4UV7H

The complex structure of extracellular domain of egfr and gc1118a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
218
Chain Sequence
b'EVQLVESGGGVVQPGGSLRLSCAASGFTFSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRFTISRDNSRKTLYLQMNSLRAEDTAVYYCARHGSPGYTLYAWDYWGQGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR
publication title Gc1118, an Anti-Egfr Antibody with a Distinct Binding Epitope and Superior Inhibitory Activity Against High-Affinity Egfr Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 218
sequence length 223
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uv7H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uv7H02
1FORH 3LMJL 2B8OT 4PLJD 1RHHA 5SWZA 3TZVA 4ZYKB 1DQDH 1BZQK 3SDYH 4OLVL 4G8GA 4QRRD 1YEEL 1IAKA 4YFDB 5I15H 1JGLL 1KJ2B 5JQ6L 4L4TE 3DGCR 1IEAA 2NY5L 4M1GH 3PHSA 3V6FA 4WTXA 4HG4K 3GMLA 1GGIH 4RRPG 2XN9B 5BOZG 3GBNL 4G8FA 1RURL 1UKTA 3LD8C 4KQ4L 1IC1A 4PJ8C 3L95B 1QD0A 3WIHH 4J3XA 4M1DL 4B5EA 5C2UB 2XNAA 3WFCL 2V6HA 5GRVL 3BMVA 3S4SG 4EDXB 1QO3B 3RU8H 2W9EH 3FHAA 3B9KB 5TE6L 1BFOA 4HFUL 3KPSE 3M8OL 2BC4B 1C5DA 4NQVB 3HI6H 4OCXL 4YXHL 5J06A 1JTOA 1D7FA 1Q38A 4KWUA 4ZFZB 4F15B 1Z5LB 4OQ1A 3LQMA 4KK6C 5CZXD 5L8LB 1GGBH 1QLRA 4JG0H 4R4BA 3EO1A 2V5SA 3QXWA 2XZCH 2NY6C 4X8JA 2G2RB 2VQ1A 4K3GA 3MCKA 1YDPA 4MDJA 4FQXB 2EYTA 5JA8B 1HI6B 5DJDB 1JPFA 3WFBH 4AEFA 4AYFA 1EHAA 1X4XA 3UMTA 2IQAB 4ODXA 3C8KA 1NLBL 3PQYB 5ICYB 4KVCH 4Y19B 4Q9CA 3SJVA 2NNAB 1XGQA 4MJIE 3RAJH 2Z31A 5TQ2L 1AC0A 3QEHB 4M5YH 2QSCL 5HHNA 4R6UA 4CNIA 3C8DA 2Y5EA 1ONQB 1S9VB 3WUWA 4BM7A 3FB8B 2GJ6A 4WUKH 4QHKI 3NFNB 2C9AA 2CIKB 4IS6A 5I8CA 2VLMD 2HFGL 5I6XB 3QDGE 3SDDB 1A14L 5IOPB 4S1SH 3W81A 5F7UA 2VDRH 4IOSD 3E6HA 5CD3A 2VYRE 3CIQA 4TNWF 1Z2KA 4FTVA 2IJ0C 4LLQA 1FO0L 4J3SA 4UAOB 3BE1L 4UINH 1KCRH 4LIQH 1M05A 4KKBD 3SDXB 2BSRB 4ZUSB 4Z8FH 4OZIB 4MA8H 2KDGA 5DFVC 3R8BB 4MAUH 5TE4L 1FQ9C 4KY1H 3OAZK 1WCBA 2J8UA 4LCWB 2BNUB 1MAMH 3NABL 4R7DB 4DTGH 1CTOA 4OD1L 4F33A 3GMNB 4JFOA 5DUMH 1EHLL 32C2B 4BQ9A 1MELA 2IALB 3QUXD 4JRXA 1VB9A 4KTDH 3SCMD 4JQIH 8FABA 4Z7QE 4KVNH 1CD0A 3TO4C 3ESUF 1GC1H 3QBTB 4WJ5B 1UACH 4JJ5A 3O3BB 4BSWA 5ENWA 2XZQH 1RUAL 4M02A 4G6FB 1QP1A 3VGBA 1K3ZA 3F6IA 4WCYL 3C60A 3I50L 3HPLA 5E7BA 1D5MA 2IQ9H 3GGWB 1B6UA 2GEEA 1ZA3B 1J5OH 3BQUC 2V5YA 1UCBL 4GRLC 3SDCD 4YH6A 5J3HD 4JG1L 1OL0A 4X6BA 3LZFH 5F7MC 4ELME 4JHBA 1JP5A 3MRBA 3TBVA 4B50A 2UZIH 4ALAH 2CLZA 1UXWA 2VLKD 3CMOH 4YPJA 4OF7A 4NQXA 1BQHG 3MBEC 1MCRA 2J8OA 4I3SH 1NLDH 3JWNC 1XGPB 1AQKH 2X4UB 2I27N 1WBZA 3DRQA 1MHCA 1KN2L 4ZXBA 1MI5E 3T0BA 1DE4A 3T2PA 4ZDHA 3IAPA 3WDIA 2K3TA 5F9WB 4TTDD 4PTUB 3L5XL 4PJAB 1OTSC 2ESVA 2Q3AA 1WC7A 3RHWK 4LLDB 2LQRA 3WDHA 4JB9L 1FL3A 4ZO6A 4Z7OE 4LGRB 4XP5L 1LE9A 1CE6B 2VN4A 2PXYC 3HNTL 5I30H 3LSOA 3X3FH 1FJ1A 4RAVB 3QDME 3WS3B 4LARL 2AKRA 3C08L 4GOSA 1J86A 2ZUSA 4M62L 4Q9RH 3O4LA 3JWDH 1A7OH 5TF1L 4PJCE 