4UUSA

Crystal structure of a ubx-exd-dna complex including the ubda motif
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
67
structure length
67
Chain Sequence
GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEIQAIKELNEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
total genus 25
structure length 67
sequence length 67
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uusA00
5F0CA 1IV6A 2JJ7A 4RBOA 3A03A 1AHDP 3FK6A 2NVQJ 3HGGA 2ECBA 2ID3A 5EZGA 3GTKJ 2XGCA 3Q0VA 1QVUA 3JRBA 2NS7A 5JLXA 1HDPA 2XSDC 5M3FJ 1JT0A 2GM4A 3JRAA 1TWGJ 3BR0A 1B8IB 1CQTA 2K40A 1EF4A 5EG0A 3S1QJ 1P7IA 1ORKA 4X1EA 5M5WJ 1HF0A 4FE7A 2DTZA 2DA2A 2HXIA 4G12A 5IYCJ 5FJ8J 5IP9J 3CCYA 2VKVA 3BTLA 2L0KA 1U8BA 1BW6A 5J1RA 2DMUA 5IP6A 5J3LA 2DA1A 2EZIA 3JRDA 4IHVA 2CUFA 2JMWA 1GV2A 2X48A 2Y2ZA 3CDLA 3Q3SA 1H89C 1IDYA 2TCTA 2R5YA 3BR6A 1RKWA 1T56A 1MSFC 3A01A 3HEFA 1QVTA 2FQ4A 1UMQA 2MW8A 4FCYA 1LFBA 4QTRA 3S17J 4A3DJ 1JUMA 2XB0X 5FKKA 5DTDA 1WPKA 4Y7NJ 1GT0C 1JKPC 2R0QC 2X9DA 4ABZA 2ZB9A 2DA7A 3BG3A 2M9HA 1ETQA 3JREA 3HOVJ 5F27A 4C3JJ 2JK3A 5F0FA 5C3EJ 3GBGA 4DYQA 4AC0A 4IEJA 4A93J 3FISA 1LFUP 2XGDA 4DYRA 3SJMA 4JX4A 3FK7A 4X6AJ 2ELKA 2M34A 4FISA 2XPWA 2D5VA 2RAEA 3GTGJ 2VUMJ 5FLMJ 2TRTA 2OPTA 1POGA 1TWHJ 3ZQHA 1PUFA 4BXXJ 1BW5A 3LSGA 2HOTA 5J1YA 1I6HJ 3OOUA 1GVDA 4M3BA 2I10A 5J1UA 3TP0A 3ZQGA 1MBKA 4UUSA 1AU7A 3GTOJ 3BTCA 4A3JJ 3A02A 1IC8A 2Y0SN 4JX5A 3HOXJ 1LE8A 2Y9YA 1FIAA 3CMYA 2R5ZA 2ME6A 3GTQJ 1X2MA 4A3LJ 4C3HJ 2HDDA 3GTLJ 4BBSJ 3BG9A 2R93J 3HOZJ 4BY7J 1VNDA 3RKQA 3ZQFA 3S2DJ 1Y1VJ 1ZR4A 5IYDJ 3S1MJ 2N8GA 2LP0A 3K2AA 3OSGA 1FIPA 1RKTA 2E1OA 4MIMA 5GP9A 1ZGWA 4MO7A 1U9OA 1ETVA 1ETKA 2CUEA 2LLKA 3MVPA 3HDDA 4B4CA 2EZLA 5IPAA 1VFCA 1ZR2A 2VKEA 1I3QJ 1JJ6C 3W6VA 3H0GJ 2IBDA 1ZK8A 4UUTA 1MBJA 1NK2P 2JA6J 3BG5A 1P7JA 1HOMA 3PM1A 1TWAJ 3LNQA 1GUUA 2HI3A 5EZHA 3WHCA 4XK4A 1FJLA 1ZQ3P 5M5YJ 4A3BJ 1H8AC 3I4MJ 2Y31A 1BJZA 1MBFA 3OIOA 1I50J 1MBHA 1FTTA 1A5JA 1OFCX 5K7FA 1JUPA 2K9NA 3BQZA 2JA7J 3S14J 1Z0XA 2LY9A 3QPLA 1D5YA 2K9SA 4QIWN 5IOYA 2H8RA 2KDZA 2DN0A 3RQIA 1TWCJ 1ETXA 1QRYA 2X6OA 4A3CJ 2QF7A 3TW7A 5EGOB 4A3IJ 4V2GA 5E3MA 2DA3A 1WCMJ 3BR3A 3NAUA 3HOWJ 3L1PA 1XS9A 2LD5A 1OJLA 2IAIA 1B72B 5C4XJ 4XRMA 5F04A 2Y30A 2M8GX 5C44J 1IDZA 2JWTA 3E7LA 2VPRA 3ZQIA 1JKQC 1B72A 1YRNA 5EG0B 2NVXJ 1AKHA 2R5YB 1ETOA 3BT9A 5BNGA 4IHYA 2NOGA 2DMQA 2XB5A 2PMZN 4A69C 4A3KJ 1OCPA 2HQ5A 4S0HB 1WH5A 3JRCA 1IJWC 1ZTRA 2JN6A 2E2JJ 3H3VK 4QSHA 1Y1WJ 3LSRA 3FIWA 3TW6A 1JKRC 1HCRA 2L7FP 2FD5A 3S1RJ 1SANA 1Q1VA 5IOZA 1GDTA 1W0UA 3FKIJ 2O9LA 2XGEA 1H88C 1IGNA 3BTIA 3JRGA 1G2HA 5K7HA 3IH4A 3DCFA 3IH2A 3G1LA 1JT6A 3G1MA 1IUFA 2HOAA 4JYKA 2JA8J 4DYCA 1XC5A 2CJJA 5E3NA 2FX0A 2DA6A 4I76A 4IHWA 1MNMC 2B63J 2AHQA 4CYCB 5EGOA 1BA5A 1ETYA 1NTCA 2KT0A 2K9QA 2LR8A 5E3OA 2L9RA 2M2EA 4M3FA 5DS9A 2OF7A 2QCOA 2GLOA 4BKXA 1U9NA 1JUSA 2W48A 3BR5A 2M0CA 5EF6A 1OCTC 2EH3A 5FKLA 3BTJA 3ZQCA 2ME0A 4B1RA 4MFEA 1HDDC 3G1OA 1NK3P 9ANTA 1YRNB 2HYJA 2VI6A 4C3IJ 1ZKGA 2E2HJ 3JRIA 5F0HA 2DA5A 3ZQLA 4V2FA 3DEWA 2DA4A 4BY1J 4D5FA 2R7ZJ 3JRHA 2R92J 1ETWA 3LOCA 1TWFJ 2EZKA 5C4JJ 3IH3A 1GV5A 2L7ZA 1F43A 2G0EA 3PO3J 1T33A 4EEFG 4IHXA 3LSPA 2R5ZB 1F36A 3JR9A 4W97A 3S15J 2HXOA 3D1NI 4XICA 3MN2A 2JA5J 3BQYA 4XRSG 2LKXA 3QQAA 1VF9A 1VI0A 4LOCA 3TEDA 3OSFA 4FE4A 4DW6A 1K83J 3HOYJ 3O8GA 5GPCA 3HOUJ 3TP3A 1E3OC 2H1KA 2WAQN 5FKOA 4HNVA 2DMTA 2XRLA 3Q0UA 2EQRA 2NS8A 5IYBJ 2LFBA 2MGQA 4C2MJ 2DJNA 1Z77A 4D7NA 1RPWA 4BBRJ 1JJ8C 4M3EA 1WGXA 2XPVA 1MH4A 3BR1A 1RETA 2GBYA 2DMPA 4M3DA 2COBA 2YUSA 5FLVA 2E19A 4MLOA 4W1UA 2MSYA 3F0CA 2YU9J 3S16J 3ZOBA 5FKNA 1RESA 1TC3C 3SDGA 2HOSA 2O8KA 1HLVA 5F08A 3RZDJ 3M3YJ 1FTZA 4XRSA 1JTYA 3K7AJ 2L7MP 4L5EA 4AUXA 3S1NJ 3QPSA 1DU0A 3HKZN 4JX6A 2FJ1A 1BL0A 3SFIA 5FKMA 5GPAA 2O7OA 4DZPA 4XIDA 2MG4A 1LE8B 1X2NA 1WH7A 4RDUA 3GTMJ 4D5CA 1ENHA 4I6ZA 3HGYA 2LTPA 2LVSA 5IP7J 2IEKA 4A3GJ 2CQXA 1DU6A 1XG1A 2EBIA 4UUSB 5F1JA 5M5XJ 2ECCA 1SFOJ 4D7MA 5EYRA 2WB1N 3UKGA 1K61A 3B6AA 3MKLA 1B8IA 1UG2A 1JGGA 3HB9A 5M3MJ 1MH3A 1U78A 4M3GA 5EDNA 3BR2A 4A3EJ 4JP0A 1O4XA 5EEAA 2E2IJ 1QPIA 3A01B 1AKHB 2EZHA 2CU7A 2YS9A 5E3LA 1UHSA 2NVYJ 3WHBA 4B3AA 3Q0WA 3C2BA 3HM5A 4Y52J 1ITYA 3CQZJ 4A3FJ 5K7ZA 1X58A 1MBGA 2ID6A 4A3MJ 3S2HJ 1IG7A 3O8HA 4FTHA 2DMNA 1APLC 1A6IA 4GFBA 4CYCA 2XPUA 4AYBN 5HODA 1WI3A 1FEXA 2CRGA 4DZJA 1MBEA 5JLWA 2AO9A 2P81A 1PUFB 1JKOC 3I4NJ 4M6VA 2WV1A 3HBLA 4MFDA 1MSEC 2LK2A 1R9TJ 3RZOJ 3GTPJ 2NVTJ 1JTXA 1RR7A 1S7EA 3LSJA 3GTJJ 4NDLA 1IRZA 3NARA 1W0TA 3JRFA 3IV5A 3B6CA 4J19A 3PO2J 2CQQA 2Y9ZA 3M4OJ 3VPRA
chains in the Genus database with same CATH superfamily
1WI9A 2UUZA 1R23A 2JJ7A 5AIPA 3RI4A 2W24A 5F64A 2NVQJ 1AHDP 3FX3A 1R5ID 1HKQA 4Q47A 5EZGA 3Q0VA 3WE3A 1KQ9A 1YHQI 1JT0A 2GIZA 3RIRA 1TWGJ 1EF4A 2W1OA 2HOEA 5EG0A 3S1QJ 1P7IA 3I0TA 2CG4A 2V6EA 5DD8A 2CUJA 4FE7A 2RNGA 1ZRFA 4D1QA 2QEXI 3PSFA 2HXIA 5K1YA 4IZZA 1XGNA 2GA2A 2D45A 5IP9J 3CCYA 4DNCA 2VKVA 1MZBA 3BTLA 2Z9OA 1YYVA 2L0KA 4LLGF 1BW6A 2R7OA 4IHVA 4AU7A 2XDVA 4EJVA 1UZCA 3H9GA 4G7HF 4DBRA 2JVGA 1S7AA 3K70D 1RKWA 1MSFC 1O7LA 3A01A 4NB5A 2Y48A 3VDXA 1QVTA 2VLAA 3N05A 4ZTFA 3S32A 1TT5B 3LWFA 2MW8A 2MLGA 1CF7B 2LREA 5FKKA 1GT0C 1JKPC 4LB5A 2XSJC 4OINF 3R61A 2ZJPF 1YW8A 1BR4A 3P7NA 2FBIA 2CW0F 2BHZA 3JREA 2VN2A 3DU5A 2BHYA 5L3FA 2M1BA 3K4JA 1LEBA 1O57A 1JI8A 3F6VA 1X3UA 2NAZA 3RKXA 3M8EA 4DYRA 1C0WA 3ZRGA 5L3DA 1G3WA 1Y6IA 4IHTA 2FU4A 1ZG3A 3UR3C 3ERMA 1LDDA 2M34A 4FISA 2XPWA 2XAQA 2VUMJ 1JE8A 2GXAA 4GYGA 3BWGA 3ZQHA 1POGA 2KFDA 1SD4A 1BW5A 3VWBA 4HSRA 2HOTA 5J1YA 4XMYA 4HDUA 2JQ7A 1MMGA 2EWNA 1JGSA 1N78A 3BJ6A 3LSMA 1RUOA 2FSWA 2QSGX 3LSHA 5JI6A 3GTOJ 4DBQA 5HLTA 2WY7Q 3A02A 4EM0B 2Y0SN 3S2WA 3BROA 2CV1A 3F9KA 2PLYA 1FIAA 4LLNA 4ENJA 3CCLI 3FBIB 1E3HA 1V55H 4HNTA 3GTLJ 2ZO4A 4L9JA 2M7BA 3IUOA 2EINH 3MAJA 2XROA 1BR1A 3HC7A 3H3UA 4LFUA 2AS5F 4KIBA 2IA2A 2E1OA 2I8DA 4CYDA 4BAYA 4MO7A 1ETVA 1U9OA 4A5MA 2VKHA 2VL8A 2LLKA 3P5JA 5D4SA 3H92A 1VFCA 1MD0A 2VKEA 2VC1A 2R7VA 2H1LA 4CCLA 2IA1A 2L01A 1XMXA 2HTJA 1MBJA 4KT6A 1FZPB 3BG5A 1G8XA 3ZMUA 3PM1A 3LNQA 5IT9Z 2XAFA 2KRCA 4XK4A 5IT9K 1BBYA 1IRGA 1SMYF 3GLXA 5IT3A 2ZSHB 4A3BJ 1H8AC 3I4MJ 3VB2A 1ZLJA 2XF6A 1OYYA 4LJZF 3TO6A 2MH9A 3ZGKA 1BJZA 1J5YA 3OIOA 3OYAA 1MBHA 4ZJZA 5L3BA 2ZFWA 3OMYA 4ZYGA 2IGNA 2IS2A 1JUPA 2O6GE 5CVRA 1TTYA 2K9NA 3OL3A 4F7ZA 3KEYA 3L2RA 3DTKA 5CQEA 3CTAA 4OWRB 3R4KA 3QPLA 3LA2A 1D5YA 3BG7A 3TGNA 4ZYDA 1XDUA 4LG3A 1OCZH 2R7QA 4XLEA 3MMYB 4A3CJ 3VEPA 5EGOB 2XVCA 1W5TA 2ISYA 4EM2A 4M72A 1X1AA 2B0LA 3TQNA 4F55A 3MFKA 4IKFA 1OJLA 2DBBA 2OBPA 3LSIA 1UAAA 1J09A 1B72B 2V4JC 3OYDA 2M8GX 2JWTA 2VPRA 2WAEA 3KEQA 3K69A 3IP4B 3OR1C 1B72A 1YRNA 3ZMTA 1WRJA 2R5YB 4XR6A 4QLCU 4C2UA 4IHYA 5J8FA 4S0HB 3H3VK 3R60A 2WV0A 2DLLA 4ZDPA 3RCOA 3SZGA 1S29A 4HPQA 4BHBA 2MFZA 2JRMA 3JAMK 3I56I 1JKRC 1QU3A 2L4AA 2CQNA 1Z9CA 2L7FP 4JBAA 2FD5A 1GVJA 4WK8F 4H4KC 4CCJA 3AAFA 1FY7A 3ECOA 4I02A 2ZXJA 1P4XA 1SC7A 2O61A 2DYRH 2W84A 4ZDLA 1H88C 1G4DA 3ULQB 1IGNA 4KUMA 3T5XA 3BTIA 3LL7A 2HZDA 1SFXA 3PL8A 1VQOI 2K5CA 3IH2A 3Q9VA 4KISA 1JT6A 1SFUA 4OIQF 5KCMA 1ZGAA 2HOAA 3ZR8X 5BOXA 2QKLB 5CVJA 3BZ6A 4PSXA 2CJJA 1T0FA 3HPGA 4D9JA 2DYSH 3ZPLA 2W4SA 1IXCA 2B63J 4XLPF 4ZTJA 4XKBA 2YR2A 3K10A 3V42A 5ICEA 2B9SA 3DPUA 3FF5A 2K9QA 2OZ6A 2BBYA 1HXDA 2V6CA 5B1AH 2F5DA 4KA4A 2HQNA 2GLOA 2QCOA 3BPVA 4S05A 2G9WA 5DM7F 1RR8C 3S8PA 2OQGA 1OCTC 3F8MA 3X2QH 1OYIA 3C3WA 1USSA 2QM3A 4II2A 2MD0A 4ESJA 3FKJA 4MNUA 4EVIA 3G1OA 4PJJA 2ELHA 5FLXZ 3ZMSA 2VI6A 2RQQA 1ZKGA 1MNEA 5F0HA 2DA5A 4PK4A 4V2FA 4A12A 4I7HA 4XNFA 3VSLA 2DA4A 2R7ZJ 4G8XA 1W7PD 4U7BA 2P8TA 2EZKA 2LKPA 3OIQA 5KAIC 2DU9A 3IHUA 1DUXC 4Z6YA 1R1VA 2G0EA 2DJIA 4AIKA 4IQJA 1KA8A 3PO3J 3AG2H 3CC7I 3V4GA 3DPLC 4GCVA 4W97A 3S15J 3HSFA 1FPQA 4XICA 1LKXA 3MN2A 1BJAA 1U8RA 2QQBA 3BLYA 4LOCA 2H09A 2PEXA 1VQNI 5B66C 4RM3A 3TEDA 2HWVA 1LDKB 2A69F 3K6GA 4FE4A 4JK1X 3JW4A 3ZN0A 4PJMA 3HOYJ 3HOUJ 4NC6A 4HAMA 3KLNA 4XBFA 1QBJA 2H1KA 1Z7UA 1ULYA 3EUKL 2DTRA 1PJRA 3KZZA 4EQQA 1D0ZA 1IO2A 1FMVA 4BEHA 2XRLA 2EQRA 3SZTA 4F91B 4XONA 3L2VA 3QPTA 3WG9A 2J5PA 4CCNA 1IN6A 4HLXA 4UVAA 1IV8A 4P55A 2XPVA 2EFOA 1BOAA 1RETA 4N4OB 4M3DA 3T8TA 1ODDA 1DP7P 1XB4A 3TO7A 2HTSA 4W1UA 1YX3A 2DCEA 1I6XA 1H9GA 3F0CA 3ZOBA 1WJEA 3FXMA 3K4KA 2BE5F 2BW3A 2O0YA 4F3QA 1TC3C 3CUQB 2AQFA 3GEZA 1YJ9I 1MJAA 5E1ZB 2L54A 3CJQB 2HPIA 2WC2A 4L5EA 2L7MP 3AG1H 4AUXA 2EV6A 4WCGA 1V4RA 2KHMA 4I0AA 3WG7H 1SAXA 1U5TA 1TW2A 2FJ1A 4IOAF 3BCAA 4FX4A 5GPAA 5GADJ 5H20A 3RSNA 3GXOA 4RDUA 2HQAA 3RYPA 2AXLA 1TLHB 3D0SA 2PJRA 1WKMA 2DOEA 5L3EA 3ABLH 1BC8C 2LVSA 4CA0A 2IEKA 4A3GJ 1T95A 5LRSA 2HGCA 1DU6A 5F1JA 2PJRB 2M5WA 4D7MA 2WB1N 4HX4A 