4UUSB

Crystal structure of a ubx-exd-dna complex including the ubda motif
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
69
structure length
69
Chain Sequence
b'NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 25
structure length 69
sequence length 69
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uusB00
1JJ6C 1TWCJ 1JKOC 3BR5A 2XGDA 2JK3A 4A3EJ 1GUUA 5JLXA 3HOVJ 3K7AJ 3QQAA 4D7MA 1MH4A 1OCPA 3WHBA 2DA3A 2FX0A 3S16J 5M3FJ 2GLOA 1JTXA 2YS9A 2CQQA 1FTZA 3OSFA 2YUSA 4A3DJ 4DYQA 1HLVA 2N8GA 1QRYA 4IEJA 3C2BA 3IV5A 1RETA 3RKQA 1BW6A 4A3KJ 3SJMA 1IRZA 1YRNB 2Y30A 4CYCB 4MIMA 4XRSG 1MBGA 3G1OA 1IJWC 4G12A 1WCMJ 2JA5J 4QSHA 3HOUJ 1JUSA 3BR2A 2KT0A 1UHSA 2E19A 2OF7A 1LFUP 5EGOB 2HDDA 4IHWA 2CUFA 1E3OC 3JRAA 3HOZJ 2EZHA 2ECBA 4XIDA 3BR3A 5EYRA 2DTZA 3BTCA 5EZGA 4CYCA 4NDLA 2YU9J 2AO9A 1VFCA 3D1NI 1JUMA 2M0CA 2EH3A 2EZLA 2FQ4A 4D5CA 3GTGJ 2NS7A 1GVDA 3WHCA 1NTCA 3LSRA 1X2NA 2R5ZB 2L9RA 9ANTA 4M3BA 4DW6A 3MN2A 2Y2ZA 5K7HA 2DA2A 3NARA 2NVXJ 2Y9YA 1Q1VA 1GV5A 5E3LA 1ZR4A 3E7LA 2NOGA 1SFOJ 4JX6A 2XB0X 1F43A 2ID6A 2FD5A 5M5XJ 5F0FA 2R5YA 1WGXA 1Y1VJ 5M3MJ 4EEFG 2CRGA 3HEFA 3PM1A 4B1RA 1OCTC 3FIWA 3IH2A 3TEDA 4Y52J 2EBIA 2GBYA 4V2FA 3HKZN 5EG0B 3B6CA 4FTHA 4FE7A 4UUSB 2EZIA 3Q0UA 2HOSA 2DA5A 1IDZA 2R7ZJ 4QTRA 1AKHA 2VI6A 2QCOA 3G1MA 2LVSA 5K7ZA 2HXIA 1OJLA 3JRDA 4A69C 5M5YJ 3VPRA 5F0CA 5M5WJ 4A3CJ 5E3NA 3BG5A 3L1PA 2DA4A 4C3JJ 4D7NA 1LE8A 3GTKJ 2XPWA 2NVYJ 3S1NJ 3HOYJ 1ZKGA 4A3IJ 1TWHJ 1WI3A 2XGEA 2O8KA 5J1RA 1WH5A 2FJ1A 1MBEA 2LKXA 1OFCX 3JRCA 4A3BJ 2JJ7A 3NAUA 4AC0A 1H8AC 1RKTA 3LSGA 1QVTA 1RR7A 1UMQA 2P81A 2X48A 3JRFA 2EQRA 2M34A 5F27A 2LK2A 1H88C 3BQYA 3S1MJ 3ZQLA 1MSEC 2HOAA 1I3QJ 5BNGA 2IBDA 4Y7NJ 2HYJA 1ETOA 2AHQA 4M6VA 1BJZA 3S2DJ 3GTQJ 2LP0A 3GTPJ 3SFIA 2JMWA 5F04A 2COBA 3DEWA 1ZR2A 1Y1WJ 5JLWA 2K9SA 1IGNA 1T33A 1TWFJ 4GFBA 1BA5A 3S2HJ 4JYKA 5DTDA 1A6IA 1K61A 5IOYA 2X9DA 2XPUA 4HNVA 2K9NA 4A3LJ 4A3FJ 2DMNA 4BY7J 3S1RJ 3BR0A 3DCFA 5C4XJ 1GV2A 3A02A 1ZGWA 4X1EA 1JTYA 1P7JA 1ORKA 4DZJA 5EEAA 3OSGA 2L7MP 5GPCA 1ZQ3P 4A93J 3GTJJ 1JKPC 1MBHA 1X2MA 1NK2P 2R93J 1JT6A 1XS9A 3CQZJ 2CJJA 1ZTRA 4M3DA 1BW5A 4BY1J 3LSPA 4M3GA 4MLOA 5IPAA 4S0HB 4IHVA 1W0TA 3A03A 4C2MJ 1IC8A 3S15J 2R5YB 4MFEA 1IDYA 2Y0SN 3BR6A 4B3AA 3BQZA 2DMUA 3ZQHA 2E2IJ 3HOXJ 3QPSA 2XGCA 2ME6A 3JRIA 1VI0A 1I6HJ 5F0HA 2LTPA 2CQXA 1HOMA 2TCTA 3HDDA 5J3LA 1FIAA 3LOCA 2DA7A 4A3GJ 1AKHB 2D5VA 3BG9A 4MFDA 3BTLA 3HGYA 1IG7A 2WB1N 3FKIJ 2L0KA 2MG4A 1U9NA 2R92J 3IH3A 5IP9J 5FJ8J 2JA7J 3BT9A 2ELKA 1D5YA 2NS8A 4I76A 1JT0A 4JP0A 4I6ZA 1XC5A 3S17J 1WH7A 1K83J 4LOCA 2DN0A 5J1UA 1POGA 1LE8B 3GTLJ 1UG2A 3SDGA 2O9LA 5FLMJ 2X6OA 4RDUA 1P7IA 2QF7A 3HBLA 1SANA 3W6VA 2IEKA 2WAQN 3ZQFA 1ETVA 4MO7A 2HQ5A 4BXXJ 4BKXA 1TWAJ 3K2AA 3Q0WA 2NVQJ 1MBFA 5GPAA 2KDZA 2VUMJ 1FIPA 3HGGA 2DMPA 2W48A 3H0GJ 1I50J 3M4OJ 2ME0A 5FLVA 1ETQA 5E3OA 2IAIA 5FKNA 1LFBA 4QIWN 1ITYA 3TW7A 3BG3A 3FK7A 2VKVA 3GTOJ 3BTIA 1EF4A 3FK6A 3ZQCA 3S14J 2E1OA 3JRHA 4DZPA 3JRGA 3HM5A 1R9TJ 3O8GA 1H89C 1JKQC 3GBGA 2I10A 2R0QC 4C3IJ 1U78A 4W1UA 2L7FP 2RAEA 2B63J 2M9HA 2VKEA 5C44J 4JX4A 3ZQIA 3I4NJ 5DS9A 4JX5A 3Q0VA 2LD5A 4IHYA 4V2GA 3CCYA 2CU7A 5FKMA 2MSYA 5C3EJ 2TRTA 3OIOA 1W0UA 1DU0A 4A3MJ 1CQTA 2NVTJ 3UKGA 4C3HJ 4M3EA 3A01A 1IUFA 2OPTA 3F0CA 5IP6A 2E2JJ 3TP0A 4AUXA 3RZDJ 3GTMJ 3TW6A 3CMYA 5IYCJ 4BBSJ 1RKWA 3MVPA 4RBOA 1U9OA 1IV6A 1PUFA 1HDDC 2K9QA 3TP3A 4FCYA 2DA6A 1HCRA 1A5JA 1MNMC 1FJLA 1X58A 4B4CA 1GDTA 2LR8A 2GM4A 2DMTA 2LY9A 2K40A 1VNDA 4UUTA 1AHDP 2E2HJ 4L5EA 5IP7J 3H3VK 1MBJA 3PO3J 2O7OA 4D5FA 1HDPA 1DU6A 3RQIA 2Y9ZA 1JKRC 3JRBA 3Q3SA 1JGGA 4XK4A 1F36A 2HI3A 3BR1A 1JJ8C 1HF0A 1YRNA 1XG1A 2DMQA 2WV1A 5EZHA 3B6AA 5E3MA 4DYRA 3LNQA 3M3YJ 2M8GX 3RZOJ 2JA8J 1G2HA 1B72B 1GT0C 2L7ZA 5EGOA 3OOUA 3BTJA 3IH4A 5EDNA 3G1LA 5GP9A 1Z77A 2ID3A 2LLKA 4XRMA 2HOTA 4X6AJ 1ENHA 5HODA 2DA1A 3QPLA 4J19A 5C4JJ 1Z0XA 2HXOA 2VPRA 2CUEA 4W97A 2JN6A 1MSFC 2MGQA 1RPWA 2H8RA 2XB5A 2ECCA 4BBRJ 1ETYA 2G0EA 1B72A 3LSJA 2Y31A 2MW8A 2R5ZA 1NK3P 3PO2J 4ABZA 1B8IB 3ZQGA 1AU7A 5EF6A 1VF9A 5FKKA 4M3FA 2DJNA 3O8HA 5F08A 3FISA 5FKLA 2JA6J 3CDLA 2EZKA 1APLC 1MH3A 2H1KA 1MBKA 3JREA 4XRSA 1ETWA 4A3JJ 1BL0A 1B8IA 4DYCA 1TWGJ 3HB9A 1QVUA 1ETXA 1QPIA 5K7FA 1O4XA 5EG0A 1FTTA 1U8BA 1RESA 3JR9A 2ZB9A 4UUSA 2PMZN 4FE4A 3HOWJ 1T56A 5FKOA 4IHXA 1FEXA 3S1QJ 4AYBN 3A01B 1WPKA 5J1YA 2XRLA 2XPVA 4XICA 1ZK8A 4FISA 1S7EA 2LFBA 3ZOBA 3I4MJ 2M2EA 1ETKA 5F1JA 2XSDC 3MKLA 5IYDJ 2JWTA 1TC3C 5IYBJ 5IOZA 1PUFB 1JUPA
chains in the Genus database with same CATH superfamily
1B6AA 4EVIA 4DNCA 5AONA 2CV2A 1HBXG 3K70D 3BR5A 3HXLA 4PJJA 4XLEA 4F7ZA 2XGDA 2VBWA 4NQWA 3K7AJ 3DTKA 1MH4A 4G7HF 3EQLF 3WHBA 2FX0A 1USTA 3W2VA 1JHFA 3GVAA 3F8FA 2CQQA 5GAHJ 1E3PA 1W7PA 2HZTA 2RC4A 3HPHA 4BH9A 1B1BA 5GTIC 4A3DJ 4XLCA 1Z7LA 3IC7A 2N8GA 5KAFC 4IEJA 5ERIA 3RKQA 4A3KJ 2GOXB 2EFPA 2A61A 2WAQA 5CPRB 2E36A 3ABMH 4XONA 4G12A 4Y3OA 1WCMJ 1FX7A 1TTYA 4ZDOA 4PK4A 3LA7A 1UHSA 3COAC 4RLQA 4HLYA 2A6TA 2K3FA 3R0AA 3JRAA 2EZHA 1WQ2A 1YITI 3CTAA 1YJNI 3LWFA 3U1KA 3BR3A 3I9V2 1AOYA 5LRSA 4KYWA 2QQ8A 3WTYC 4LLNA 4CYCA 2FQ3A 1PDNC 2VJ4A 2AO9A 4HX4A 1IZ1A 2EH3A 2HKXA 5H20A 2EZLA 3GTGJ 4HBLA 1C0WA 1GVDA 4HQEA 3F8BA 2LMDA 3BY6A 4L9VA 9ANTA 2QEXI 2HQRA 3MN2A 3TOBA 3I0TA 1IN8A 1KGSA 1R1TA 3LL7A 2M8EA 4LFUA 2WV0A 5D6FA 1G59A 4ESFA 2CV0A 2X85A 1BIAA 5FROA 3QAHA 1XMKA 2JT1A 1YQAA 3CP8A 3EUAA 2VL8A 1WGXA 2OZUA 3DPUA 2VQCA 3I59A 3C18A 3IH2A 3FXJA 4XRFA 3MKZA 4DJAA 1TP4A 2ZMEC 4B09A 2DPUA 2E5ZA 3L09A 3KZZA 1YFHA 4FTHA 4FE7A 4UUSB 2EZIA 3Q0UA 2R7SA 4FHTA 1MZBA 3H9GA 3ZMVA 4QTRA 2VI6A 5EEHA 3P9KA 4ZC3A 3LAPA 1W36C 2V6CA 3WG7H 2KRFA 4RMNA 1SEUA 2K4JA 3WTUC 3V8KA 3H35A 3KZIC 2X51A 4A6DA 5BMZA 3CD6I 3OY9A 4WCGA 5L3DA 1V5FA 3BG5A 4EJTA 4YIFA 1E17A 2BY1A 2WAFA 3BZCA 2Y0SA 2KJBA 2STWA 1ZKGA 3ZN1A 1WI3A 2O8KA 3DFGA 1WH5A 1MMNA 2FJ1A 2XKPA 2PQ8A 2VOPA 3KEOA 1HW1A 3MEXA 5LD2C 2BW3A 2JJ7A 3QOEA 1WJEA 1HW2A 1UMQA 1WI9A 3REOA 1WJAA 1S9HA 2X48A 1HQCA 3JRFA 1YX3A 2LK2A 1H88C 2XV4S 4U0YA 3IAS2 1XMAA 2HGCA 4E7JA 3M7GA 3E6DA 5BNGA 5HVQC 2HYJA 3KEQA 1XGOA 4CCMA 3CCRI 1BJZA 1FYMA 3GTQJ 3S2DJ 3GTPJ 1OCCH 2JMWA 3IP4B 1K4TA 2COBA 3DEWA 2K7LA 1U5TC 3R60A 1Y1WJ 3PQKA 5JLWA 5CJ9A 1I27A 3DBHB 1B4AA 2DI3A 1FY7A 3CCMI 3H5NA 1A6IA 2E5NA 3PJRA 2XPUA 2RN7A 4A3FJ 3HSRA 4F92B 1VQ8I 4IX7A 2HFHA 2XF6A 3EDPA 1JTYA 4PSXA 4CCKA 4DZJA 4A93J 5FGMA 4ITVA 1UFMA 3GTJJ 1JKPC 5K5RA 1X2MA 2R93J 4D0PA 5DCFA 1XS9A 3J7AY 3CQZJ 4OU0A 4BE0A 3NWTA 1BW5A 3QWLA 2FUG2 3LSPA 1DPUA 4I99C 4MLOA 2V6EA 2FOWA 5FD5A 1LVAA 2Z5UA 3SHFA 1BC8C 3S15J 2UWMA 1IDYA 3NWSA 2Y0SN 3I59B 4B3AA 4HV5A 1KYWA 2W82A 2STTA 3MZHA 3CMAI 1G6NA 1QGPA 1CF7A 1ZHFA 2ME6A 3TO9A 1VI0A 4L0YB 5F0HA 5JVTA 4B43A 4LJZF 3HDDA 2BBYA 3WTSC 3RDIA 1FIAA 2DT6A 3KP3A 1V54H 2DA7A 5HLGA 4A3GJ 5JR3A 3ZN0A 3BZ6A 3CC2I 4M71A 4LITA 4MFDA 2W00A 2IJLA 4A12A 3GMEA 5CLSA 5J4VA 3CCVI 2JA7J 1D5YA 3KP5A 5E1XA 4IHTA 3OYIA 3S17J 1FLIA 5D8KB 1MD0A 4LOCA 2DN0A 3FZVA 3S3OA 4IRIA 3WG9A 5FLMJ 2LBFA 2FMLA 1FP1D 4B47A 3W6VA 5D6EA 2MH9A 3AG3H 3I58A 3PUBA 3DU5A 3ELKA 4BXXJ 4BKXA 1TWAJ 4ON0A 2BW3B 2YX7A 2CSOA 2PG4A 4NC6A 5GPAA 3S93A 2H6BA 1FIPA 3K1NA 4CGZA 3HGGA 4BUPA 2W48A 3N05A 1OCOH 1HA8A 2BY0A 3LFUA 3H0GJ 2ELJA 2XF5A 3M4OJ 2L4MA 2P0WA 2JA2A 4G9YA 5FLVA 5EEGA 1RR8C 2GZWA 2HDWA 1Y0UA 1VQMI 2VT2A 2L9NA 2HTJA 2LY2A 1ITYA 1R23A 3TW7A 2ELHA 2XAUA 2CG4A 4UNOA 1LDKB 1EF4A 3IHUA 5DUIA 3ZQCA 3S14J 1U0JA 2DQRA 2TDXA 3K4KA 4DZPA 3ASNH 3RPUA 3JRGA 1O3TA 3AAFA 3N4MA 1ZN2A 1VQ6I 3ML6A 4ENMA 1IW7F 3I71A 4LLGF 2L5QA 2X1DA 3CCUI 3S32A 3L2WA 1P92A 4JX4A 5J8CA 3AG2H 4RLFA 5HLIA 4IQJA 3HOTA 2DODA 2UXXA 4CHUA 2ZSHB 3Q0VA 2YPRA 1FMVA 4KN7X 1QQIA 1Z3XA 1GXQA 3GF2A 3L9FA 2R7XA 1I1GA 3FHZA 2LG4A 3O6BB 4CCNA 5C3EJ 1VQLI 1T6SA 1W0UA 2RKHA 2D45A 1SMTA 3ULQB 1DPRA 5IP6A 4NBQA 2XHKA 3GEZA 3RIRA 2XKOA 3TW6A 3F72A 2F5DA 2XGXA 1IRXA 1XPXA 3M07A 3T0YA 4ZZDA 4YG2F 3ABTA 1B59A 5L3GA 1U9OA 4HX8A 1TNTA 3I54A 4FASD 2W85A 2K9QA 4FCYA 1LPQA 2GOMA 1HXDA 2LR8A 1RRJA 3C1DA 1MMGA 1UJ8A 2KDOA 1V55H 1AHDP 1FBUA 2E7WA 1MDMB 3ZGKA 4L5EA 1R4MB 2MYSA 4OIOF 1HDPA 2DQLA 2MD5A 4M73A 1P4XA 3RQIA 2OV7A 3H36A 2VC1A 1FC3A 1DUXC 3DV8A 3E5XA 2YSRA 1SFUA 4NC7A 1RUNA 2F6CA 3H5RA 3N97A 3BR1A 1JJ8C 2RREA 1HF0A 4E4HA 3UNGC 2A6EF 4WF2A 1L3LA 3S3MA 3B6AA 1XN7A 3EYIA 3T8RA 3IAM2 2GWRA 2KZGA 1QHGA 2DDBA 1TW3A 2M8GX 3M8FA 4MTDA 2LBFB 1WZ2A 2Z3YA 2RQQA 2XUBA 3RKXA 4UHTA 2COMA 1Y6IA 3IH4A 5EDNA 4U0VA 3QRFF 5E1WA 3WE3A 3KYLA 2V9KA 4LB5A 2AS5F 3WU1B 1VQPI 1LFPA 2HOTA 5E18F 4UB8C 3CUOA 1ODDA 1OCRH 3X2QH 5C4JJ 1W5SA 2ESHA 5IT3A 2JVGA 2JN6A 4L9TA 1NH3A 2C6YA 2H8RA 1FOXA 2XB5A 4KT5C 2ECCA 2DFHA 3E0JB 3OYHA 2QKMB 