4DGVH 2V2WA 1L9NA 3R1GL 1FVEB 1XGTA 1AGDA 1SHMA 3QFJA 1RI8A 5DXWA 3TVMA 5IVOA 2OJZH 4Y5XA 5F1OB 1U3YA 5KSAD 5BCAA 4NUGH 2BVPA 3L3JA 4YIQA 4RA0C 2VDQL 5FKPB 2QHLA 1R3JA 3O6ML 4G7YH 5D7SL 1KNOA 4K9EH 3CSYB 3K74B 4KAQL 2HG5A 5BW7C 4OLUL 2UY7A 2IANA 2CUIA 4PLKC 1FYTB 1L7TH 1NCAL 4U0QB 4CW1A 3T0AA 4E9LA 4O00A 4WUUB 2FX7L 3ZKND 1G7IA 4OQTL 5IQ7H 3RWGA 1OGTA 5HHXL 5F96L 3BP4B 2P5EA 5CJXC 1WGOA 5DR5L 5EZLA 3X12B 4R0LC 3UAJD 3DARA 4XPGL 2KBGA 4AQOA 4TN9A 4NPYB 3MTRA 1UJ3C 2DQUL 1BVLB 3NZHH 3GMQB 1KTDB 3SE4C 2NCMA 1B2WH 5EORL 1BZ7B 5I9QB 3O45B 3EO0A 4ZNEE 1VEMA 5ALCL 4OFPA 4RMQA 2ITDB 4QT5A 1QG3A 4V2CB 5CWSB 4RFNC 1MHPH 1BWMA 1QHOA 3QFDB 3IU4L 3RNQA 5TH2A 4WU7B 3PP3H 1SBBA 2IGFH 3LAFA 3LKQB 1C08B 2ZCHL 3DGGB 5EZJA 2E27H 3DVFA 4Z78B 4FMKA 1P4BH 2BZDA 3TWCH 5IVXE 1AGBA 3M1BA 3BKMH 1JNLH 3G9VA 1LEGB 1RJLB 3I02B 1C7TA 5DMGD 3UTZB 5IKCB 4JGMA 4JM2B 3O0RL 3BHBA 5MENA 5CINL 5ITBL 1R3KA 3H7LA 2ICCA 1BOGB 4PRIB 3IDYB 2DQFB 4O2EA 5HYJD 4UV7H 5I1JH 2NZ9C 1DLFH 1LDSA 2C1PB 4L4VD 5IFAL 2EXWD 3GDBA 3RIAK 3PHOB 1BJMA 3FJTA 4FQIH 5F88B 4OF5A 1MVUA 1FFQA 1A22B 2NY7L 3C9NA 4X0KA 4GFTB 1RHHB 4PJ9C 3WIIL 1CFVL 5SWZB 3TZVB 1HHJB 3BUTA 2C26A 1CICC 1WFUA 4UV4H 4K94H 5CIPH 3WJJC 4G8GB 3ELAT 1IAKB 4LPWA 3ALWA 3ARED 1AR1C 4WTWA 3FTGB 4DW2H 4POZC 1NCWH 1WFNA 1QSVA 2VLJB 2JB6A 1XF5A 1GGYA 4QRRE 4CN4A 3V6FB 5I8EA 3FQUA 4U1HA 4NKOA 3M45A 3ARWA 3N9GH 4G8FB 4LNRA 5CGTA 2OXHA 4JZJC 3TV3L 2B4CH 1WIUA 2HH0H 1CF8L 2DQHL 5IB3B 5JR1H 2G75A 1WT5A 2ADFL 4EKXA 3H42L 1EFXD 2DL9A 2FHBA 1MPAL 1YY9C 1ED3A 1G84A 4Y2DD 5LGKA 2R2HB 3ZHDA 1JZ4A 3B8YA 3BPNB 4HWNA 1BBDL 4J3UA 5DQJA 1QFWL 3VE0A 4S0TD 5HVHC 3MRGA 3U4BH 5C09D 4C55A 4TVPD 5D7KD 5EOCJ 4W4OC 4LQFL 4P23B 4Z7UA 3T77A 2GCYA 4JO3L 4MXWH 4U1LA 1QLRB 2UVFA 3IFNH 4R4BB 3MJ9L 4X8JB 3L6FB 2VQ1B 4XHJC 4Z7VA 3MCKB 3I9GH 5ID0A 5IBUB 2EYTB 4NN5B 1JHLL 3MO1A 3U4AA 2XTJD 3NFPA 2X4SA 2X1XR 4QXGH 4ODXB 3QCUH 4Y16D 3C8KB 2VDML 1X5KA 3SOBH 3TT1L 1CLYL 4NQTA 4TSCL 2BFVL 5E56A 3KPRD 1IGCH 1OF2A 3RKDD 4JO4H 1MFCL 3SJVB 1XGQB 2Z31B 5A3ID 1FPTL 2CRZA 4PY7A 3S34H 5FYLL 5JOFA 5FHBL 4K3DH 3MV8D 3VRJA 3T2NL 5HHNB 4D9LL 4O02L 4EXKA 2X41A 3RBSA 3QA3B 3WUWB 3QDJA 5CZVH 1R3LA 2GJ6B 3K4ZA 5I8CB 4IS6B 3W9DB 1EPFA 4XNQA 1DQDL 3SDYL 2GY7B 1CYGA 5MI0C 4U3HA 4OZGF 4PGBA 5I15L 4GAJH 3E6HB 5CD3B 2VLME 4BH8A 1DEEA 3MX0A 5FO8A 2XA3A 1YPZB 5GZNC 2QADC 2R2CA 4LLQB 3HR6A 1MCLA 1GGIL 2R0WL 4OF3A 1M05B 4HKBA 2V7NA 3B5GA 3O3DA 4M6MH 2Q86B 3LRGA 3GMOA 4EJ1C 4HH9A 3QCVH 3BDXA 1LEIA 3ZT7A 5AAWA 2W9EL 4DZ8A 4F33B 3VGAC 5FM8A 4JFOB 1K8IA 2Q3ZA 2DIJA 1TCMA 5J1SC 1SVZA 1ZA6A 1AR2A 3TIDB 1QLFA 3OAZH 3DSFH 3RWJA 4NT6B 8FABB 3QUMA 3HI6L 4MA7H 3CFIC 2CJUL 3K2UL 2V9TA 1I1YA 3O8XC 4DCQA 4JJ5B 3MA7A 1SJXA 2AV1A 1HKLH 5AYUH 4BSWB 5GZOD 5F1IA 5ENWB 1FNSH 1NFDA 4XPTH 1JNHA 1GGBL 5IHZA 4JG0L 5CEZE 4R3SA 4XP9L 1DQTA 1U3HB 5I16A 3HPLB 4UNVA 5FK9A 3V7AG 1D5MB 3OX8B 1WICA 4DN4H 3GI8L 