3KP6A 3EPZA 1UG2A 2OU2A 2X4HA 3HB9A 3KYCB 3O6BB 2V9KA 1K78B 2XUBA 1Z3XA 3CLOA 4XOPA 4HX8A 4MQVA 1KGSA 5EEAA 3CDIA 2E2IJ 3WHBA 1FYKA 1TNTA 1WJCA 3HHHA 2V1XA 4ZYEA 2HS5A 2Z99A 2X6XA 3V7RA 3ERED 4F52A 3CQZJ 3C1DA 2DT6A 1R22A 4J00A 1A31A 1X58A 1IRFA 4S04A 5BMZA 4XL9A 1H9TA 2X51A 5TJJA 1U2WA 2XPUA 5LBQA 4CYCA 4AYBN 4IHSA 1FEXA 1OYWA 3F3XA 4DZJA 1MBEA 2VQGA 1D1BA 2R7XA 2E1NA 4RGRA 3I4NJ 2QQAA 2KISA 2KJCA 1W4MA 1N75A 4U0VA 5CVUA 3CJTB 2M4KA 2RDPA 2LK2A 3E0JB 5AIQA 1Y8RB 1RR7A 5DUKA 1S7EA 2EV0A 3LSJA 3TDUC 4E7LA 4NDLA 2IXSA 5DCMA 4RGSA 1W0TA 3IV5A 3OYFA 3TBIA 3NWTA 4IJAA 2Z16A 2Y9ZA 3OS1A 3I53A 3RYRA 1X1BA 4RB2C 3VPRA 4RB0A 4G6QA 5F0CA 2Q1ZB 1IN4A 3ECHA 2F6CA 1VQ9I 2EPFA 3GTKJ 2P5LC 1X3WB 1FOWA 2NS7A 1ZH5A 3FHNA 1HDPA 3JSOA 2XSDC 2GM4A 4CZZA 5JHFA 3OYEA 1CQTA 1B8IB 1ON1A 1XSDA 5KHDA 3WU2C 1GHCA 5CJ9A 2ADUA 3QU3A 1HW5A 1WJBA 1KU2A 5IYCJ 1E0EA 5GTIC 2ZXWH 5E20A 5CQGA 1T0FC 1LQ1A 1XN7A 2MC3A 1U8BA 2CUZA 5J1RA 2HU9A 2DMUA 1FP1D 5J3LA 3JRDA 2EZIA 3KEOA 2Y2ZA 5FO5A 3OYGA 4B09A 1KQ8A 1IDYA 2TCTA 2R5YA 2VBXA 5TRDA 2KRHA 1LVAA 5JVTA 1SFKA 1T38A 3QODA 1K4TA 1BIAA 4ZDOA 3IL2A 4BE1A 3SXYA 4UHTA 4FCYA 1LFBA 4QTRA 3S17J 5FRNA 1W5CC 3HPHA 4R1HA 2XB0X 1W36D 1WPKA 3M8JA 2HYGD 1MJ9A 2PMHA 5HLHA 4ZH4F 3SQNA 2R0QC 1GXPA 2ZB9A 4EATA 1HBXG 2DK8A 1ETQA 4E7SA 5DYMA 2JK3A 2WADA 5BPIA 1YIJI 5IY5H 1YX5A 1A35A 4XKCA 1IF1A 4GDFA 2NYXA 4Y3OA 4BHPA 2XGDA 4L5IA 4NC7A 4BXFA 1SMTA 2M8EA 4JX4A 3G6EI 2E5NA 4X6AJ 2ELKA 1WJDA 1YE9A 2QYOA 5F1RA 3V7SA 1O3SA 2A05A 3J80Z 2TRTA 2GOMA 3S3OA 2P5KA 2ZMEC 1PUFA 4BJ6C 4V19K 3LSGA 1I6HJ 1A04A 2UZKA 2DFFA 2M45A 5KK1A 4FQGA 3WU0A 3D5SC 1MBKA 1ZYRF 4UUSA 4XQFA 4LITA 4LD5A 3BTCA 3CMMA 4A3JJ 2X6YA 1XDSA 4ENMA 3LQQA 3GFMA 4XORA 3TOAA 1R7JA 4HNUA 3L2UA 3OYNA 1Y8QB 3DXJF 2ME6A 3AG4H 1X2MA 3CC2I 4A3LJ 1TBXA 2HDDA 2LOOA 3V8JA 4OIPF 2R93J 2G7UA 2DQLA 3CUOA 4BY7J 1VNDA 3F8BA 2BZTA 3CP8A 5KAFC 1W36C 3RKQA 3DV8A 1FOYA 2LC2A 3S1MJ 2M87A 3HG9A 3WTTC 1FIPA 2OTLI 3OYLA 3SZPA 4E7JA 3M07A 2EIJH 4B3XA 1ETKA 4HG2A 2P7CB 1ZELA 4B4CA 3HDDA 5K5RA 4L0ZB 5IPAA 3OYCA 4EV0A 1ZR2A 2VOPA 2FOWA 5D5UB 3FMRA 4HV5A 1JJ6C 2BY2A 3WE2A 2IBDA 2RC4A 4C9YA 5J6XA 4UUTA 1HOMA 4O5VA 1P7JA 4RLQA 2LNBA 1TWAJ 4CDGA 3RQ4A 1GUUA 5EZHA 2K02A 5B5EC 2VQCA 3WGGA 4RM2A 4G6DA 2E34A 1ZQ3P 1R4NB 2R7TA 1P6RA 4Y33A 5JFRA 2A6EF 4PGHA 3PQJA 2OV7A 1MBFA 1H0MA 1STZA 3M1EA 2A6HF 3GX4X 3WTZA 3HZJA 1MMSA 2DT7B 5DCFA 2XC7A 4LIUA 4HYEA 4I2OA 2KJBA 3BQZA 1O3QA 2JA7J 4NQWB 1CF7A 1FLIA 4HA8A 2IP2A 1QQIA 1USTA 5D8LB 2BW3B 5LGTA 5TISC 2K9SA 4QIWN 2FQ3A 1XMKA 2DN0A 1F9NA 3KP7A 1I3AA 3RQIA 5D8KB 4CSWA 1UELB 1RRJA 1BOBA 1I5ZA 4A3IJ 5HNFA 3BZCA 3LSTA 3R0AA 4QPOA 4Q5SF 2P6SA 1O3TA 2QUFA 1M1EB 3KE2A 5EEHA 4WF2A 1CGPA 2QENA 2QQ8A 1FBQA 4BACA 5HOOA 4E7KA 1ERDA 2JUGA 2IAIA 5C4XJ 2KQRA 4XRMA 5C44J 2Y30A 5B1BH 1IDZA 3E7LA 1K6OA 4XLAA 3KYDB 2VONA 1JKQC 5LGUA 2NVXJ 3GZ6A 5BS6A 2COMA 2LDUA 4A0XA 1YJWI 2PMZN 4A69C 4HZFA 1K78A 1OCPA 2HQ5A 5JHUA 1IJWC 4HF0A 2A07F 4LG0B 5E79C 3E97A 3VODA 2WAQA 3LSRA 3CJNA 4HF1A 2OTJI 3FIWA 1W7PB 3I59A 3CCVI 4LG0A 3TL4X 2E60A 1RNLA 1SANA 4PFOA 3KP3A 3L2WA 5IOZA 2HYFA 4AVPA 5HVQC 2HPMA 1KQ0A 3OYKA 2PMZA 1RZ4A 2XGEA 2DFIA 2XIGA 3IWFA 3JRGA 1NG6A 3B02A 3IAS2 2FE3A 3O2PE 4H0EA 1OISA 3G1MA 4JYKA 3IAM2 2VJ4A 3BOQA 4DYCA 3A0HC 2ACJA 5D6EA 5LHIA 1Y39A 2X1EA 1FSHA 4N0BA 5DCMB 1VQ8I 3RJPA 4WXDA 4KIGA 2FX0A 3OYHA 5ILSA 2Q2EA 2DA6A 2RV8A 4OOIA 2EA4A 2AHQA 2HDCA 2W82A 4CYCB 1DQUA 4CHUA 5EGOA 2F5FA 1B4AA 2LR8A 1G3TA 2F5EA 4BE0A 4Q48A 5DS9A 4BKXA 3CCUI 2GWRA 3W6KB 2W48A 3BR5A 2L4MA 3H9JA 5L3GA 5EF6A 1R71A 4BS9A 4IX7A 1TT0A 1P4WA 3KCCA 1LNWA 5FKLA 3ZQCA 1X3ZB 1XGOA 2WAFA 3OV8A 2ME0A 3Q9SA 4B1RA 2NXNB 2STWA 3DFGA 2OUMA 3HJEA 4MFEA 1HDDC 2H6CA 3HRUA 2NVUB 1YRNB 2E2HJ 3PNTA 1K4SA 5E8IA 1KONA 3DTIA 1IN7A 3FXJA 4XLCA 2XASA 4ON0A 2F5CA 3DEWA 1XGSA 3L09A 3QU6A 4ZZLA 3MKWB 4D5FA 4BY1J 4X0GA 3JRHA 3HRMA 2R92J 2EILH 3COAC 2CV2A 1SD6A 4ZZDA 1GV5A 3NQOA 2L7ZA 2E1MB 3AL0B 2M7AA 2A6TA 4UXNA 1ZRCA 2BXYA 1DP3A 1GLNA 4EEFG 2ZJRF 2BXZA 4IHXA 4Q4ZF 3LSPA 1F36A 1FT9A 2HXOA 3D1NI 3K1MA 1L3LA 2G7HA 2K4JA 1SVLA 2LKXA 1R5GA 4I98B 2LKSA 4OAYA 1VF9A 1VI0A 4JQFA 3K4MA 1ZG5A 1QNTA 1X4OA 3K2ZA 1WJ5A 4CXFA 5B3SH 5GPCA 1V3FA 3TP3A 2PG4A 2EFNA 2Y75A 1K79A 3KX2A 3ZMVA 2DXIA 1FWZA 2X1CA 1Z91A 1R1UA 3J81K 1QO0D 4HNVA 2DMTA 3PNYA 4EMSA 4Y13A 1F1ZA 3WTUC 2PI0A 2WA0A 2VC0A 3SYTA 5IYBJ 1MMNA 2MGQA 3K1NA 1G3SA 1S7OA 2P7VB 3VYSB 2DI3A 4D7NA 2IS1A 4BBRJ 4ESFA 1J9IA 1WGXA 4M3EA 1MH4A 2QKMB 2EFQA 2GBYA 2DMPA 3IC7A 2V79A 2COBA 2YUSA 4PJ0C 3K9TA 1UCRA 1Z3YA 4HX7A 2E19A 2R4GA 4PDKA 3IKTA 1BI2A 2Y0MA 1NHAA 1AA7A 2JRTA 2MSYA 1D1AA 3JCUC 3VYTB 2YU9J 3A4CA 3I58A 1X1PA 5FKNA 3E5QA 3WTVC 4C2TA 2JSPA 3SDGA 4M9SA 2OCCH 5BQTA 2BY3A 1FTZA 3K7AJ 3O3KA 3S1NJ 2FRHA 4JX6A 2EFWA 2IJLA 3G4SI 2F48A 1UB9A 1FYMA 2VXZA 4CICA 2HVSA 4DZPA 4XIDA 3AG3H 3VFZA 2MG4A 3OYIA 3A2KA 2H8WA 1AWCA 3GTMJ 4D5CA 1Y56A 5E1XA 1MMDA 4BDYA 3HGYA 1O3RA 3GYHX 2GZWA 4C30A 1XG1A 4UUSB 1QZZA 3ZQQA 5M5XJ 4ASNA 3E6BA 1E2XA 4ETSA 1K61A 1I39A 3B6AA 3FXOA 2P0WA 2VE8A 1OCOH 4XLNF 2JZYA 1OR7C 1MH3A 3WTSC 2H27A 4EJUA 4YFNF 2DPDA 2NRAC 3BR2A 1I1GA 3A01B 1AKHB 2EZHA 1LB2A 2LY1A 4Y15A 4B3AA 2D2WA 4RB1A 2A5YB 3K4BA 3C2BA 4Y52J 2RVCA 2R7WA 1ITYA 5K7ZA 2DPUA 1MDMB 2K86A 4A3MJ 3GW2A 3A0BC 2PJPA 3MD2A 2QSHX 2DMNA 2Y69H 4N9IA 3F6OA 3BC8A 3FXUA 4M71A 4RAZA 4GO1A 2FA5A 4Y4RA 1OR7A 2P81A 1BI1A 3EQLF 4L9TA 1I27A 4LLLA 1JKOC 1GXQA 2E7XA 3N4MA 2DFHA 4RA2A 3WODF 3KZYA 3W2WA 4CCKA 3HBLA 2FBKA 4MFDA 5DD4A 3LA3A 1R9TJ 3GTPJ 4BQAA 4XKVA 2BV6A 5ERIA 3OIPA 3NARA 3C2HA 5EEGA 4AIDA 2OZUA 2O8XA 3PO2J 2YPRA 3M4OJ 4NQWA 3IRQA 3HOSA 3CCQI 3HRSA 1IV6A 3DBRB 2BY1A 2V1UA 3FK6A 1TNSA 3HGGA 2JTVA 4PUSA 1IN8A 2OAZA 4R79A 2EFPA 3T0YA 3EUHC 5JLXA 2CW8A 2F2EA 4YG2F 1IN5A 3JRAA 2KLOA 3BR0A 5LRRA 3DQVC 1VQMI 4X1EA 4BHCA 1OPCA 1HF0A 2E1CA 2DTZA 4YIFA 4PFPA 5FJ8J 2WBMA 2LF7A 2YU3A 2LG4A 4AYBA 2D1VA 3ZQ7A 3HUGB 1MKMA 1MMAA 4WXHA 5IP6A 4BQNA 2JMWA 1GV2A 2E7WA 2BYVE 2CSOA 3Q3SA 5HDNA 2M4GA 1VQLI 1T56A 2Z33A 3ISPA 5D5WB 3HEFA 2ZFUA 2FQ4A 3ABUA 4UY8I 1AOYA 4KYWA 1E17A 2ICWG 1FP2A 3FBNB 4G94A 2IVMA 2VOOA 2RREA 4UUVA 2CQ7A 4HSTA 1W7PA 1R58A 3I59B 1QZEA 4BU2A 2X9DA 5F6FA 4BJTA 2JUCA 4ABZA 1BI0A 2XHKA 3I9V2 1J0RA 2IPQX 3F72A 3N97A 2L9NA 1RC9A 1QHHD 4C3JJ 3HOVJ 3GBGA 2MBFA 1V54H 4AC0A 1K7AA 2L02A 4A93J 2X1DA 4N4NB 1ZGJA 1IXRC 4FASD 1Z67A 3FISA 2L2OA 1QPMA 2JVHA 2QGUA 3SJMA 3K4LA 1SAUA 5DDGA 4GYIA 4BYYA 4KN4X 2D5VA 3IKVA 2IRFG 2OPTA 1TWHJ 2W85A 2UV1A 3E6CC 3H0DA 3L00A 1J59A 3MQ0A 5FRMA 3CF5F 3OOUA 4R8HA 1TQPA 3ZQGA 1ZG1A 2IGKA 2CS3A 5D5VB 2ZXIA 1OLTA 1KU7A 2K85A 2JPBA 1IC8A 4KT5C 4JX5A 1G3YA 3HOXJ 1DPRA 1LE8A 5D6FA 3CMYA 3FWEA 4HDVA 1W1WE 1S5LC 4MTEA 3GTQJ 3ZCOA 2HKXA 5DV5A 3FM5A 4BBSJ 3BG9A 3PQKA 2JSCA 2L9SA 2P6TA 1D0YA 4KICA 3QWLA 5D4RA 3S2DJ 3ZQFA 1Y1VJ 3QYFA 3W6JB 2N8GA 2LP0A 3K2AA 4XSZF 3OSGA 1RKTA 4MIMA 6PAXA 1XSVA 5GP9A 3CCMI 1ZGWA 4DOZA 2CUEA 1I1SA 3BPXA 2K27A 2EZLA 1SVOA 4E70A 1N77A 4IOCF 3W6VA 3KP2A 4AIJA 1ZK8A 2JA6J 4IRGA 3CCRI 2A3SA 2XAGA 3GF2A 3WHCA 1FJLA 3SHFA 3G73A 2E71A 2OA4A 1D0XA 2DOFA 5M5YJ 3V8KA 1OMIA 5FFZA 1B1BA 2CV0A 1XD7A 1FTTA 3IWZA 4ZYAA 3C18A 5FB2A 2VBZA 2IT0A 3BZKA 1OFCX 3AFHA 1HKSA 3LFKA 3TMOA 5GAHJ 3GZNB 3GFLA 3E3VA 2AQEA 3S14J 2LY9A 5LLQA 2D1HA 3L7WA 1BN5A 2E1MC 3AL0C 5IOYA 4I01A 4ENKA 3HXLA 1G59A 1TWCJ 1QRYA 2X6OA 1PDNC 2KIMA 4ESBA 2MYSA 1XMAA 3FDYA 3TW7A 2LMDA 3ML6A 4FETA 4B48A 2VPLA 2VODA 2QZ8A 1Z6RA 3H36A 4V2GA 3BCBA 3R6SA 2PMUA 2V9VA 2K7LA 3BR3A 4II3A 2MABA 3L1PA 1S6LA 2BEOA 5K5OA 3DF8A 3OY9A 1DGWY 2K3FA 2R7RA 1B6AA 1VQ4I 2NS0A 2O03A 3PJRA 1YTYA 2DOAA 3DKWA 4ITVA 4PJNA 1F5TA 1X4PA 3ZQIA 4YEJA 2XKOA 2EB7A 3OOPA 4HLYA 2VKDA 2H6BA 3S3MA 2KKOA 2RN7A 4P9FA 5EG0B 3T8RA 1AKHA 2HEOA 2MC4A 1ZLKA 3BT9A 1JHFA 3MWMA 5BNGA 2XB5A 4BH9A 4A3KJ 3JRCA 3C7JA 1YW9A 3M9AA 1OQYA 2E2JJ 2V9PA 1IRXA 4XM3A 1Y1WJ 5HLIA 5LHHA 3P9IA 1R6RA 5ICCA 3E5UA 3PSIA 1ZAOA 4NC8A 2VQLA 4I99C 3KFWX 3KP4A 3H9QA 3S1RJ 3CMAI 4L0YB 1EH8A 3BY6A 2OQRA 2FUG2 5LHGA 1TW3A 4LK1F 1GDTA 2XF7A 4IXAA 4F93B 1W0UA 2O3FA 3FKIJ 1YOVB 2M30A 3RPUA 2VB6A 2VQHA 1G2HA 5K7HA 3IH4A 3GCMA 3CDHA 4BE2A 4M74A 4U0YA 1IUFA 2KPMA 2VBYA 2WY8Q 1F4KA 2CMPA 3HHGA 2BGCA 2XV4S 3U1DA 1KU3A 4CGZA 3K70C 5E3NA 4UV8A 1Q1HA 1N25A 4M73A 1MW7A 2W25A 3F8FA 4I76A 4IHWA 1MNMC 4Z2YA 2NNYA 3FMSA 3TO9A 1U6GA 2PX9A 4KFCA 1IAWA 4E7IA 1VQKI 2ETHA 5E18F 3D5LA 3CUQA 4M9ZA 1NTCA 2KT0A 5E3OA 2LF8A 1YS7A 2JPCA 2L9RA 2M2EA 2YX4A 3R0JA 4M3FA 4HV6A 4KITB 5ILUA 2FNPA 1B59A 1U9NA 2DQRA 5D5XB 1JUSA 2C6YA 1XX5A 3MEXA 4YELA 3ZMZA 1Z6TA 3G71I 4WX9A 3F8CA 4PZJA 4UNOA 3RPQA 1NG7A 1P2FA 1YFHA 2LH9A 9ANTA 3RTRA 2EIKH 4L9NA 5J47A 2HYJA 