3LSJA 2Y31A 2VT3A 4N4OB 3TDUC 2WC2A 3BWGA 1A35A 2R5ZA 2A07F 1UZCA 3BJAA 2EJRA 1B8IB 2PI0A 2FU4A 4AIDA 1W7PD 1OYIA 2IGNA 4RAYA 4P5OA 3E5QA 5F08A 4KN4X 4K2EA 1B9NA 1YS7A 5EJCA 2XC7A 5CVJA 2R7RA 1ZG1A 1IXRC 1WJBA 2JA6J 4XR6A 2H1KA 1ETWA 1T0FC 4IKFA 3ZMZA 1BL0A 1SFKA 1YIJI 2M1BA 1ETXA 3HSEA 4LIVA 5DYMA 1ZLKA 1ZGJA 4J00A 5BPDA 1U8BA 3JR9A 4AVZA 3OIQA 2PMZN 4FE4A 4IHXA 1FEXA 3S1QJ 3WTVC 2XRLA 1TQPA 2HDCA 2OD5A 5ICEA 3LSTA 2K9LA 4GYGA 4R79A 4G7ZF 3FXUA 4Y4RA 5KCMA 5FD6A 2IA1A 2Y48A 2Z33A 3CJQB 1R22A 4L0ZB 1F9NA 1OCZH 2XSDC 5K5QA 1HC8A 1VQ7I 4KUMA 1TC3C 4GRIA 5CVVA 3ZMDA 3FMRA 4I0AA 5IOZA 1G3TA 1JUPA 4B8XA 5J47A 3RCOA 3AFHA 1JJ6C 1ZRCA 1D1BA 1TWCJ 2QA4I 3NRVA 3TDZC 3G4SI 4PGHA 2BE5F 3IKTA 3Q9VA 2K85A 2V79A 4UV9A 3S8PA 2R7QA 4G6QA 2JK3A 2EIMH 3CLOA 1OCPA 2PMUA 4KFCA 1A04A 3A0BC 1JTXA 5LBQA 1FTZA 2YUSA 1H0MA 2KPMA 1D0YA 1D0ZA 1HLVA 1YOVB 1XDUA 3WU2C 3IV5A 3G73A 4EMSA 3FXKA 1IRZA 3HG9A 1G3WA 4B44A 4P9UA 1W1WE 3HIFA 1MBGA 4BAYA 3QYFA 3BR2A 3HHGA 4E6KG 4OWRB 3EYYA 3AG4H 2CUFA 4IHWA 4IPAA 2VQGA 1J2XA 3HOZJ 1P4AA 4XIDA 2OQGA 3MCZA 5FLXZ 3ABUA 4D9JA 2OBPA 1NHAA 4EGYA 1Z9CA 4G8XA 3NEUA 2CW0F 4O3MA 3IWZA 3PNVA 3G3ZA 3OYNA 5F6FA 4BGDA 1VFCA 4I7HA 3TQNA 3D1NI 1REPC 1QZZA 2HOEA 2M0CA 4E7LA 2QSHX 3M9AA 1BC7C 2KRHA 1BI1A 2D1HA 2NS7A 3FXLA 4JOMA 3FF5A 5KVRA 2R5ZB 3QPTA 4M3BA 2GA2A 1WHUA 4HYEA 2CS3A 4HF0A 3NARA 2B9SA 2NRAC 2NVXJ 1JXSA 3FHNA 2CQ7A 1IN5A 3FXMA 4NUBA 3E7LA 3ABLH 3WTWC 3GWZA 2G9WA 2BXZA 3M1EA 1SFOJ 2XB0X 1E0EA 2HWVA 1D5VA 2FBHA 4PDKA 5M5XJ 5F0FA 4IHSA 4H0EA 4BU2A 2JPBA 5M3MJ 4HDVA 2VQHA 3HEFA 4LK0F 4CDGA 1OCTC 2W84A 4XSZF 5H6RA 2IXSA 3VOEA 2K4BA 3FIWA 4QPOA 4KIGA 5LGUA 3F23A 1S6LA 2GBYA 1E3HA 3QPHA 2XROA 3J80Z 1FBSA 5LLQA 2E60A 4XLNF 1QBJA 3V4GA 1A6QA 2DCEA 3P7NA 2WTEA 4M6YA 4XL9A 3OOPA 1AKHA 3WGIA 1D1AA 4P1WA 2FXAA 1ZAOA 2MD0A 2A5YB 4IJAA 1FPQA 2BVLA 1ZARA 3ERMA 3JRDA 3BPVA 4L5IA 1SMYF 3KPHA 1WJCA 2IS2A 1STZA 2O6GE 3VPRA 4D1QA 5F0CA 3HSFA 2O61A 1Z05A 3HZJA 4A3CJ 2W57A 4DQ2A 4UB6C 3OR1C 5DEQA 1OR7C 1BJAA 1WJFA 3S1NJ 3I64A 1XMXA 4G6DA 3T1BA 2VJ5A 2XGEA 5J1RA 2BY2A 2LKXA 3QOPA 3F3XA 3DTEA 4MHGA 2EPFA 4HDUA 1ZG5A 1RUOA 3GYHX 1RKTA 4U7DA 2UV1A 2YR2A 1RR7A 4WXHA 2M34A 2EA2A 3CUQC 1IXSB 3ZP5A 2O8XA 4PFOA 4PJLA 1XB4A 2IBDA 4Y7NJ 2WWYA 3I53A 5LGNA 1ETOA 2AHQA 3LFKA 4M6VA 4BHCA 1K79A 2QWWA 1ONVA 1SD4A 3CJRB 3SFIA 5F04A 3KLNA 3SDBA 4G7OF 5B1AH 5D4SA 2ISYA 1IGNA 2K9SA 3IL2A 1T33A 4EV0A 1Q1HA 2EV0A 3K9TA 1ZYRF 2DBBA 3FMQA 2XRNA 2EK5A 2HEOA 1YYVA 2P5KA 4YFNF 5IOYA 2RGVA 1BN5A 3O2PE 3E5UA 1LDDA 2K9NA 1BR4A 2H6CA 1J59A 1S8NA 2DMNA 2F5FA 4BY7J 2V1NA 3D5RC 3ZQ7A 2QBYA 4MGRA 1JI8A 1TNSA 3CDHA 3L2UA 3E3VA 1MMAA 1UG0A 1FT9A 1HKQA 4I01A 5TISC 5EEAA 2NAZA 3HOSA 3OSGA 4EQQA 2QQ9A 2MABA 1XSXA 1NK2P 4AM3A 2ZXWH 1HKTA 2ZMEA 1ZTRA 4F3QA 3VFZA 4IOAF 4XM3A 3V7SA 5IPAA 4N4NB 1W0TA 1D3YA 1S7OA 1X3UA 1YW9A 3A03A 3OL4A 4C2MJ 1IC8A 2P4WA 3IWFA 2DMUA 3ZCOA 2E2IJ 1F4KA 3HOXJ 2LDUA 2F4OB 2VBXA 3RPUD 2FE3A 4F91B 2WBMA 2YU3A 1LVKA 4II3A 5CQEA 3PUFA 1QA6A 1HOMA 5E79C 3CUQB 1AKHB 3FXRA 2JTVA 4MNUA 1VQNI 2AXLA 3BTLA 5CVIA 1IG7A 3KE2A 2L0KA 4CO8A 1U9NA 3IH3A 5IP9J 2UZKA 3BT9A 4QPQA 2NS8A 3ZR8X 2Y69H 2JSCA 1LDJA 5B1BH 1WH7A 5FLXK 4Y15A 5J1UA 4BE1A 2PLYA 3MZ8A 1R1UA 3FMSA 3OYLA 4UV8A 2CYYA 2LH9A 4BQNA 4IVNA 3LSIA 1SANA 2CUZA 2DOAA 2HNHA 2UXNA 2FF4A 2WAQN 4B3XA 4E7SA 3J7AO 2HQ5A 3AL0C 2M4GA 4HNUA 2V9PA 3FX3A 1VQ9I 3SFZA 4WXCA 1MBFA 1QNTA 2ESNA 3BCBA 2KDZA 2VUMJ 1U5TA 2DK8A 3JSPA 2KIFA 4S04A 3JAMZ 4QLCU 3GO5A 1IXCA 5DDGA 1XCVA 1T08B 4MQVA 3BC8A 2ME0A 1K78A 3SEQA 5E3OA 3I5UA 2KZVA 1LFBA 1FOWA 4QIWN 1FMWA 2VKVA 3WTZA 3GTOJ 2EFOA 3BTIA 2CQNA 2VBYA 4C2UA 2A69F 2NOJB 3HM5A 1R9TJ 3O8GA 2DPDA 2XDVA 1ZLJA 4A5MA 1YI2I 3U9GA 1WFXA 3J80K 1U78A 4C3IJ 4NC8A 2GIVA 4BEHA 2DLLA 2RAEA 3ZQIA 4KMFA 2XAGA 4JK1X 2QBYB 4IHYA 3CCYA 1YO5C 4M9XA 4NHJA 2HVQA 2GQQA 5HOOA 1KU7A 1E2XA 2CV1A 4U0WA 3VB2A 2PJRA 2NVTJ 2HYGD 4A3MJ 4LMYA 1KU3A 1CQTA 3VSKA 4IRHA 4M3EA 2IVMA 1X1CA 1YX5A 2VJIA 2ZMEB 2AXTC 3HRSA 1G4DA 3BP8A 2H27A 4BS9A 2RNGA 4UUVA 2PX9A 3KZYA 1TQIA 2LKSA 1LKXA 2ICWG 2IA0A 3CMYA 2QM3A 3HKZA 4UVCA 3H92A 1RKWA 3MVPA 3K1PA 1VQOI 2H1LA 1BBYA 2OAZA 2M5WA 1MJ9A 2DA6A 1MJBA 4CUGA 1A5JA 1O7LA 1O7FA 3DF8A 1FJLA 3LQQA 4B4CA 2GM4A 3CCJI 4EM0B 4GXOA 2KQRA 4HV6A 2DMTA 3VDXA 3BCAA 2VONA 2G7HA 4XLHA 1RNLA 5LHIA 5B66C 5IP7J 1WVRA 2O7OA 2Q0OA 1A36A 5DM6F 3BROA 4AU7A 3Q3SA 1JGGA 3RTRA 3RYPA 1S7AA 4XLFA 3G71I 1S29A 3QODA 2CWEA 4LG0B 2B0LA 3EUKL 3P9IA 1F36A 4E7ZA 2HI3A 2F4IA 3DEEA 1R5GA 3ASOH 1JE8A 1XG1A 3GFIA 1IAWA 2DOEA 3GFJA 1YTYA 3MFKA 3O3KA 1ERDA 1MDMA 1F1ZA 3LNQA 2RDPA 3RQ4A 3AG1H 1Y56A 2W25A 2R4GA 4XKVA 3WODF 4U87A 2NXNB 5EGOA 2QSFX 3ZMUA 3TL4X 5AIQA 2WY7Q 5GP9A 2ID3A 3WE2A 4L5JA 4X6AJ 1ENHA 2B7EA 5HODA 2DFIA 3QPLA 1U5TB 2VJJA 2MH2A 5AIPA 4J19A 2K5CA 4Q47A 2A05A 2ZXJA 2RVCA 2M87A 1MSFC 3HYIA 2KL4A 3L2QA 1BOBA 1ETYA 2G0EA 4C2TA 1K78B 1H9TA 1F5TA 2V1UA 2PFBA 3PO2J 2I8DA 1NK3P 2QKLB 2IRFG 4ABZA 4PFPA 4ESBA 2FRHA 1UHMA 1AU7A 4F52A 4ZDLA 2P5VA 3O8HA 4KITB 3D0SA 4EM1A 1R5HA 4BHBA 4EM2A 4BEHB 1VQ4I 2EZKA 3JREA 1QU3A 2DXIA 2KMUA 1B8IA 4DYCA 5DD8A 5HLHA 3K70C 2BV6A 3U21A 3OYAA 1O4XA 5EG0A 3OYFA 1FTTA 1X4PA 3EETA 4DBRA 3FM5A 4XLAA 1EH7A 1MGTA 1OPCA 4M72A 3HOWJ 5LHHA 2PJRB 2L3DA 4BJTA 2Q2EB 4M74A 1WPKA 3RJPA 2VODA 5LEKA 4FISA 2IT0A 1QPMA 3ZOBA 3TO6A 3I4MJ 4MEYF 1ETKA 2BY3A 2RV8A 2VXDA 3P9CA 5LRRA 3OS1A 1SVOA 2ZXIA 1YS6A 4L9NA 5ICGA 1WRJA 3SQNA 1JKOC 2BHZA 1SFEA 1YG2A 2IS6A 3VEPA 1YW7A 5CYVA 2BZTA 2WB1A 3M8JA 2K9MA 4IO9F 1RIOH 1YW8A 5JLXA 4CICA 4D7MA 3QQAA 1Z91A 3D5SC 2DA3A 4HLXA 2VKDA 5M3FJ 3DLLF 2YS9A 3KP2A 5HLTA 2OUMA 5GAEJ 2QZ8A 1N78A 3VYRB 4DYQA 1EKEA 4I2OA 2L2OA 2BGCA 3K4JA 3C2BA 1RETA 4ZTJA 1WJ5A 4RB3C 2ETHA 3SJMA 3L00A 3CJNA 4GCVA 5LGTA 2IGOA 4MIMA 4ZYAA 3G1OA 4XRSG 3DEUA 3NQOA 1FNNA 4QSHA 3UR3C 4WK8F 3WTTC 3HOUJ 2OF7A 3B73A 3GXOA 2ZSIB 1OYYA 5EGOB 1XGSA 2HR3A 2NYXA 3GFMA 5F1RA 3OYDA 3BDDA 3H9JA 2DTZA 3A0HC 4YRVA 3BTCA 5A2QZ 5EZGA 1MNEA 3P5JA 5LFAA 4S05A 1JUMA 3H9QA 1N75A 1T98A 1Y39A 2XAHA 2X6WA 4D5CA 2FQ4A 1TT5B 2F5EA 1TLHB 3WHCA 1NTCA 1X3WB 1X2NA 4EATA 2L9RA 2JRTA 1T0FA 2Y2ZA 4A2UA 5K7HA 3L2CA 1YE9A 2M7BA 2IGMA 2Y9YA 4DIQA 2H8WA 1TL8A 4EJUA 1GV5A 1NG7A 1Z1DA 1BI0A 1SAUA 3ROUA 5E3LA 2Y75A 1ZR4A 2QENA 2A3SA 2NOGA 3BJ6A 3M1CA 5LHGA 3K10A 4JX6A 1F43A 2E34A 3OIPA 2ZNYA 3W6KB 2FOKA 1N77A 1FOKA 1GXPA 2EB7A 3CC7I 2MLKA 4PGGA 4AVPA 3DXJF 4UVBA 1P6RA 2L9SA 4HAMA 3TEDA 3QU6A 4V2FA 5EG0B 3H1CA 4WX9A 1SD5A 3C2GA 4KJZA 3OYGA 5BPIA 1IDZA 2LSOA 5FFZA 1DP3A 1KYZA 2GXGA 3G1MA 1TQMA 4N0BA 2LVSA 5K7ZA 3V8LA 2HXIA 1LQ1A 2KHMA 3CDIA 1OJLA 4E7HA 3R4KA 5M5YJ 4OIRF 1J0RA 2NNNA 3F22A 2OU2A 2E1MC 2DA4A 1LE8A 4D7NA 3PSIA 3GTKJ 3MKWB 3CMMA 1I1SA 2NVYJ 3JTGA 5TGTA 4IZZA 3HOYJ 1MW7A 2QVOA 4O5VA 5CVRA 2Q8KA 3LMMA 3HPGA 1J5YA 5E8IA 1MBEA 2FA5A 4A3BJ 4JBAA 3NAUA 4AC0A 3I4PA 1W36D 3LSGA 1QVTA 3BJOA 4BQQA 1ZRDA 3KCCA 5F27A 5TRDA 4DOZA 4XBFA 4OAZA 1J7KA 1K7AA 3OR2C 4LK1F 5FB2A 2L4AA 3L2VA 2MLGA 2FNPA 1KQ8A 3CMEI 1KU9A 2JZYA 2DOFA 1KA8A 2ZKZA 4FX4A 2P7CB 3MWMA 4DGWB 4XN0A 2HPMA 1I6XA 2IP2A 4XOTA 4HQMA 4TV7A 3H5AA 3FKJA 1PUEE 4GFBA 1BA5A 3S2HJ 2KISA 2Y0MA 4Q48A 5DTDA 4H4KC 3AKZA 3DWLE 1DQUA 3PNYA 1U3EM 1Z6TA 3FBNB 2JRMA 4MQ9F 2DYRH 3DP7A 3SEZA 4HNVA 2VN2A 1TBXA 1O57A 2MBFA 3V8JA 4CA0A 4CCJA 4OAYA 3DCFA 3CC4I 1JGSA 1GV2A 2OA4A 1OQYA 3A02A 1ZGWA 4RB0A 4BXUA 1IF1A 5E17F 1P7JA 2OTJI 2OCEA 4KMUX 4XKBA 1P4WA 5GPCA 1ZQ3P 3L7WA 4GGGA 1MBHA 4LD5A 2V1DA 1JT6A 3HRMA 2CJJA 2KIQA 1LEAA 2HZDA 2Z2SB 2P7VB 3KYCB 5CKTA 2HQNA 4BY1J 2E1MB 1WWXA 3WGHA 1V5EA 2ACJA 4IHVA 4OIPF 1OYWA 3SZGA 2V1XA 4Q4ZF 4MFEA 4QWQA 2FBIA 2E35A 3BR6A 3I56I 4PJ0C 3BQZA 3FDYA 4NNJA 3W2WA 4I02A 4ASNA 4KA4A 3WU0A 4AYBA 2OQRA 2VE9A 1U6GA 2XGCA 2R7VA 3JRIA 4YFXF 4OMZA 4RGRA 3U1DA 5JFRA 1XTAA 2TCTA 5J3LA 1D8KA 2XAJA 3MMYB 1OR7A 2QQBA 2XAQA 3BG9A 2R7FA 1CGPA 2BXYA 4AIJA 4ZTFA 3FKIJ 2IA2A 1XSDA 2MG4A 2IGKA 5JI6A 1MMDA 1D8JA 1BR2A 3JTHA 5FJ8J 1FSHA 1DGWY 2EINH 3OMYA 2LREA 1IRGA 4LGWA 1GHCA 4I6ZA 1XC5A 1ZG3A 4ETSA 1FZPB 2PN6A 4IL6C 3T5XA 3OYEA 1POGA 1LE8B 1V3FA 3SDGA 3J81Z 4Y13A 3OYMA 3CUQA 1ZRFA 2O9LA 3GTLJ 2R7DA 2X6OA 4BJ5C 4CZCA 2ZXHA 3PNTA 3HBLA 4I98B 3JSOA 5F64A 2IEKA 3ZQFA 3TGNA 3HRUA 1ETVA 3DLAA 3V42A 2XVCA 5JHFA 3K2AA 4MEXF 1FSEA 1GLNA 3TBIA 4E70A 3HRTA 2K02A 2LRDA 4RS8A 1IN6A 3K1MA 2K3PA 2DT5A 3CP2A 5HS9A 4XORA 1EH6A 3HUGA 3HHHA 1G3YA 2CH0A 2ZNZA 3KEYA 4KIFA 2M3AA 1ETQA 2EIJH 3DKYA 5FKNA 2XF7A 1UAAA 1SD6A 1RC9A 3F8NA 3I3LA 4XKWA 1XGNA 3BG3A 2VXZA 3FK7A 3OWTA 3GFLA 4V19K 2QLZA 1XCBA 1EA3A 2P5LC 3E97A 2IS1A 2E1OA 3TMOA 1X3ZB 3JRHA 3VODA 4LB6B 2WY8Q 5D5VB 3OYKA 1JKQC 1HSTA 3KP6A 5D8LB 3EUHC 4BQOA 