3WFBL 5BVJA 5D2LA 4OCWH 2DQEH 3MOBH 3MRBB 1DSFH 1TPXC 2AJZA 3TBVB 1B88A 4KVCL 3VRLF 1UB6B 2CLZB 1LEKA 1UXWB 2NX5D 4AM0A 2BVEA 1GGTA 2OL3A 4NQXB 1OAZH 5D5MA 2ZCLL 4QWWC 3RAJL 5T1LD 2Z4QA 1YEDB 3DX8A 2Y07H 2VLKE 1V3KA 3VFSA 4JKPL 3BN3B 3L7FA 1WBZB 1WTLA 2EZ0C 4G8IA 2P43B 4YBQD 2Q87A 1MHCB 5D96C 4WUKL 4ZXBB 1LD9A 4Z7WF 3WIFA 4RGMB 1C1EL 1UM4H 1MJUL 3MMEA 4ZDHB 2JJSA 3VWKA 1FNEA 4MYWB 1R5WA 1WUNT 3WN5A 4S1SL 2ESVB 1WC7B 4LSRH 2VDRL 1KXVC 4AEHH 4GLRI 4L3ED 1FL3B 2D0FA 1WV7T 2F53D 1FZJA 5DA0B 3MLRH 1DBBH 5KVDH 2UY6A 4CU6A 3HFMH 4HV8A 4F7EA 4HEPG 3HG1A 4UINL 1KCRL 3LSOB 5DLMH 1FJ1B 4HLZH 4LIQL 5CAYB 1UKQA 2AEPH 2FX8H 1JVKA 2H1PH 4MHHI 2AKRB 4Z8FL 5L8JB 4MA8L 4D0DA 3O4LB 4XWGH 4JFZH 2V2WB 4U05A 5DJXA 4MAUL 5EUOF 1J0IA 4KY1L 1XGTB 1AGDB 3MYJA 3VFPA 3QFJB 3D18A 3UBXA 4LAJH 3VA2C 2BY2A 5DGRA 2EE6A 4DTGL 1FAKT 4UI2A 5DUML 1IC5H 1X5FA 2BVPB 3L3JB 4BH7A 3WD5H 1R3JB 1EJ6A 2DJUA 3FO9A 1TTFA 4KTDL 1KNOB 4YK4C 4FQ1H 5T1KA 4GLRH 4WW1A 1UACL 3MLUH 3QI9D 3NA9L 3O9WA 4IIQA 3ZDZE 2BY0A 1PAMA 1HKFA 2XZQL 4K23H 3C6LA 4YDJA 2IANB 4CW1B 1EO5A 2KZWA 2HLAA 2WUCH 2F9BT 3EYQC 1FSKB 1G7IB 1A6TA 4HXAL 3RWGB 3N1FC 1OGTB 2IQ9L 4Z18A 4LKXA 1J5OL 2P5EB 5EZLB 3KXFD 5GS2D 2DMCA 1URLA 2OJEA 3QZWA 3ZMRA 2IC2A 4XNXH 4U6XA 1JPSH 5JW4Q 1ROWA 3ZYZA 2UZIL 4ALAL 1AO7A 3CMOL 2K7QA 3BVNA 4HHAA 5E8OA 1RZJH 3BKJH 1IARB 1NLDL 4WWID 3EO0B 3VXUA 5ALBL 5E6ZA 2YA1A 2ICWA 1P7HL 2YZ1A 3FRPG 1DBAL 4JY6A 4LFHD 2R0ZL 1RUMH 5IR1A 1HK6A 4FS0A 1HHKA 2EDLA 3AROA 3RNQB 5TH2B 1IM3A 4ODVH 4ZO7A 3S5LB 3OTTA 1EGJA 1PY4A 3OF6A 5EZJB 2XT1B 1CVRA 4CMHC 3VXRD 5EU6D 4HLZG 5E2TL 5ADPL 4LLAA 5HDBE 1AGBB 2P48B 3M1BB 4XVUD 5HI5D 4QRQA 4ZFOB 5I1EL 1YJDC 5I30L 1QVOA 3X3FL 1CZ8H 2AXJA 2EDTA 4FP8H 4Q9RL 3JWDL 3BHBB 5MENB 3G6JA 2EEAA 4DGVL 1R3KB 3VMPA 5E6IA 1JYVA 3CFBA 4O2EB 5I1LA 1DBJH 1CD9B 1T89A 2OJZL 4P46D 2GTWB 25C8H 4NUGL 5J12C 4Y16A 2JJTA 5HYJE 5KSBF 4YWGH 1FGVH 1MVUB 1NBVH 4K9EL 3ULUH 3C9NB 3TJEH 1CWVA 2Q7YA 2VXVH 1BD2D 3IS1X 2VQTA 4N0YH 2HT3C 3I2CH 4ODBD 4MHHG 4X80H 1D6VH 1MOEA 3F6LA 1KUMA 3REVB 1L7TL 2D4FA 4EIZC 4YDKL 2B20A 4JJHA 4M6NH 4UMGA 2JB6B 3U0WH 4IDLA 1E4XI 3ARDD 5I8EB 4C4KT 3SGKA 15C8L 1WCQA 5EBMA 3FQUB 4U1HB 3HPJA 4NKOB 4WIQA 5BV7C 5LWYH 1T5WA 4LNRB 5FDWA 3BPOC 3GJFK 3VGDA 2X9XA 4KJPD 1TCRB 4LVNC 2G75B 4PJ8A 3QO1A 4O4YH 1PYWA 5D8JL 1MCCA 1B2WL 4KMTH 4W4NA 1NAMH 4JQXC 2DWDA 3T09A 3VGGA 1U95A 1J05B 3RVWC 4U1GC 5DQJB 1MHPL 1F5WA 5IW3A 2AS5M 1E4XH 5B39G 3MRGB 1UCTA 4JQVC 4OD2A 4PJEF 2IGFL 3T77B 4Z7UB 1T2XA 2GCYB 3ZDXF 3CFEA 4U1LB 5KSAC 3IDIA 2E27L 3L9RA 2WINA 1DDHA 1RZIA 5DJYB 5C09E 1P4BL 5MP6H 4TVPE 4Z7VB 5D7KE 5ID0B 2UWEF 5CUSL 1XF2A 4GSDH 3T4AA 3MO1B 4WFFD 2X4SB 4XAWL 1A6ZA 4ZFGL 4JVUA 1Z9MA 2Y7QA 3QIBD 2LU4A 3RZCD 2E6PA 3CX5K 1I3VA 1GOFA 4UV7L 3ZKNC 3LN9A 4IOFD 2RJMA 2ZOKB 3QNXA 4N9GA 4NSKB 2ZSVA 1DLFL 1H15A 1YY8B 1M7IA 3KPRE 3MUJA 1G7JA 5IEKB 2R2EA 1T20A 4R4FH 3VRJB 5FB8A 3QNYA 