4C3IJ 5CLSA 2OD5A 2VJJA 3IRRA 2W7NA 1FOKA 3ZQLA 2LYCA 3E1SA 5LGNA 1EJ9A 5LEJA 2DODA 3DKXA 2RGVA 4RB3C 4UB8C 4J01A 3WGHA 1ETWA 1KYWA 1TWFJ 3BJAA 3C2GA 3G2BA 2OC6A 4GGGA 2BVLA 1FBUA 4JOMA 5C4JJ 2CGPA 2Q8KA 5HDGA 1ZN2A 1LUJB 4P9UA 2ZMEA 4RLFA 3BG6A 3LFUA 4P5OA 4L9VA 2R5ZB 3VYUB 1B9NA 5J4YA 2ZJ2A 3I3LA 1R00A 4XKWA 3DPTA 4HBLA 1XPXA 3J80K 1PP7U 5GAEJ 4RMNA 4OAZA 3I64A 3SEQA 3FHZA 2HFHA 2BVMA 2GOXB 2CH0A 1K83J 3M7GA 3CC4I 2MLKA 3O8GA 3DP7A 2HKOA 4GRIA 3U2RA 1YI2I 1E3OC 1XCVA 5HLGA 1B9MA 3KZIC 1HSJA 2HR3A 1P4AA 3OS0A 2AXTC 4EGYA 1IZ1A 1Y0UA 3OS2A 4AVZA 3K4CA 2NS8A 2LSOA 2HQRA 3RDIA 4OMZA 4Y17A 5BPDA 1TQIA 1Z77A 1JJ8C 1VTNC 1YJNI 2HNHA 5ED4A 4OU0A 2VASA 2QBYA 3S16J 4LIVA 3DBLB 4QPQA 1WQ2A 4EJWA 1ZRDA 2KIFA 2HOSA 3OL4A 4FX0A 3PFYA 2QBYB 2EA2A 3SDBA 1JTYA 1V5GA 1Z05A 5GAGJ 4ENNA 5HNHA 3ONQA 2Z5UA 1DU0A 1PVEA 1HW1A 1BL0A 3GO5A 2DO7A 2CFXA 1QHGA 2O7OA 2ESHA 4A5NA 2QA4I 4XN0A 1UJ8A 3NWSA 3P9CA 3PIPF 1LE8B 4QWQA 3SFZA 2LY2A 1TP4A 1U3EM 2IS4A 2BOLA 4I6ZA 4BNCA 3U9GA 5AONA 3BDDA 2CQXA 5CVIA 2JA2A 3MKYB 2GIVA 3PUBA 1L0OC 2EBIA 1Z7LA 3AKZA 1MIJA 4OMYA 4CUGA 4LB6B 3KLOA 3VOEA 4G7OF 1DDNA 2XKPA 1JGGA 2JT1A 3J7AO 2O5RA 2ZJQF 4UB6C 2W57A 5M3MJ 5EDNA 5FGMA 2F4IA 4HOBA 4JP0A 1NH3A 2DK5A 3CMEI 3F21A 5KVRA 2IS6A 4IVNA 5LD2C 2CU7A 4NNJA 2HZTA 2YS9A 5E3LA 1UHSA 2NVYJ 4CCMA 3HSEA 3HRTA 3Q0WA 3W2AA 1BM9A 3HM5A 2PQ8A 5K5QA 4DJAA 4KN7X 3W3CA 2ISZA 3S2HJ 3MKZA 4IF4A 2V7FA 1IG7A 4FTHA 3A1YA 2FXAA 3HTSB 1EH7A 1VQ7I 3FXQA 3I55I 1BC7C 1A6IA 4GFBA 2DDBA 5H2FC 5KNLA 5HODA 3I5UA 3QYEA 1KU9A 2EJRA 3U21A 5JLWA 4I0BA 1QZYA 3KIOA 1YIOA 2R7FA 4M6VA 3DLAA 1MSEC 3KETA 3RZOJ 1MJBA 2XAUA 3OYBA 1PYVA 3ROUA 1ON2A 4DGWB 3DEEA 4A6DA 3JRFA 3H5NA 4J19A 1PUEE 2F4MB 2CQQA 4AWXB 3J81Z 1QGPA 5E1WA 4RAGA 3KPHA 4RBOA 3A03A 4AM3A 3S3NA 1UG0A 4A0ZA 2ECBA 1FX7A 2ID3A 2K9LA 2R7DA 2XGCA 2ELJA 1E3PA 3PNVA 1QVUA 3JRBA 4O3MA 4XN3A 1R5HA 1ZARA 3DLLF 4NHJA 2UWMA 5M3FJ 4MGRA 2QSFX 4LGWA 2K40A 1ZREA 2YX7A 1VZ0A 4I09A 1ORKA 1REPC 5CVVA 4BGDA 1A36A 5JR3A 3PIOF 5M5WJ 1EKEA 3ZN1A 1OKRA 3CO6C 2DA2A 1VQ5I 4G12A 2PBIA 1YW7A 4KJZA 4PCQA 4LK0F 5ILVA 2NOJB 1IUYA 2DA1A 2YSRA 3M8FA 2CUFA 2FBHA 2X48A 2ZCWA 3ABKH 1R49A 3CDLA 1H89C 1X1DA 3LQRA 4XLHA 4FHTA 2KZGA 3QOPA 3BR6A 4HQEA 3U1KA 2HDWA 2P5VA 2X6WA 2E35A 4XLFA 1BR2A 4YIIA 1X19A 3P9KA 1T8IA 1UMQA 1TL8A 3KP5A 2WB1A 4A3DJ 4LMYA 1JUMA 1OCRH 4RAFA 4PGGA 4GXOA 5EJCA 5DTDA 4Y7NJ 3GFJA 1V5FA 3ASOH 2NNNA 4M6YA 2XRNA 2DA7A 3BG3A 2M9HA 5LFAA 4BQOA 4MEXF 3D5RC 1LDJA 5F27A 5C3EJ 5F0FA 4IO9F 1BIBA 4N9HA 4DYQA 1Y0NA 4IEJA 2VE9A 1S9HA 2FEZA 3H35A 2W00A 3DEUA 3ZMDA 1MDMA 1LFUP 2KP6A 4BDZA 3H1CA 1OCCH 3JSPA 3FK7A 3QYBA 2KZVA 2A5WA 2Y0SA 1LPQA 3Q5FA 4WXCA 2VBWA 2EIMH 2R7SA 2RAEA 3GTGJ 1FOXA 1WWXA 2HVRA 5FLMJ 4AD9A 4BXXJ 4NUBA 3PFIA 2IW5A 5CKTA 1GVDA 1SD7A 4M3BA 1D3YA 2I10A 5DUIA 2DAOA 2V1NA 5J1UA 3TP0A 2KIUA 3CP2A 4YFKF 1AU7A 3ZXSA 4XSXF 2Z3YA 3DWLE 4IRHA 1FC3A 2F5VA 2KMUA 3ELKA 2CYYA 3QPHA 1LFPA 2Y9YA 4KNYA 1D8JA 1JXSA 2R5ZA 3LAPA 1ACIA 2EV5A 3HKZA 4C3HJ 4ZC3A 5HS7A 1FNNA 1VQPI 3HOZJ 3NEUA 3E5XA 3J7AY 3LAJA 1ZR4A 5IYDJ 4OIOF 3BP8A 1XTAA 4K2EA 4EJTA 1G6NA 1HC8A 1T39A 2QQ9A 3MVPA 5HS8A 1S72I 3LMMA 4HW0A 1I3QJ 3FXRA 1J75A 2CFOA 3H0GJ 3W2VA 4CZCA 2BY0A 1NK2P 4P96A 1SVMA 1P92A 2QLZA 5J4VA 3EYYA 2HI3A 2E36A 3CLQA 3WTWC 3HUGA 3CCEI 5E8GA 3HIFA 4BQQA 4G7ZF 5HDKA 3UNGC 2A68F 2RNJA 2KRFA 2KL4A 4UVBA 3FXKA 1VQ6I 3CD6I 2Y31A 3GWZA 1I50J 3MCZA 3V7CA 2R7UA 1A5JA 1RI7A 2FMLA 5ICGA 5K7FA 5E17F 1UHWA 2RKHA 4MTDA 1Z0XA 1V5EA 3F23A 3HYIA 3TKYA 2H8RA 2KDZA 1D1CA 2DFEA 2P4WA 2TDXA 1ETXA 1HKTA 2QVOA 5J8CA 4AIHA 2FOKA 2QF7A 1LVKA 1IW7F 1HQCA 3JAMZ 1YITI 4BL0B 5E3MA 2DA3A 2STTA 1WCMJ 4B8XA 3NAUA 2LBFB 3HOWJ 3LA7A 4A0YA 1XS9A 2LD5A 1T6SA 2Q0OA 3EUAA 2E5ZA 5F04A 4M6XA 4YFXF 2LBFA 3CCSI 2KIQA 2OJED 2VJIA 4KMFA 2CWEA 5LEKA 4PJLA 1ETOA 1D5VA 4EGZA 1WJAA 3CJRB 2WTEA 2NOGA 2DMQA 1R36A 4WWCA 1TQMA 2L7KA 1WH5A 3CO7C 1ZTRA 2JN6A 2GXGA 4QSHA 4UV9A 4L18B 1FYLA 3EYIA 2DDAA 4G9YA 3TW6A 4E7HA 2GAUA 3NRVA 1HCRA 1LEAA 2HVQA 3JTHA 3K4NA 1DGRM 2CO5A 3GVAA 1S8NA 3CESA 3M1CA 4B43A 1DPUA 1Q1VA 3CF2A 3ZP5A 2M3AA 3EUHA 3ABTA 4CH7A 1FMWA 1JHHA 2O9LA 1YS6A 4KIFA 1RIOH 2RQPA 2GXBA 3QP5A 3DCFA 2L9VA 3H5RA 3G1LA 1HSTA 3REOA 3RKYA 1WZ2A 3QP6A 1WFXA 4XOTA 2JA8J 3HSRA 4RS8A 4IL6C 5H6QA 1XC5A 2FMYA 1KYZA 3PUFA 2DW4A 4U7DA 1YQAA 2ESNA 4BEHB 1U5TB 3FZVA 1SD5A 4OIRF 3L9FA 2V1DA 1HA8A 4DQ2A 5JVGF 1BA5A 3OYMA 4EM1A 2XAHA 4ZYHA 1ETYA 4PSWA 1S3JA 3GFIA 2ZC2A 3G3ZA 2OF7A 4FT8A 4HEA2 2ZSIB 5GTHC 2M0CA 4B44A 1TZLA 2MA3A 4RGXA 2EH3A 4CCOA 1YG2A 3BTJA 3RPUD 4F92B 1R4MB 3GMEA 2CQKA 3HOTA 4E7ZA 1NK3P 1K6YA 4U88A 5HS9A 4HQMA 4E4HA 4RGUA 3JRIA 1EA3A 1MNDA 3I71A 1WSUA 2MH2A 2VT3A 1W5SA 3QOEA 4KMUX 2K3PA 2ZNYA 3LOCA 5FD5A 3S93A 4IRIA 2I5UA 1P9QC 2PFBA 5J40A 3IH3A 1F43A 4CO8A 3GLLA 4RAYA 3E6MA 1T33A 2K4BA 1XCBA 1T98A 3ASNH 2UXXA 4IQ4A 5CYVA 1T08B 4KDPA 3JR9A 2DT5A 2FNAA 4HRIA 3RKWA 3DKYA 2JA5J 1BI3A 1KZHA 3WU1B 3BQYA 4XRSG 1T2KA 3TDZC 1IXSB 5DEQA 2VIXA 3QQAA 4P1WA 3K1PA 4YRVA 1XGMA 2L5QA 3OSFA 4O6JA 4DW6A 1EH6A 2PN6A 3QAHA 1PP8F 1ZHFA 5FROA 1YO5C 3ESWB 3GZ5A 4UVCA 3TOBA 4A6EA 4EJOA 3J7ZI 3OYJA 2WAQN 2B7EA 5FKOA 2MD5A 3Q0UA 1J2XA 1R1TA 3FMQA 4U87A 3SEZA 3LSKA 2LFBA 1A6QA 2GA1A 1UHMA 2DJNA 3FM3A 4C2MJ 1RPWA 3JTGA 2VT2A 1WJFA 3BR1A 1WVRA 3H5AA 5FLVA 5L3CA 2Q2EB 4MLOA 1FBSA 1RESA 2XAJA 2XGXA 3EDPA 5CPRB 3J7YJ 3KYLA 2QWWA 3HTUA 2O8KA 1HLVA 5F08A 2IGMA 1YLFA 3RZDJ 3M3YJ 1XSXA 3FXLA 4XRSA 2V26A 2EK5A 1SEUA 2Z2SB 3CUQC 4MEYF 3VSKA 3BJOA 3QPSA 3HKZN 4NBQA 4BUPA 1ONVA 4MQ9F 1D8KA 3DU6A 3GUDA 2OCEA 1X1CA 4BJ5C 4YIRX 3SFIA 2ZBKA 5FKMA 1X2NA 1WH7A 1U0JA 2XF5A 2IGOA 4U0WA 1ENHA 3L2CA 4MHGA 3WGIA 2X85A 2ZNZA 2Z1DA 2LTPA 5IP7J 1LJ9A 4TV7A 2UXNA 3WTXC 2GQQA 1EV7A 2ECCA 1SFOJ 4ANJA 4D0PA 5EYRA 3UKGA 3MKLA 1B8IA 2LRDA 2VJ5A 2FF4A 4M3GA 3L2QA 1U78A 1MGTA 5H6RA 4A3EJ 2ZKZA 5TGTA 2R3SA 4DIQA 5DM6F 2J5OA 1O4XA 1QPIA 3F8NA 1WHUA 1FSEA 2KDOA 4L5JA 1SFEA 1QA6A 3MZ8A 5A2QZ 4BXUA 3CZ6A 4M9XA 3VYRB 4A3FJ 4B47A 1MBGA 2ID6A 3OWTA 4A2UA 5FFXA 2CW7A 3O8HA 2ZMEB 3I54A 4XRFA 1APLC 3QRFF 1J7KA 3MZYA 1HW2A 5FD6A 1WI3A 3B73A 2A61A 2CRGA 2K9MA 3CCJI 1O7FA 5ICFA 3E6DA 2AO9A 4E6KG 1PUFB 2F4OB 4IPAA 1Z1DA 3V8LA 2X0LA 3ABMH 1Z21A 4G6TB 3K0LA 3WTYC 2WV1A 2VXDA 3MZHA 2L3DA 3T1BA 3H3ZA 2ZXHA 2NVTJ 1JTXA 3DTEA 3OR2C 5A2QK 3GTJJ 1U5TC 1IRZA 2H94A 2IA0A 2M0MA 3B6CA 1RUNA 4HF2A 3DBHB 3EETA 3I4PA 1UFMA 3HL2A 2WWYA 5FLXK 3F22A
chains in the Genus database with same CATH topology
5F0CA 1IV6A 2JJ7A 4RBOA 3A03A 1AHDP 3FK6A 2NVQJ 3HGGA 2ECBA 2ID3A 5EZGA 3GTKJ 2XGCA 3Q0VA 1QVUA 3JRBA 2NS7A 5JLXA 1HDPA 2XSDC 5M3FJ 1JT0A 2GM4A 3JRAA 1TWGJ 3BR0A 1B8IB 1CQTA 2K40A 1EF4A 5EG0A 3S1QJ 1P7IA 1ORKA 4X1EA 5M5WJ 1HF0A 4FE7A 2DTZA 2DA2A 2HXIA 4G12A 5IYCJ 5FJ8J 5IP9J 3CCYA 2VKVA 3BTLA 2L0KA 1U8BA 1BW6A 5J1RA 2DMUA 5IP6A 5J3LA 2DA1A 2EZIA 3JRDA 4IHVA 2CUFA 2JMWA 1GV2A 2X48A 2Y2ZA 3CDLA 3Q3SA 1H89C 1IDYA 2TCTA 2R5YA 3BR6A 1RKWA 1T56A 1MSFC 3A01A 3HEFA 1QVTA 2FQ4A 1UMQA 2MW8A 4FCYA 1LFBA 4QTRA 3S17J 4A3DJ 1JUMA 2XB0X 5FKKA 5DTDA 1WPKA 4Y7NJ 1GT0C 1JKPC 2R0QC 2X9DA 4ABZA 2ZB9A 2DA7A 3BG3A 2M9HA 1ETQA 3JREA 3HOVJ 5F27A 4C3JJ 2JK3A 5F0FA 5C3EJ 3GBGA 4DYQA 4AC0A 4IEJA 4A93J 3FISA 1LFUP 2XGDA 4DYRA 3SJMA 4JX4A 3FK7A 4X6AJ 2ELKA 2M34A 4FISA 2XPWA 2D5VA 2RAEA 3GTGJ 2VUMJ 5FLMJ 2TRTA 2OPTA 1POGA 1TWHJ 3ZQHA 1PUFA 4BXXJ 1BW5A 3LSGA 2HOTA 5J1YA 1I6HJ 3OOUA 1GVDA 4M3BA 2I10A 5J1UA 3TP0A 3ZQGA 1MBKA 4UUSA 1AU7A 3GTOJ 3BTCA 4A3JJ 3A02A 1IC8A 2Y0SN 4JX5A 3HOXJ 1LE8A 2Y9YA 1FIAA 3CMYA 2R5ZA 2ME6A 3GTQJ 1X2MA 4A3LJ 4C3HJ 2HDDA 3GTLJ 4BBSJ 3BG9A 2R93J 3HOZJ 4BY7J 1VNDA 3RKQA 3ZQFA 3S2DJ 1Y1VJ 1ZR4A 5IYDJ 3S1MJ 2N8GA 2LP0A 3K2AA 3OSGA 1FIPA 1RKTA 2E1OA 4MIMA 5GP9A 1ZGWA 4MO7A 1U9OA 1ETVA 1ETKA 2CUEA 2LLKA 3MVPA 3HDDA 4B4CA 2EZLA 5IPAA 1VFCA 1ZR2A 2VKEA 1I3QJ 1JJ6C 3W6VA 3H0GJ 2IBDA 1ZK8A 4UUTA 1MBJA 1NK2P 2JA6J 3BG5A 1P7JA 1HOMA 3PM1A 1TWAJ 3LNQA 1GUUA 2HI3A 5EZHA 3WHCA 4XK4A 1FJLA 1ZQ3P 5M5YJ 4A3BJ 1H8AC 3I4MJ 2Y31A 1BJZA 1MBFA 3OIOA 1I50J 1MBHA 1FTTA 1A5JA 1OFCX 5K7FA 1JUPA 2K9NA 3BQZA 2JA7J 3S14J 1Z0XA 2LY9A 3QPLA 1D5YA 2K9SA 4QIWN 5IOYA 2H8RA 2KDZA 2DN0A 3RQIA 1TWCJ 1ETXA 1QRYA 2X6OA 4A3CJ 2QF7A 3TW7A 5EGOB 4A3IJ 4V2GA 5E3MA 2DA3A 1WCMJ 3BR3A 3NAUA 3HOWJ 3L1PA 1XS9A 2LD5A 1OJLA 2IAIA 1B72B 5C4XJ 4XRMA 5F04A 2Y30A 2M8GX 5C44J 1IDZA 2JWTA 3E7LA 2VPRA 3ZQIA 1JKQC 1B72A 1YRNA 5EG0B 2NVXJ 1AKHA 2R5YB 1ETOA 3BT9A 5BNGA 4IHYA 2NOGA 2DMQA 2XB5A 2PMZN 4A69C 4A3KJ 1OCPA 2HQ5A 4S0HB 1WH5A 3JRCA 1IJWC 1ZTRA 2JN6A 2E2JJ 3H3VK 4QSHA 1Y1WJ 3LSRA 3FIWA 3TW6A 1JKRC 1HCRA 2L7FP 2FD5A 3S1RJ 1SANA 1Q1VA 5IOZA 1GDTA 1W0UA 3FKIJ 2O9LA 2XGEA 1H88C 1IGNA 