2R0QC 3MD2A 1UHWA 3K4LA 1R1VA 4O6JA 1XD7A 1MMSA 2VKEA 5HS8A 3ZQQA 4KIBA 3KLOA 3I4NJ 1VQKI 1W5TA 1R6RA 1JHHA 5DCMA 3S3NA 4JX5A 2DFEA 3G6EI 4V2GA 2BEOA 5FKMA 2Z9OA 2X0LA 2ZFWA 4GDFA 1SVLA 2MSYA 2QQAA 2DT7B 4FT8A 2LF7A 3PL8A 2TRTA 3OIOA 4C30A 1DU0A 1WKMA 4IQ4A 4C3HJ 3LSMA 5IT9Z 1TZLA 2PMHA 3F0CA 4BDZA 3CCSI 2E1CA 3RZDJ 3GTMJ 1K6YA 1LUJB 1O3QA 4AWXB 5IYCJ 5D5WB 1IUYA 2HKOA 2CW8A 1IV6A 1PUFA 4L18B 1SC7A 2A6HF 3R0JA 4CCLA 3TOAA 1HCRA 1MNMC 1FP2A 3IRRA 2X1CA 3Q5FA 2F2EA 2LY9A 4UUTA 2E2HJ 4F55A 2VKHA 3G2BA 1S72I 2JQ7A 3PFIA 3H3VK 3ABKH 1GVJA 1MBJA 3PO3J 2EFQA 1T2KA 1W5CC 2Z99A 3VSLA 2DFFA 2Y9ZA 1V5GA 2WADA 2DO7A 2H09A 3MKYB 4FQGA 3LSHA 3BG6A 3BLYA 4WWCA 1T8IA 5K5OA 4R1HA 3OYCA 2BVMA 1X1PA 3R61A 4M9ZA 1YRNA 1ZH5A 2W4SA 5D5UB 2WV1A 4YIIA 4P55A 3K2ZA 4RGUA 1TW2A 2ZC2A 4PJMA 1LNWA 4M6XA 1UB9A 3RZOJ 4ZYGA 1SVMA 2MA3A 1B72B 2L7ZA 2JUCA 4HEA2 3OOUA 3BTJA 1D0XA 3DQVC 4LG0A 3GX4X 1S3JA 1Z77A 4U88A 5CVUA 2R3SA 2V4JC 2Z16A 4XRMA 5L3EA 2L54A 1R58A 4KICA 2DTRA 2QGUA 2RNJA 2ZCWA 3RSNA 2GA1A 4P9FA 2ZBKA 2V9VA 2HXOA 5HDKA 4CH7A 3HUGB 4HX7A 1OLTA 2F48A 2GAUA 4BBRJ 2MC3A 3BOQA 2XAFA 2MW8A 2LY1A 4AIHA 2EWNA 1DDNA 4AIKA 2JUGA 3ZQGA 2X1EA 3W3CA 5IY5H 3OV8A 1XSVA 1VTNC 4BJ6C 2ZJQF 4HF1A 1J75A 2HVSA 5FKLA 5KK1A 1ZELA 3D5LA 1BR1A 4ZH4F 3A2KA 5D5XB 3CDLA 3CCEI 2L9VA 1EV7A 1MBKA 4XRSA 2KFDA 3VYSB 3PFYA 2O5RA 3C3WA 5DCMB 1PP8F 2LYCA 1TWGJ 3HB9A 3K4BA 1UCRA 3KX2A 4Z6YA 3Q9SA 1RESA 1M1EB 1IO2A 2DU9A 4JQFA 3OYJA 4YELA 1T56A 2LOOA 3FXQA 4Y33A 5FKOA 4HA8A 4RB2C 3E6MA 1HKSA 4NB5A 3J81K 2DK5A 2VE8A 4XICA 1ZK8A 3C7JA 2ISZA 4NQWB 2LFBA 5GADJ 5GAGJ 2DW4A 3W2AA 4A0YA 5F1JA 3MQ0A 5IYDJ 3L2RA 1W7PB 1HSJA 5BS6A 5IYBJ 3GLLA 1PUFB 2CFXA 2Q2EA 4RGXA 2J5OA 2E7XA 5DD4A 1R49A 1R71A 3M8EA 2P8TA 3R6SA 2X4HA 4E7KA 1LJ9A 4A3EJ 2QUFA 1GUUA 2W1OA 3DBLB 4OOIA 3HOVJ 1T39A 1KZHA 3S16J 5L3CA 2GLOA 4ENKA 3PIOF 3OSFA 4PCQA 3CF5F 4ESJA 2M0MA 3PSFA 2MFZA 3S2WA 2AQFA 1QRYA 1BI2A 1V4RA 4EGZA 2LKPA 1BW6A 3ESWB 3AL0B 1YRNB 2Y30A 1OMIA 5FFXA 4RM3A 5CQGA 1ULYA 2EA4A 2IPQX 4CYCB 4HZFA 4ZJZA 2Z1DA 3FWEA 1IJWC 3DU6A 2JVHA 5JVGF 2JA5J 2VASA 1BI3A 3VYUB 1JUSA 5BQTA 2KT0A 2E19A 1YJWI 2CQKA 1LFUP 2V26A 2KIUA 2HDDA 3QP6A 2PBIA 4HW0A 4XLPF 2R7WA 1E3OC 2ECBA 2E71A 3K6GA 4GYIA 4YIRX 2VLAA 2CMPA 5EYRA 5H2FC 2DJIA 1FWZA 4NDLA 2YU9J 4PUSA 4OIQF 5IT9K 2HPIA 2NNYA 4RGSA 1XDSA 1USSA 3WGGA 1Z3YA 3LSRA 1P2FA 5B3SH 4DW6A 2OZ6A 2BYVE 2DA2A 4EJOA 1Q1VA 2PJPA 3E6BA 3GLXA 2QYOA 2R7OA 1YHQI 2V7FA 5ICFA 2CUJA 2FEZA 2ID6A 2FD5A 2I5UA 1R00A 1PJRA 1U2WA 4KT6A 2R5YA 1Y1VJ 3GUDA 5HNHA 2CO5A 2XSJC 4I09A 2CRGA 4EEFG 1PVEA 5HDNA 1Z7UA 3PM1A 2IW5A 3ZRGA 4B1RA 2HU9A 4CCOA 2ZFUA 1TT0A 4KNYA 4Y52J 2EBIA 4A6EA 2EV5A 3HKZN 1G3SA 1EJ9A 1P9QC 3B6CA 1YLFA 1RZ4A 1MJAA 3GZNB 2OCCH 4N9IA 2HOSA 2DA5A 1RI7A 1FBQA 1KQ9A 1X1DA 3FBIB 3CJTB 3LQRA 4XN3A 2R7ZJ 3KFWX 2QCOA 2W24A 3ISPA 5ED4A 2X6YA 4XOPA 3BZKA 3CF2A 3PQJA 4A69C 2OTLI 3SXYA 5M5WJ 3KP4A 4LIUA 4CZZA 5L3FA 1VZ0A 5E3NA 5ILVA 3L1PA 1QHHD 4C3JJ 2EILH 2XPWA 1X1BA 4XKCA 3SZPA 4ZDPA 5GTHC 5J40A 1X1AA 1OKRA 2J5PA 2P6SA 2NVUB 1ON1A 4A3IJ 1TWHJ 6PAXA 5E20A 2R7UA 3DKXA 3F8MA 1OFCX 3MAJA 2VOOA 3JRCA 3EPZA 4RM2A 4BE2A 1H8AC 1I39A 3F6VA 4XMYA 3DKWA 2P81A 2L7KA 1FYKA 5KAIC 1ON2A 2EQRA 4UY8I 2WA0A 1G8XA 3BQYA 3S1MJ 3ZQLA 1VQ5I 2DYSH 3JAMK 1MSEC 2HOAA 1I3QJ 1YJ9I 1Y0NA 4BL0B 2LP0A 5K1YA 3K4CA 3BPXA 4XQFA 1ZR2A 2DDAA 4G6TB 1TWFJ 4HSTA 2HQAA 4HSRA 2E1NA 5DUKA 4KDPA 4JYKA 4E7IA 1AA7A 4LLLA 1K61A 4RAGA 2X9DA 3CLQA 3KP7A 3ZMSA 1IV8A 2KP6A 2KJCA 3ZXSA 1J9IA 4CSWA 4A3LJ 2A5WA 2M45A 4LG3A 3JW4A 4N9HA 4ZYEA 3S1RJ 3BR0A 5C4XJ 4A0XA 3ZMTA 2CGPA 1HW5A 4L9JA 2A68F 1Y8RB 4X1EA 2BHYA 1ORKA 2L7MP 1X4OA 2EIKH 5E8GA 4OMYA 2LNBA 2QSGX 1CF7B 3TKYA 4CXFA 3ECHA 3LA2A 2H94A 4M3DA 2FBKA 3RKWA 2ZO4A 2F4MB 5J6XA 4M3GA 4FETA 3PIPF 5HDGA 5D4RA 3DPLC 2G7UA 4S0HB 2VQLA 1QZEA 4PZJA 3RKYA 1MIJA 2R5YB 2PMZA 3DBRB 2ZJRF 2FNAA 2M4KA 4MTEA 3ZQHA 4ANJA 4YFKF 2GXAA 3QPSA 3IKVA 3ECOA 1K4SA 4HF2A 1I6HJ 1KONA 3I55I 3FM3A 2IS4A 1I3AA 2LTPA 2CQXA 1T95A 3LOCA 2D5VA 1ZGAA 2Q1ZB 3MZYA 2KLOA 5ILSA 2W7NA 3HGYA 4ENNA 1XX5A 2EFNA 3LAJA 2WB1N 1QZYA 4DBQA 1LB2A 1SFXA 2L01A 4C9YA 2R92J 2HVRA 2ELKA 3GZ6A 4I76A 1JT0A 1B9MA 4JP0A 3V7RA 5FRMA 3OL3A 3H3ZA 1K83J 1LEBA 4RB1A 1Z21A 1SAXA 1UG2A 5H6QA 4PSWA 2RQPA 3HTUA 4RDUA 1P7IA 2QF7A 2VB6A 3F6OA 1Y8QB 5HNFA 2VIXA 4CYDA 1KU2A 4MO7A 3C2HA 3Q0WA 3U2RA 2NVQJ 3K4NA 2F5VA 3F8CA 1MNDA 3GZ5A 4P96A 2DMPA 2GIZA 3TO7A 1R4NB 3RI4A 4ZYHA 1I50J 1L0OC 4J01A 4HOBA 4RAFA 1XGMA 5E1ZB 4BXFA 2M7AA 2IAIA 4AD9A 1X19A 5HS7A 3E1SA 2MC4A 2L02A 4WXDA 3FK6A 4A5NA 4HPQA 2XASA 3IUOA 3RYRA 3KYDB 1H89C 2CW7A 2LF8A 3GBGA 3HC7A 1KQ0A 1J09A 2I10A 2YX4A 3VYTB 4W1UA 2L7FP 3F21A 4UVAA 2KIMA 4Q5SF 2B63J 2M9HA 4FX0A 5C44J 2HYFA 3ONQA 3H0DA 4X0GA 1K6OA 5DS9A 2LD5A 4PJNA 2KKOA 3DTIA 3RPQA 2CU7A 4B48A 1BOAA 3K4MA 4XNFA 3J7ZI 5KHDA 2O0YA 4HG2A 2K86A 2M30A 4R8HA 4Z2YA 3UKGA 3A01A 1IUFA 4BACA 2OPTA 2DAOA 3QYEA 2E2JJ 1R5ID 1BIBA 3TP0A 4AUXA 4IOCF 4HRIA 3LA3A 1WSUA 3SZTA 5TJJA 1R7JA 2LC2A 1H9GA 2HS5A 1T38A 4BBSJ 4RBOA 3FXOA 5JHUA 3H3UA 2ZJ2A 1HDDC 4BHPA 3TP3A 1O3RA 4G94A 4IF4A 3IRQA 1IN7A 1MKMA 1X58A 1GDTA 5BOXA 3DPTA 5ICCA 1QO0D 2K40A 1VNDA 1FOYA 1BM9A 4II2A 3SYTA 4U7BA 3F9KA 3T8TA 2GXBA 4D5FA 1WJDA 1DU6A 5J4YA 2PEXA 1EH8A 1YIOA 2NS0A 2VBZA 1JKRC 3JRBA 2EV6A 5B5EC 4BNCA 4XK4A 4ZYDA 2ZJPF 1Z6RA 1W4MA 4BDYA 3E6CC 3OS2A 1ACIA 1PYVA 4IRGA 2DMQA 2F5CA 3B02A 4ENJA 5EZHA 5L3BA 2FMYA 1IRFA 5E3MA 4DYRA 3CCQI 3M3YJ 1N25A 2EFWA 2JA8J 2WAEA 3GCMA 1G2HA 2UUZA 1NG6A 1GT0C 4M9SA 3QYBA 4F93B 3OS0A 1FYLA 2JSPA 3CCLI 1S5LC 1A31A 3G1LA 5DM7F 2LLKA 2VPLA 3ZPLA 1DP7P 2OJED 5FO5A 3BG7A 4GO1A 2DA1A 2AQEA 3VWBA 3JCUC 4XSXF 4HNTA 1Z0XA 2VPRA 2CUEA 4W97A 5A2QK 1AWCA 2MGQA 1RPWA 2KRCA 3EUHA 5ILUA 5DV5A 3A1YA 1B72A 3QU3A 3GW2A 4BYYA 3A4CA 2JPCA 3KIOA 1I5ZA 4Y17A 5EF6A 1VF9A 5FKKA 4UXNA 4M3FA 2VC0A 1OISA 2DJNA 3W6JB 4A0ZA 3FISA 4ZZLA 1DGRM 2D2WA 4YEJA 4RAZA 3WTXC 1APLC 5J8FA 2D1VA 1MH3A 3QP5A 1ZREA 2ADUA 2BOLA 4IXAA 4A3JJ 5KNLA 1QVUA 3HJEA 1QPIA 5K7FA 5FRNA 2O3FA 3LSKA 2HTSA 2K27A 5LEJA 1U8RA 3CESA 2ZB9A 1SD7A 4UUSA 4I0BA 3CO6C 3HL2A 4BQAA 3CZ6A 3V7CA 3HTSB 2FSWA 3CO7C 2R7TA 3OYBA 4AYBN 3A01B 1O3SA 5J1YA 3KETA 2OC6A 2XPVA 1D1CA 2P6TA 3K0LA 1S7EA 1Z67A 2CFOA 2O03A 1R36A 1IN4A 2M2EA 3J7YJ 2XIGA 1PP7U 3MKLA 4RA2A 4EJWA 2JWTA 4EJVA 3ERED 4OINF 1UELB 3K69A 4KISA 2X6XA
chains in the Genus database with same CATH topology
1JJ6C 1TWCJ 1JKOC 3BR5A 2XGDA 2JK3A 4A3EJ 1GUUA 5JLXA 3HOVJ 3K7AJ 3QQAA 4D7MA 1MH4A 1OCPA 3WHBA 2DA3A 2FX0A 3S16J 5M3FJ 2GLOA 1JTXA 2YS9A 2CQQA 1FTZA 3OSFA 2YUSA 4A3DJ 4DYQA 1HLVA 2N8GA 1QRYA 4IEJA 3C2BA 3IV5A 1RETA 3RKQA 1BW6A 4A3KJ 3SJMA 1IRZA 1YRNB 2Y30A 4CYCB 4MIMA 4XRSG 1MBGA 3G1OA 1IJWC 4G12A 1WCMJ 2JA5J 4QSHA 3HOUJ 1JUSA 3BR2A 2KT0A 1UHSA 2E19A 2OF7A 1LFUP 5EGOB 2HDDA 4IHWA 2CUFA 1E3OC 3JRAA 3HOZJ 2EZHA 2ECBA 4XIDA 3BR3A 5EYRA 2DTZA 3BTCA 5EZGA 4CYCA 4NDLA 2YU9J 2AO9A 1VFCA 3D1NI 1JUMA 2M0CA 2EH3A 2EZLA 2FQ4A 4D5CA 3GTGJ 2NS7A 1GVDA 3WHCA 1NTCA 3LSRA 1X2NA 2R5ZB 2L9RA 9ANTA 4M3BA 4DW6A 3MN2A 2Y2ZA 5K7HA 2DA2A 3NARA 2NVXJ 2Y9YA 1Q1VA 1GV5A 5E3LA 1ZR4A 3E7LA 2NOGA 1SFOJ 4JX6A 2XB0X 1F43A 2ID6A 2FD5A 5M5XJ 5F0FA 2R5YA 1WGXA 1Y1VJ 5M3MJ 4EEFG 2CRGA 3HEFA 3PM1A 4B1RA 1OCTC 3FIWA 3IH2A 3TEDA 4Y52J 2EBIA 2GBYA 4V2FA 3HKZN 5EG0B 3B6CA 4FTHA 4FE7A 4UUSB 2EZIA 3Q0UA 2HOSA 2DA5A 1IDZA 2R7ZJ 4QTRA 1AKHA 2VI6A 2QCOA 3G1MA 2LVSA 5K7ZA 2HXIA 1OJLA 3JRDA 4A69C 5M5YJ 3VPRA 5F0CA 5M5WJ 4A3CJ 5E3NA 3BG5A 3L1PA 2DA4A 4C3JJ 4D7NA 1LE8A 3GTKJ 2XPWA 2NVYJ 3S1NJ 3HOYJ 1ZKGA 4A3IJ 1TWHJ 1WI3A 2XGEA 2O8KA 5J1RA 1WH5A 2FJ1A 1MBEA 2LKXA 1OFCX 3JRCA 4A3BJ 2JJ7A 3NAUA 4AC0A 1H8AC 1RKTA 3LSGA 1QVTA 1RR7A 1UMQA 2P81A 2X48A 3JRFA 2EQRA 2M34A 5F27A 2LK2A 1H88C 3BQYA 3S1MJ 3ZQLA 1MSEC 2HOAA 1I3QJ 5BNGA 2IBDA 4Y7NJ 2HYJA 1ETOA 2AHQA 4M6VA 1BJZA 3S2DJ 3GTQJ 2LP0A 3GTPJ 3SFIA 2JMWA 5F04A 2COBA 3DEWA 1ZR2A 1Y1WJ 5JLWA 2K9SA 1IGNA 1T33A 1TWFJ 4GFBA 1BA5A 3S2HJ 4JYKA 5DTDA 1A6IA 1K61A 5IOYA 2X9DA 2XPUA 4HNVA 2K9NA 4A3LJ 4A3FJ 2DMNA 4BY7J 3S1RJ 3BR0A 3DCFA 5C4XJ 1GV2A 3A02A 1ZGWA 4X1EA 1JTYA 1P7JA 1ORKA 4DZJA 5EEAA 3OSGA 2L7MP 5GPCA 1ZQ3P 4A93J 3GTJJ 1JKPC 1MBHA 1X2MA 1NK2P 2R93J 1JT6A 1XS9A 3CQZJ 2CJJA 1ZTRA 4M3DA 1BW5A 4BY1J 3LSPA 4M3GA 4MLOA 5IPAA 4S0HB 4IHVA 1W0TA 3A03A 4C2MJ 1IC8A 3S15J 2R5YB 4MFEA 1IDYA 2Y0SN 3BR6A 4B3AA 3BQZA 2DMUA 3ZQHA 2E2IJ 3HOXJ 3QPSA 2XGCA 2ME6A 3JRIA 1VI0A 1I6HJ 5F0HA 2LTPA 2CQXA 1HOMA 2TCTA 3HDDA 5J3LA 1FIAA 3LOCA 2DA7A 4A3GJ 1AKHB 2D5VA 3BG9A 4MFDA 3BTLA 3HGYA 1IG7A 2WB1N 3FKIJ 2L0KA 2MG4A 1U9NA 2R92J 3IH3A 5IP9J 5FJ8J 2JA7J 3BT9A 2ELKA 1D5YA 2NS8A 4I76A 1JT0A 4JP0A 4I6ZA 