DU0 A;  2NVT J;  1I3Q J;  2N8G A;  3ZQH A;  2ECB A;  2JJ7 A;  5F1J A;  3HDD A;  1G2H A;  4C3J J;  2LR8 A;  5C44 J;  5E3N A;  1HLV A;  1RPW A;  1ENH A;  1MBK A;  1P7J A;  2X48 A;  3JRA A;  1MSE C;  3ZQL A;  4M3D A;  2B63 J;  3JRG A;  1RR7 A;  3B6A A;  1JTX A;  3MKL A;  3BR3 A;  3S15 J;  4D7M A;  3HGY A;  2R5Z B;  2EQR A;  2LLK A;  1JUM A;  2XPU A;  1JTY A;  1S7E A;  1WGX A;  2L7M P;  1HF0 A;  1MBG A;  2K9N A;  2XGE A;  3ZQF A;  3BR5 A;  4M3E A;  2CJJ A;  2CQQ A;  3IH4 A;  3FIS A;  5F0C A;  5F0H A;  3Q0V A;  5FLV A;  5C4X J;  1OCT C;  3BTL A;  2WAQ N;  2COB A;  1IUF A;  1JKR C;  3I4M J;  3CMY A;  2DMU A;  1LFU P;  4DZJ A;  4IHY A;  3BTC A;  2XB5 A;  1RET A;  2EZI A;  3SDG A;  1NK3 P;  2EH3 A;  2HDD A;  5FKL A;  3JRB A;  1ETK A;  3S16 J;  4MIM A;  1LFB A;  2M2E A;  3JRI A;  5J1U A;  4XID A;  2YS9 A;  3A01 B;  4NDL A;  2JK3 A;  3HM5 A;  2DA1 A;  2NS7 A;  3B6C A;  1Y1W J;  2Y9Z A;  1SAN A;  3A02 A;  1WI3 A;  4CYC B;  4QIW N;  2DMP A;  5IPA A;  4A3D J;  4GFB A;  2O8K A;  3HOW J;  3G1L A;  5HOD A;  1U78 A;  3M3Y J;  1ZKG A;  1IV6 A;  3OSF A;  3RQI A;  1RES A;  2HQ5 A;  5JLX A;  2FQ4 A;  2MSY A;  3JRH A;  2VI6 A;  4BY7 J;  1MBJ A;  2L7Z A;  4JX4 A;  4A69 C;  1I50 J;  2EZK A;  2QCO A;  2TRT A;  4A3K J;  3GTG J;  3PM1 A;  5FKO A;  5FJ8 J;  1U8B A;  1ITY A;  2L0K A;  2CU7 A;  1NK2 P;  2E2H J;  1UHS A;  1HDP A;  2I10 A;  4HNV A;  1QVU A;  5J3L A;  2XSD C;  2KDZ A;  2YUS A;  1F43 A;  2DMT A;  2D5V A;  3W6V A;  2DA5 A;  2WV1 A;  2R93 J;  3S2D J;  3NAR A;  3PO2 J;  4W97 A;  4A3L J;  4BKX A;  3BG9 A;  3UKG A;  2ID3 A;  1A6I A;  4MFE A;  5M3M J;  4B4C A;  3Q0W A;  1JT6 A;  1JJ6 C;  5K7H A;  1CQT A;  1U9N A;  2M0C A;  2M34 A;  4S0H B;  1FJL A;  1POG A;  3O8G A;  2XPV A;  1UG2 A;  4V2F A;  1AU7 A;  1VFC A;  3HOY J;  3TW7 A;  3I4N J;  1ETX A;  2XGD A;  2Y2Z A;  4D5C A;  4DYR A;  1B72 A;  3S1N J;  3S1Q J;  5EF6 A;  1ETQ A;  5F0F A;  3BQY A;  1P7I A;  3ZQI A;  3GTP J;  2EZL A;  1A5J A;  4IHX A;  5M5X J;  3C2B A;  1OCP A;  2K40 A;  