3BTIA 3JRGA 1G2HA 5K7HA 3IH4A 3DCFA 3IH2A 3G1LA 1JT6A 3G1MA 1IUFA 2HOAA 4JYKA 2JA8J 4DYCA 1XC5A 2CJJA 5E3NA 2FX0A 2DA6A 4I76A 4IHWA 1MNMC 2B63J 2AHQA 4CYCB 5EGOA 1BA5A 1ETYA 1NTCA 2KT0A 2K9QA 2LR8A 5E3OA 2L9RA 2M2EA 4M3FA 5DS9A 2OF7A 2QCOA 2GLOA 4BKXA 1U9NA 1JUSA 2W48A 3BR5A 2M0CA 5EF6A 1OCTC 2EH3A 5FKLA 3BTJA 3ZQCA 2ME0A 4B1RA 4MFEA 1HDDC 3G1OA 1NK3P 9ANTA 1YRNB 2HYJA 2VI6A 4C3IJ 1ZKGA 2E2HJ 3JRIA 5F0HA 2DA5A 3ZQLA 4V2FA 3DEWA 2DA4A 4BY1J 4D5FA 2R7ZJ 3JRHA 2R92J 1ETWA 3LOCA 1TWFJ 2EZKA 5C4JJ 3IH3A 1GV5A 2L7ZA 1F43A 2G0EA 3PO3J 1T33A 4EEFG 4IHXA 3LSPA 2R5ZB 1F36A 3JR9A 4W97A 3S15J 2HXOA 3D1NI 4XICA 3MN2A 2JA5J 3BQYA 4XRSG 2LKXA 3QQAA 1VF9A 1VI0A 4LOCA 3TEDA 3OSFA 4FE4A 4DW6A 1K83J 3HOYJ 3O8GA 5GPCA 3HOUJ 3TP3A 1E3OC 2H1KA 2WAQN 5FKOA 4HNVA 2DMTA 2XRLA 3Q0UA 2EQRA 2NS8A 5IYBJ 2LFBA 2MGQA 4C2MJ 2DJNA 1Z77A 4D7NA 1RPWA 4BBRJ 1JJ8C 4M3EA 1WGXA 2XPVA 1MH4A 3BR1A 1RETA 2GBYA 2DMPA 4M3DA 2COBA 2YUSA 5FLVA 2E19A 4MLOA 4W1UA 2MSYA 3F0CA 2YU9J 3S16J 3ZOBA 5FKNA 1RESA 1TC3C 3SDGA 2HOSA 2O8KA 1HLVA 5F08A 3RZDJ 3M3YJ 1FTZA 4XRSA 1JTYA 3K7AJ 2L7MP 4L5EA 4AUXA 3S1NJ 3QPSA 1DU0A 3HKZN 4JX6A 2FJ1A 1BL0A 3SFIA 5FKMA 5GPAA 2O7OA 4DZPA 4XIDA 2MG4A 1LE8B 1X2NA 1WH7A 4RDUA 3GTMJ 4D5CA 1ENHA 4I6ZA 3HGYA 2LTPA 2LVSA 5IP7J 2IEKA 4A3GJ 2CQXA 1DU6A 1XG1A 2EBIA 4UUSB 5F1JA 5M5XJ 2ECCA 1SFOJ 4D7MA 5EYRA 2WB1N 3UKGA 1K61A 3B6AA 3MKLA 1B8IA 1UG2A 1JGGA 3HB9A 5M3MJ 1MH3A 1U78A 4M3GA 5EDNA 3BR2A 4A3EJ 4JP0A 1O4XA 5EEAA 2E2IJ 1QPIA 3A01B 1AKHB 2EZHA 2CU7A 2YS9A 5E3LA 1UHSA 2NVYJ 3WHBA 4B3AA 3Q0WA 3C2BA 3HM5A 4Y52J 1ITYA 3CQZJ 4A3FJ 5K7ZA 1X58A 1MBGA 2ID6A 4A3MJ 3S2HJ 1IG7A 3O8HA 4FTHA 2DMNA 1APLC 1A6IA 4GFBA 4CYCA 2XPUA 4AYBN 5HODA 1WI3A 1FEXA 2CRGA 4DZJA 1MBEA 5JLWA 2AO9A 2P81A 1PUFB 1JKOC 3I4NJ 4M6VA 2WV1A 3HBLA 4MFDA 1MSEC 2LK2A 1R9TJ 3RZOJ 3GTPJ 2NVTJ 1JTXA 1RR7A 1S7EA 3LSJA 3GTJJ 4NDLA 1IRZA 3NARA 1W0TA 3JRFA 3IV5A 3B6CA 4J19A 3PO2J 2CQQA 2Y9ZA 3M4OJ 3VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0C A;  1IV6 A;  2JJ7 A;  4RBO A;  3A03 A;  1AHD P;  3FK6 A;  2NVQ J;  3HGG A;  2ECB A;  2ID3 A;  5EZG A;  3GTK J;  2XGC A;  3Q0V A;  1QVU A;  3JRB A;  2NS7 A;  5JLX A;  1HDP A;  2XSD C;  5M3F J;  1JT0 A;  2GM4 A;  3JRA A;  1TWG J;  3BR0 A;  1B8I B;  1CQT A;  2K40 A;  1EF4 A;  5EG0 A;  3S1Q J;  1P7I A;  1ORK A;  4X1E A;  5M5W J;  1HF0 A;  4FE7 A;  2DTZ A;  2DA2 A;  2HXI A;  4G12 A;  5IYC J;  5FJ8 J;  5IP9 J;  3CCY A;  2VKV A;  3BTL A;  2L0K A;  1U8B A;  1BW6 A;  5J1R A;  2DMU A;  5IP6 A;  5J3L A;  2DA1 A;  2EZI A;  3JRD A;  4IHV A;  2CUF A;  2JMW A;  1GV2 A;  2X48 A;  2Y2Z A;  3CDL A;  3Q3S A;  1H89 C;  1IDY A;  2TCT A;  2R5Y A;  3BR6 A;  1RKW A;  1T56 A;  1MSF C;  3A01 A;  3HEF A;  1QVT A;  2FQ4 A;  1UMQ A;  2MW8 A;  4FCY A;  1LFB A;  4QTR A;  3S17 J;  4A3D J;  1JUM A;  2XB0 X;  5FKK A;  5DTD A;  1WPK A;  4Y7N J;  1GT0 C;  1JKP C;  2R0Q C;  2X9D A;  4ABZ A;  2ZB9 A;  2DA7 A;  3BG3 A;  2M9H A;  1ETQ A;  3JRE A;  3HOV J;  5F27 A;  4C3J J;  2JK3 A;  5F0F A;  5C3E J;  3GBG A;  4DYQ A;  4AC0 A;  4IEJ A;  4A93 J;  3FIS A;  1LFU P;  2XGD A;  4DYR A;  3SJM A;  4JX4 A;  3FK7 A;  4X6A J;  2ELK A;  2M34 A;  4FIS A;  2XPW A;  2D5V A;  2RAE A;  3GTG J;  2VUM J;  5FLM J;  2TRT A;  2OPT A;  1POG A;  1TWH J;  3ZQH A;  1PUF A;  4BXX J;  1BW5 A;  3LSG A;  2HOT A;  5J1Y A;  1I6H J;  3OOU A;  1GVD A;  4M3B A;  2I10 A;  5J1U A;  3TP0 A;  3ZQG A;  1MBK A;  4UUS A;  1AU7 A;  3GTO J;  3BTC A;  4A3J J;  3A02 A;  1IC8 A;  2Y0S N;  4JX5 A;  3HOX J;  1LE8 A;  2Y9Y A;  1FIA A;  3CMY A;  2R5Z A;  2ME6 A;  3GTQ J;  1X2M A;  4A3L J;  4C3H J;  2HDD A;  3GTL J;  4BBS J;  3BG9 A;  2R93 J;  3HOZ J;  4BY7 J;  1VND A;  3RKQ A;  3ZQF A;  3S2D J;  1Y1V J;  1ZR4 A;  5IYD J;  3S1M J;  2N8G A;  2LP0 A;  3K2A A;  3OSG A;  1FIP A;  1RKT A;  2E1O A;  4MIM A;  5GP9 A;  1ZGW A;  4MO7 A;  1U9O A;  1ETV A;  1ETK A;  2CUE A;  2LLK A;  3MVP A;  3HDD A;  4B4C A;  2EZL A;  5IPA A;  1VFC A;  1ZR2 A;  2VKE A;  1I3Q J;  1JJ6 C;  3W6V A;  3H0G J;  2IBD A;  1ZK8 A;  4UUT A;  1MBJ A;  1NK2 P;  2JA6 J;  3BG5 A;  1P7J A;  1HOM A;  3PM1 A;  1TWA J;  3LNQ A;  1GUU A;  2HI3 A;  5EZH A;  3WHC A;  4XK4 A;  1FJL A;  1ZQ3 P;  5M5Y J;  4A3B J;  1H8A C;  3I4M J;  2Y31 A;  1BJZ A;  1MBF A;  3OIO A;  1I50 J;  1MBH A;  1FTT A;  1A5J A;  1OFC X;  5K7F A;  1JUP A;  2K9N A;  3BQZ A;  2JA7 J;  3S14 J;  1Z0X A;  2LY9 A;  3QPL A;  1D5Y A;  2K9S A;  4QIW N;  5IOY A;  2H8R A;  2KDZ A;  2DN0 A;  3RQI A;  1TWC J;  1ETX A;  1QRY A;  2X6O A;  4A3C J;  2QF7 A;  3TW7 A;  5EGO B;  4A3I J;  4V2G A;  5E3M A;  2DA3 A;  1WCM J;  3BR3 A;  3NAU A;  3HOW J;  3L1P A;  1XS9 A;  2LD5 A;  1OJL A;  2IAI A;  1B72 B;  5C4X J;  4XRM A;  5F04 A;  2Y30 A;  2M8G X;  5C44 J;  1IDZ A;  2JWT A;  3E7L A;  2VPR A;  3ZQI A;  1JKQ C;  1B72 A;  1YRN A;  5EG0 B;  2NVX J;  1AKH A;  2R5Y B;  1ETO A;  3BT9 A;  5BNG A;  4IHY A;  2NOG A;  2DMQ A;  2XB5 A;  2PMZ N;  4A69 C;  4A3K J;  1OCP A;  2HQ5 A;  4S0H B;  1WH5 A;  3JRC A;  1IJW C;  1ZTR A;  2JN6 A;  2E2J J;  3H3V K;  4QSH A;  1Y1W J;  3LSR A;  3FIW A;  3TW6 A;  1JKR C;  1HCR A;  2L7F P;  2FD5 A;  3S1R J;  1SAN A;  1Q1V A;  5IOZ A;  1GDT A;  1W0U A;  3FKI J;  2O9L A;  2XGE A;  1H88 C;  1IGN A;  3BTI A;  3JRG A;  1G2H A;  5K7H A;  3IH4 A;  3DCF A;  3IH2 A;  3G1L A;  1JT6 A;  3G1M A;  1IUF A;  2HOA A;  4JYK A;  2JA8 J;  4DYC A;  1XC5 A;  2CJJ A;  5E3N A;  2FX0 A;  2DA6 A;  4I76 A;  4IHW A;  1MNM C;  2B63 J;  2AHQ A;  4CYC B;  5EGO A;  1BA5 A;  1ETY A;  1NTC A;  2KT0 A;  2K9Q A;  2LR8 A;  5E3O A;  2L9R A;  2M2E A;  4M3F A;  5DS9 A;  2OF7 A;  2QCO A;  2GLO A;  4BKX A;  1U9N A;  1JUS A;  2W48 A;  3BR5 A;  2M0C A;  5EF6 A;  1OCT C;  2EH3 A;  5FKL A;  3BTJ A;  3ZQC A;  2ME0 A;  4B1R A;  4MFE A;  1HDD C;  3G1O A;  1NK3 P;  9ANT A;  1YRN B;  2HYJ A;  2VI6 A;  4C3I J;  1ZKG A;  2E2H J;  3JRI A;  5F0H A;  2DA5 A;  3ZQL A;  4V2F A;  3DEW A;  2DA4 A;  4BY1 J;  4D5F A;  2R7Z J;  3JRH A;  2R92 J;  1ETW A;  3LOC A;  1TWF J;  2EZK A;  5C4J J;  3IH3 A;  1GV5 A;  2L7Z A;  1F43 A;  2G0E A;  3PO3 J;  1T33 A;  4EEF G;  4IHX A;  3LSP A;  2R5Z B;  1F36 A;  3JR9 A;  4W97 A;  3S15 J;  2HXO A;  3D1N I;  4XIC A;  3MN2 A;  2JA5 J;  3BQY A;  4XRS G;  2LKX A;  3QQA A;  1VF9 A;  1VI0 A;  4LOC A;  3TED A;  3OSF A;  4FE4 A;  4DW6 A;  1K83 J;  3HOY J;  3O8G A;  5GPC A;  3HOU J;  3TP3 A;  1E3O C;  2H1K A;  2WAQ N;  5FKO A;  4HNV A;  2DMT A;  2XRL A;  3Q0U A;  2EQR A;  2NS8 A;  5IYB J;  2LFB A;  2MGQ A;  4C2M J;  2DJN A;  1Z77 A;  4D7N A;  1RPW A;  4BBR J;  1JJ8 C;  4M3E A;  1WGX A;  2XPV A;  1MH4 A;  3BR1 A;  1RET A;  2GBY A;  2DMP A;  4M3D A;  2COB A;  2YUS A;  5FLV A;  2E19 A;  4MLO A;  4W1U A;  2MSY A;  3F0C A;  2YU9 J;  3S16 J;  3ZOB A;  5FKN A;  1RES A;  1TC3 C;  3SDG A;  2HOS A;  2O8K A;  1HLV A;  5F08 A;  3RZD J;  3M3Y J;  1FTZ A;  4XRS A;  1JTY A;  3K7A J;  2L7M P;  4L5E A;  4AUX A;  3S1N J;  3QPS A;  1DU0 A;  3HKZ N;  4JX6 A;  2FJ1 A;  1BL0 A;  3SFI A;  5FKM A;  5GPA A;  2O7O A;  4DZP A;  4XID A;  2MG4 A;  1LE8 B;  1X2N A;  1WH7 A;  4RDU A;  3GTM J;  4D5C A;  1ENH A;  4I6Z A;  3HGY A;  2LTP A;  2LVS A;  5IP7 J;  2IEK A;  4A3G J;  2CQX A;  1DU6 A;  1XG1 A;  2EBI A;  4UUS B;  5F1J A;  5M5X J;  2ECC A;  1SFO J;  4D7M A;  5EYR A;  2WB1 N;  3UKG A;  1K61 A;  3B6A A;  3MKL A;  1B8I A;  1UG2 A;  1JGG A;  3HB9 A;  5M3M J;  1MH3 A;  1U78 A;  4M3G A;  5EDN A;  3BR2 A;  4A3E J;  4JP0 A;  1O4X A;  5EEA A;  2E2I J;  1QPI A;  3A01 B;  1AKH B;  2EZH A;  2CU7 A;  2YS9 A;  5E3L A;  1UHS A;  2NVY J;  3WHB A;  4B3A A;  3Q0W A;  3C2B A;  3HM5 A;  4Y52 J;  1ITY A;  3CQZ J;  4A3F J;  5K7Z A;  1X58 A;  1MBG A;  2ID6 A;  4A3M J;  3S2H J;  1IG7 A;  3O8H A;  4FTH A;  2DMN A;  1APL C;  1A6I A;  4GFB A;  4CYC A;  2XPU A;  4AYB N;  5HOD A;  1WI3 A;  1FEX A;  2CRG A;  4DZJ A;  1MBE A;  5JLW A;  2AO9 A;  2P81 A;  1PUF B;  1JKO C;  3I4N J;  4M6V A;  2WV1 A;  3HBL A;  4MFD A;  1MSE C;  2LK2 A;  1R9T J;  3RZO J;  3GTP J;  2NVT J;  1JTX A;  1RR7 A;  1S7E A;  3LSJ A;  3GTJ J;  4NDL A;  1IRZ A;  3NAR A;  1W0T A;  3JRF A;  3IV5 A;  3B6C A;  4J19 A;  3PO2 J;  2CQQ A;  2Y9Z A;  3M4O J;  3VPR A; 
#chains in the Genus database with same CATH topology