1XC5A 3S17J 1WH7A 1K83J 4LOCA 2DN0A 5J1UA 1POGA 1LE8B 3GTLJ 1UG2A 3SDGA 2O9LA 5FLMJ 2X6OA 4RDUA 1P7IA 2QF7A 3HBLA 1SANA 3W6VA 2IEKA 2WAQN 3ZQFA 1ETVA 4MO7A 2HQ5A 4BXXJ 4BKXA 1TWAJ 3K2AA 3Q0WA 2NVQJ 1MBFA 5GPAA 2KDZA 2VUMJ 1FIPA 3HGGA 2DMPA 2W48A 3H0GJ 1I50J 3M4OJ 2ME0A 5FLVA 1ETQA 5E3OA 2IAIA 5FKNA 1LFBA 4QIWN 1ITYA 3TW7A 3BG3A 3FK7A 2VKVA 3GTOJ 3BTIA 1EF4A 3FK6A 3ZQCA 3S14J 2E1OA 3JRHA 4DZPA 3JRGA 3HM5A 1R9TJ 3O8GA 1H89C 1JKQC 3GBGA 2I10A 2R0QC 4C3IJ 1U78A 4W1UA 2L7FP 2RAEA 2B63J 2M9HA 2VKEA 5C44J 4JX4A 3ZQIA 3I4NJ 5DS9A 4JX5A 3Q0VA 2LD5A 4IHYA 4V2GA 3CCYA 2CU7A 5FKMA 2MSYA 5C3EJ 2TRTA 3OIOA 1W0UA 1DU0A 4A3MJ 1CQTA 2NVTJ 3UKGA 4C3HJ 4M3EA 3A01A 1IUFA 2OPTA 3F0CA 5IP6A 2E2JJ 3TP0A 4AUXA 3RZDJ 3GTMJ 3TW6A 3CMYA 5IYCJ 4BBSJ 1RKWA 3MVPA 4RBOA 1U9OA 1IV6A 1PUFA 1HDDC 2K9QA 3TP3A 4FCYA 2DA6A 1HCRA 1A5JA 1MNMC 1FJLA 1X58A 4B4CA 1GDTA 2LR8A 2GM4A 2DMTA 2LY9A 2K40A 1VNDA 4UUTA 1AHDP 2E2HJ 4L5EA 5IP7J 3H3VK 1MBJA 3PO3J 2O7OA 4D5FA 1HDPA 1DU6A 3RQIA 2Y9ZA 1JKRC 3JRBA 3Q3SA 1JGGA 4XK4A 1F36A 2HI3A 3BR1A 1JJ8C 1HF0A 1YRNA 1XG1A 2DMQA 2WV1A 5EZHA 3B6AA 5E3MA 4DYRA 3LNQA 3M3YJ 2M8GX 3RZOJ 2JA8J 1G2HA 1B72B 1GT0C 2L7ZA 5EGOA 3OOUA 3BTJA 3IH4A 5EDNA 3G1LA 5GP9A 1Z77A 2ID3A 2LLKA 4XRMA 2HOTA 4X6AJ 1ENHA 5HODA 2DA1A 3QPLA 4J19A 5C4JJ 1Z0XA 2HXOA 2VPRA 2CUEA 4W97A 2JN6A 1MSFC 2MGQA 1RPWA 2H8RA 2XB5A 2ECCA 4BBRJ 1ETYA 2G0EA 1B72A 3LSJA 2Y31A 2MW8A 2R5ZA 1NK3P 3PO2J 4ABZA 1B8IB 3ZQGA 1AU7A 5EF6A 1VF9A 5FKKA 4M3FA 2DJNA 3O8HA 5F08A 3FISA 5FKLA 2JA6J 3CDLA 2EZKA 1APLC 1MH3A 2H1KA 1MBKA 3JREA 4XRSA 1ETWA 4A3JJ 1BL0A 1B8IA 4DYCA 1TWGJ 3HB9A 1QVUA 1ETXA 1QPIA 5K7FA 1O4XA 5EG0A 1FTTA 1U8BA 1RESA 3JR9A 2ZB9A 4UUSA 2PMZN 4FE4A 3HOWJ 1T56A 5FKOA 4IHXA 1FEXA 3S1QJ 4AYBN 3A01B 1WPKA 5J1YA 2XRLA 2XPVA 4XICA 1ZK8A 4FISA 1S7EA 2LFBA 3ZOBA 3I4MJ 2M2EA 1ETKA 5F1JA 2XSDC 3MKLA 5IYDJ 2JWTA 1TC3C 5IYBJ 5IOZA 1PUFB 1JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ6 C;  1TWC J;  1JKO C;  3BR5 A;  2XGD A;  2JK3 A;  4A3E J;  1GUU A;  5JLX A;  3HOV J;  3K7A J;  3QQA A;  4D7M A;  1MH4 A;  1OCP A;  3WHB A;  2DA3 A;  2FX0 A;  3S16 J;  5M3F J;  2GLO A;  1JTX A;  2YS9 A;  2CQQ A;  1FTZ A;  3OSF A;  2YUS A;  4A3D J;  4DYQ A;  1HLV A;  2N8G A;  1QRY A;  4IEJ A;  3C2B A;  3IV5 A;  1RET A;  3RKQ A;  1BW6 A;  4A3K J;  3SJM A;  1IRZ A;  1YRN B;  2Y30 A;  4CYC B;  4MIM A;  4XRS G;  1MBG A;  3G1O A;  1IJW C;  4G12 A;  1WCM J;  2JA5 J;  4QSH A;  3HOU J;  1JUS A;  3BR2 A;  2KT0 A;  1UHS A;  2E19 A;  2OF7 A;  1LFU P;  5EGO B;  2HDD A;  4IHW A;  2CUF A;  1E3O C;  3JRA A;  3HOZ J;  2EZH A;  2ECB A;  4XID A;  3BR3 A;  5EYR A;  2DTZ A;  3BTC A;  5EZG A;  4CYC A;  4NDL A;  2YU9 J;  2AO9 A;  1VFC A;  3D1N I;  1JUM A;  2M0C A;  2EH3 A;  2EZL A;  2FQ4 A;  4D5C A;  3GTG J;  2NS7 A;  1GVD A;  3WHC A;  1NTC A;  3LSR A;  1X2N A;  2R5Z B;  2L9R A;  9ANT A;  4M3B A;  4DW6 A;  3MN2 A;  2Y2Z A;  5K7H A;  2DA2 A;  3NAR A;  2NVX J;  2Y9Y A;  1Q1V A;  1GV5 A;  5E3L A;  1ZR4 A;  3E7L A;  2NOG A;  1SFO J;  4JX6 A;  2XB0 X;  1F43 A;  2ID6 A;  2FD5 A;  5M5X J;  5F0F A;  2R5Y A;  1WGX A;  1Y1V J;  5M3M J;  4EEF G;  2CRG A;  3HEF A;  3PM1 A;  4B1R A;  1OCT C;  3FIW A;  3IH2 A;  3TED A;  4Y52 J;  2EBI A;  2GBY A;  4V2F A;  3HKZ N;  5EG0 B;  3B6C A;  4FTH A;  4FE7 A;  4UUS B;  2EZI A;  3Q0U A;  2HOS A;  2DA5 A;  1IDZ A;  2R7Z J;  4QTR A;  1AKH A;  2VI6 A;  2QCO A;  3G1M A;  2LVS A;  5K7Z A;  2HXI A;  1OJL A;  3JRD A;  4A69 C;  5M5Y J;  3VPR A;  5F0C A;  5M5W J;  4A3C J;  5E3N A;  3BG5 A;  3L1P A;  2DA4 A;  4C3J J;  4D7N A;  1LE8 A;  3GTK J;  2XPW A;  2NVY J;  3S1N J;  3HOY J;  1ZKG A;  4A3I J;  1TWH J;  1WI3 A;  2XGE A;  2O8K A;  5J1R A;  1WH5 A;  2FJ1 A;  1MBE A;  2LKX A;  1OFC X;  3JRC A;  4A3B J;  2JJ7 A;  3NAU A;  4AC0 A;  1H8A C;  1RKT A;  3LSG A;  1QVT A;  1RR7 A;  1UMQ A;  2P81 A;  2X48 A;  3JRF A;  2EQR A;  2M34 A;  5F27 A;  2LK2 A;  1H88 C;  3BQY A;  3S1M J;  3ZQL A;  1MSE C;  2HOA A;  1I3Q J;  5BNG A;  2IBD A;  4Y7N J;  2HYJ A;  1ETO A;  2AHQ A;  4M6V A;  1BJZ A;  3S2D J;  3GTQ J;  2LP0 A;  3GTP J;  3SFI A;  2JMW A;  5F04 A;  2COB A;  3DEW A;  1ZR2 A;  1Y1W J;  5JLW A;  2K9S A;  1IGN A;  1T33 A;  1TWF J;  4GFB A;  1BA5 A;  3S2H J;  4JYK A;  5DTD A;  1A6I A;  1K61 A;  5IOY A;  2X9D A;  2XPU A;  4HNV A;  2K9N A;  4A3L J;  4A3F J;  2DMN A;  4BY7 J;  3S1R J;  3BR0 A;  3DCF A;  5C4X J;  1GV2 A;  3A02 A;  1ZGW A;  4X1E A;  1JTY A;  1P7J A;  1ORK A;  4DZJ A;  5EEA A;  3OSG A;  2L7M P;  5GPC A;  1ZQ3 P;  4A93 J;  3GTJ J;  1JKP C;  1MBH A;  1X2M A;  1NK2 P;  2R93 J;  1JT6 A;  1XS9 A;  3CQZ J;  2CJJ A;  1ZTR A;  4M3D A;  1BW5 A;  4BY1 J;  3LSP A;  4M3G A;  4MLO A;  5IPA A;  4S0H B;  4IHV A;  1W0T A;  3A03 A;  4C2M J;  1IC8 A;  3S15 J;  2R5Y B;  4MFE A;  1IDY A;  2Y0S N;  3BR6 A;  4B3A A;  3BQZ A;  2DMU A;  3ZQH A;  2E2I J;  3HOX J;  3QPS A;  2XGC A;  2ME6 A;  3JRI A;  1VI0 A;  1I6H J;  5F0H A;  2LTP A;  2CQX A;  1HOM A;  2TCT A;  3HDD A;  5J3L A;  1FIA A;  3LOC A;  2DA7 A;  4A3G J;  1AKH B;  2D5V A;  3BG9 A;  4MFD A;  3BTL A;  3HGY A;  1IG7 A;  2WB1 N;  3FKI J;  2L0K A;  2MG4 A;  1U9N A;  2R92 J;  3IH3 A;  5IP9 J;  5FJ8 J;  2JA7 J;  3BT9 A;  2ELK A;  1D5Y A;  2NS8 A;  4I76 A;  1JT0 A;  4JP0 A;  4I6Z A;  1XC5 A;  3S17 J;  1WH7 A;  1K83 J;  4LOC A;  2DN0 A;  5J1U A;  1POG A;  1LE8 B;  3GTL J;  1UG2 A;  3SDG A;  2O9L A;  5FLM J;  2X6O A;  4RDU A;  1P7I A;  2QF7 A;  3HBL A;  1SAN A;  3W6V A;  2IEK A;  2WAQ N;  3ZQF A;  1ETV A;  4MO7 A;  2HQ5 A;  4BXX J;  4BKX A;  1TWA J;  3K2A A;  3Q0W A;  2NVQ J;  1MBF A;  5GPA A;  2KDZ A;  2VUM J;  1FIP A;  3HGG A;  2DMP A;  2W48 A;  3H0G J;  1I50 J;  3M4O J;  2ME0 A;  5FLV A;  1ETQ A;  5E3O A;  2IAI A;  5FKN A;  1LFB A;  4QIW N;  1ITY A;  3TW7 A;  3BG3 A;  3FK7 A;  2VKV A;  3GTO J;  3BTI A;  1EF4 A;  3FK6 A;  3ZQC A;  3S14 J;  2E1O A;  3JRH A;  4DZP A;  3JRG A;  3HM5 A;  1R9T J;  3O8G A;  1H89 C;  1JKQ C;  3GBG A;  2I10 A;  2R0Q C;  4C3I J;  1U78 A;  4W1U A;  2L7F P;  2RAE A;  2B63 J;  2M9H A;  2VKE A;  5C44 J;  4JX4 A;  3ZQI A;  3I4N J;  5DS9 A;  4JX5 A;  3Q0V A;  2LD5 A;  4IHY A;  4V2G A;  3CCY A;  2CU7 A;  5FKM A;  2MSY A;  5C3E J;  2TRT A;  3OIO A;  1W0U A;  1DU0 A;  4A3M J;  1CQT A;  2NVT J;  3UKG A;  4C3H J;  4M3E A;  3A01 A;  1IUF A;  2OPT A;  3F0C A;  5IP6 A;  2E2J J;  3TP0 A;  4AUX A;  3RZD J;  3GTM J;  3TW6 A;  3CMY A;  5IYC J;  4BBS J;  1RKW A;  3MVP A;  4RBO A;  1U9O A;  1IV6 A;  1PUF A;  1HDD C;  2K9Q A;  3TP3 A;  4FCY A;  2DA6 A;  1HCR A;  1A5J A;  1MNM C;  1FJL A;  1X58 A;  4B4C A;  1GDT A;  2LR8 A;  2GM4 A;  2DMT A;  2LY9 A;  2K40 A;  1VND A;  4UUT A;  1AHD P;  2E2H J;  4L5E A;  5IP7 J;  3H3V K;  1MBJ A;  3PO3 J;  2O7O A;  4D5F A;  1HDP A;  1DU6 A;  3RQI A;  2Y9Z A;  1JKR C;  3JRB A;  3Q3S A;  1JGG A;  4XK4 A;  1F36 A;  2HI3 A;  3BR1 A;  1JJ8 C;  1HF0 A;  1YRN A;  1XG1 A;  2DMQ A;  2WV1 A;  5EZH A;  3B6A A;  5E3M A;  4DYR A;  3LNQ A;  3M3Y J;  2M8G X;  3RZO J;  2JA8 J;  1G2H A;  1B72 B;  1GT0 C;  2L7Z A;  5EGO A;  3OOU A;  3BTJ A;  3IH4 A;  5EDN A;  3G1L A;  5GP9 A;  1Z77 A;  2ID3 A;  2LLK A;  4XRM A;  2HOT A;  4X6A J;  1ENH A;  5HOD A;  2DA1 A;  3QPL A;  4J19 A;  5C4J J;  1Z0X A;  2HXO A;  2VPR A;  2CUE A;  4W97 A;  2JN6 A;  1MSF C;  2MGQ A;  1RPW A;  2H8R A;  2XB5 A;  2ECC A;  4BBR J;  1ETY A;  2G0E A;  1B72 A;  3LSJ A;  2Y31 A;  2MW8 A;  2R5Z A;  1NK3 P;  3PO2 J;  4ABZ A;  1B8I B;  3ZQG A;  1AU7 A;  5EF6 A;  1VF9 A;  5FKK A;  4M3F A;  2DJN A;  3O8H A;  5F08 A;  3FIS A;  5FKL A;  2JA6 J;  3CDL A;  2EZK A;  1APL C;  1MH3 A;  2H1K A;  1MBK A;  3JRE A;  4XRS A;  1ETW A;  4A3J J;  1BL0 A;  1B8I A;  4DYC A;  1TWG J;  3HB9 A;  1QVU A;  1ETX A;  1QPI A;  5K7F A;  1O4X A;  5EG0 A;  1FTT A;  1U8B A;  1RES A;  3JR9 A;  2ZB9 A;  4UUS A;  2PMZ N;  4FE4 A;  3HOW J;  1T56 A;  5FKO A;  4IHX A;  1FEX A;  3S1Q J;  4AYB N;  3A01 B;  1WPK A;  5J1Y A;  2XRL A;  2XPV A;  4XIC A;  1ZK8 A;  4FIS A;  1S7E A;  2LFB A;  3ZOB A;  3I4M J;  2M2E A;  1ETK A;  5F1J A;  2XSD C;  3MKL A;  5IYD J;  2JWT A;  1TC3 C;  5IYB J;  5IOZ A;  1PUF B;  1JUP A; 
#chains in the Genus database with same CATH topology