2CDEA 1NUNB 3NAAH 2EC8A 1QR4A 2KL6A 3KYMA 4UT6H 3TO2A 1YQVH 3WFHA 3QDJB 3ZTJH 1R3LB 3E3QC 3MV8E 4P2OD 1FFOA 4XNQB 5AUMA 4LASH 4GG6F 4UV4L 4K94L 4Q0XH 4DGIH 5KVMC 4UIKH 4PGBB 4D94A 4DW2L 4BH8B 1NCWL 1DEEB 4EI5D 5FO8B 4X98A 4H20L 2PYED 4NNYA 4PD4K 1XCTA 2IADA 4HKBB 2V7NB 2B4CL 2OK0H 4Q2ZA 1KJ2H 2JJWA 3IB4A 1T7WA 4HBCH 4N5ED 4PJFE 3GMOB 3OXSA 5JR1L 1AD9B 1A6WH 2EDYA 3RL1B 4I3GA 1LEIB 2AK4D 3J7HA 1GGUA 1HXMA 2C3WA 4DZ8B 5IG7A 3NPSC 1K8IB 2VLRA 5A1AA 2ZG3A 3LQAC 1ZA6B 2V5TA 5CJQH 1QLFB 4LPVA 3RWJB 1XIWC 5K9OA 5HD8C 4Y4HD 1CIDA 3O2DA 5TQ0H 5JW4R 4HWEH 3MA7B 2AV1B 5JORA 2DLTA 3TO4A 4GMSH 5F1IB 4Y4FD 3U4BL 1LO5A 1NFDB 4OLWH 3CLFL 4MXWL 1JNHB 5IHZB 4UBDC 3IFNL 4R3SB 1I3GH 4Y89A 3CK0H 5I16B 5D1ZD 5FK9B 1PSKL 3I9GL 3QSKB 4XPBH 3ZT5A 2EIEA 3QJHA 4KHTH 5IB2A 5BVJB 5DUBA 3KG5A 2CO7B 3FZUC 1H3WM 1ZTXL 3OSKA 4PJDF 4L3CA 3TFKC 4WHYG 3CXDH 2VR5A 2AJZB 2AW2A 3SOBL 1IILE 4XVSH 2HRLA 1TZHA 3V5HB 4AIXA 5GIRA 1LEKB 3F58L 4AM0B 3AREC 5EIQA 1A6VH 4JO4L 3GRWH 4QYOA 5FV1L 2Z4QB 1HYRC 4Z9KB 5IT2H 1REIA 2QTEA 3S34L 3MBEA 2NX5E 3HNSL 1G0YR 3FQTA 3ZTJG 1FLRL 4K3DL 2EE2A 5GJSH 1BEYH 3F7RA 1ZT4A 1WZMA 2D7OA 2FNBA 1WAAF 4HFWB 4P2QA 3VFSB 3L7FB 4H8WH 4G8IB 3VDBA 1RZKL 4FFZH 5CZVL 1QSEA 1OGAE 4MZ2A 1YUHA 1JE6A 1LD9B 5C0EA 3WIFB 2XOTA 3VD3A 3MMEB 3VWKB 1FNEB 1R5WB 3WN5B 1LO0L 2AV7A 1N64H 3BISA 3Q3GA 4YUEH 4Y2DC 2CKNA 4RGNB 4P57A 4X7FC 4PB0H 1BGXL 3MRKA 5E4EB 4YAQA 2QHRH 1FZJB 4PJGA 5CHNB 5FF6A 2VISA 3AY4C 4HV8B 4F7EB 3H3BC 3B9EA 1BFVH 1Q0YH 3HG1B 1P1ZA 1CTNA 4L3EE 2F53E 4OLXL 4M6ML 1MFEL 3RUGF 4D0DB 3VXRA 2R0KH 3CLEL 5EDXA 4LSSH 3FRUA 1DANT 3AMLA 2R15A 3VFPB 1K4CA 2Y5TB 3D18B 3UBXB 3LVEA 4OD3H 4X9GA 5CJ5A 1CT8A 2VXUL 1CGWA 4BH7B 1S78D 4KK9C 2HJFB 4V1DD 3FO9B 4R4ND 3DSFL 4MA7L 2DBLH 2NY0B 5T1KB 4WW1B 1VEOA 1I1CA 3Q6FA 3O9WB 1LP9A 1HKLL 3A6CH 4IIQB 4L4VB 5AYUL 4ZO8A 4PJXA 4YDJB 5CD5C 4RDQG 3QEQA 1L6ZA 3TEUA 1GVIA 2HLAB 1JI1A 1K2DA 1PEWA 3HI5H 3TJHD 1A6TB 1BD2A 3CVHA 3P3YA 4LKXB 4DN4L 3BH9A 1YEJH 1A7RH 3MOBL 4LDLB 3QZWB 1HH9A 4HGWA 1MAKA 5C08E 5CJXA 3RTQD 4U6XB 3KXFE 1FC2D 1X4YA 1NC2D 4ZUUA 3HAEA 4JO1H 1AO7B 5ACMA 5C0NC 4I4WA 4HHAB 2IH3A 5E8OB 3PWUA 2Y07L 2YD9A 4QNPF 3VXUB 3SE4A 4B41A 1J18A 5FECA 1U8JA 1SY6A 4GQ9H 4MJ4A 1OAKL 4Z76A 5B3JF 3IVKA 2HA1A 1G9MC 5IM7B 4JY6B 1EFXB 3JVGC 1WFTA 5D70H 1VA9A 2L0DA 3BOVA 5IR1B 2YZ8A 2OZ4H 1HHKB 3TA3C 1UM4L 4GRWE 3LKOA 1IM3B 3VWJC 4CDHA 4JFEA 2NZIA 3LRHA 4LSRL 3QAZC 4AEHL 2C7UA 2MWCA 4B53A 3WCYA 1DBBL 5KVDL 3HFML 4GW4A 3QUKA 4YZFF 1J8HD 1QVOB 5EU6E 3U7WH 4I8DA 2AEPL 2FX8L 5F7LB 2H1PL 1ACZA 5KVFH 2RIKA 4NJAH 3PP4H 4P4RA 4XWGL 5LAXA 2V9RA 3QXAB 2IAMA 2VSDA 3CFBB 5I1LB 1KXQE 3VGHA 4JHZA 1NGWB 2EC9U 3KAAA 2XTJB 3KYOA 1FFNA 1IC5L 1CBVL 4Y16B 1SJVA 4OSUH 1QEWA 4ELMA 4RMRA 2WLZA 3U4EA 3O6FD 3ZO0A 2YC1A 2Q7YB 5DEGA 4LHUD 2J3SA 2D0GA 1JUFA 2X89D 1IVLA 3ZZ1A 2BNQA 3MPCA 3LHPH 1I85C 1J1OH 5EU5A 1A7PL 3V4PL 4Y4KA 1CICA 1JF1B 4KQ3L 