 1WI9 A;  2UUZ A;  1R23 A;  2JJ7 A;  5AIP A;  3RI4 A;  2W24 A;  5F64 A;  2NVQ J;  1AHD P;  3FX3 A;  1R5I D;  1HKQ A;  4Q47 A;  5EZG A;  3Q0V A;  3WE3 A;  1KQ9 A;  1YHQ I;  1JT0 A;  2GIZ A;  3RIR A;  1TWG J;  1EF4 A;  2W1O A;  2HOE A;  5EG0 A;  3S1Q J;  1P7I A;  3I0T A;  2CG4 A;  2V6E A;  5DD8 A;  2CUJ A;  4FE7 A;  2RNG A;  1ZRF A;  4D1Q A;  2QEX I;  3PSF A;  2HXI A;  5K1Y A;  4IZZ A;  1XGN A;  2GA2 A;  2D45 A;  5IP9 J;  3CCY A;  4DNC A;  2VKV A;  1MZB A;  3BTL A;  2Z9O A;  1YYV A;  2L0K A;  4LLG F;  1BW6 A;  2R7O A;  4IHV A;  4AU7 A;  2XDV A;  4EJV A;  1UZC A;  3H9G A;  4G7H F;  4DBR A;  2JVG A;  1S7A A;  3K70 D;  1RKW A;  1MSF C;  1O7L A;  3A01 A;  4NB5 A;  2Y48 A;  3VDX A;  1QVT A;  2VLA A;  3N05 A;  4ZTF A;  3S32 A;  1TT5 B;  3LWF A;  2MW8 A;  2MLG A;  1CF7 B;  2LRE A;  5FKK A;  1GT0 C;  1JKP C;  4LB5 A;  2XSJ C;  4OIN F;  3R61 A;  2ZJP F;  1YW8 A;  1BR4 A;  3P7N A;  2FBI A;  2CW0 F;  2BHZ A;  3JRE A;  2VN2 A;  3DU5 A;  2BHY A;  5L3F A;  2M1B A;  3K4J A;  1LEB A;  1O57 A;  1JI8 A;  3F6V A;  1X3U A;  2NAZ A;  3RKX A;  3M8E A;  4DYR A;  1C0W A;  3ZRG A;  5L3D A;  1G3W A;  1Y6I A;  4IHT A;  2FU4 A;  1ZG3 A;  3UR3 C;  3ERM A;  1LDD A;  2M34 A;  4FIS A;  2XPW A;  2XAQ A;  2VUM J;  1JE8 A;  2GXA A;  4GYG A;  3BWG A;  3ZQH A;  1POG A;  2KFD A;  1SD4 A;  1BW5 A;  3VWB A;  4HSR A;  2HOT A;  5J1Y A;  4XMY A;  4HDU A;  2JQ7 A;  1MMG A;  2EWN A;  1JGS A;  1N78 A;  3BJ6 A;  3LSM A;  1RUO A;  2FSW A;  2QSG X;  3LSH A;  5JI6 A;  3GTO J;  4DBQ A;  5HLT A;  2WY7 Q;  3A02 A;  4EM0 B;  2Y0S N;  3S2W A;  3BRO A;  2CV1 A;  3F9K A;  2PLY A;  1FIA A;  4LLN A;  4ENJ A;  3CCL I;  3FBI B;  1E3H A;  1V55 H;  4HNT A;  3GTL J;  2ZO4 A;  4L9J A;  2M7B A;  3IUO A;  2EIN H;  3MAJ A;  2XRO A;  1BR1 A;  3HC7 A;  3H3U A;  4LFU A;  2AS5 F;  4KIB A;  2IA2 A;  2E1O A;  2I8D A;  4CYD A;  4BAY A;  4MO7 A;  1ETV A;  1U9O A;  4A5M A;  2VKH A;  2VL8 A;  2LLK A;  3P5J A;  5D4S A;  3H92 A;  1VFC A;  1MD0 A;  2VKE A;  2VC1 A;  2R7V A;  2H1L A;  4CCL A;  2IA1 A;  2L01 A;  1XMX A;  2HTJ A;  1MBJ A;  4KT6 A;  1FZP B;  3BG5 A;  1G8X A;  3ZMU A;  3PM1 A;  3LNQ A;  5IT9 Z;  2XAF A;  2KRC A;  4XK4 A;  5IT9 K;  1BBY A;  1IRG A;  1SMY F;  3GLX A;  5IT3 A;  2ZSH B;  4A3B J;  1H8A C;  3I4M J;  3VB2 A;  1ZLJ A;  2XF6 A;  1OYY A;  4LJZ F;  3TO6 A;  2MH9 A;  3ZGK A;  1BJZ A;  1J5Y A;  3OIO A;  3OYA A;  1MBH A;  4ZJZ A;  5L3B A;  2ZFW A;  3OMY A;  4ZYG A;  2IGN A;  2IS2 A;  1JUP A;  2O6G E;  5CVR A;  1TTY A;  2K9N A;  3OL3 A;  4F7Z A;  3KEY A;  3L2R A;  3DTK A;  5CQE A;  3CTA A;  4OWR B;  3R4K A;  3QPL A;  3LA2 A;  1D5Y A;  3BG7 A;  3TGN A;  4ZYD A;  1XDU A;  4LG3 A;  1OCZ H;  2R7Q A;  4XLE A;  3MMY B;  4A3C J;  3VEP A;  5EGO B;  2XVC A;  1W5T A;  2ISY A;  4EM2 A;  4M72 A;  1X1A A;  2B0L A;  3TQN A;  4F55 A;  3MFK A;  4IKF A;  1OJL A;  2DBB A;  2OBP A;  3LSI A;  1UAA A;  1J09 A;  1B72 B;  2V4J C;  3OYD A;  2M8G X;  2JWT A;  2VPR A;  2WAE A;  3KEQ A;  3K69 A;  3IP4 B;  3OR1 C;  1B72 A;  1YRN A;  3ZMT A;  1WRJ A;  2R5Y B;  4XR6 A;  4QLC U;  4C2U A;  4IHY A;  5J8F A;  4S0H B;  3H3V K;  3R60 A;  2WV0 A;  2DLL A;  4ZDP A;  3RCO A;  3SZG A;  1S29 A;  4HPQ A;  4BHB A;  2MFZ A;  2JRM A;  3JAM K;  3I56 I;  1JKR C;  1QU3 A;  2L4A A;  2CQN A;  1Z9C A;  2L7F P;  4JBA A;  2FD5 A;  1GVJ A;  4WK8 F;  4H4K C;  4CCJ A;  3AAF A;  1FY7 A;  3ECO A;  4I02 A;  2ZXJ A;  1P4X A;  1SC7 A;  2O61 A;  2DYR H;  2W84 A;  4ZDL A;  1H88 C;  1G4D A;  3ULQ B;  1IGN A;  4KUM A;  3T5X A;  3BTI A;  3LL7 A;  2HZD A;  1SFX A;  3PL8 A;  1VQO I;  2K5C A;  3IH2 A;  3Q9V A;  4KIS A;  1JT6 A;  1SFU A;  4OIQ F;  5KCM A;  1ZGA A;  2HOA A;  3ZR8 X;  5BOX A;  2QKL B;  5CVJ A;  3BZ6 A;  4PSX A;  2CJJ A;  1T0F A;  3HPG A;  4D9J A;  2DYS H;  3ZPL A;  2W4S A;  1IXC A;  2B63 J;  4XLP F;  4ZTJ A;  4XKB A;  2YR2 A;  3K10 A;  3V42 A;  5ICE A;  2B9S A;  3DPU A;  3FF5 A;  2K9Q A;  2OZ6 A;  2BBY A;  1HXD A;  2V6C A;  5B1A H;  2F5D A;  4KA4 A;  2HQN A;  2GLO A;  2QCO A;  3BPV A;  4S05 A;  2G9W A;  5DM7 F;  1RR8 C;  3S8P A;  2OQG A;  1OCT C;  3F8M A;  3X2Q H;  1OYI A;  3C3W A;  1USS A;  2QM3 A;  4II2 A;  2MD0 A;  4ESJ A;  3FKJ A;  4MNU A;  4EVI A;  3G1O A;  4PJJ A;  2ELH A;  5FLX Z;  3ZMS A;  2VI6 A;  2RQQ A;  1ZKG A;  1MNE A;  5F0H A;  2DA5 A;  4PK4 A;  4V2F A;  4A12 A;  4I7H A;  4XNF A;  3VSL A;  2DA4 A;  2R7Z J;  4G8X A;  1W7P D;  4U7B A;  2P8T A;  2EZK A;  2LKP A;  3OIQ A;  5KAI C;  2DU9 A;  3IHU A;  1DUX C;  4Z6Y A;  1R1V A;  2G0E A;  2DJI A;  4AIK A;  4IQJ A;  1KA8 A;  3PO3 J;  3AG2 H;  3CC7 I;  3V4G A;  3DPL C;  4GCV A;  4W97 A;  3S15 J;  3HSF A;  1FPQ A;  4XIC A;  1LKX A;  3MN2 A;  1BJA A;  1U8R A;  2QQB A;  3BLY A;  4LOC A;  2H09 A;  2PEX A;  1VQN I;  5B66 C;  4RM3 A;  3TED A;  2HWV A;  1LDK B;  2A69 F;  3K6G A;  4FE4 A;  4JK1 X;  3JW4 A;  3ZN0 A;  4PJM A;  3HOY J;  3HOU J;  4NC6 A;  4HAM A;  3KLN A;  4XBF A;  1QBJ A;  2H1K A;  1Z7U A;  1ULY A;  3EUK L;  2DTR A;  1PJR A;  3KZZ A;  4EQQ A;  1D0Z A;  1IO2 A;  1FMV A;  4BEH A;  2XRL A;  2EQR A;  3SZT A;  4F91 B;  4XON A;  3L2V A;  3QPT A;  3WG9 A;  2J5P A;  4CCN A;  1IN6 A;  4HLX A;  4UVA A;  1IV8 A;  4P55 A;  2XPV A;  2EFO A;  1BOA A;  1RET A;  4N4O B;  4M3D A;  3T8T A;  1ODD A;  1DP7 P;  1XB4 A;  3TO7 A;  2HTS A;  4W1U A;  1YX3 A;  2DCE A;  1I6X A;  1H9G A;  3F0C A;  3ZOB A;  1WJE A;  3FXM A;  3K4K A;  2BE5 F;  2BW3 A;  2O0Y A;  4F3Q A;  1TC3 C;  3CUQ B;  2AQF A;  3GEZ A;  1YJ9 I;  1MJA A;  5E1Z B;  2L54 A;  3CJQ B;  2HPI A;  2WC2 A;  4L5E A;  2L7M P;  3AG1 H;  4AUX A;  2EV6 A;  4WCG A;  1V4R A;  2KHM A;  4I0A A;  3WG7 H;  1SAX A;  1U5T A;  1TW2 A;  2FJ1 A;  4IOA F;  3BCA A;  4FX4 A;  5GPA A;  5GAD J;  5H20 A;  3RSN A;  3GXO A;  4RDU A;  2HQA A;  3RYP A;  2AXL A;  1TLH B;  3D0S A;  2PJR A;  1WKM A;  2DOE A;  5L3E A;  3ABL H;  1BC8 C;  2LVS A;  4CA0 A;  2IEK A;  4A3G J;  1T95 A;  5LRS A;  2HGC A;  1DU6 A;  5F1J A;  2PJR B;  2M5W A;  4D7M A;  2WB1 N;  4HX4 A;  3KP6 A;  3EPZ A;  1UG2 A;  2OU2 A;  2X4H A;  3HB9 A;  3KYC B;  3O6B B;  2V9K A;  1K78 B;  2XUB A;  1Z3X A;  3CLO A;  4XOP A;  4HX8 A;  4MQV A;  1KGS A;  5EEA A;  3CDI A;  2E2I J;  3WHB A;  1FYK A;  1TNT A;  1WJC A;  3HHH A;  2V1X A;  4ZYE A;  2HS5 A;  2Z99 A;  2X6X A;  3V7R A;  3ERE D;  4F52 A;  3CQZ J;  3C1D A;  2DT6 A;  1R22 A;  4J00 A;  1A31 A;  1X58 A;  1IRF A;  4S04 A;  5BMZ A;  4XL9 A;  1H9T A;  2X51 A;  5TJJ A;  1U2W A;  2XPU A;  5LBQ A;  4CYC A;  4AYB N;  4IHS A;  1FEX A;  1OYW A;  3F3X A;  4DZJ A;  1MBE A;  2VQG A;  1D1B A;  2R7X A;  2E1N A;  4RGR A;  3I4N J;  2QQA A;  2KIS A;  2KJC A;  1W4M A;  1N75 A;  4U0V A;  5CVU A;  3CJT B;  2M4K A;  2RDP A;  2LK2 A;  3E0J B;  5AIQ A;  1Y8R B;  1RR7 A;  5DUK A;  1S7E A;  2EV0 A;  3LSJ A;  3TDU C;  4E7L A;  4NDL A;  2IXS A;  5DCM A;  4RGS A;  1W0T A;  3IV5 A;  3OYF A;  3TBI A;  3NWT A;  4IJA A;  2Z16 A;  2Y9Z A;  3OS1 A;  3I53 A;  3RYR A;  1X1B A;  4RB2 C;  3VPR A;  4RB0 A;  4G6Q A;  5F0C A;  2Q1Z B;  1IN4 A;  3ECH A;  2F6C A;  1VQ9 I;  2EPF A;  3GTK J;  2P5L C;  1X3W B;  1FOW A;  2NS7 A;  1ZH5 A;  3FHN A;  1HDP A;  3JSO A;  2XSD C;  2GM4 A;  4CZZ A;  5JHF A;  3OYE A;  1CQT A;  1B8I B;  1ON1 A;  1XSD A;  5KHD A;  3WU2 C;  1GHC A;  5CJ9 A;  2ADU A;  3QU3 A;  1HW5 A;  1WJB A;  1KU2 A;  5IYC J;  1E0E A;  5GTI C;  2ZXW H;  5E20 A;  5CQG A;  1T0F C;  1LQ1 A;  1XN7 A;  2MC3 A;  1U8B A;  2CUZ A;  5J1R A;  2HU9 A;  2DMU A;  1FP1 D;  5J3L A;  3JRD A;  2EZI A;  3KEO A;  2Y2Z A;  5FO5 A;  3OYG A;  4B09 A;  1KQ8 A;  1IDY A;  2TCT A;  2R5Y A;  2VBX A;  5TRD A;  2KRH A;  1LVA A;  5JVT A;  1SFK A;  1T38 A;  3QOD A;  1K4T A;  1BIA A;  4ZDO A;  3IL2 A;  4BE1 A;  3SXY A;  4UHT A;  4FCY A;  1LFB A;  4QTR A;  3S17 J;  5FRN A;  1W5C C;  3HPH A;  4R1H A;  2XB0 X;  1W36 D;  1WPK A;  3M8J A;  2HYG D;  1MJ9 A;  2PMH A;  5HLH A;  4ZH4 F;  3SQN A;  2R0Q C;  1GXP A;  2ZB9 A;  4EAT A;  1HBX G;  2DK8 A;  1ETQ A;  4E7S A;  5DYM A;  2JK3 A;  2WAD A;  5BPI A;  1YIJ I;  5IY5 H;  1YX5 A;  1A35 A;  4XKC A;  1IF1 A;  4GDF A;  2NYX A;  4Y3O A;  4BHP A;  2XGD A;  4L5I A;  4NC7 A;  4BXF A;  1SMT A;  2M8E A;  4JX4 A;  3G6E I;  2E5N A;  4X6A J;  2ELK A;  1WJD A;  1YE9 A;  2QYO A;  5F1R A;  3V7S A;  1O3S A;  2A05 A;  3J80 Z;  2TRT A;  2GOM A;  3S3O A;  2P5K A;  2ZME C;  1PUF A;  4BJ6 C;  4V19 K;  3LSG A;  1I6H J;  1A04 A;  2UZK A;  2DFF A;  2M45 A;  5KK1 A;  4FQG A;  3WU0 A;  3D5S C;  1MBK A;  1ZYR F;  4UUS A;  4XQF A;  4LIT A;  4LD5 A;  3BTC A;  3CMM A;  4A3J J;  2X6Y A;  1XDS A;  4ENM A;  3LQQ A;  3GFM A;  4XOR A;  3TOA A;  1R7J A;  4HNU A;  3L2U A;  3OYN A;  1Y8Q B;  3DXJ F;  2ME6 A;  3AG4 H;  1X2M A;  3CC2 I;  4A3L J;  1TBX A;  2HDD A;  2LOO A;  3V8J A;  4OIP F;  2R93 J;  2G7U A;  2DQL A;  3CUO A;  4BY7 J;  1VND A;  3F8B A;  2BZT A;  3CP8 A;  5KAF C;  1W36 C;  3RKQ A;  3DV8 A;  1FOY A;  2LC2 A;  3S1M J;  2M87 A;  3HG9 A;  3WTT C;  1FIP A;  2OTL I;  3OYL A;  