 1B6A A;  4EVI A;  4DNC A;  5AON A;  2CV2 A;  1HBX G;  3K70 D;  3BR5 A;  3HXL A;  4PJJ A;  4XLE A;  4F7Z A;  2XGD A;  2VBW A;  4NQW A;  3K7A J;  3DTK A;  1MH4 A;  4G7H F;  3EQL F;  3WHB A;  2FX0 A;  1UST A;  3W2V A;  1JHF A;  3GVA A;  3F8F A;  2CQQ A;  5GAH J;  1E3P A;  1W7P A;  2HZT A;  2RC4 A;  3HPH A;  4BH9 A;  1B1B A;  5GTI C;  4A3D J;  4XLC A;  1Z7L A;  3IC7 A;  2N8G A;  5KAF C;  4IEJ A;  5ERI A;  3RKQ A;  4A3K J;  2GOX B;  2EFP A;  2A61 A;  2WAQ A;  5CPR B;  2E36 A;  3ABM H;  4XON A;  4G12 A;  4Y3O A;  1WCM J;  1FX7 A;  1TTY A;  4ZDO A;  4PK4 A;  3LA7 A;  1UHS A;  3COA C;  4RLQ A;  4HLY A;  2A6T A;  2K3F A;  3R0A A;  3JRA A;  2EZH A;  1WQ2 A;  1YIT I;  3CTA A;  1YJN I;  3LWF A;  3U1K A;  3BR3 A;  3I9V 2;  1AOY A;  5LRS A;  4KYW A;  2QQ8 A;  3WTY C;  4LLN A;  4CYC A;  2FQ3 A;  1PDN C;  2VJ4 A;  2AO9 A;  4HX4 A;  1IZ1 A;  2EH3 A;  2HKX A;  5H20 A;  2EZL A;  3GTG J;  4HBL A;  1C0W A;  1GVD A;  4HQE A;  3F8B A;  2LMD A;  3BY6 A;  4L9V A;  9ANT A;  2QEX I;  2HQR A;  3MN2 A;  3TOB A;  3I0T A;  1IN8 A;  1KGS A;  1R1T A;  3LL7 A;  2M8E A;  4LFU A;  2WV0 A;  5D6F A;  1G59 A;  4ESF A;  2CV0 A;  2X85 A;  1BIA A;  5FRO A;  3QAH A;  1XMK A;  2JT1 A;  1YQA A;  3CP8 A;  3EUA A;  2VL8 A;  1WGX A;  2OZU A;  3DPU A;  2VQC A;  3I59 A;  3C18 A;  3IH2 A;  3FXJ A;  4XRF A;  3MKZ A;  4DJA A;  1TP4 A;  2ZME C;  4B09 A;  2DPU A;  2E5Z A;  3L09 A;  3KZZ A;  1YFH A;  4FTH A;  4FE7 A;  4UUS B;  2EZI A;  3Q0U A;  2R7S A;  4FHT A;  1MZB A;  3H9G A;  3ZMV A;  4QTR A;  2VI6 A;  5EEH A;  3P9K A;  4ZC3 A;  3LAP A;  1W36 C;  2V6C A;  3WG7 H;  2KRF A;  4RMN A;  1SEU A;  2K4J A;  3WTU C;  3V8K A;  3H35 A;  3KZI C;  2X51 A;  4A6D A;  5BMZ A;  3CD6 I;  3OY9 A;  4WCG A;  5L3D A;  1V5F A;  3BG5 A;  4EJT A;  4YIF A;  1E17 A;  2BY1 A;  2WAF A;  3BZC A;  2Y0S A;  2KJB A;  2STW A;  1ZKG A;  3ZN1 A;  1WI3 A;  2O8K A;  3DFG A;  1WH5 A;  1MMN A;  2FJ1 A;  2XKP A;  2PQ8 A;  2VOP A;  3KEO A;  1HW1 A;  3MEX A;  5LD2 C;  2BW3 A;  2JJ7 A;  3QOE A;  1WJE A;  1HW2 A;  1UMQ A;  1WI9 A;  3REO A;  1WJA A;  1S9H A;  2X48 A;  1HQC A;  3JRF A;  1YX3 A;  2LK2 A;  1H88 C;  2XV4 S;  4U0Y A;  3IAS 2;  1XMA A;  2HGC A;  4E7J A;  3M7G A;  3E6D A;  5BNG A;  5HVQ C;  2HYJ A;  3KEQ A;  1XGO A;  4CCM A;  3CCR I;  1BJZ A;  1FYM A;  3GTQ J;  3S2D J;  3GTP J;  1OCC H;  2JMW A;  3IP4 B;  1K4T A;  2COB A;  3DEW A;  2K7L A;  1U5T C;  3R60 A;  1Y1W J;  3PQK A;  5JLW A;  5CJ9 A;  1I27 A;  3DBH B;  1B4A A;  2DI3 A;  1FY7 A;  3CCM I;  3H5N A;  1A6I A;  2E5N A;  3PJR A;  2XPU A;  2RN7 A;  4A3F J;  3HSR A;  4F92 B;  1VQ8 I;  4IX7 A;  2HFH A;  2XF6 A;  3EDP A;  1JTY A;  4PSX A;  4CCK A;  4DZJ A;  4A93 J;  5FGM A;  4ITV A;  1UFM A;  3GTJ J;  1JKP C;  5K5R A;  1X2M A;  2R93 J;  4D0P A;  5DCF A;  1XS9 A;  3J7A Y;  3CQZ J;  4OU0 A;  4BE0 A;  3NWT A;  1BW5 A;  3QWL A;  2FUG 2;  3LSP A;  1DPU A;  4I99 C;  4MLO A;  2V6E A;  2FOW A;  5FD5 A;  1LVA A;  2Z5U A;  3SHF A;  1BC8 C;  3S15 J;  2UWM A;  1IDY A;  3NWS A;  2Y0S N;  3I59 B;  4B3A A;  4HV5 A;  1KYW A;  2W82 A;  2STT A;  3MZH A;  3CMA I;  1G6N A;  1QGP A;  1CF7 A;  1ZHF A;  2ME6 A;  3TO9 A;  1VI0 A;  4L0Y B;  5F0H A;  5JVT A;  4B43 A;  4LJZ F;  3HDD A;  2BBY A;  3WTS C;  3RDI A;  1FIA A;  2DT6 A;  3KP3 A;  1V54 H;  2DA7 A;  5HLG A;  4A3G J;  5JR3 A;  3ZN0 A;  3BZ6 A;  3CC2 I;  4M71 A;  4LIT A;  4MFD A;  2W00 A;  2IJL A;  4A12 A;  3GME A;  5CLS A;  5J4V A;  3CCV I;  2JA7 J;  1D5Y A;  3KP5 A;  5E1X A;  4IHT A;  3OYI A;  3S17 J;  1FLI A;  5D8K B;  1MD0 A;  4LOC A;  2DN0 A;  3FZV A;  3S3O A;  4IRI A;  3WG9 A;  5FLM J;  2LBF A;  2FML A;  1FP1 D;  4B47 A;  3W6V A;  5D6E A;  2MH9 A;  3AG3 H;  3I58 A;  3PUB A;  3DU5 A;  3ELK A;  4BXX J;  4BKX A;  1TWA J;  4ON0 A;  2BW3 B;  2YX7 A;  2CSO A;  2PG4 A;  4NC6 A;  5GPA A;  3S93 A;  2H6B A;  1FIP A;  3K1N A;  4CGZ A;  3HGG A;  4BUP A;  2W48 A;  3N05 A;  1OCO H;  1HA8 A;  2BY0 A;  3LFU A;  3H0G J;  2ELJ A;  2XF5 A;  3M4O J;  2L4M A;  2P0W A;  2JA2 A;  4G9Y A;  5FLV A;  5EEG A;  1RR8 C;  2GZW A;  2HDW A;  1Y0U A;  1VQM I;  2VT2 A;  2L9N A;  2HTJ A;  2LY2 A;  1ITY A;  1R23 A;  3TW7 A;  2ELH A;  2XAU A;  2CG4 A;  4UNO A;  1LDK B;  1EF4 A;  3IHU A;  5DUI A;  3ZQC A;  3S14 J;  1U0J A;  2DQR A;  2TDX A;  3K4K A;  4DZP A;  3ASN H;  3RPU A;  3JRG A;  1O3T A;  3AAF A;  3N4M A;  1ZN2 A;  1VQ6 I;  3ML6 A;  4ENM A;  1IW7 F;  3I71 A;  4LLG F;  2L5Q A;  2X1D A;  3CCU I;  3S32 A;  3L2W A;  1P92 A;  4JX4 A;  5J8C A;  3AG2 H;  4RLF A;  5HLI A;  4IQJ A;  3HOT A;  2DOD A;  2UXX A;  4CHU A;  2ZSH B;  3Q0V A;  2YPR A;  1FMV A;  4KN7 X;  1QQI A;  1Z3X A;  1GXQ A;  3GF2 A;  3L9F A;  2R7X A;  1I1G A;  3FHZ A;  2LG4 A;  3O6B B;  4CCN A;  5C3E J;  1VQL I;  1T6S A;  1W0U A;  2RKH A;  2D45 A;  1SMT A;  3ULQ B;  1DPR A;  5IP6 A;  4NBQ A;  2XHK A;  3GEZ A;  3RIR A;  2XKO A;  3TW6 A;  3F72 A;  2F5D A;  2XGX A;  1IRX A;  1XPX A;  3M07 A;  3T0Y A;  4ZZD A;  4YG2 F;  3ABT A;  1B59 A;  5L3G A;  1U9O A;  4HX8 A;  1TNT A;  3I54 A;  4FAS D;  2W85 A;  2K9Q A;  4FCY A;  1LPQ A;  2GOM A;  1HXD A;  2LR8 A;  1RRJ A;  3C1D A;  1MMG A;  1UJ8 A;  2KDO A;  1V55 H;  1AHD P;  1FBU A;  2E7W A;  1MDM B;  3ZGK A;  4L5E A;  1R4M B;  2MYS A;  4OIO F;  1HDP A;  2DQL A;  2MD5 A;  4M73 A;  1P4X A;  3RQI A;  2OV7 A;  3H36 A;  2VC1 A;  1FC3 A;  1DUX C;  3DV8 A;  3E5X A;  2YSR A;  1SFU A;  4NC7 A;  1RUN A;  2F6C A;  3H5R A;  3N97 A;  3BR1 A;  1JJ8 C;  2RRE A;  1HF0 A;  4E4H A;  3UNG C;  2A6E F;  4WF2 A;  1L3L A;  3S3M A;  3B6A A;  1XN7 A;  3EYI A;  3T8R A;  3IAM 2;  2GWR A;  2KZG A;  1QHG A;  2DDB A;  1TW3 A;  2M8G X;  3M8F A;  4MTD A;  2LBF B;  1WZ2 A;  2Z3Y A;  2RQQ A;  2XUB A;  3RKX A;  4UHT A;  2COM A;  1Y6I A;  3IH4 A;  5EDN A;  4U0V A;  3QRF F;  5E1W A;  3WE3 A;  3KYL A;  2V9K A;  4LB5 A;  2AS5 F;  3WU1 B;  1VQP I;  1LFP A;  2HOT A;  5E18 F;  4UB8 C;  3CUO A;  1ODD A;  1OCR H;  3X2Q H;  5C4J J;  1W5S A;  2ESH A;  5IT3 A;  2JVG A;  2JN6 A;  4L9T A;  1NH3 A;  2C6Y A;  2H8R A;  1FOX A;  2XB5 A;  4KT5 C;  2ECC A;  2DFH A;  3E0J B;  3OYH A;  2QKM B;  3LSJ A;  2Y31 A;  2VT3 A;  4N4O B;  3TDU C;  2WC2 A;  3BWG A;  1A35 A;  2R5Z A;  2A07 F;  1UZC A;  3BJA A;  2EJR A;  1B8I B;  2PI0 A;  2FU4 A;  4AID A;  1W7P D;  1OYI A;  2IGN A;  4RAY A;  4P5O A;  3E5Q A;  5F08 A;  4KN4 X;  4K2E A;  1B9N A;  1YS7 A;  5EJC A;  2XC7 A;  5CVJ A;  2R7R A;  1ZG1 A;  1IXR C;  1WJB A;  2JA6 J;  4XR6 A;  2H1K A;  1ETW A;  1T0F C;  4IKF A;  3ZMZ A;  1BL0 A;  1SFK A;  1YIJ I;  2M1B A;  1ETX A;  3HSE A;  4LIV A;  5DYM A;  1ZLK A;  1ZGJ A;  4J00 A;  5BPD A;  1U8B A;  3JR9 A;  4AVZ A;  3OIQ A;  2PMZ N;  4FE4 A;  4IHX A;  1FEX A;  3S1Q J;  3WTV C;  2XRL A;  1TQP A;  2HDC A;  2OD5 A;  5ICE A;  3LST A;  2K9L A;  4GYG A;  4R79 A;  4G7Z F;  3FXU A;  4Y4R A;  5KCM A;  5FD6 A;  2IA1 A;  2Y48 A;  2Z33 A;  3CJQ B;  1R22 A;  4L0Z B;  1F9N A;  1OCZ H;  2XSD C;  5K5Q A;  1HC8 A;  1VQ7 I;  4KUM A;  1TC3 C;  4GRI A;  5CVV A;  3ZMD A;  3FMR A;  4I0A A;  5IOZ A;  1G3T A;  1JUP A;  4B8X A;  5J47 A;  3RCO A;  3AFH A;  1JJ6 C;  1ZRC A;  1D1B A;  1TWC J;  2QA4 I;  3NRV A;  3TDZ C;  3G4S I;  4PGH A;  2BE5 F;  3IKT A;  3Q9V A;  2K85 A;  2V79 A;  4UV9 A;  3S8P A;  2R7Q A;  4G6Q A;  2JK3 A;  2EIM H;  3CLO A;  1OCP A;  2PMU A;  4KFC A;  1A04 A;  3A0B C;  1JTX A;  5LBQ A;  1FTZ A;  2YUS A;  1H0M A;  2KPM A;  1D0Y A;  1D0Z A;  1HLV A;  1YOV B;  1XDU A;  3WU2 C;  3IV5 A;  3G73 A;  4EMS A;  3FXK A;  1IRZ A;  3HG9 A;  1G3W A;  4B44 A;  4P9U A;  1W1W E;  3HIF A;  1MBG A;  4BAY A;  3QYF A;  3BR2 A;  3HHG A;  4E6K G;  4OWR B;  3EYY A;  3AG4 H;  2CUF A;  4IHW A;  4IPA A;  2VQG A;  1J2X A;  3HOZ J;  1P4A A;  4XID A;  2OQG A;  3MCZ A;  5FLX Z;  3ABU A;  4D9J A;  2OBP A;  1NHA A;  4EGY A;  1Z9C A;  4G8X A;  3NEU A;  2CW0 F;  4O3M A;  3IWZ A;  3PNV A;  3G3Z A;  3OYN A;  5F6F A;  4BGD A;  1VFC A;  4I7H A;  3TQN A;  3D1N I;  1REP C;  1QZZ A;  2HOE A;  2M0C A;  4E7L A;  2QSH X;  3M9A A;  1BC7 C;  2KRH A;  1BI1 A;  2D1H A;  2NS7 A;  3FXL A;  4JOM A;  3FF5 A;  5KVR A;  2R5Z B;  3QPT A;  4M3B A;  2GA2 A;  1WHU A;  4HYE A;  2CS3 A;  4HF0 A;  3NAR A;  2B9S A;  2NRA C;  2NVX J;  1JXS A;  3FHN A;  2CQ7 A;  1IN5 A;  3FXM A;  4NUB A;  3E7L A;  3ABL H;  3WTW C;  3GWZ A;  2G9W A;  2BXZ A;  3M1E A;  1SFO J;  2XB0 X;  1E0E A;  2HWV A;  1D5V A;  2FBH A;  4PDK A;  5M5X J;  5F0F A;  4IHS A;  4H0E A;  4BU2 A;  2JPB A;  5M3M J;  4HDV A;  2VQH A;  3HEF A;  4LK0 F;  4CDG A;  1OCT C;  2W84 A;  4XSZ F;  5H6R A;  2IXS A;  3VOE A;  2K4B A;  3FIW A;  4QPO A;  4KIG A;  5LGU A;  3F23 A;  1S6L A;  2GBY A;  1E3H A;  3QPH A;  2XRO A;  3J80 Z;  1FBS A;  5LLQ A;  2E60 A;  4XLN F;  1QBJ A;  3V4G A;  1A6Q A;  2DCE A;  3P7N A;  2WTE A;  4M6Y A;  4XL9 A;  3OOP A;  1AKH A;  3WGI A;  1D1A A;  4P1W A;  2FXA A;  1ZAO A;  2MD0 A;  2A5Y B;  4IJA A;  1FPQ A;  2BVL A;  1ZAR A;  3ERM A;  3JRD A;  3BPV A;  4L5I A;  1SMY F;  3KPH A;  1WJC A;  2IS2 A;  1STZ A;  