2R7Z J;  1JGG A;  3TP0 A;  4EEF G;  1YRN A;  3QPL A;  3HOU J;  3JRD A;  3FK7 A;  1QPI A;  3ZQG A;  1JUP A;  1IC8 A;  1X2N A;  5EG0 B;  3GTL J;  3OOU A;  2ECC A;  5K7F A;  3BR0 A;  3CDL A;  2OF7 A;  1GDT A;  3A03 A;  2DJN A;  1VI0 A;  1FIP A;  2IAI A;  1TC3 C;  5M3F J;  2NOG A;  1LE8 B;  3L1P A;  3VPR A;  5C4J J;  4M3B A;  3JRC A;  2R5Z A;  4RDU A;  1T56 A;  4W1U A;  1X2M A;  3CQZ J;  1RKW A;  1MNM C;  4L5E A;  4A3I J;  4MFD A;  1JKQ C;  3PO3 J;  3LSP A;  2MGQ A;  3LSG A;  2O9L A;  1FTZ A;  2GLO A;  4C3I J;  3JRF A;  1K61 A;  2X9D A;  5IP7 J;  1QVT A;  2WB1 N;  2VKE A;  2TCT A;  4C3H J;  3HOX J;  3QPS A;  1H8A C;  4FIS A;  4XRS A;  1GV2 A;  4JX6 A;  1IJW C;  4BXX J;  1ZR4 A;  3BQZ A;  2QF7 A;  1B8I B;  5FLM J;  4J19 A;  3BR2 A;  3RZO J;  3WHB A;  4B1R A;  2HI3 A;  4A3F J;  2AO9 A;  1TWA J;  2FD5 A;  3DEW A;  4A3C J;  5EGO B;  5GP9 A;  2XPW A;  2Y31 A;  4JP0 A;  5K7Z A;  1NTC A;  5DTD A;  1EF4 A;  2E2J J;  4AYB N;  1K83 J;  4ABZ A;  2JMW A;  4CYC A;  1ZGW A;  4A3M J;  5IP9 J;  4IHV A;  2JA8 J;  2CQX A;  3HKZ N;  3S14 J;  3ZQC A;  2R0Q C;  3LOC A;  1AHD P;  4IHW A;  2XGC A;  4UUS B;  1TWH J;  1PUF B;  3TW6 A;  2DA4 A;  3G1O A;  1HDD C;  4BY1 J;  3G1M A;  3LSR A;  2W48 A;  4A3E J;  4FE4 A;  4AC0 A;  5JLW A;  1IDZ A;  1XC5 A;  1XS9 A;  3GTJ J;  3O8H A;  2HYJ A;  2KT0 A;  4C2M J;  5J1R A;  3SJM A;  1MH4 A;  2IEK A;  2NS8 A;  5GPA A;  2R5Y B;  1GUU A;  1SFO J;  2LP0 A;  1FEX A;  4IEJ A;  3S2H J;  4AUX A;  1F36 A;  5F27 A;  2M8G X;  5GPC A;  3GTK J;  1TWC J;  3JRE A;  2LD5 A;  2ZB9 A;  2R92 J;  1TWG J;  1H89 C;  2H8R A;  2LY9 A;  3GTO J;  3BG5 A;  4XRS G;  2LFB A;  5M5Y J;  2OPT A;  5E3M A;  2H1K A;  3M4O J;  1ETO A;  1JKO C;  2DTZ A;  3FIW A;  3BTJ A;  2DA7 A;  3WHC A;  2JA5 J;  2E19 A;  2K9Q A;  4I76 A;  2Y0S N;  2Y30 A;  3RZD J;  4JYK A;  2K9S A;  1JT0 A;  1R9T J;  4M3F A;  1MBE A;  5IOZ A;  4A3G J;  2DMQ A;  3MN2 A;  1DU6 A;  2CRG A;  3BR6 A;  1X58 A;  1AKH B;  3NAU A;  4DYC A;  3JR9 A;  1GVD A;  1Q1V A;  1VND A;  5DS9 