3SZP A;  4E7J A;  3M07 A;  2EIJ H;  4B3X A;  1ETK A;  4HG2 A;  2P7C B;  1ZEL A;  4B4C A;  3HDD A;  5K5R A;  4L0Z B;  5IPA A;  3OYC A;  4EV0 A;  1ZR2 A;  2VOP A;  2FOW A;  5D5U B;  3FMR A;  4HV5 A;  1JJ6 C;  2BY2 A;  3WE2 A;  2IBD A;  2RC4 A;  4C9Y A;  5J6X A;  4UUT A;  1HOM A;  4O5V A;  1P7J A;  4RLQ A;  2LNB A;  1TWA J;  4CDG A;  3RQ4 A;  1GUU A;  5EZH A;  2K02 A;  5B5E C;  2VQC A;  3WGG A;  4RM2 A;  4G6D A;  2E34 A;  1ZQ3 P;  1R4N B;  2R7T A;  1P6R A;  4Y33 A;  5JFR A;  2A6E F;  4PGH A;  3PQJ A;  2OV7 A;  1MBF A;  1H0M A;  1STZ A;  3M1E A;  2A6H F;  3GX4 X;  3WTZ A;  3HZJ A;  1MMS A;  2DT7 B;  5DCF A;  2XC7 A;  4LIU A;  4HYE A;  4I2O A;  2KJB A;  3BQZ A;  1O3Q A;  2JA7 J;  4NQW B;  1CF7 A;  1FLI A;  4HA8 A;  2IP2 A;  1QQI A;  1UST A;  5D8L B;  2BW3 B;  5LGT A;  5TIS C;  2K9S A;  4QIW N;  2FQ3 A;  1XMK A;  2DN0 A;  1F9N A;  3KP7 A;  1I3A A;  3RQI A;  5D8K B;  4CSW A;  1UEL B;  1RRJ A;  1BOB A;  1I5Z A;  4A3I J;  5HNF A;  3BZC A;  3LST A;  3R0A A;  4QPO A;  4Q5S F;  2P6S A;  1O3T A;  2QUF A;  1M1E B;  3KE2 A;  5EEH A;  4WF2 A;  1CGP A;  2QEN A;  2QQ8 A;  1FBQ A;  4BAC A;  5HOO A;  4E7K A;  1ERD A;  2JUG A;  2IAI A;  5C4X J;  2KQR A;  4XRM A;  5C44 J;  2Y30 A;  5B1B H;  1IDZ A;  3E7L A;  1K6O A;  4XLA A;  3KYD B;  2VON A;  1JKQ C;  5LGU A;  2NVX J;  3GZ6 A;  5BS6 A;  2COM A;  2LDU A;  4A0X A;  1YJW I;  2PMZ N;  4A69 C;  4HZF A;  1K78 A;  1OCP A;  2HQ5 A;  5JHU A;  1IJW C;  4HF0 A;  2A07 F;  4LG0 B;  5E79 C;  3E97 A;  3VOD A;  2WAQ A;  3LSR A;  3CJN A;  4HF1 A;  2OTJ I;  3FIW A;  1W7P B;  3I59 A;  3CCV I;  4LG0 A;  3TL4 X;  2E60 A;  1RNL A;  1SAN A;  4PFO A;  3KP3 A;  3L2W A;  5IOZ A;  2HYF A;  4AVP A;  5HVQ C;  2HPM A;  1KQ0 A;  3OYK A;  2PMZ A;  1RZ4 A;  2XGE A;  2DFI A;  2XIG A;  3IWF A;  3JRG A;  1NG6 A;  3B02 A;  3IAS 2;  2FE3 A;  3O2P E;  4H0E A;  1OIS A;  3G1M A;  4JYK A;  3IAM 2;  2VJ4 A;  3BOQ A;  4DYC A;  3A0H C;  2ACJ A;  5D6E A;  5LHI A;  1Y39 A;  2X1E A;  1FSH A;  4N0B A;  5DCM B;  1VQ8 I;  3RJP A;  4WXD A;  4KIG A;  2FX0 A;  3OYH A;  5ILS A;  2Q2E A;  2DA6 A;  2RV8 A;  4OOI A;  2EA4 A;  2AHQ A;  2HDC A;  2W82 A;  4CYC B;  1DQU A;  4CHU A;  5EGO A;  2F5F A;  1B4A A;  2LR8 A;  1G3T A;  2F5E A;  4BE0 A;  4Q48 A;  5DS9 A;  4BKX A;  3CCU I;  2GWR A;  3W6K B;  2W48 A;  3BR5 A;  2L4M A;  3H9J A;  5L3G A;  5EF6 A;  1R71 A;  4BS9 A;  4IX7 A;  1TT0 A;  1P4W A;  3KCC A;  1LNW A;  5FKL A;  3ZQC A;  1X3Z B;  1XGO A;  2WAF A;  3OV8 A;  2ME0 A;  3Q9S A;  4B1R A;  2NXN B;  2STW A;  3DFG A;  2OUM A;  3HJE A;  4MFE A;  1HDD C;  2H6C A;  3HRU A;  2NVU B;  1YRN B;  2E2H J;  3PNT A;  1K4S A;  5E8I A;  1KON A;  3DTI A;  1IN7 A;  3FXJ A;  4XLC A;  2XAS A;  4ON0 A;  2F5C A;  3DEW A;  1XGS A;  3L09 A;  3QU6 A;  4ZZL A;  3MKW B;  4D5F A;  4BY1 J;  4X0G A;  3JRH A;  3HRM A;  2R92 J;  2EIL H;  3COA C;  2CV2 A;  1SD6 A;  4ZZD A;  1GV5 A;  3NQO A;  2L7Z A;  2E1M B;  3AL0 B;  2M7A A;  2A6T A;  4UXN A;  1ZRC A;  2BXY A;  1DP3 A;  1GLN A;  4EEF G;  2ZJR F;  2BXZ A;  4IHX A;  4Q4Z F;  3LSP A;  1F36 A;  1FT9 A;  2HXO A;  3D1N I;  3K1M A;  1L3L A;  2G7H A;  2K4J A;  1SVL A;  2LKX A;  1R5G A;  4I98 B;  2LKS A;  4OAY A;  1VF9 A;  1VI0 A;  4JQF A;  3K4M A;  1ZG5 A;  1QNT A;  1X4O A;  3K2Z A;  1WJ5 A;  4CXF A;  5B3S H;  5GPC A;  1V3F A;  3TP3 A;  2PG4 A;  2EFN A;  2Y75 A;  1K79 A;  3KX2 A;  3ZMV A;  2DXI A;  1FWZ A;  2X1C A;  1Z91 A;  1R1U A;  3J81 K;  1QO0 D;  4HNV A;  2DMT A;  3PNY A;  4EMS A;  4Y13 A;  1F1Z A;  3WTU C;  2PI0 A;  2WA0 A;  2VC0 A;  3SYT A;  5IYB J;  1MMN A;  2MGQ A;  3K1N A;  1G3S A;  1S7O A;  2P7V B;  3VYS B;  2DI3 A;  4D7N A;  2IS1 A;  4BBR J;  4ESF A;  1J9I A;  1WGX A;  4M3E A;  1MH4 A;  2QKM B;  2EFQ A;  2GBY A;  2DMP A;  3IC7 A;  2V79 A;  2COB A;  2YUS A;  4PJ0 C;  3K9T A;  1UCR A;  1Z3Y A;  4HX7 A;  2E19 A;  2R4G A;  4PDK A;  3IKT A;  1BI2 A;  2Y0M A;  1NHA A;  1AA7 A;  2JRT A;  2MSY A;  1D1A A;  3JCU C;  3VYT B;  2YU9 J;  3A4C A;  3I58 A;  1X1P A;  5FKN A;  3E5Q A;  3WTV C;  4C2T A;  2JSP A;  3SDG A;  4M9S A;  2OCC H;  5BQT A;  2BY3 A;  1FTZ A;  3K7A J;  3O3K A;  3S1N J;  2FRH A;  4JX6 A;  2EFW A;  2IJL A;  3G4S I;  2F48 A;  1UB9 A;  1FYM A;  2VXZ A;  4CIC A;  2HVS A;  4DZP A;  4XID A;  3AG3 H;  3VFZ A;  2MG4 A;  3OYI A;  3A2K A;  2H8W A;  1AWC A;  3GTM J;  4D5C A;  1Y56 A;  5E1X A;  1MMD A;  4BDY A;  3HGY A;  1O3R A;  3GYH X;  2GZW A;  4C30 A;  1XG1 A;  4UUS B;  1QZZ A;  3ZQQ A;  5M5X J;  4ASN A;  3E6B A;  1E2X A;  4ETS A;  1K61 A;  1I39 A;  3B6A A;  3FXO A;  2P0W A;  2VE8 A;  1OCO H;  4XLN F;  2JZY A;  1OR7 C;  1MH3 A;  3WTS C;  2H27 A;  4EJU A;  4YFN F;  2DPD A;  2NRA C;  3BR2 A;  1I1G A;  3A01 B;  1AKH B;  2EZH A;  1LB2 A;  2LY1 A;  4Y15 A;  4B3A A;  2D2W A;  4RB1 A;  2A5Y B;  3K4B A;  3C2B A;  4Y52 J;  2RVC A;  2R7W A;  1ITY A;  5K7Z A;  2DPU A;  1MDM B;  2K86 A;  4A3M J;  3GW2 A;  3A0B C;  2PJP A;  3MD2 A;  2QSH X;  2DMN A;  2Y69 H;  4N9I A;  3F6O A;  3BC8 A;  3FXU A;  4M71 A;  4RAZ A;  4GO1 A;  2FA5 A;  4Y4R A;  1OR7 A;  2P81 A;  1BI1 A;  3EQL F;  4L9T A;  1I27 A;  4LLL A;  1JKO C;  1GXQ A;  2E7X A;  3N4M A;  2DFH A;  4RA2 A;  3WOD F;  3KZY A;  3W2W A;  4CCK A;  3HBL A;  2FBK A;  4MFD A;  5DD4 A;  3LA3 A;  1R9T J;  3GTP J;  4BQA A;  4XKV A;  2BV6 A;  5ERI A;  3OIP A;  3NAR A;  3C2H A;  5EEG A;  4AID A;  2OZU A;  2O8X A;  3PO2 J;  2YPR A;  3M4O J;  4NQW A;  3IRQ A;  3HOS A;  3CCQ I;  3HRS A;  1IV6 A;  3DBR B;  2BY1 A;  2V1U A;  3FK6 A;  1TNS A;  3HGG A;  2JTV A;  4PUS A;  1IN8 A;  2OAZ A;  4R79 A;  2EFP A;  3T0Y A;  3EUH C;  5JLX A;  2CW8 A;  2F2E A;  4YG2 F;  1IN5 A;  3JRA A;  2KLO A;  3BR0 A;  5LRR A;  3DQV C;  1VQM I;  4X1E A;  4BHC A;  1OPC A;  1HF0 A;  2E1C A;  2DTZ A;  4YIF A;  4PFP A;  5FJ8 J;  2WBM A;  2LF7 A;  2YU3 A;  2LG4 A;  4AYB A;  2D1V A;  3ZQ7 A;  3HUG B;  1MKM A;  1MMA A;  4WXH A;  5IP6 A;  4BQN A;  2JMW A;  1GV2 A;  2E7W A;  2BYV E;  2CSO A;  3Q3S A;  5HDN A;  2M4G A;  1VQL I;  1T56 A;  2Z33 A;  3ISP A;  5D5W B;  3HEF A;  2ZFU A;  2FQ4 A;  3ABU A;  4UY8 I;  1AOY A;  4KYW A;  1E17 A;  2ICW G;  1FP2 A;  3FBN B;  4G94 A;  2IVM A;  2VOO A;  2RRE A;  4UUV A;  2CQ7 A;  4HST A;  1W7P A;  1R58 A;  3I59 B;  1QZE A;  4BU2 A;  2X9D A;  5F6F A;  4BJT A;  2JUC A;  4ABZ A;  1BI0 A;  2XHK A;  3I9V 2;  1J0R A;  2IPQ X;  3F72 A;  3N97 A;  2L9N A;  1RC9 A;  1QHH D;  4C3J J;  3HOV J;  3GBG A;  2MBF A;  1V54 H;  4AC0 A;  1K7A A;  2L02 A;  4A93 J;  2X1D A;  4N4N B;  1ZGJ A;  1IXR C;  4FAS D;  1Z67 A;  3FIS A;  2L2O A;  1QPM A;  2JVH A;  2QGU A;  3SJM A;  3K4L A;  1SAU A;  5DDG A;  4GYI A;  4BYY A;  4KN4 X;  2D5V A;  3IKV A;  2IRF G;  2OPT A;  1TWH J;  2W85 A;  2UV1 A;  3E6C C;  3H0D A;  3L00 A;  1J59 A;  3MQ0 A;  5FRM A;  3CF5 F;  3OOU A;  4R8H A;  1TQP A;  3ZQG A;  1ZG1 A;  2IGK A;  2CS3 A;  5D5V B;  2ZXI A;  1OLT A;  1KU7 A;  2K85 A;  2JPB A;  1IC8 A;  4KT5 C;  4JX5 A;  1G3Y A;  3HOX J;  1DPR A;  1LE8 A;  5D6F A;  3CMY A;  3FWE A;  4HDV A;  1W1W E;  1S5L C;  4MTE A;  3GTQ J;  3ZCO A;  2HKX A;  5DV5 A;  3FM5 A;  4BBS J;  3BG9 A;  3PQK A;  2JSC A;  2L9S A;  2P6T A;  1D0Y A;  4KIC A;  3QWL A;  5D4R A;  3S2D J;  3ZQF A;  1Y1V J;  3QYF A;  3W6J B;  2N8G A;  2LP0 A;  3K2A A;  4XSZ F;  3OSG A;  1RKT A;  4MIM A;  6PAX A;  1XSV A;  5GP9 A;  3CCM I;  1ZGW A;  4DOZ A;  2CUE A;  1I1S A;  3BPX A;  2K27 A;  2EZL A;  1SVO A;  4E70 A;  1N77 A;  4IOC F;  3W6V A;  3KP2 A;  4AIJ A;  1ZK8 A;  2JA6 J;  4IRG A;  3CCR I;  2A3S A;  2XAG A;  3GF2 A;  3WHC A;  1FJL A;  3SHF A;  3G73 A;  2E71 A;  2OA4 A;  1D0X A;  2DOF A;  5M5Y J;  3V8K A;  1OMI A;  5FFZ A;  1B1B A;  2CV0 A;  1XD7 A;  1FTT A;  3IWZ A;  4ZYA A;  3C18 A;  5FB2 A;  2VBZ A;  2IT0 A;  3BZK A;  1OFC X;  3AFH A;  1HKS A;  3LFK A;  3TMO A;  5GAH J;  3GZN B;  3GFL A;  3E3V A;  2AQE A;  3S14 J;  2LY9 A;  5LLQ A;  2D1H A;  3L7W A;  1BN5 A;  2E1M C;  3AL0 C;  5IOY A;  4I01 A;  4ENK A;  3HXL A;  1G59 A;  1TWC J;  1QRY A;  2X6O A;  1PDN C;  2KIM A;  4ESB A;  2MYS A;  1XMA A;  3FDY A;  3TW7 A;  2LMD A;  3ML6 A;  4FET A;  4B48 A;  2VPL A;  2VOD A;  2QZ8 A;  1Z6R A;  3H36 A;  4V2G A;  3BCB A;  3R6S A;  2PMU A;  2V9V A;  2K7L A;  3BR3 A;  4II3 A;  2MAB A;  3L1P A;  1S6L A;  2BEO A;  5K5O A;  3DF8 A;  3OY9 A;  1DGW Y;  2K3F A;  2R7R A;  1B6A A;  1VQ4 I;  2NS0 A;  2O03 A;  3PJR A;  1YTY A;  2DOA A;  3DKW A;  4ITV A;  4PJN A;  1F5T A;  1X4P A;  3ZQI A;  4YEJ A;  2XKO A;  2EB7 A;  3OOP A;  4HLY A;  2VKD A;  2H6B A;  3S3M A;  2KKO A;  2RN7 A;  4P9F A;  5EG0 B;  3T8R A;  1AKH A;  2HEO A;  2MC4 A;  1ZLK A;  