2WUCL 3BYTA 4K71C 1HINH 1QKZH 5KS9F 2W07A 3WJJA 3IXTB 4OGZA 2PYFA 4B7LA 1MH5B 3HI1A 1CXLA 2V17H 4DWHA 5GJTH 3HPJB 2XACC 4P48A 1T5WB 2QJDA 4GXUM 2O61A 1CFQA 1JPTH 3NN8A 4EDWH 1HWGB 5IVNA 2EXYD 4XNXL 3H2WA 2Z92A 4N8PA 3TN0D 3LD8B 3QO1B 4BSVA 3HUJA 4N90D 4MD5A 1VACB 3BKJL 4DN3H 4U1IB 1TZGL 3RHWF 2YUWA 4L4JA 4JHWH 2DWDB 5HI4C 3L3HA 5KG9B 4LCUA 4L5FL 3SKMA 3T0ED 1GHFL 5E95B 1RUML 3QG7L 4U1MA 3ULVF 2YBRA 2NY5C 4DAGH 4OD2B 5IEHB 3PGFH 3AS0A 3CFEB 3IDIB 3D3VD 3L9RB 5IVZB 2WINB 1DDHB 5LCVH 1RQ5A 3MLWH 4JFFA 4W4OA 1RZIB 1JK8A 4IEFB 4DK3A 2H3NA 4LPCA 3T4AB 3FT4A 1P6AB 3RPIA 1G7LA 1A9EB 2AP2A 1NMBL 1CDCA 4FP8L 3OBAA 2QEJA 4F9PC 1KFAH 2WWKT 3QPQD 2Y7QB 4WFFE 2IF7A 2BY1A 1UH3A 1DBJL 2FLRT 4HF5H 3V5KA 1X5AA 1YYLL 3QNXB 2HLFC 4N9GB 2ZSVB 4K7FA 2IPUK 1H9VA 1H15B 4LU5L 25C8L 1KTKE 1M7IB 1ODAA 1G7JB 2R2EB 1T20B 4X4MA 5FB8B 3QNYB 2CDEB 1A9BA 4YWGL 1HYSC 1FGVL 3ULUL 4N5UA 3KYMB 4OGAD 3TO2B 5DMJB 3P30H 3OR6A 4N0YL 3I2CL 4M03A 1D9KC 4HC1A 3ILPA 4HBQA 3GKWH 2WUBL 3V0WH 4D9QD 3KYNB 4X80L 1D6VL 1FFOB 1U8KA 4OZFA 5AUMB 1XR9A 3O3AA 3UC0H 1BJ1H 2B7DT 3WHE1 5FKAA 3WFDH 3SKJL 1ZEAH 4PRHD 4M6NL 1F6FB 2QV2A 4NNYB 2OYPA 2FB4L 1XCTB 4HKZA 2PW1A 4RNRA 1TJIH 2IADB 3MA9H 2F58L 4MQ7A 2ZKHH 3D48R 3OXSB 5C70A 2HT2D 4JY4A 4MD0B 2NYYD 1NCUA 5J11C 1JGDA 4X99A 2DN7A 1IGJA 4KMTL 4JPKL 5D1XD 2DLIA 4GBXC 5IG7B 4YFEA 2VLRB 1JIBA 4N1EA 4UOW1 1F3DH 2FWOA 1YNTA 2OR7A 8CGTA 2AK4E 1U92A 2MPAH 3JTTA 5K9OB 3OKKA 4MA1B 4JFXA 3QUZA 1MJ7L 4CMMA 5JORB 3W5MA 5TE7L 3TO4B 3TBYA 3CFJA 1NDMB 2OLDA 3RGVA 5GS1A 3O8XA 2CPCA 1ZVHA 3KLHD 1I1AA 2HTLC 3NIGE 2VH5H 1OQOA 1KPUA 4Z95H 5MP6L 4ETYA 2YPKA 3QI9B 2E9JA 2FIRT 3RIAF 4FQJH 4QHMB 5IB2B 5DUBB 4O2FA 5FA3A 1H3VA 3NIDE 3H9SA 1CFBA 1N8ZA 3CFCH 4L3CB 4DKDC 1MCNA 1EBAA 3KJ6H 4F8TA 3KWWB 5GIRB 2WQ8A 4QYOB 4B7IA 4KV5E 3OV6A 3ARDC 3MBEB 4X6DF 5E4IA 4KJWC 3BMWA 4N0UE 1ZT4B 1OAYH 4P2QB 2CLRA 4QOKD 5CSZB 4YR6B 4PRBA 5BZDB 1QSEB 4KJPC 3A6BH 5C0EB 2QKIA 3DUSA 4LASL 4LMQI 5E8NA 4Q0XL 4DGIL 4KK5D 2VDNH 4M7LH 1U2CA 3NGBB 4P57B 3TYGH 4GAGH 3G6DH 2WBWB 2ENSA 1CXEA 4PJGB 3UTPD 1OTUC 2VISB 4NN6C 5K59E 1U8IB 1AKJA 5CP7A 1P1ZB 3PWPD 4G8EB 2YPLA 1JCKA 4NZUH 1TNMA 3MRFB 3B6SA 3GIVA 3ZE2F 2OK0L 2I26N 4LEOA 2Q76A 3VXRB 4HBCL 4HJJL 3I3BA 5HGGS 4X9FA 3FRUB 1A6WL 4NQEE 1K4CB 2VDLH 3STZA 2I60H 1J8HA 4KI5F 1CT8B 3X11A 3VXMD 1PG7X 4RBPH 3OMZA 5C3TA 3MLVH 5CJQL 5IFHH 5C0FA 1N6UA 2KQMA 2HMID 3NOIA 5F93C 3S37X 5TQ0L 1R0AL 4V1DE 2E9IA 3Q6FB 4X7SH 3IDNA 1LP9B 3PIQA 4QF1A 4GMSL 4PJXB 3CJJA 1INEH 3QEQB 4H0IA 2YUVA 4OLWL 1K2DB 1I3GL 2Z8VC 1BD2B 4ZOAA 3H3KA 1PY9A 2CDFA 1A47A 5FYJH 4HG4J 4XPBL 3L5IA 4XAKD 4KHTL 4OZGE 3T0DA 2X89A 2JIXA 3BH9B 2MCPL 4XMLH 4HGWB 1HH9B 2AXGB 4P5TC 4FHBD 3V79C 5D6DA 3CXDL 3ARGC 4NC1E 1JL8A 1K6QL 1NL0L 3GKZA 1CGSL 4NO0D 4RIRA 5F6HI 4ZUUB 3HAEB 2DDQL 3DRTA 1ZSDA 4I4WB 5JLZA 1A6VL 1DFBH 2FBJH 5EFIA 3WMSA 4BELD 2IH3B 5JIPA 3VFOA 3GRWL 3PWUB 1UZ6F 1S5HA 1MRDH 