A;  4QSH A;  4V2G A;  2YU9 J;  1FTT A;  5IYC J;  1TWF J;  4X1E A;  2IBD A;  5F08 A;  2GM4 A;  5F04 A;  3S1R J;  2LTP A;  4XRM A;  1YRN B;  5EG0 A;  1U9O A;  4D7N A;  3E7L A;  3MVP A;  2GBY A;  3ZOB A;  1WCM J;  5M5W J;  4RBO A;  1LE8 A;  1Z0X A;  3RKQ A;  5E3L A;  4UUT A;  2DA6 A;  1JUS A;  1JJ8 C;  2EBI A;  2ME6 A;  1IGN A;  1I6H J;  2NVQ J;  3GTM J;  3S1M J;  5FKK A;  5IP6 A;  5E3O A;  2L9R A;  1RKT A;  1H88 C;  2EZH A;  2XRL A;  2ME0 A;  1GV5 A;  4M3G A;  3LSJ A;  2DMN A;  2FJ1 A;  3HB9 A;  4BBR J;  2JWT A;  4FTH A;  3Q3S A;  1IG7 A;  2HOT A;  1BW5 A;  2NVY J;  3S17 J;  2MW8 A;  1UMQ A;  4DZP A;  4LOC A;  1B8I A;  2VKV A;  3FKI J;  3A01 A;  3IV5 A;  4Y52 J;  2P81 A;  1E3O C;  1MSF C;  1VF9 A;  2O7O A;  5BNG A;  2LVS A;  3BG3 A;  3TED A;  2DA2 A;  5EGO A;  4DYQ A;  1GT0 C;  3DCF A;  3HGG A;  5EZG A;  4BBS J;  1O4X A;  2ELK A;  5IYD J;  1WH5 A;  4M6V A;  1HOM A;  4A93 J;  2DA3 A;  4DW6 A;  1JKP C;  2AHQ A;  1ORK A;  3HOV J;  5C3E J;  1MH3 A;  3QQA A;  5EYR A;  3FK6 A;  4G12 A;  2M9H A;  4I6Z A;  1D5Y A;  3IH3 A;  2HOA A;  4UUS A;  1HCR A;  1IDY A;  1PUF A;  1FIA A;  3OIO A;  3K2A A;  5FKM A;  2LKX A;  1ZR2 A;  2DN0 A;  4FE7 A;  5IYB J;  9ANT A;  3HEF A;  1BL0 A;  2HXI A;  1XG1 A;  1ETV A;  2RAE A;  3LNQ A;  3D1N I;  5J1Y A;  5EEA A;  5IOY A;  4X6A J;  4MLO A;  1APL C;  2Y9Y A;  3SFI A;  4B3A A;  2XB0 X;  2R5Y A;  3CCY A;  2E2I J;  3BR1 A;  4A3J J;  3IH2 A;  1IRZ A;  2HOS A;  1T33 A;  3K7A J;  3H0G J;  1MBH A;  3BT9 A;  3HOZ J;  3GBG A;  1BA5 A;  1W0U A;  1WH7 A;  2NVX J;  1Y1V J;  4A3B J;  3BTI A;  1ZTR A;  3Q0U A;  1BJZ A;  2CUE A;  2JA7 J;  2JN6 A;  2LK2 A;  4Y7N J;  2L7F P;  4QTR A;  5FKN A;  2JA6 J;  2E1O A;  4XIC A;  1BW6 A;  3HBL A;  1ETY A;  1ZK8 A;  4MO7 A;  2G0E A;  2HXO A;  2FX0 A;  2MG4 A;  1B72 B;  1WPK A;  4D5F A;  1AKH A;  2VPR A;  2X6O A;  2ID6 A;  1W0T A;  5EZH A;  1ZQ3 P;  2VUM J;  1ETW A;  2CUF A;  4XK4 A;  1Z77 A;  5EDN A;  3F0C A;  1MBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...