3BT9 A;  1JHF A;  3MWM A;  5BNG A;  2XB5 A;  4BH9 A;  4A3K J;  3JRC A;  3C7J A;  1YW9 A;  3M9A A;  1OQY A;  2E2J J;  2V9P A;  1IRX A;  4XM3 A;  1Y1W J;  5HLI A;  5LHH A;  3P9I A;  1R6R A;  5ICC A;  3E5U A;  3PSI A;  1ZAO A;  4NC8 A;  2VQL A;  4I99 C;  3KFW X;  3KP4 A;  3H9Q A;  3S1R J;  3CMA I;  4L0Y B;  1EH8 A;  3BY6 A;  2OQR A;  2FUG 2;  5LHG A;  1TW3 A;  4LK1 F;  1GDT A;  2XF7 A;  4IXA A;  4F93 B;  1W0U A;  2O3F A;  3FKI J;  1YOV B;  2M30 A;  3RPU A;  2VB6 A;  2VQH A;  1G2H A;  5K7H A;  3IH4 A;  3GCM A;  3CDH A;  4BE2 A;  4M74 A;  4U0Y A;  1IUF A;  2KPM A;  2VBY A;  2WY8 Q;  1F4K A;  2CMP A;  3HHG A;  2BGC A;  2XV4 S;  3U1D A;  1KU3 A;  4CGZ A;  3K70 C;  5E3N A;  4UV8 A;  1Q1H A;  1N25 A;  4M73 A;  1MW7 A;  2W25 A;  3F8F A;  4I76 A;  4IHW A;  1MNM C;  4Z2Y A;  2NNY A;  3FMS A;  3TO9 A;  1U6G A;  2PX9 A;  4KFC A;  1IAW A;  4E7I A;  1VQK I;  2ETH A;  5E18 F;  3D5L A;  3CUQ A;  4M9Z A;  1NTC A;  2KT0 A;  5E3O A;  2LF8 A;  1YS7 A;  2JPC A;  2L9R A;  2M2E A;  2YX4 A;  3R0J A;  4M3F A;  4HV6 A;  4KIT B;  5ILU A;  2FNP A;  1B59 A;  1U9N A;  2DQR A;  5D5X B;  1JUS A;  2C6Y A;  1XX5 A;  3MEX A;  4YEL A;  3ZMZ A;  1Z6T A;  3G71 I;  4WX9 A;  3F8C A;  4PZJ A;  4UNO A;  3RPQ A;  1NG7 A;  1P2F A;  1YFH A;  2LH9 A;  9ANT A;  3RTR A;  2EIK H;  4L9N A;  5J47 A;  2HYJ A;  4C3I J;  5CLS A;  2OD5 A;  2VJJ A;  3IRR A;  2W7N A;  1FOK A;  3ZQL A;  2LYC A;  3E1S A;  5LGN A;  1EJ9 A;  5LEJ A;  2DOD A;  3DKX A;  2RGV A;  4RB3 C;  4UB8 C;  4J01 A;  3WGH A;  1ETW A;  1KYW A;  1TWF J;  3BJA A;  3C2G A;  3G2B A;  2OC6 A;  4GGG A;  2BVL A;  1FBU A;  4JOM A;  5C4J J;  2CGP A;  2Q8K A;  5HDG A;  1ZN2 A;  1LUJ B;  4P9U A;  2ZME A;  4RLF A;  3BG6 A;  3LFU A;  4P5O A;  4L9V A;  2R5Z B;  3VYU B;  1B9N A;  5J4Y A;  2ZJ2 A;  3I3L A;  1R00 A;  4XKW A;  3DPT A;  4HBL A;  1XPX A;  3J80 K;  1PP7 U;  5GAE J;  4RMN A;  4OAZ A;  3I64 A;  3SEQ A;  3FHZ A;  2HFH A;  2BVM A;  2GOX B;  2CH0 A;  1K83 J;  3M7G A;  3CC4 I;  2MLK A;  3O8G A;  3DP7 A;  2HKO A;  4GRI A;  3U2R A;  1YI2 I;  1E3O C;  1XCV A;  5HLG A;  1B9M A;  3KZI C;  1HSJ A;  2HR3 A;  1P4A A;  3OS0 A;  2AXT C;  4EGY A;  1IZ1 A;  1Y0U A;  3OS2 A;  4AVZ A;  3K4C A;  2NS8 A;  2LSO A;  2HQR A;  3RDI A;  4OMZ A;  4Y17 A;  5BPD A;  1TQI A;  1Z77 A;  1JJ8 C;  1VTN C;  1YJN I;  2HNH A;  5ED4 A;  4OU0 A;  2VAS A;  2QBY A;  3S16 J;  4LIV A;  3DBL B;  4QPQ A;  1WQ2 A;  4EJW A;  1ZRD A;  2KIF A;  2HOS A;  3OL4 A;  4FX0 A;  3PFY A;  2QBY B;  2EA2 A;  3SDB A;  1JTY A;  1V5G A;  1Z05 A;  5GAG J;  4ENN A;  5HNH A;  3ONQ A;  2Z5U A;  1DU0 A;  1PVE A;  1HW1 A;  1BL0 A;  3GO5 A;  2DO7 A;  2CFX A;  1QHG A;  2O7O A;  2ESH A;  4A5N A;  2QA4 I;  4XN0 A;  1UJ8 A;  3NWS A;  3P9C A;  3PIP F;  1LE8 B;  4QWQ A;  3SFZ A;  2LY2 A;  1TP4 A;  1U3E M;  2IS4 A;  2BOL A;  4I6Z A;  4BNC A;  3U9G A;  5AON A;  3BDD A;  2CQX A;  5CVI A;  2JA2 A;  3MKY B;  2GIV A;  3PUB A;  1L0O C;  2EBI A;  1Z7L A;  3AKZ A;  1MIJ A;  4OMY A;  4CUG A;  4LB6 B;  3KLO A;  3VOE A;  4G7O F;  1DDN A;  2XKP A;  1JGG A;  2JT1 A;  3J7A O;  2O5R A;  2ZJQ F;  4UB6 C;  2W57 A;  5M3M J;  5EDN A;  5FGM A;  2F4I A;  4HOB A;  4JP0 A;  1NH3 A;  2DK5 A;  3CME I;  3F21 A;  5KVR A;  2IS6 A;  4IVN A;  5LD2 C;  2CU7 A;  4NNJ A;  2HZT A;  2YS9 A;  5E3L A;  1UHS A;  2NVY J;  4CCM A;  3HSE A;  3HRT A;  3Q0W A;  3W2A A;  1BM9 A;  3HM5 A;  2PQ8 A;  5K5Q A;  4DJA A;  4KN7 X;  3W3C A;  2ISZ A;  3S2H J;  3MKZ A;  4IF4 A;  2V7F A;  1IG7 A;  4FTH A;  3A1Y A;  2FXA A;  3HTS B;  1EH7 A;  1VQ7 I;  3FXQ A;  3I55 I;  1BC7 C;  1A6I A;  4GFB A;  2DDB A;  5H2F C;  5KNL A;  5HOD A;  3I5U A;  3QYE A;  1KU9 A;  2EJR A;  3U21 A;  5JLW A;  4I0B A;  1QZY A;  3KIO A;  1YIO A;  2R7F A;  4M6V A;  3DLA A;  1MSE C;  3KET A;  3RZO J;  1MJB A;  2XAU A;  3OYB A;  1PYV A;  3ROU A;  1ON2 A;  4DGW B;  3DEE A;  4A6D A;  3JRF A;  3H5N A;  4J19 A;  1PUE E;  2F4M B;  2CQQ A;  4AWX B;  3J81 Z;  1QGP A;  5E1W A;  4RAG A;  3KPH A;  4RBO A;  3A03 A;  4AM3 A;  3S3N A;  1UG0 A;  4A0Z A;  2ECB A;  1FX7 A;  2ID3 A;  2K9L A;  2R7D A;  2XGC A;  2ELJ A;  1E3P A;  3PNV A;  1QVU A;  3JRB A;  4O3M A;  4XN3 A;  1R5H A;  1ZAR A;  3DLL F;  4NHJ A;  2UWM A;  5M3F J;  4MGR A;  2QSF X;  4LGW A;  2K40 A;  1ZRE A;  2YX7 A;  1VZ0 A;  4I09 A;  1ORK A;  1REP C;  5CVV A;  4BGD A;  1A36 A;  5JR3 A;  3PIO F;  5M5W J;  1EKE A;  3ZN1 A;  1OKR A;  3CO6 C;  2DA2 A;  1VQ5 I;  4G12 A;  2PBI A;  1YW7 A;  4KJZ A;  4PCQ A;  4LK0 F;  5ILV A;  2NOJ B;  1IUY A;  2DA1 A;  2YSR A;  3M8F A;  2CUF A;  2FBH A;  2X48 A;  2ZCW A;  3ABK H;  1R49 A;  3CDL A;  1H89 C;  1X1D A;  3LQR A;  4XLH A;  4FHT A;  2KZG A;  3QOP A;  3BR6 A;  4HQE A;  3U1K A;  2HDW A;  2P5V A;  2X6W A;  2E35 A;  4XLF A;  1BR2 A;  4YII A;  1X19 A;  3P9K A;  1T8I A;  1UMQ A;  1TL8 A;  3KP5 A;  2WB1 A;  4A3D J;  4LMY A;  1JUM A;  1OCR H;  4RAF A;  4PGG A;  4GXO A;  5EJC A;  5DTD A;  4Y7N J;  3GFJ A;  1V5F A;  3ASO H;  2NNN A;  4M6Y A;  2XRN A;  2DA7 A;  3BG3 A;  2M9H A;  5LFA A;  4BQO A;  4MEX F;  3D5R C;  1LDJ A;  5F27 A;  5C3E J;  5F0F A;  4IO9 F;  1BIB A;  4N9H A;  4DYQ A;  1Y0N A;  4IEJ A;  2VE9 A;  1S9H A;  2FEZ A;  3H35 A;  2W00 A;  3DEU A;  3ZMD A;  1MDM A;  1LFU P;  2KP6 A;  4BDZ A;  3H1C A;  1OCC H;  3JSP A;  3FK7 A;  3QYB A;  2KZV A;  2A5W A;  2Y0S A;  1LPQ A;  3Q5F A;  4WXC A;  2VBW A;  2EIM H;  2R7S A;  2RAE A;  3GTG J;  1FOX A;  1WWX A;  2HVR A;  5FLM J;  4AD9 A;  4BXX J;  4NUB A;  3PFI A;  2IW5 A;  5CKT A;  1GVD A;  1SD7 A;  4M3B A;  1D3Y A;  2I10 A;  5DUI A;  2DAO A;  2V1N A;  5J1U A;  3TP0 A;  2KIU A;  3CP2 A;  4YFK F;  1AU7 A;  3ZXS A;  4XSX F;  2Z3Y A;  3DWL E;  4IRH A;  1FC3 A;  2F5V A;  2KMU A;  3ELK A;  2CYY A;  3QPH A;  1LFP A;  2Y9Y A;  4KNY A;  1D8J A;  1JXS A;  2R5Z A;  3LAP A;  1ACI A;  2EV5 A;  3HKZ A;  4C3H J;  4ZC3 A;  5HS7 A;  1FNN A;  1VQP I;  3HOZ J;  3NEU A;  3E5X A;  3J7A Y;  3LAJ A;  1ZR4 A;  5IYD J;  4OIO F;  3BP8 A;  1XTA A;  4K2E A;  4EJT A;  1G6N A;  1HC8 A;  1T39 A;  2QQ9 A;  3MVP A;  5HS8 A;  1S72 I;  3LMM A;  4HW0 A;  1I3Q J;  3FXR A;  1J75 A;  2CFO A;  3H0G J;  3W2V A;  4CZC A;  2BY0 A;  1NK2 P;  4P96 A;  1SVM A;  1P92 A;  2QLZ A;  5J4V A;  3EYY A;  2HI3 A;  2E36 A;  3CLQ A;  3WTW C;  3HUG A;  3CCE I;  5E8G A;  3HIF A;  4BQQ A;  4G7Z F;  5HDK A;  3UNG C;  2A68 F;  2RNJ A;  2KRF A;  2KL4 A;  4UVB A;  3FXK A;  1VQ6 I;  3CD6 I;  2Y31 A;  3GWZ A;  1I50 J;  3MCZ A;  3V7C A;  2R7U A;  1A5J A;  1RI7 A;  2FML A;  5ICG A;  5K7F A;  5E17 F;  1UHW A;  2RKH A;  4MTD A;  1Z0X A;  1V5E A;  3F23 A;  3HYI A;  3TKY A;  2H8R A;  2KDZ A;  1D1C A;  2DFE A;  2P4W A;  2TDX A;  1ETX A;  1HKT A;  2QVO A;  5J8C A;  4AIH A;  2FOK A;  2QF7 A;  1LVK A;  1IW7 F;  1HQC A;  3JAM Z;  1YIT I;  4BL0 B;  5E3M A;  2DA3 A;  2STT A;  1WCM J;  4B8X A;  3NAU A;  2LBF B;  3HOW J;  3LA7 A;  4A0Y A;  1XS9 A;  2LD5 A;  1T6S A;  2Q0O A;  3EUA A;  2E5Z A;  5F04 A;  4M6X A;  4YFX F;  2LBF A;  3CCS I;  2KIQ A;  2OJE D;  2VJI A;  4KMF A;  2CWE A;  5LEK A;  4PJL A;  1ETO A;  1D5V A;  4EGZ A;  1WJA A;  3CJR B;  2WTE A;  2NOG A;  2DMQ A;  1R36 A;  4WWC A;  1TQM A;  2L7K A;  1WH5 A;  3CO7 C;  1ZTR A;  2JN6 A;  2GXG A;  4QSH A;  4UV9 A;  4L18 B;  1FYL A;  3EYI A;  2DDA A;  4G9Y A;  3TW6 A;  4E7H A;  2GAU A;  3NRV A;  1HCR A;  1LEA A;  2HVQ A;  3JTH A;  3K4N A;  1DGR M;  2CO5 A;  3GVA A;  1S8N A;  3CES A;  3M1C A;  4B43 A;  1DPU A;  1Q1V A;  3CF2 A;  3ZP5 A;  2M3A A;  3EUH A;  3ABT A;  4CH7 A;  1FMW A;  1JHH A;  2O9L A;  1YS6 A;  4KIF A;  1RIO H;  2RQP A;  2GXB A;  3QP5 A;  3DCF A;  2L9V A;  3H5R A;  3G1L A;  1HST A;  3REO A;  3RKY A;  1WZ2 A;  3QP6 A;  1WFX A;  4XOT A;  2JA8 J;  3HSR A;  4RS8 A;  4IL6 C;  5H6Q A;  1XC5 A;  2FMY A;  1KYZ A;  3PUF A;  2DW4 A;  4U7D A;  1YQA A;  2ESN A;  4BEH B;  1U5T B;  3FZV A;  1SD5 A;  4OIR F;  3L9F A;  2V1D A;  1HA8 A;  4DQ2 A;  5JVG F;  1BA5 A;  3OYM A;  4EM1 A;  2XAH A;  4ZYH A;  1ETY A;  4PSW A;  1S3J A;  3GFI A;  2ZC2 A;  3G3Z A;  2OF7 A;  4FT8 A;  4HEA 2;  2ZSI B;  5GTH C;  2M0C A;  4B44 A;  1TZL A;  2MA3 A;  4RGX A;  2EH3 A;  4CCO A;  1YG2 A;  3BTJ A;  3RPU D;  4F92 B;  1R4M B;  3GME A;  2CQK A;  3HOT A;  4E7Z A;  1NK3 P;  1K6Y A;  4U88 A;  5HS9 A;  4HQM A;  4E4H A;  4RGU A;  3JRI A;  1EA3 A;  1MND A;  3I71 A;  1WSU A;  2MH2 A;  2VT3 A;  1W5S A;  3QOE A;  4KMU X;  2K3P A;  2ZNY A;  3LOC A;  5FD5 A;  3S93 A;  4IRI A;  2I5U A;  1P9Q C;  2PFB A;  5J40 A;  3IH3 A;  1F43 A;  4CO8 A;  3GLL A;  4RAY A;  3E6M A;  1T33 A;  2K4B A;  1XCB A;  1T98 A;  3ASN H;  2UXX A;  4IQ4 A;  5CYV