2O6G E;  3VPR A;  4D1Q A;  5F0C A;  3HSF A;  2O61 A;  1Z05 A;  3HZJ A;  4A3C J;  2W57 A;  4DQ2 A;  4UB6 C;  3OR1 C;  5DEQ A;  1OR7 C;  1BJA A;  1WJF A;  3S1N J;  3I64 A;  1XMX A;  4G6D A;  3T1B A;  2VJ5 A;  2XGE A;  5J1R A;  2BY2 A;  2LKX A;  3QOP A;  3F3X A;  3DTE A;  4MHG A;  2EPF A;  4HDU A;  1ZG5 A;  1RUO A;  3GYH X;  1RKT A;  4U7D A;  2UV1 A;  2YR2 A;  1RR7 A;  4WXH A;  2M34 A;  2EA2 A;  3CUQ C;  1IXS B;  3ZP5 A;  2O8X A;  4PFO A;  4PJL A;  1XB4 A;  2IBD A;  4Y7N J;  2WWY A;  3I53 A;  5LGN A;  1ETO A;  2AHQ A;  3LFK A;  4M6V A;  4BHC A;  1K79 A;  2QWW A;  1ONV A;  1SD4 A;  3CJR B;  3SFI A;  5F04 A;  3KLN A;  3SDB A;  4G7O F;  5B1A H;  5D4S A;  2ISY A;  1IGN A;  2K9S A;  3IL2 A;  1T33 A;  4EV0 A;  1Q1H A;  2EV0 A;  3K9T A;  1ZYR F;  2DBB A;  3FMQ A;  2XRN A;  2EK5 A;  2HEO A;  1YYV A;  2P5K A;  4YFN F;  5IOY A;  2RGV A;  1BN5 A;  3O2P E;  3E5U A;  1LDD A;  2K9N A;  1BR4 A;  2H6C A;  1J59 A;  1S8N A;  2DMN A;  2F5F A;  4BY7 J;  2V1N A;  3D5R C;  3ZQ7 A;  2QBY A;  4MGR A;  1JI8 A;  1TNS A;  3CDH A;  3L2U A;  3E3V A;  1MMA A;  1UG0 A;  1FT9 A;  1HKQ A;  4I01 A;  5TIS C;  5EEA A;  2NAZ A;  3HOS A;  3OSG A;  4EQQ A;  2QQ9 A;  2MAB A;  1XSX A;  1NK2 P;  4AM3 A;  2ZXW H;  1HKT A;  2ZME A;  1ZTR A;  4F3Q A;  3VFZ A;  4IOA F;  4XM3 A;  3V7S A;  5IPA A;  4N4N B;  1W0T A;  1D3Y A;  1S7O A;  1X3U A;  1YW9 A;  3A03 A;  3OL4 A;  4C2M J;  1IC8 A;  2P4W A;  3IWF A;  2DMU A;  3ZCO A;  2E2I J;  1F4K A;  3HOX J;  2LDU A;  2F4O B;  2VBX A;  3RPU D;  2FE3 A;  4F91 B;  2WBM A;  2YU3 A;  1LVK A;  4II3 A;  5CQE A;  3PUF A;  1QA6 A;  1HOM A;  5E79 C;  3CUQ B;  1AKH B;  3FXR A;  2JTV A;  4MNU A;  1VQN I;  2AXL A;  3BTL A;  5CVI A;  1IG7 A;  3KE2 A;  2L0K A;  4CO8 A;  1U9N A;  3IH3 A;  5IP9 J;  2UZK A;  3BT9 A;  4QPQ A;  2NS8 A;  3ZR8 X;  2Y69 H;  2JSC A;  1LDJ A;  5B1B H;  1WH7 A;  5FLX K;  4Y15 A;  5J1U A;  4BE1 A;  2PLY A;  3MZ8 A;  1R1U A;  3FMS A;  3OYL A;  4UV8 A;  2CYY A;  2LH9 A;  4BQN A;  4IVN A;  3LSI A;  1SAN A;  2CUZ A;  2DOA A;  2HNH A;  2UXN A;  2FF4 A;  2WAQ N;  4B3X A;  4E7S A;  3J7A O;  2HQ5 A;  3AL0 C;  2M4G A;  4HNU A;  2V9P A;  3FX3 A;  1VQ9 I;  3SFZ A;  4WXC A;  1MBF A;  1QNT A;  2ESN A;  3BCB A;  2KDZ A;  2VUM J;  1U5T A;  2DK8 A;  3JSP A;  2KIF A;  4S04 A;  3JAM Z;  4QLC U;  3GO5 A;  1IXC A;  5DDG A;  1XCV A;  1T08 B;  4MQV A;  3BC8 A;  2ME0 A;  1K78 A;  3SEQ A;  5E3O A;  3I5U A;  2KZV A;  1LFB A;  1FOW A;  4QIW N;  1FMW A;  2VKV A;  3WTZ A;  3GTO J;  2EFO A;  3BTI A;  2CQN A;  2VBY A;  4C2U A;  2A69 F;  2NOJ B;  3HM5 A;  1R9T J;  3O8G A;  2DPD A;  2XDV A;  1ZLJ A;  4A5M A;  1YI2 I;  3U9G A;  1WFX A;  3J80 K;  1U78 A;  4C3I J;  4NC8 A;  2GIV A;  4BEH A;  2DLL A;  2RAE A;  3ZQI A;  4KMF A;  2XAG A;  4JK1 X;  2QBY B;  4IHY A;  3CCY A;  1YO5 C;  4M9X A;  4NHJ A;  2HVQ A;  2GQQ A;  5HOO A;  1KU7 A;  1E2X A;  2CV1 A;  4U0W A;  3VB2 A;  2PJR A;  2NVT J;  2HYG D;  4A3M J;  4LMY A;  1KU3 A;  1CQT A;  3VSK A;  4IRH A;  4M3E A;  2IVM A;  1X1C A;  1YX5 A;  2VJI A;  2ZME B;  2AXT C;  3HRS A;  1G4D A;  3BP8 A;  2H27 A;  4BS9 A;  2RNG A;  4UUV A;  2PX9 A;  3KZY A;  1TQI A;  2LKS A;  1LKX A;  2ICW G;  2IA0 A;  3CMY A;  2QM3 A;  3HKZ A;  4UVC A;  3H92 A;  1RKW A;  3MVP A;  3K1P A;  1VQO I;  2H1L A;  1BBY A;  2OAZ A;  2M5W A;  1MJ9 A;  2DA6 A;  1MJB A;  4CUG A;  1A5J A;  1O7L A;  1O7F A;  3DF8 A;  1FJL A;  3LQQ A;  4B4C A;  2GM4 A;  3CCJ I;  4EM0 B;  4GXO A;  2KQR A;  4HV6 A;  2DMT A;  3VDX A;  3BCA A;  2VON A;  2G7H A;  4XLH A;  1RNL A;  5LHI A;  5B66 C;  5IP7 J;  1WVR A;  2O7O A;  2Q0O A;  1A36 A;  5DM6 F;  3BRO A;  4AU7 A;  3Q3S A;  1JGG A;  3RTR A;  3RYP A;  1S7A A;  4XLF A;  3G71 I;  1S29 A;  3QOD A;  2CWE A;  4LG0 B;  2B0L A;  3EUK L;  3P9I A;  1F36 A;  4E7Z A;  2HI3 A;  2F4I A;  3DEE A;  1R5G A;  3ASO H;  1JE8 A;  1XG1 A;  3GFI A;  1IAW A;  2DOE A;  3GFJ A;  1YTY A;  3MFK A;  3O3K A;  1ERD A;  1MDM A;  1F1Z A;  3LNQ A;  2RDP A;  3RQ4 A;  3AG1 H;  1Y56 A;  2W25 A;  2R4G A;  4XKV A;  3WOD F;  4U87 A;  2NXN B;  5EGO A;  2QSF X;  3ZMU A;  3TL4 X;  5AIQ A;  2WY7 Q;  5GP9 A;  2ID3 A;  3WE2 A;  4L5J A;  4X6A J;  1ENH A;  2B7E A;  5HOD A;  2DFI A;  3QPL A;  1U5T B;  2VJJ A;  2MH2 A;  5AIP A;  4J19 A;  2K5C A;  4Q47 A;  2A05 A;  2ZXJ A;  2RVC A;  2M87 A;  1MSF C;  3HYI A;  2KL4 A;  3L2Q A;  1BOB A;  1ETY A;  2G0E A;  4C2T A;  1K78 B;  1H9T A;  1F5T A;  2V1U A;  2PFB A;  3PO2 J;  2I8D A;  1NK3 P;  2QKL B;  2IRF G;  4ABZ A;  4PFP A;  4ESB A;  2FRH A;  1UHM A;  1AU7 A;  4F52 A;  4ZDL A;  2P5V A;  3O8H A;  4KIT B;  3D0S A;  4EM1 A;  1R5H A;  4BHB A;  4EM2 A;  4BEH B;  1VQ4 I;  2EZK A;  3JRE A;  1QU3 A;  2DXI A;  2KMU A;  1B8I A;  4DYC A;  5DD8 A;  5HLH A;  3K70 C;  2BV6 A;  3U21 A;  3OYA A;  1O4X A;  5EG0 A;  3OYF A;  1FTT A;  1X4P A;  3EET A;  4DBR A;  3FM5 A;  4XLA A;  1EH7 A;  1MGT A;  1OPC A;  4M72 A;  3HOW J;  5LHH A;  2PJR B;  2L3D A;  4BJT A;  2Q2E B;  4M74 A;  1WPK A;  3RJP A;  2VOD A;  5LEK A;  4FIS A;  2IT0 A;  1QPM A;  3ZOB A;  3TO6 A;  3I4M J;  4MEY F;  1ETK A;  2BY3 A;  2RV8 A;  2VXD A;  3P9C A;  5LRR A;  3OS1 A;  1SVO A;  2ZXI A;  1YS6 A;  4L9N A;  5ICG A;  1WRJ A;  3SQN A;  1JKO C;  2BHZ A;  1SFE A;  1YG2 A;  2IS6 A;  3VEP A;  1YW7 A;  5CYV A;  2BZT A;  2WB1 A;  3M8J A;  2K9M A;  4IO9 F;  1RIO H;  1YW8 A;  5JLX A;  4CIC A;  4D7M A;  3QQA A;  1Z91 A;  3D5S C;  2DA3 A;  4HLX A;  2VKD A;  5M3F J;  3DLL F;  2YS9 A;  3KP2 A;  5HLT A;  2OUM A;  5GAE J;  2QZ8 A;  1N78 A;  3VYR B;  4DYQ A;  1EKE A;  4I2O A;  2L2O A;  2BGC A;  3K4J A;  3C2B A;  1RET A;  4ZTJ A;  1WJ5 A;  4RB3 C;  2ETH A;  3SJM A;  3L00 A;  3CJN A;  4GCV A;  5LGT A;  2IGO A;  4MIM A;  4ZYA A;  3G1O A;  4XRS G;  3DEU A;  3NQO A;  1FNN A;  4QSH A;  3UR3 C;  4WK8 F;  3WTT C;  3HOU J;  2OF7 A;  3B73 A;  3GXO A;  2ZSI B;  1OYY A;  5EGO B;  1XGS A;  2HR3 A;  2NYX A;  3GFM A;  5F1R A;  3OYD A;  3BDD A;  3H9J A;  2DTZ A;  3A0H C;  4YRV A;  3BTC A;  5A2Q Z;  5EZG A;  1MNE A;  3P5J A;  5LFA A;  4S05 A;  1JUM A;  3H9Q A;  1N75 A;  1T98 A;  1Y39 A;  2XAH A;  2X6W A;  4D5C A;  2FQ4 A;  1TT5 B;  2F5E A;  1TLH B;  3WHC A;  1NTC A;  1X3W B;  1X2N A;  4EAT A;  2L9R A;  2JRT A;  1T0F A;  2Y2Z A;  4A2U A;  5K7H A;  3L2C A;  1YE9 A;  2M7B A;  2IGM A;  2Y9Y A;  4DIQ A;  2H8W A;  1TL8 A;  4EJU A;  1GV5 A;  1NG7 A;  1Z1D A;  1BI0 A;  1SAU A;  3ROU A;  5E3L A;  2Y75 A;  1ZR4 A;  2QEN A;  2A3S A;  2NOG A;  3BJ6 A;  3M1C A;  5LHG A;  3K10 A;  4JX6 A;  1F43 A;  2E34 A;  3OIP A;  2ZNY A;  3W6K B;  2FOK A;  1N77 A;  1FOK A;  1GXP A;  2EB7 A;  3CC7 I;  2MLK A;  4PGG A;  4AVP A;  3DXJ F;  4UVB A;  1P6R A;  2L9S A;  4HAM A;  3TED A;  3QU6 A;  4V2F A;  5EG0 B;  3H1C A;  4WX9 A;  1SD5 A;  3C2G A;  4KJZ A;  3OYG A;  5BPI A;  1IDZ A;  2LSO A;  5FFZ A;  1DP3 A;  1KYZ A;  2GXG A;  3G1M A;  1TQM A;  4N0B A;  2LVS A;  5K7Z A;  3V8L A;  2HXI A;  1LQ1 A;  2KHM A;  3CDI A;  1OJL A;  4E7H A;  3R4K A;  5M5Y J;  4OIR F;  1J0R A;  2NNN A;  3F22 A;  2OU2 A;  2E1M C;  2DA4 A;  1LE8 A;  4D7N A;  3PSI A;  3GTK J;  3MKW B;  3CMM A;  1I1S A;  2NVY J;  3JTG A;  5TGT A;  4IZZ A;  3HOY J;  1MW7 A;  2QVO A;  4O5V A;  5CVR A;  2Q8K A;  3LMM A;  3HPG A;  1J5Y A;  5E8I A;  1MBE A;  2FA5 A;  4A3B J;  4JBA A;  3NAU A;  4AC0 A;  3I4P A;  1W36 D;  3LSG A;  1QVT A;  3BJO A;  4BQQ A;  1ZRD A;  3KCC A;  5F27 A;  5TRD A;  4DOZ A;  4XBF A;  4OAZ A;  1J7K A;  1K7A A;  3OR2 C;  4LK1 F;  5FB2 A;  2L4A A;  3L2V A;  2MLG A;  2FNP A;  1KQ8 A;  3CME I;  1KU9 A;  2JZY A;  2DOF A;  1KA8 A;  2ZKZ A;  4FX4 A;  2P7C B;  3MWM A;  4DGW B;  4XN0 A;  2HPM A;  1I6X A;  2IP2 A;  4XOT A;  4HQM A;  4TV7 A;  3H5A A;  3FKJ A;  1PUE E;  4GFB A;  1BA5 A;  3S2H J;  2KIS A;  2Y0M A;  4Q48 A;  5DTD A;  4H4K C;  3AKZ A;  3DWL E;  1DQU A;  3PNY A;  1U3E M;  1Z6T A;  3FBN B;  2JRM A;  4MQ9 F;  2DYR H;  3DP7 A;  3SEZ A;  4HNV A;  2VN2 A;  1TBX A;  1O57 A;  2MBF A;  3V8J A;  4CA0 A;  4CCJ A;  4OAY A;  3DCF A;  3CC4 I;  1JGS A;  1GV2 A;  2OA4 A;  1OQY A;  3A02 A;  1ZGW A;  4RB0 A;  4BXU A;  1IF1 A;  5E17 F;  1P7J A;  2OTJ I;  2OCE A;  4KMU X;  4XKB A;  1P4W A;  5GPC A;  1ZQ3 P;  3L7W A;  4GGG A;  1MBH A;  4LD5 A;  2V1D A;  1JT6 A;  3HRM A;  2CJJ A;  2KIQ A;  1LEA A;  2HZD A;  2Z2S B;  2P7V B;  3KYC B;  5CKT A;  2HQN A;  4BY1 J;  2E1M B;  1WWX A;  3WGH A;  1V5E A;  2ACJ A;  4IHV A;  4OIP F;  1OYW A;  3SZG A;  2V1X A;  4Q4Z F;  4MFE A;  4QWQ A;  2FBI A;  2E35 A;  3BR6 A;  3I56 I;  4PJ0 C;  3BQZ A;  3FDY A;  4NNJ A;  3W2W A;  4I02 A;  4ASN A;  4KA4 A;  3WU0 A;  4AYB A;  