5FV2A 3GJEA 5FECB 1U8JB 1ULVA 3BKCH 5GJSL 1BEYL 4Z76B 2W0PA 4H8WL 5FM4A 4TSAH 3EJZC 4FFZL 5DDHA 2EO1A 3BZ4A 3VG9C 3RDTC 2WM0A 3EOBA 3LKOB 5JHDD 4BFEA 3D69A 3SGJC 4WWKC 3WKNA 1F11B 4JFEB 1IGFH 1JZ7A 5DC4B 5LBSH 3JWOH 2EH8L 3QQ4A 4RMUA 1GAFH 1H8OA 3C5ZC 2C7UB 3PWNB 4MVBD 3DX7A 5FUOH 5FYLE 3P4MA 4PB0L 3GSOA 3IETA 2QHRL 4WI9A 4KMLB 4PJHA 5GGRY 4GW4B 3QUKB 1BFVL 1Q0YL 5KVEH 2IPKA 2DL2A 3VMOA 5C71A 1OHQA 1KCUL 4JO2H 1C16B 1QFPA 3IF1A 4GKOA 3BGFB 4P4RB 3QUYD 5I8KL 5LAXB 4MMZC 2R0KL 2IAMB 3PDOA 4C56E 4OCMC 2EDBA 4JDZA 1MCEA 4WFGD 1E4KA 2DQTH 3IKCA 2JLLA 4L1DA 5D1ZC 1BFSA 3I75A 2DS4A 2Y72A 3KYOB 1FFNB 4NGHH 1RIVL 1QEWB 3OQ3B 3W39A 3P0YL 1JPGA 1BQLH 2P49B 4CDGC 3U4EB 1O7VA 1UQSA 1PFCA 3FT2B 3RZCB 3EAKA 3KJ4B 5DEGB 2NY3C 1S7UA 1JUFB 2VXSH 3A6CL 2WANA 2BNQB 4LP5A 4TVSa 4HKXA 5EU5B 3WXVH 3WSQL 4Y4KB 1RIHL 2BK8A 5FUZL 4Z7WE 3UTSA 4PG9A 4XH2A 2X05A 3ULSB 1HIMH 2PYFB 3MOAH 2AERT 3HI1B 1MCJA 2GJZA 2O61B 1NCBH 4PGZA 1CFQB 5CP3A 1BF2A 1X7QA 2WNGA 3MV9A 3G6AA 1INDL 2Z92B 1OM3L 4ZFFA 3PJSA 1TTGA 4BSVB 3HUJB 2FJGB 4MD5B 3BXNA 2PYEB 1IEBA 1J87A 3P77B 4RQQA 5EUOE 2EDEA 2F19H 2DLFH 2IBZY 3K46A 3L3HB 3PF2A 4ZQKA 1WEJL 4OZHA 4JQXA 4LCUB 3SKMB 2O93L 1B0GB 5D70L 1AIFA 4POUB 4U1MB 4AY0A 3DVNA 2OZ4L 3SDXF 1I7TB 1NEZG 2YBRB 4OZIF 2AJYL 4OAWA 3MGOA 5KSBA 4F58H 3L1OH 4YHYB 2AJUH 1S78C 1IKFH 4JFFB 1JK8B 4JDTH 2VZOA 3ZE0E 2H3NB 1W72A 4Y4FB 1MJ8H 3FT4B 3U7WL 3RPIB 2X4PA 3BZFA 1G7LB 5E8PA 5KVFL 2L4OA 2NLJA 3PP4L 4HWUA 5CMAA 3BP5A 1MFAH 2X42A 3MQIA 5I1AA 4LOUC 1T6VN 2GK2A 1UWXK 1NDGA 3V5KB 2AGJL 4K7FB 3FO1A 3CAFA 5A2LH 2UYLA 5HHQA 1YEFL 4OGXH 3ARFD 1F4WH 1A9BB 5DJ0A 3LOWA 3RTQC 2E7LC 5L7XH 1MCSA 3OR6B 5D2NE 3ZKMD 3ILPB 1ORQA 2Z8RA 2CLVA 2WBJA 3TBWA 2SEBA 1FNLA 4OZFB 3LHPL 2WZPD 1XR9B 1J1OL 1R5IA 3HTLX 4QY8A 4FQLL 2D7QA 3U82B 3NCYS 4D9QE 1QKZL 4HCRA 5J57B 4JN1H 2V17L 4O51A 5E8EA 2H9GA 4PRHE 2R9HD 4HKZB 5GJTL 2PW1B 2QADB 4RNRB 2Q6WA 3T0XA 4EDWL 4YHZH 2BXZA 5JXED 2J5LC 3VH8A 2CR3A 2NY1C 5F8RC 2YUXA 2HRPH 1UT9A 4JY4B 1KB5A 2UWEA 1JGDB 4X99B 1G1YA 4G6KH 3N1QC 4DN3L 1IGJB 5DWUH 3VXOA 4PJAF 3MACH 1C7SA 2E7BA 2FWOB 5MEOA 4WNQA 4JHWL 2E9BA 3VGAB 3JTTB 2A6JA 3OKKB 3T0VA 3P2TA 3INUH 2ZZUT 4HZAA 1JWSA 1NGYA 3C09C 4JFXB 3QUZB 1NPUA 4CMMB 3SE3C 4ETQA 3TBYB 3CFJB 1T4KB 3RGVB 5GS1B 3O8XB 1JZ8A 1KXTB 3OXRA 3OKEA 1I1AB 3S5LG 1KPUB 3U1SH 1BECA 5FA3B 4O2FB 5HYSA 1XF1A 3DOSA 4M48H 3H9SB 1N8ZB 1MCPH 4YHLL 1QSFD 1KFAL 1N6QL 3L5HA 4NZJA 4HF5L 5JHLH 1NJ9A 4YX2H 2NY2D 1YMMA 1Q8MA 4KDTC 1BZ9B 4I0CC 2DTSA 2VAAA 4NO0A 2Q8AH 4OJFH 3W82A 1E6JH 2MMXA 2CLRB 3L5WA 5CJ8A 2EXYC 2R4RL 3P30L 5KZCB 3V0WL 3GKWL 5GS0D 1YEKL 2QKIB 3DUSB 3ULVD 1L9MA 1YN6A 3K4DA 4RFEA 1U8OA 5E8NB 2OMBA 2UUDH 4M1CD 2GQHA 1YN7A 1ZEAL 4PJIE 4PJEE 3ZDXE 5CP7B 3RWFA 5I18L 2YPLB 1TJIL 3AY4A 3B6SB 3GIVB 1UZ8A 3MA9L 2GAZA 5HPOA 3UTPE 1CS6A 4LEOB 1T21A 4X5LA 5GRWA 2VZ1A 5F6IB 2ZKHL 3PWPE 1KIRA 4PGEA 1YNLH 1RY7B 1HEZA 4Y5VC 