A;  1T08 B;  4KDP A;  3JR9 A;  2DT5 A;  2FNA A;  4HRI A;  3RKW A;  3DKY A;  2JA5 J;  1BI3 A;  1KZH A;  3WU1 B;  3BQY A;  4XRS G;  1T2K A;  3TDZ C;  1IXS B;  5DEQ A;  2VIX A;  3QQA A;  4P1W A;  3K1P A;  4YRV A;  1XGM A;  2L5Q A;  3OSF A;  4O6J A;  4DW6 A;  1EH6 A;  2PN6 A;  3QAH A;  1PP8 F;  1ZHF A;  5FRO A;  1YO5 C;  3ESW B;  3GZ5 A;  4UVC A;  3TOB A;  4A6E A;  4EJO A;  3J7Z I;  3OYJ A;  2WAQ N;  2B7E A;  5FKO A;  2MD5 A;  3Q0U A;  1J2X A;  1R1T A;  3FMQ A;  4U87 A;  3SEZ A;  3LSK A;  2LFB A;  1A6Q A;  2GA1 A;  1UHM A;  2DJN A;  3FM3 A;  4C2M J;  1RPW A;  3JTG A;  2VT2 A;  1WJF A;  3BR1 A;  1WVR A;  3H5A A;  5FLV A;  5L3C A;  2Q2E B;  4MLO A;  1FBS A;  1RES A;  2XAJ A;  2XGX A;  3EDP A;  5CPR B;  3J7Y J;  3KYL A;  2QWW A;  3HTU A;  2O8K A;  1HLV A;  5F08 A;  2IGM A;  1YLF A;  3RZD J;  3M3Y J;  1XSX A;  3FXL A;  4XRS A;  2V26 A;  2EK5 A;  1SEU A;  2Z2S B;  3CUQ C;  4MEY F;  3VSK A;  3BJO A;  3QPS A;  3HKZ N;  4NBQ A;  4BUP A;  1ONV A;  4MQ9 F;  1D8K A;  3DU6 A;  3GUD A;  2OCE A;  1X1C A;  4BJ5 C;  4YIR X;  3SFI A;  2ZBK A;  5FKM A;  1X2N A;  1WH7 A;  1U0J A;  2XF5 A;  2IGO A;  4U0W A;  1ENH A;  3L2C A;  4MHG A;  3WGI A;  2X85 A;  2ZNZ A;  2Z1D A;  2LTP A;  5IP7 J;  1LJ9 A;  4TV7 A;  2UXN A;  3WTX C;  2GQQ A;  1EV7 A;  2ECC A;  1SFO J;  4ANJ A;  4D0P A;  5EYR A;  3UKG A;  3MKL A;  1B8I A;  2LRD A;  2VJ5 A;  2FF4 A;  4M3G A;  3L2Q A;  1U78 A;  1MGT A;  5H6R A;  4A3E J;  2ZKZ A;  5TGT A;  2R3S A;  4DIQ A;  5DM6 F;  2J5O A;  1O4X A;  1QPI A;  3F8N A;  1WHU A;  1FSE A;  2KDO A;  4L5J A;  1SFE A;  1QA6 A;  3MZ8 A;  5A2Q Z;  4BXU A;  3CZ6 A;  4M9X A;  3VYR B;  4A3F J;  4B47 A;  1MBG A;  2ID6 A;  3OWT A;  4A2U A;  5FFX A;  2CW7 A;  3O8H A;  2ZME B;  3I54 A;  4XRF A;  1APL C;  3QRF F;  1J7K A;  3MZY A;  1HW2 A;  5FD6 A;  1WI3 A;  3B73 A;  2A61 A;  2CRG A;  2K9M A;  3CCJ I;  1O7F A;  5ICF A;  3E6D A;  2AO9 A;  4E6K G;  1PUF B;  2F4O B;  4IPA A;  1Z1D A;  3V8L A;  2X0L A;  3ABM H;  1Z21 A;  4G6T B;  3K0L A;  3WTY C;  2WV1 A;  2VXD A;  3MZH A;  2L3D A;  3T1B A;  3H3Z A;  2ZXH A;  2NVT J;  1JTX A;  3DTE A;  3OR2 C;  5A2Q K;  3GTJ J;  1U5T C;  1IRZ A;  2H94 A;  2IA0 A;  2M0M A;  3B6C A;  1RUN A;  4HF2 A;  3DBH B;  3EET A;  3I4P A;  1UFM A;  3HL2 A;  2WWY A;  5FLX K;  3F22 A; 
#chains in the Genus database with same CATH homology
 5F0C A;  1IV6 A;  2JJ7 A;  4RBO A;  3A03 A;  1AHD P;  3FK6 A;  2NVQ J;  3HGG A;  2ECB A;  2ID3 A;  5EZG A;  3GTK J;  2XGC A;  3Q0V A;  1QVU A;  3JRB A;  2NS7 A;  5JLX A;  1HDP A;  2XSD C;  5M3F J;  1JT0 A;  2GM4 A;  3JRA A;  1TWG J;  3BR0 A;  1B8I B;  1CQT A;  2K40 A;  1EF4 A;  5EG0 A;  3S1Q J;  1P7I A;  1ORK A;  4X1E A;  5M5W J;  1HF0 A;  4FE7 A;  2DTZ A;  2DA2 A;  2HXI A;  4G12 A;  5IYC J;  5FJ8 J;  5IP9 J;  3CCY A;  2VKV A;  3BTL A;  2L0K A;  1U8B A;  1BW6 A;  5J1R A;  2DMU A;  5IP6 A;  5J3L A;  2DA1 A;  2EZI A;  3JRD A;  4IHV A;  2CUF A;  2JMW A;  1GV2 A;  2X48 A;  2Y2Z A;  3CDL A;  3Q3S A;  1H89 C;  1IDY A;  2TCT A;  2R5Y A;  3BR6 A;  1RKW A;  1T56 A;  1MSF C;  3A01 A;  3HEF A;  1QVT A;  2FQ4 A;  1UMQ A;  2MW8 A;  4FCY A;  1LFB A;  4QTR A;  3S17 J;  4A3D J;  1JUM A;  2XB0 X;  5FKK A;  5DTD A;  1WPK A;  4Y7N J;  1GT0 C;  1JKP C;  2R0Q C;  2X9D A;  4ABZ A;  2ZB9 A;  2DA7 A;  3BG3 A;  2M9H A;  1ETQ A;  3JRE A;  3HOV J;  5F27 A;  4C3J J;  2JK3 A;  5F0F A;  5C3E J;  3GBG A;  4DYQ A;  4AC0 A;  4IEJ A;  4A93 J;  3FIS A;  1LFU P;  2XGD A;  4DYR A;  3SJM A;  4JX4 A;  3FK7 A;  4X6A J;  2ELK A;  2M34 A;  4FIS A;  2XPW A;  2D5V A;  2RAE A;  3GTG J;  2VUM J;  5FLM J;  2TRT A;  2OPT A;  1POG A;  1TWH J;  3ZQH A;  1PUF A;  4BXX J;  1BW5 A;  3LSG A;  2HOT A;  5J1Y A;  1I6H J;  3OOU A;  1GVD A;  4M3B A;  2I10 A;  5J1U A;  3TP0 A;  3ZQG A;  1MBK A;  4UUS A;  1AU7 A;  3GTO J;  3BTC A;  4A3J J;  3A02 A;  1IC8 A;  2Y0S N;  4JX5 A;  3HOX J;  1LE8 A;  2Y9Y A;  1FIA A;  3CMY A;  2R5Z A;  2ME6 A;  3GTQ J;  1X2M A;  4A3L J;  4C3H J;  2HDD A;  3GTL J;  4BBS J;  3BG9 A;  2R93 J;  3HOZ J;  4BY7 J;  1VND A;  3RKQ A;  3ZQF A;  3S2D J;  1Y1V J;  1ZR4 A;  5IYD J;  3S1M J;  2N8G A;  2LP0 A;  3K2A A;  3OSG A;  1FIP A;  1RKT A;  2E1O A;  4MIM A;  5GP9 A;  1ZGW A;  4MO7 A;  1U9O A;  1ETV A;  1ETK A;  2CUE A;  2LLK A;  3MVP A;  3HDD A;  4B4C A;  2EZL A;  5IPA A;  1VFC A;  1ZR2 A;  2VKE A;  1I3Q J;  1JJ6 C;  3W6V A;  3H0G J;  2IBD A;  1ZK8 A;  4UUT A;  1MBJ A;  1NK2 P;  2JA6 J;  3BG5 A;  1P7J A;  1HOM A;  3PM1 A;  1TWA J;  3LNQ A;  1GUU A;  2HI3 A;  5EZH A;  3WHC A;  4XK4 A;  1FJL A;  1ZQ3 P;  5M5Y J;  4A3B J;  1H8A C;  3I4M J;  2Y31 A;  1BJZ A;  1MBF A;  3OIO A;  1I50 J;  1MBH A;  1FTT A;  1A5J A;  1OFC X;  5K7F A;  1JUP A;  2K9N A;  3BQZ A;  2JA7 J;  3S14 J;  1Z0X A;  2LY9 A;  3QPL A;  1D5Y A;  2K9S A;  4QIW N;  5IOY A;  2H8R A;  2KDZ A;  2DN0 A;  3RQI A;  1TWC J;  1ETX A;  1QRY A;  2X6O A;  4A3C J;  2QF7 A;  3TW7 A;  5EGO B;  4A3I J;  4V2G A;  5E3M A;  2DA3 A;  1WCM J;  3BR3 A;  3NAU A;  3HOW J;  3L1P A;  1XS9 A;  2LD5 A;  1OJL A;  2IAI A;  1B72 B;  5C4X J;  4XRM A;  5F04 A;  2Y30 A;  2M8G X;  5C44 J;  1IDZ A;  2JWT A;  3E7L A;  2VPR A;  3ZQI A;  1JKQ C;  1B72 A;  1YRN A;  5EG0 B;  2NVX J;  1AKH A;  2R5Y B;  1ETO A;  3BT9 A;  5BNG A;  4IHY A;  2NOG A;  2DMQ A;  2XB5 A;  2PMZ N;  4A69 C;  4A3K J;  1OCP A;  2HQ5 A;  4S0H B;  1WH5 A;  3JRC A;  1IJW C;  1ZTR A;  2JN6 A;  2E2J J;  3H3V K;  4QSH A;  1Y1W J;  3LSR A;  3FIW A;  3TW6 A;  1JKR C;  1HCR A;  2L7F P;  2FD5 A;  3S1R J;  1SAN A;  1Q1V A;  5IOZ A;  1GDT A;  1W0U A;  3FKI J;  2O9L A;  2XGE A;  1H88 C;  1IGN A;  3BTI A;  3JRG A;  1G2H A;  5K7H A;  3IH4 A;  3DCF A;  3IH2 A;  3G1L A;  1JT6 A;  3G1M A;  1IUF A;  2HOA A;  4JYK A;  2JA8 J;  4DYC A;  1XC5 A;  2CJJ A;  5E3N A;  2FX0 A;  2DA6 A;  4I76 A;  4IHW A;  1MNM C;  2B63 J;  2AHQ A;  4CYC B;  5EGO A;  1BA5 A;  1ETY A;  1NTC A;  2KT0 A;  2K9Q A;  2LR8 A;  5E3O A;  2L9R A;  2M2E A;  4M3F A;  5DS9 A;  2OF7 A;  2QCO A;  2GLO A;  4BKX A;  1U9N A;  1JUS A;  2W48 A;  3BR5 A;  2M0C A;  5EF6 A;  1OCT C;  2EH3 A;  5FKL A;  3BTJ A;  3ZQC A;  2ME0 A;  4B1R A;  4MFE A;  1HDD C;  3G1O A;  1NK3 P;  9ANT A;  1YRN B;  2HYJ A;  2VI6 A;  4C3I J;  1ZKG A;  2E2H J;  3JRI A;  5F0H A;  2DA5 A;  3ZQL A;  4V2F A;  3DEW A;  2DA4 A;  4BY1 J;  4D5F A;  2R7Z J;  3JRH A;  2R92 J;  1ETW A;  3LOC A;  1TWF J;  2EZK A;  5C4J J;  3IH3 A;  1GV5 A;  2L7Z A;  1F43 A;  2G0E A;  3PO3 J;  1T33 A;  4EEF G;  4IHX A;  3LSP A;  2R5Z B;  1F36 A;  3JR9 A;  4W97 A;  3S15 J;  2HXO A;  3D1N I;  4XIC A;  3MN2 A;  2JA5 J;  3BQY A;  4XRS G;  2LKX A;  3QQA A;  1VF9 A;  1VI0 A;  4LOC A;  3TED A;  3OSF A;  4FE4 A;  4DW6 A;  1K83 J;  3HOY J;  3O8G A;  5GPC A;  3HOU J;  3TP3 A;  1E3O C;  2H1K A;  2WAQ N;  5FKO A;  4HNV A;  2DMT A;  2XRL A;  3Q0U A;  2EQR A;  2NS8 A;  5IYB J;  2LFB A;  2MGQ A;  4C2M J;  2DJN A;  1Z77 A;  4D7N A;  1RPW A;  4BBR J;  1JJ8 C;  4M3E A;  1WGX A;  2XPV A;  1MH4 A;  3BR1 A;  1RET A;  2GBY A;  2DMP A;  4M3D A;  2COB A;  2YUS A;  5FLV A;  2E19 A;  4MLO A;  4W1U A;  2MSY A;  3F0C A;  2YU9 J;  3S16 J;  3ZOB A;  5FKN A;  1RES A;  1TC3 C;  3SDG A;  2HOS A;  2O8K A;  1HLV A;  5F08 A;  3RZD J;  3M3Y J;  1FTZ A;  4XRS A;  1JTY A;  3K7A J;  2L7M P;  4L5E A;  4AUX A;  3S1N J;  3QPS A;  1DU0 A;  3HKZ N;  4JX6 A;  2FJ1 A;  1BL0 A;  3SFI A;  5FKM A;  5GPA A;  2O7O A;  4DZP A;  4XID A;  2MG4 A;  1LE8 B;  1X2N A;  1WH7 A;  4RDU A;  3GTM J;  4D5C A;  1ENH A;  4I6Z A;  3HGY A;  2LTP A;  2LVS A;  5IP7 J;  2IEK A;  4A3G J;  2CQX A;  1DU6 A;  1XG1 A;  2EBI A;  4UUS B;  5F1J A;  5M5X J;  2ECC A;  1SFO J;  4D7M A;  5EYR A;  2WB1 N;  3UKG A;  1K61 A;  3B6A A;  3MKL A;  1B8I A;  1UG2 A;  1JGG A;  3HB9 A;  5M3M J;  1MH3 A;  1U78 A;  4M3G A;  5EDN A;  3BR2 A;  4A3E J;  4JP0 A;  1O4X A;  5EEA A;  2E2I J;  1QPI A;  3A01 B;  1AKH B;  2EZH A;  2CU7 A;  2YS9 A;  5E3L A;  1UHS A;  2NVY J;  3WHB A;  4B3A A;  3Q0W A;  3C2B A;  3HM5 A;  4Y52 J;  1ITY A;  3CQZ J;  4A3F J;  5K7Z A;  1X58 A;  1MBG A;  2ID6 A;  4A3M J;  3S2H J;  1IG7 A;  3O8H A;  4FTH A;  2DMN A;  1APL C;  1A6I A;  4GFB A;  4CYC A;  2XPU A;  4AYB N;  5HOD A;  1WI3 A;  1FEX A;  2CRG A;  4DZJ A;  1MBE A;  5JLW A;  2AO9 A;  2P81 A;  1PUF B;  1JKO C;  3I4N J;  4M6V A;  2WV1 A;  3HBL A;  4MFD A;  1MSE C;  2LK2 A;  1R9T J;  3RZO J;  3GTP J;  2NVT J;  1JTX A;  1RR7 A;  1S7E A;  3LSJ A;  3GTJ J;  4NDL A;  1IRZ A;  3NAR A;  1W0T A;  3JRF A;  3IV5 A;  3B6C A;  4J19 A;  3PO2 J;  2CQQ A;  2Y9Z A;  3M4O J;  3VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...