2OQR A;  2VE9 A;  1U6G A;  2XGC A;  2R7V A;  3JRI A;  4YFX F;  4OMZ A;  4RGR A;  3U1D A;  5JFR A;  1XTA A;  2TCT A;  5J3L A;  1D8K A;  2XAJ A;  3MMY B;  1OR7 A;  2QQB A;  2XAQ A;  3BG9 A;  2R7F A;  1CGP A;  2BXY A;  4AIJ A;  4ZTF A;  3FKI J;  2IA2 A;  1XSD A;  2MG4 A;  2IGK A;  5JI6 A;  1MMD A;  1D8J A;  1BR2 A;  3JTH A;  5FJ8 J;  1FSH A;  1DGW Y;  2EIN H;  3OMY A;  2LRE A;  1IRG A;  4LGW A;  1GHC A;  4I6Z A;  1XC5 A;  1ZG3 A;  4ETS A;  1FZP B;  2PN6 A;  4IL6 C;  3T5X A;  3OYE A;  1POG A;  1LE8 B;  1V3F A;  3SDG A;  3J81 Z;  4Y13 A;  3OYM A;  3CUQ A;  1ZRF A;  2O9L A;  3GTL J;  2R7D A;  2X6O A;  4BJ5 C;  4CZC A;  2ZXH A;  3PNT A;  3HBL A;  4I98 B;  3JSO A;  5F64 A;  2IEK A;  3ZQF A;  3TGN A;  3HRU A;  1ETV A;  3DLA A;  3V42 A;  2XVC A;  5JHF A;  3K2A A;  4MEX F;  1FSE A;  1GLN A;  3TBI A;  4E70 A;  3HRT A;  2K02 A;  2LRD A;  4RS8 A;  1IN6 A;  3K1M A;  2K3P A;  2DT5 A;  3CP2 A;  5HS9 A;  4XOR A;  1EH6 A;  3HUG A;  3HHH A;  1G3Y A;  2CH0 A;  2ZNZ A;  3KEY A;  4KIF A;  2M3A A;  1ETQ A;  2EIJ H;  3DKY A;  5FKN A;  2XF7 A;  1UAA A;  1SD6 A;  1RC9 A;  3F8N A;  3I3L A;  4XKW A;  1XGN A;  3BG3 A;  2VXZ A;  3FK7 A;  3OWT A;  3GFL A;  4V19 K;  2QLZ A;  1XCB A;  1EA3 A;  2P5L C;  3E97 A;  2IS1 A;  2E1O A;  3TMO A;  1X3Z B;  3JRH A;  3VOD A;  4LB6 B;  2WY8 Q;  5D5V B;  3OYK A;  1JKQ C;  1HST A;  3KP6 A;  5D8L B;  3EUH C;  4BQO A;  2R0Q C;  3MD2 A;  1UHW A;  3K4L A;  1R1V A;  4O6J A;  1XD7 A;  1MMS A;  2VKE A;  5HS8 A;  3ZQQ A;  4KIB A;  3KLO A;  3I4N J;  1VQK I;  1W5T A;  1R6R A;  1JHH A;  5DCM A;  3S3N A;  4JX5 A;  2DFE A;  3G6E I;  4V2G A;  2BEO A;  5FKM A;  2Z9O A;  2X0L A;  2ZFW A;  4GDF A;  1SVL A;  2MSY A;  2QQA A;  2DT7 B;  4FT8 A;  2LF7 A;  3PL8 A;  2TRT A;  3OIO A;  4C30 A;  1DU0 A;  1WKM A;  4IQ4 A;  4C3H J;  3LSM A;  5IT9 Z;  1TZL A;  2PMH A;  3F0C A;  4BDZ A;  3CCS I;  2E1C A;  3RZD J;  3GTM J;  1K6Y A;  1LUJ B;  1O3Q A;  4AWX B;  5IYC J;  5D5W B;  1IUY A;  2HKO A;  2CW8 A;  1IV6 A;  1PUF A;  4L18 B;  1SC7 A;  2A6H F;  3R0J A;  4CCL A;  3TOA A;  1HCR A;  1MNM C;  1FP2 A;  3IRR A;  2X1C A;  3Q5F A;  2F2E A;  2LY9 A;  4UUT A;  2E2H J;  4F55 A;  2VKH A;  3G2B A;  1S72 I;  2JQ7 A;  3PFI A;  3H3V K;  3ABK H;  1GVJ A;  1MBJ A;  3PO3 J;  2EFQ A;  1T2K A;  1W5C C;  2Z99 A;  3VSL A;  2DFF A;  2Y9Z A;  1V5G A;  2WAD A;  2DO7 A;  2H09 A;  3MKY B;  4FQG A;  3LSH A;  3BG6 A;  3BLY A;  4WWC A;  1T8I A;  5K5O A;  4R1H A;  3OYC A;  2BVM A;  1X1P A;  3R61 A;  4M9Z A;  1YRN A;  1ZH5 A;  2W4S A;  5D5U B;  2WV1 A;  4YII A;  4P55 A;  3K2Z A;  4RGU A;  1TW2 A;  2ZC2 A;  4PJM A;  1LNW A;  4M6X A;  1UB9 A;  3RZO J;  4ZYG A;  1SVM A;  2MA3 A;  1B72 B;  2L7Z A;  2JUC A;  4HEA 2;  3OOU A;  3BTJ A;  1D0X A;  3DQV C;  4LG0 A;  3GX4 X;  1S3J A;  1Z77 A;  4U88 A;  5CVU A;  2R3S A;  2V4J C;  2Z16 A;  4XRM A;  5L3E A;  2L54 A;  1R58 A;  4KIC A;  2DTR A;  2QGU A;  2RNJ A;  2ZCW A;  3RSN A;  2GA1 A;  4P9F A;  2ZBK A;  2V9V A;  2HXO A;  5HDK A;  4CH7 A;  3HUG B;  4HX7 A;  1OLT A;  2F48 A;  2GAU A;  4BBR J;  2MC3 A;  3BOQ A;  2XAF A;  2MW8 A;  2LY1 A;  4AIH A;  2EWN A;  1DDN A;  4AIK A;  2JUG A;  3ZQG A;  2X1E A;  3W3C A;  5IY5 H;  3OV8 A;  1XSV A;  1VTN C;  4BJ6 C;  2ZJQ F;  4HF1 A;  1J75 A;  2HVS A;  5FKL A;  5KK1 A;  1ZEL A;  3D5L A;  1BR1 A;  4ZH4 F;  3A2K A;  5D5X B;  3CDL A;  3CCE I;  2L9V A;  1EV7 A;  1MBK A;  4XRS A;  2KFD A;  3VYS B;  3PFY A;  2O5R A;  3C3W A;  5DCM B;  1PP8 F;  2LYC A;  1TWG J;  3HB9 A;  3K4B A;  1UCR A;  3KX2 A;  4Z6Y A;  3Q9S A;  1RES A;  1M1E B;  1IO2 A;  2DU9 A;  4JQF A;  3OYJ A;  4YEL A;  1T56 A;  2LOO A;  3FXQ A;  4Y33 A;  5FKO A;  4HA8 A;  4RB2 C;  3E6M A;  1HKS A;  4NB5 A;  3J81 K;  2DK5 A;  2VE8 A;  4XIC A;  1ZK8 A;  3C7J A;  2ISZ A;  4NQW B;  2LFB A;  5GAD J;  5GAG J;  2DW4 A;  3W2A A;  4A0Y A;  5F1J A;  3MQ0 A;  5IYD J;  3L2R A;  1W7P B;  1HSJ A;  5BS6 A;  5IYB J;  3GLL A;  1PUF B;  2CFX A;  2Q2E A;  4RGX A;  2J5O A;  2E7X A;  5DD4 A;  1R49 A;  1R71 A;  3M8E A;  2P8T A;  3R6S A;  2X4H A;  4E7K A;  1LJ9 A;  4A3E J;  2QUF A;  1GUU A;  2W1O A;  3DBL B;  4OOI A;  3HOV J;  1T39 A;  1KZH A;  3S16 J;  5L3C A;  2GLO A;  4ENK A;  3PIO F;  3OSF A;  4PCQ A;  3CF5 F;  4ESJ A;  2M0M A;  3PSF A;  2MFZ A;  3S2W A;  2AQF A;  1QRY A;  1BI2 A;  1V4R A;  4EGZ A;  2LKP A;  1BW6 A;  3ESW B;  3AL0 B;  1YRN B;  2Y30 A;  1OMI A;  5FFX A;  4RM3 A;  5CQG A;  1ULY A;  2EA4 A;  2IPQ X;  4CYC B;  4HZF A;  4ZJZ A;  2Z1D A;  3FWE A;  1IJW C;  3DU6 A;  2JVH A;  5JVG F;  2JA5 J;  2VAS A;  1BI3 A;  3VYU B;  1JUS A;  5BQT A;  2KT0 A;  2E19 A;  1YJW I;  2CQK A;  1LFU P;  2V26 A;  2KIU A;  2HDD A;  3QP6 A;  2PBI A;  4HW0 A;  4XLP F;  2R7W A;  1E3O C;  2ECB A;  2E71 A;  3K6G A;  4GYI A;  4YIR X;  2VLA A;  2CMP A;  5EYR A;  5H2F C;  2DJI A;  1FWZ A;  4NDL A;  2YU9 J;  4PUS A;  4OIQ F;  5IT9 K;  2HPI A;  2NNY A;  4RGS A;  1XDS A;  1USS A;  3WGG A;  1Z3Y A;  3LSR A;  1P2F A;  5B3S H;  4DW6 A;  2OZ6 A;  2BYV E;  2DA2 A;  4EJO A;  1Q1V A;  2PJP A;  3E6B A;  3GLX A;  2QYO A;  2R7O A;  1YHQ I;  2V7F A;  5ICF A;  2CUJ A;  2FEZ A;  2ID6 A;  2FD5 A;  2I5U A;  1R00 A;  1PJR A;  1U2W A;  4KT6 A;  2R5Y A;  1Y1V J;  3GUD A;  5HNH A;  2CO5 A;  2XSJ C;  4I09 A;  2CRG A;  4EEF G;  1PVE A;  5HDN A;  1Z7U A;  3PM1 A;  2IW5 A;  3ZRG A;  4B1R A;  2HU9 A;  4CCO A;  2ZFU A;  1TT0 A;  4KNY A;  4Y52 J;  2EBI A;  4A6E A;  2EV5 A;  3HKZ N;  1G3S A;  1EJ9 A;  1P9Q C;  3B6C A;  1YLF A;  1RZ4 A;  1MJA A;  3GZN B;  2OCC H;  4N9I A;  2HOS A;  2DA5 A;  1RI7 A;  1FBQ A;  1KQ9 A;  1X1D A;  3FBI B;  3CJT B;  3LQR A;  4XN3 A;  2R7Z J;  3KFW X;  2QCO A;  2W24 A;  3ISP A;  5ED4 A;  2X6Y A;  4XOP A;  3BZK A;  3CF2 A;  3PQJ A;  4A69 C;  2OTL I;  3SXY A;  5M5W J;  3KP4 A;  4LIU A;  4CZZ A;  5L3F A;  1VZ0 A;  5E3N A;  5ILV A;  3L1P A;  1QHH D;  4C3J J;  2EIL H;  2XPW A;  1X1B A;  4XKC A;  3SZP A;  4ZDP A;  5GTH C;  5J40 A;  1X1A A;  1OKR A;  2J5P A;  2P6S A;  2NVU B;  1ON1 A;  4A3I J;  1TWH J;  6PAX A;  5E20 A;  2R7U A;  3DKX A;  3F8M A;  1OFC X;  3MAJ A;  2VOO A;  3JRC A;  3EPZ A;  4RM2 A;  4BE2 A;  1H8A C;  1I39 A;  3F6V A;  4XMY A;  3DKW A;  2P81 A;  2L7K A;  1FYK A;  5KAI C;  1ON2 A;  2EQR A;  4UY8 I;  2WA0 A;  1G8X A;  3BQY A;  3S1M J;  3ZQL A;  1VQ5 I;  2DYS H;  3JAM K;  1MSE C;  2HOA A;  1I3Q J;  1YJ9 I;  1Y0N A;  4BL0 B;  2LP0 A;  5K1Y A;  3K4C A;  3BPX A;  4XQF A;  1ZR2 A;  2DDA A;  4G6T B;  1TWF J;  4HST A;  2HQA A;  4HSR A;  2E1N A;  5DUK A;  4KDP A;  4JYK A;  4E7I A;  1AA7 A;  4LLL A;  1K61 A;  4RAG A;  2X9D A;  3CLQ A;  3KP7 A;  3ZMS A;  1IV8 A;  2KP6 A;  2KJC A;  3ZXS A;  1J9I A;  4CSW A;  4A3L J;  2A5W A;  2M45 A;  4LG3 A;  3JW4 A;  4N9H A;  4ZYE A;  3S1R J;  3BR0 A;  5C4X J;  4A0X A;  3ZMT A;  2CGP A;  1HW5 A;  4L9J A;  2A68 F;  1Y8R B;  4X1E A;  2BHY A;  1ORK A;  2L7M P;  1X4O A;  2EIK H;  5E8G A;  4OMY A;  2LNB A;  2QSG X;  1CF7 B;  3TKY A;  4CXF A;  3ECH A;  3LA2 A;  2H94 A;  4M3D A;  2FBK A;  3RKW A;  2ZO4 A;  2F4M B;  5J6X A;  4M3G A;  4FET A;  3PIP F;  5HDG A;  5D4R A;  3DPL C;  2G7U A;  4S0H B;  2VQL A;  1QZE A;  4PZJ A;  3RKY A;  1MIJ A;  2R5Y B;  2PMZ A;  3DBR B;  2ZJR F;  2FNA A;  2M4K A;  4MTE A;  3ZQH A;  4ANJ A;  4YFK F;  2GXA A;  3QPS A;  3IKV A;  3ECO A;  1K4S A;  4HF2 A;  1I6H J;  1KON A;  3I55 I;  3FM3 A;  2IS4 A;  1I3A A;  2LTP A;  2CQX A;  1T95 A;  3LOC A;  2D5V A;  1ZGA A;  2Q1Z B;  3MZY A;  2KLO A;  5ILS A;  2W7N A;  3HGY A;  4ENN A;  1XX5 A;  2EFN A;  3LAJ A;  2WB1 N;  1QZY A;  4DBQ A;  1LB2 A;  1SFX A;  2L01 A;  4C9Y A;  2R92 J;  2HVR A;  2ELK A;  3GZ6 A;  4I76 A;  1JT0 A;  1B9M A;  4JP0 A;  3V7R A;  5FRM A;  3OL3 A;  3H3Z A;  1K83 J;  1LEB A;  4RB1 A;  1Z21 A;  1SAX A;  1UG2 A;  5H6Q A;  4PSW A;  2RQP A;  3HTU A;  4RDU A;  1P7I A;  2QF7 A;  2VB6 A;  3F6O A;  1Y8Q B;  5HNF A;  2VIX A;  4CYD A;  1KU2 A;  4MO7 A;  3C2H A;  3Q0W A;  3U2R A;  2NVQ J;  3K4N A;  2F5V A;  3F8C A;  1MND A;  3GZ5 A;  4P96 A;  2DMP A;  2GIZ A;  3TO7 A;  1R4N B;  3RI4 A;  4ZYH A;  1I50 J;  1L0O C;  4J01 A;  4HOB A;  4RAF A;  1XGM A;  5E1Z B;  4BXF A;  2M7A A;  2IAI A;  4AD9 A;  1X19 A;  5HS7 A;  3E1S A;  2MC4 A;  2L02 A;  4WXD A;  3FK6 A;  4A5N A;  4HPQ A;  2XAS A;  3IUO A;  3RYR A;  3KYD B;  1H89 C;  2CW7 A;  2LF8 A;  3GBG A;  3HC7 A;  1KQ0 A;  1J09 A;  2I10 A;  2YX4 A;  3VYT B;  4W1U A;  2L7F P;  3F21 A;  4UVA A;  2KIM A;  4Q5S F;  2B63 J;  2M9H A;  4FX0 A;  5C44 J;  2HYF A;  3ONQ A;  3H0D A;  4X0G A;  1K6O A;  5DS9 A;  2LD5 A;  4PJN A;  2KKO A;  3DTI A;  3RPQ A;  2CU7 A;  4B48 