4IRJC 3O41A 3STZB 1J8HB 2K1MA 5DQ9A 1QBBA 3X11B 1KSRA 1TETH 1MIEH 4OIBA 4QXTA 2MPAL 5C0FB 1XCQA 2Y1VA 1A4KA 5GQBA 1T66D 4JREC 5D7LA 4JRYD 4MJ6A 2CIIA 3FN0H 4OF8A 2ATPA 2EIDA 4YK4B 3PIQB 1OW0C 4QF1B 4KGJA 1PEZA 4LDOB 5BS0D 5DO2D 2GKIA 3SDAC 3C8HA 1JZ2A 4PJ5D 4YGVA 4I0PD 4Z95L 2F54D 1PDKA 2CDFB 5EZIH 2CSPA 2JIXB 4FQJL 4OGAC 5L0QC 1H0DA 5TF0A 1OTTC 3GI9H 4XAKE 4RIRB 3S35X 3I6LD 5SX5H 3DETD 4O5LH 3QQ9D 3WO3B 3DRTB 1ZSDB 2V5RA 4KJQC 5JLZB 3PV6A 4HUXA 3VFOB 1CFSA 1S5HB 4RA3A 3ARYA 3GJEB 2IBZX 4R7NA 1EHNA 3TN0B 1OAYL 2W92A 4UTBL 4ONGH 1JMXA 1I7UB 4CVWA 5FIEA 2M2DA 3BZ4B 1VFAA 3STBA 5C0IA 2YD1A 1H5BA 3JVGA 3EOBB 3D69B 4ISVA 2AVGA 4FFYH 3DXAA 5E6YA 1YMHB 1MEXH 3TA3A 3QQ4B 5HVGB 2D7NA 1HN1A 5EA0L 3T0EB 3UBXI 3VWJA 3TYGL 3DX7B 4R96A 1D5IL 3P4MB 5JHDE 4GAGL 4OI7A 1S5IH 3IETB 3ISWA 4PJHB 4P9HH 4CMHB 4HAGA 4R90H 2CDGA 1CCZA 5D93B 1BLNA 4WW2C 2IPKB 4M6OH 3HC0A 3MODL 5SWSD 5C0AA 4QRTA 3D3VB 3IF1B 4OCSH 1LO4H 2VAJA 5DRZA 5IIEB 2PO6A 5C0CD 2ZUXA 4AG4L 1L6XA 2W9DH 5DHVA 4JDZB 3ZSTA 4QXWA 3IKCB 2I60L 3I75B 2VMFA 4IHOA 5FM5O 2E7HA 4WFGE 3W39B 4IRZH 4M4RA 1JPGB 4HUVA 5CJOH 4S0SD 2WP3T 1UQSB 4ZPTA 3D85D 4G6JH 2Y36H 5IROC 1HILB 1S7UB 4X7SL 1WAAE 2G5BA 5DFTA 1EVTC 2NXYC 2XWBA 4N8VA 5CLWA 4HKXB 1INEL 1NBYA 4YFLF 4A6YA 2ORBH 3BAEH 3UTSB 3FONB 4PG9B 1DBMH 4XH2B 4D0CA 3CVIH 1PZ5A 1ZHLA 3JWDC 1PQZA 3TNMA 5GSRB 4Z5RA 1ZLUH 1OGAA 2GJZB 3HE6C 2F74A 1NGQH 4KTYA 4XMLL 4TUKH 5BRZE 1T03H 1X7QB 3TYFA 3MV9B 3G6AB 3SY0A 5BV7B 4QRPD 4ZFFB 4RWHA 3B3IA 3PJSB 4GKSA 3VFGH 3F62A 2QSVA 4HK0A 3RJQB 3BPOB 3BXNB 1DFBL 1IEBB 4K9EC 4NQDD 3RUGE 4P59H 4RQQB 1JRHI 3MC0A 2QQKH 4KI5D 1Q72H 1Y0LA 4HWBA 2BMKB 2VB5A 5D7JC 4E41D 4ZQKB 2MHAA 4OZHB 1EJOH 4TSAL 4LLMA 1AIFB 2JELH 2FJHA 3DV4A 3DVNB 4U1JA 5EC2A 5DMYA 1IGFL 5KSBB 4ODHH 1MSPA 1MLBA 3JWOL 1GAFL 4L29A 1QHPA 5DA4A 1K85A 4F7CA 5FUOL 2J8UF 2XPGA 3WEXA 4YE4L 5HHOA 2DJSA 1NSNH 4PB9H 1TVHA 3QWOA 1W72B 3GHBH 1I8LC 3O3UN 2X4PB 3BZFB 1JRHH 2WMPA 5E8PB 4MNQD 4PPTA 3O81A 3V4VH 4XPAH 5I1IL 3MV7E 1HOCA 5KS9A 4WI4A 5CMAB 3BP5B 3IKKA 3JTSA 4MWFA 4ZUTA 5I1AB 1NDGB 1KBGH 2DQTL 2VQUA 4NDMA 4QTHA 4TVPH 3U2SA 4MNGA 2QQLH 3FO1B 2DQIH 2UYLB 2VXTH 5HHQB 2AJVH 3FO2B 4WEBH 4J6RL 4NO5B 5C08A 3ZKXC 4Q6IA 5DJ0B 3OR7A 2AQ3A 2BHYA 3HN3A 2GYSA 2XN9D 4WI7A 1ORQB 2VXSL 3T65B 4ZNCD 2CLVB 2WBJB 5IJKA 4H88H 4RGOH 1MNUH 1R5IB 2BJMH 3WXVL 2DLHA 3ECBA 3FFCE 4NJ9H 5LGHH 4QOKB 1J88A 4GMTH 4C83A 3B9AA 2H2PD 5HGDA 5IMMA 1QA9A 1QZ1A 1HIML 3RVTD 4XNMA 1AFVH 4Q97A 5EWIH 2ERJB 1R3HA 2AJXH 1F3RB 4ORZC 5HJ3A 5E8EB 5B8CA 3VD9A 2H9GB 5DTFA 1NCBL 2Q6WB 1OARH 2W38A 3QIWC 5IMOA 4TRPH 1KLUB 4RMSA 4R8WL 1VCAA 1CR9L 3GSWA 3P11H 4NKQB 3UYOD 1KB5B 2UWEB 4I2XE 1CG9A 4LCYA 1A7BA 4HK3N 3VXOB 1MFBH 4OFYD 5TFSH 2F19L 1X5XA 2YSSB 1ZHNA 2DLFL 4LK4A 5MEOB 4PS4L 3IJYA 4WNQB 4KPHH 4GBXA 4XBPA 3NPSB 1M7XA 2A6JB 2BERA 4K94C 3AVEA 1LK2A 2A6KA 5IBTH 1JWSB 1NGYB 3QUYC 1CDHA 3ILQD 4ODTH 5GGQH 