A;  1BOA A;  3K4M A;  4XNF A;  3J7Z I;  5KHD A;  2O0Y A;  4HG2 A;  2K86 A;  2M30 A;  4R8H A;  4Z2Y A;  3UKG A;  3A01 A;  1IUF A;  4BAC A;  2OPT A;  2DAO A;  3QYE A;  2E2J J;  1R5I D;  1BIB A;  3TP0 A;  4AUX A;  4IOC F;  4HRI A;  3LA3 A;  1WSU A;  3SZT A;  5TJJ A;  1R7J A;  2LC2 A;  1H9G A;  2HS5 A;  1T38 A;  4BBS J;  4RBO A;  3FXO A;  5JHU A;  3H3U A;  2ZJ2 A;  1HDD C;  4BHP A;  3TP3 A;  1O3R A;  4G94 A;  4IF4 A;  3IRQ A;  1IN7 A;  1MKM A;  1X58 A;  1GDT A;  5BOX A;  3DPT A;  5ICC A;  1QO0 D;  2K40 A;  1VND A;  1FOY A;  1BM9 A;  4II2 A;  3SYT A;  4U7B A;  3F9K A;  3T8T A;  2GXB A;  4D5F A;  1WJD A;  1DU6 A;  5J4Y A;  2PEX A;  1EH8 A;  1YIO A;  2NS0 A;  2VBZ A;  1JKR C;  3JRB A;  2EV6 A;  5B5E C;  4BNC A;  4XK4 A;  4ZYD A;  2ZJP F;  1Z6R A;  1W4M A;  4BDY A;  3E6C C;  3OS2 A;  1ACI A;  1PYV A;  4IRG A;  2DMQ A;  2F5C A;  3B02 A;  4ENJ A;  5EZH A;  5L3B A;  2FMY A;  1IRF A;  5E3M A;  4DYR A;  3CCQ I;  3M3Y J;  1N25 A;  2EFW A;  2JA8 J;  2WAE A;  3GCM A;  1G2H A;  2UUZ A;  1NG6 A;  1GT0 C;  4M9S A;  3QYB A;  4F93 B;  3OS0 A;  1FYL A;  2JSP A;  3CCL I;  1S5L C;  1A31 A;  3G1L A;  5DM7 F;  2LLK A;  2VPL A;  3ZPL A;  1DP7 P;  2OJE D;  5FO5 A;  3BG7 A;  4GO1 A;  2DA1 A;  2AQE A;  3VWB A;  3JCU C;  4XSX F;  4HNT A;  1Z0X A;  2VPR A;  2CUE A;  4W97 A;  5A2Q K;  1AWC A;  2MGQ A;  1RPW A;  2KRC A;  3EUH A;  5ILU A;  5DV5 A;  3A1Y A;  1B72 A;  3QU3 A;  3GW2 A;  4BYY A;  3A4C A;  2JPC A;  3KIO A;  1I5Z A;  4Y17 A;  5EF6 A;  1VF9 A;  5FKK A;  4UXN A;  4M3F A;  2VC0 A;  1OIS A;  2DJN A;  3W6J B;  4A0Z A;  3FIS A;  4ZZL A;  1DGR M;  2D2W A;  4YEJ A;  4RAZ A;  3WTX C;  1APL C;  5J8F A;  2D1V A;  1MH3 A;  3QP5 A;  1ZRE A;  2ADU A;  2BOL A;  4IXA A;  4A3J J;  5KNL A;  1QVU A;  3HJE A;  1QPI A;  5K7F A;  5FRN A;  2O3F A;  3LSK A;  2HTS A;  2K27 A;  5LEJ A;  1U8R A;  3CES A;  2ZB9 A;  1SD7 A;  4UUS A;  4I0B A;  3CO6 C;  3HL2 A;  4BQA A;  3CZ6 A;  3V7C A;  3HTS B;  2FSW A;  3CO7 C;  2R7T A;  3OYB A;  4AYB N;  3A01 B;  1O3S A;  5J1Y A;  3KET A;  2OC6 A;  2XPV A;  1D1C A;  2P6T A;  3K0L A;  1S7E A;  1Z67 A;  2CFO A;  2O03 A;  1R36 A;  1IN4 A;  2M2E A;  3J7Y J;  2XIG A;  1PP7 U;  3MKL A;  4RA2 A;  4EJW A;  2JWT A;  4EJV A;  3ERE D;  4OIN F;  1UEL B;  3K69 A;  4KIS A;  2X6X A; 
#chains in the Genus database with same CATH homology
 1JJ6 C;  1TWC J;  1JKO C;  3BR5 A;  2XGD A;  2JK3 A;  4A3E J;  1GUU A;  5JLX A;  3HOV J;  3K7A J;  3QQA A;  4D7M A;  1MH4 A;  1OCP A;  3WHB A;  2DA3 A;  2FX0 A;  3S16 J;  5M3F J;  2GLO A;  1JTX A;  2YS9 A;  2CQQ A;  1FTZ A;  3OSF A;  2YUS A;  4A3D J;  4DYQ A;  1HLV A;  2N8G A;  1QRY A;  4IEJ A;  3C2B A;  3IV5 A;  1RET A;  3RKQ A;  1BW6 A;  4A3K J;  3SJM A;  1IRZ A;  1YRN B;  2Y30 A;  4CYC B;  4MIM A;  4XRS G;  1MBG A;  3G1O A;  1IJW C;  4G12 A;  1WCM J;  2JA5 J;  4QSH A;  3HOU J;  1JUS A;  3BR2 A;  2KT0 A;  1UHS A;  2E19 A;  2OF7 A;  1LFU P;  5EGO B;  2HDD A;  4IHW A;  2CUF A;  1E3O C;  3JRA A;  3HOZ J;  2EZH A;  2ECB A;  4XID A;  3BR3 A;  5EYR A;  2DTZ A;  3BTC A;  5EZG A;  4CYC A;  4NDL A;  2YU9 J;  2AO9 A;  1VFC A;  3D1N I;  1JUM A;  2M0C A;  2EH3 A;  2EZL A;  2FQ4 A;  4D5C A;  3GTG J;  2NS7 A;  1GVD A;  3WHC A;  1NTC A;  3LSR A;  1X2N A;  2R5Z B;  2L9R A;  9ANT A;  4M3B A;  4DW6 A;  3MN2 A;  2Y2Z A;  5K7H A;  2DA2 A;  3NAR A;  2NVX J;  2Y9Y A;  1Q1V A;  1GV5 A;  5E3L A;  1ZR4 A;  3E7L A;  2NOG A;  1SFO J;  4JX6 A;  2XB0 X;  1F43 A;  2ID6 A;  2FD5 A;  5M5X J;  5F0F A;  2R5Y A;  1WGX A;  1Y1V J;  5M3M J;  4EEF G;  2CRG A;  3HEF A;  3PM1 A;  4B1R A;  1OCT C;  3FIW A;  3IH2 A;  3TED A;  4Y52 J;  2EBI A;  2GBY A;  4V2F A;  3HKZ N;  5EG0 B;  3B6C A;  4FTH A;  4FE7 A;  4UUS B;  2EZI A;  3Q0U A;  2HOS A;  2DA5 A;  1IDZ A;  2R7Z J;  4QTR A;  1AKH A;  2VI6 A;  2QCO A;  3G1M A;  2LVS A;  5K7Z A;  2HXI A;  1OJL A;  3JRD A;  4A69 C;  5M5Y J;  3VPR A;  5F0C A;  5M5W J;  4A3C J;  5E3N A;  3BG5 A;  3L1P A;  2DA4 A;  4C3J J;  4D7N A;  1LE8 A;  3GTK J;  2XPW A;  2NVY J;  3S1N J;  3HOY J;  1ZKG A;  4A3I J;  1TWH J;  1WI3 A;  2XGE A;  2O8K A;  5J1R A;  1WH5 A;  2FJ1 A;  1MBE A;  2LKX A;  1OFC X;  3JRC A;  4A3B J;  2JJ7 A;  3NAU A;  4AC0 A;  1H8A C;  1RKT A;  3LSG A;  1QVT A;  1RR7 A;  1UMQ A;  2P81 A;  2X48 A;  3JRF A;  2EQR A;  2M34 A;  5F27 A;  2LK2 A;  1H88 C;  3BQY A;  3S1M J;  3ZQL A;  1MSE C;  2HOA A;  1I3Q J;  5BNG A;  2IBD A;  4Y7N J;  2HYJ A;  1ETO A;  2AHQ A;  4M6V A;  1BJZ A;  3S2D J;  3GTQ J;  2LP0 A;  3GTP J;  3SFI A;  2JMW A;  5F04 A;  2COB A;  3DEW A;  1ZR2 A;  1Y1W J;  5JLW A;  2K9S A;  1IGN A;  1T33 A;  1TWF J;  4GFB A;  1BA5 A;  3S2H J;  4JYK A;  5DTD A;  1A6I A;  1K61 A;  5IOY A;  2X9D A;  2XPU A;  4HNV A;  2K9N A;  4A3L J;  4A3F J;  2DMN A;  4BY7 J;  3S1R J;  3BR0 A;  3DCF A;  5C4X J;  1GV2 A;  3A02 A;  1ZGW A;  4X1E A;  1JTY A;  1P7J A;  1ORK A;  4DZJ A;  5EEA A;  3OSG A;  2L7M P;  5GPC A;  1ZQ3 P;  4A93 J;  3GTJ J;  1JKP C;  1MBH A;  1X2M A;  1NK2 P;  2R93 J;  1JT6 A;  1XS9 A;  3CQZ J;  2CJJ A;  1ZTR A;  4M3D A;  1BW5 A;  4BY1 J;  3LSP A;  4M3G A;  4MLO A;  5IPA A;  4S0H B;  4IHV A;  1W0T A;  3A03 A;  4C2M J;  1IC8 A;  3S15 J;  2R5Y B;  4MFE A;  1IDY A;  2Y0S N;  3BR6 A;  4B3A A;  3BQZ A;  2DMU A;  3ZQH A;  2E2I J;  3HOX J;  3QPS A;  2XGC A;  2ME6 A;  3JRI A;  1VI0 A;  1I6H J;  5F0H A;  2LTP A;  2CQX A;  1HOM A;  2TCT A;  3HDD A;  5J3L A;  1FIA A;  3LOC A;  2DA7 A;  4A3G J;  1AKH B;  2D5V A;  3BG9 A;  4MFD A;  3BTL A;  3HGY A;  1IG7 A;  2WB1 N;  3FKI J;  2L0K A;  2MG4 A;  1U9N A;  2R92 J;  3IH3 A;  5IP9 J;  5FJ8 J;  2JA7 J;  3BT9 A;  2ELK A;  1D5Y A;  2NS8 A;  4I76 A;  1JT0 A;  4JP0 A;  4I6Z A;  1XC5 A;  3S17 J;  1WH7 A;  1K83 J;  4LOC A;  2DN0 A;  5J1U A;  1POG A;  1LE8 B;  3GTL J;  1UG2 A;  3SDG A;  2O9L A;  5FLM J;  2X6O A;  4RDU A;  1P7I A;  2QF7 A;  3HBL A;  1SAN A;  3W6V A;  2IEK A;  2WAQ N;  3ZQF A;  1ETV A;  4MO7 A;  2HQ5 A;  4BXX J;  4BKX A;  1TWA J;  3K2A A;  3Q0W A;  2NVQ J;  1MBF A;  5GPA A;  2KDZ A;  2VUM J;  1FIP A;  3HGG A;  2DMP A;  2W48 A;  3H0G J;  1I50 J;  3M4O J;  2ME0 A;  5FLV A;  1ETQ A;  5E3O A;  2IAI A;  5FKN A;  1LFB A;  4QIW N;  1ITY A;  3TW7 A;  3BG3 A;  3FK7 A;  2VKV A;  3GTO J;  3BTI A;  1EF4 A;  3FK6 A;  3ZQC A;  3S14 J;  2E1O A;  3JRH A;  4DZP A;  3JRG A;  3HM5 A;  1R9T J;  3O8G A;  1H89 C;  1JKQ C;  3GBG A;  2I10 A;  2R0Q C;  4C3I J;  1U78 A;  4W1U A;  2L7F P;  2RAE A;  2B63 J;  2M9H A;  2VKE A;  5C44 J;  4JX4 A;  3ZQI A;  3I4N J;  5DS9 A;  4JX5 A;  3Q0V A;  2LD5 A;  4IHY A;  4V2G A;  3CCY A;  2CU7 A;  5FKM A;  2MSY A;  5C3E J;  2TRT A;  3OIO A;  1W0U A;  1DU0 A;  4A3M J;  1CQT A;  2NVT J;  3UKG A;  4C3H J;  4M3E A;  3A01 A;  1IUF A;  2OPT A;  3F0C A;  5IP6 A;  2E2J J;  3TP0 A;  4AUX A;  3RZD J;  3GTM J;  3TW6 A;  3CMY A;  5IYC J;  4BBS J;  1RKW A;  3MVP A;  4RBO A;  1U9O A;  1IV6 A;  1PUF A;  1HDD C;  2K9Q A;  3TP3 A;  4FCY A;  2DA6 A;  1HCR A;  1A5J A;  1MNM C;  1FJL A;  1X58 A;  4B4C A;  1GDT A;  2LR8 A;  2GM4 A;  2DMT A;  2LY9 A;  2K40 A;  1VND A;  4UUT A;  1AHD P;  2E2H J;  4L5E A;  5IP7 J;  3H3V K;  1MBJ A;  3PO3 J;  2O7O A;  4D5F A;  1HDP A;  1DU6 A;  3RQI A;  2Y9Z A;  1JKR C;  3JRB A;  3Q3S A;  1JGG A;  4XK4 A;  1F36 A;  2HI3 A;  3BR1 A;  1JJ8 C;  1HF0 A;  1YRN A;  1XG1 A;  2DMQ A;  2WV1 A;  5EZH A;  3B6A A;  5E3M A;  4DYR A;  3LNQ A;  3M3Y J;  2M8G X;  3RZO J;  2JA8 J;  1G2H A;  1B72 B;  1GT0 C;  2L7Z A;  5EGO A;  3OOU A;  3BTJ A;  3IH4 A;  5EDN A;  3G1L A;  5GP9 A;  1Z77 A;  2ID3 A;  2LLK A;  4XRM A;  2HOT A;  4X6A J;  1ENH A;  5HOD A;  2DA1 A;  3QPL A;  4J19 A;  5C4J J;  1Z0X A;  2HXO A;  2VPR A;  2CUE A;  4W97 A;  2JN6 A;  1MSF C;  2MGQ A;  1RPW A;  2H8R A;  2XB5 A;  2ECC A;  4BBR J;  1ETY A;  2G0E A;  1B72 A;  3LSJ A;  2Y31 A;  2MW8 A;  2R5Z A;  1NK3 P;  3PO2 J;  4ABZ A;  1B8I B;  3ZQG A;  1AU7 A;  5EF6 A;  1VF9 A;  5FKK A;  4M3F A;  2DJN A;  3O8H A;  5F08 A;  3FIS A;  5FKL A;  2JA6 J;  3CDL A;  2EZK A;  1APL C;  1MH3 A;  2H1K A;  1MBK A;  3JRE A;  4XRS A;  1ETW A;  4A3J J;  1BL0 A;  1B8I A;  4DYC A;  1TWG J;  3HB9 A;  1QVU A;  1ETX A;  1QPI A;  5K7F A;  1O4X A;  5EG0 A;  1FTT A;  1U8B A;  1RES A;  3JR9 A;  2ZB9 A;  4UUS A;  2PMZ N;  4FE4 A;  3HOW J;  1T56 A;  5FKO A;  4IHX A;  1FEX A;  3S1Q J;  4AYB N;  3A01 B;  1WPK A;  5J1Y A;  2XRL A;  2XPV A;  4XIC A;  1ZK8 A;  4FIS A;  1S7E A;  2LFB A;  3ZOB A;  3I4M J;  2M2E A;  1ETK A;  5F1J A;  2XSD C;  3MKL A;  5IYD J;  2JWT A;  1TC3 C;  5IYB J;  5IOZ A;  1PUF B;  1JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...