1ZK9A 3VXMB 4ETQB 2X4QA 3GM8A 5EOQH 4NZTH 2R8SH 4DOHB 1KJVA 3L1OL 3OXRB 2AJUL 3DVGA 3OKEB 1FO0A 3ZTNH 2B4CC 4JFPA 1IKFL 2X2YA 2AK1H 4JDTL 3JV0A 3MNZB 4GQPH 5BMFH 5HYFA 3NH7H 4ZS6C 5EOCH 3ALXA 1MJ8L 5HYSB 2J4WH 1CGTA 4GG6B 2FHCA 1FH5H 1VEPA 2X4RA 4GW5A 1N26A 1NGZA 4CADB 1IGMH 1MFAL 4ZFOL 5DURB 4BZ1L 1P9MC 3ARZA 4NN7B 2EYSA 1EHXA 5HGHA 1QSFE 1YMMB 2UVEA 2VZTA 3FO0H 1WITA 2E6JA 1PLGL 4KFZC 4ACPA 2VAAB 4NO0B 5DFWH 4OGXL 3GBMH 4MB5A 1F4WL 5KBNC 3L5WB 3TT3H 3TBTA 5JW5A 4ZUWB 5L7XL 1WZKA 1MCWW 4AEEA 3D6GA 4F37K 3PABA 4J8RA 3N85L 1YN6B 1B0RA 4RFEB 1U8OB 4RWYH 3WJLA 2XTLA 1DQJA 2C5DC 2Y6SD 4WTZA 1YN7B 3EFDH 4LCWD 4HS3A 2EDFA 4JN1L 3PDGA 3RWFB 5ACZA 4WV1C 3BPLC 5HVWA 3T3ME 4YHZL 1UZ8B 1ORSB 4LPXA 2GAZB 5GS3A 1T21B 1KB9K 3MUY1 1U6AH 1KIRB 2HRPL 4PGEB 1VADA 5J8OA 2APTA 1HEZB 5I66A 5ANMA 3O41B 1OOAA 4CJ0A 5DQ9B 4I13B 4G6FD 4G6AD 5DWUL 3PL6D 4G9FA 5BXFB 4M4PA 1MCBA 5DJAA 3MACL 3S97C 4JDVA 4RFOH 4S1QH 2FRGP 4PJDB 2R1XA 4QXTB 4XP1L 1J8KA 3MBXH 1XCQB 3CFKA 4PTTA 1T5XB 3INUL 5D7LB 4MJ6B 2CIIB 2ATPB 3GMPA 3MCLH 4WEUD 2DQDH 1IRAY 4JRYE 4DKEH 5I76A 3GSUA 5JNYA 3V4UH 3O2DH 4YGVB 1AJ7H 2NW3B 3P9LA 3U1SL 5L88H 4XP4H 4DKFH 4MB3A 4MAYA 2YOCA 3UTTA 4PJ5E 5MEPA 1H0DB 2QL1A 4M48L 3NA4A 2F54E 4KKNA 1IQDB 1IBGL 1XEDA 4KDWA 1FL6B 1MCPL 3SE9H 5EO0A 2XXCB 1FZKA 1L4IA 3MGTB 3PWJA 5IB1A 4WO4A 4U1NA 2QSQA 2FGWL 3PV6B 4HUXB 1PKQB 1KELH 3ZL4H 4YX2L 1CFSB 3I6LE 4ODUB 5C92A 3WFEH 1QTYT 4R7NB 5T3XH 5FO9A 2BP3A 2Q8AL 1Q9KA 4OJFL 1E6JL 1D3CA 4ODWA 4R97C 3CMGA 2LFGA 5JXEC 3JUZA 3CH1B 3CGTA 1VFAB 3DMMC 3WLWD 5C0IB 3Q5TA 4GS7C 1GYAA 4UDUA 1H5BB 1FCGA 3D0VA 4ISVB 1QBML 4OQTA 3DXAB 1NKRA 3RDTA 3TA3B 4OUOA 3I3DA 2P44B 5DEFB 3VWJB 3SGJA 4WWKA 2R23A 1ZMYA 1IL1A 3RWEA 3C5ZA 3TC9A 1P4IL 2CDGB 4F3FA 3OAYH 2H2SC 3L5JA 5C0AB 4QRTB 1OP3H 5DRZB 2PO6B 5E2JA 3CX5J 5GHWL 5JOEA 5SWSE 1YNLL 3AS3A 3F12A 2DOCA 4HMEA 5DHVB 3DWTA 5KOMC 3W0WA 5T3ZD 2R2BA 4XVJH 5KW9L 5D71H 3B4NA 1XGRA 2KH2B 1FYTD 5C0CE 4IHOB 5SWQA 2X4TA 1AGFA 4JGJA 4WUUD 1WWAX 4HUVB 5FGRA 4KROC 4ZPTB 3KPOB 4AL8H 5C2BH 3D1MC 1AQDA 3FN0L 2G5BB 1LK3H 1U8LA 2XWBB 4N8VB 1P7QA 1AGCA 4GAYA 1NBYB 2EDKA 3ARFB 4APQC 4HPYL 4P3CH 5I1HH 4N0UA 4D0CB 2JCCA 5GSVB 1PZ5B 1ZHLB 2HKHH 2VL5A 3C6SA 1PQZB 3TNMB 4K71B 3O2VH 5EZIL 2O5ZH 4PD4J 4FG6D 1IFHH 1RULL 4FQCH 4M7KH 4UZGA 4BFBD 1KULA 4DEPB 3BSZH 5GISL 1T6WA 3TYFB 3SY0B 4ZOEA 4D9RD 3B2UC 3B3IB 4GKSB 5ESAA 4N1CA 1A0QL 4HMDA 2HTKD 5CBAA 3K8MA 3QDHA 3NCFB 3KHQA 2FR4A 2OSLA 2Z35B 4KGLA 4UB0H 1Y0LB 2L7UA 4BZ2H 4U0RC 4NQDE 3Q1SH 4QRUA 1CLCA 3HAEH 2MHAB 3UTOA 4ONGL 2NR6D 3L3IA 2R39A 4LLMB 1EMTH 2VDOL 2AQ1A 4E41E 3MR9B 1O7SA 5KN5A 2FJHB 3KS0J 3DV4B 3PHQA 4NRXA 3RI5K 5GXBB 1HSBA 1KG0B 4W6WB 4U1JB 2MQCA 3V6OE 1T22A 1SY6H 2ZCKH 3VGFA 1I9RH 4ODSH 4FFYL 2BOCA 1F02I 1MLBB 1J1PL 1TQCC 1CGYA 4L29B 3IFOA 5IW1A 4PRID 2R1YA 4F7CB 1GCFA 4CL7A 2XPGB 4LBEB 5HHOB 1BVZA 3HCVA 4IMKC 1TVHB 3QWOB 4P9HL 3IRPX 4LFHG 4R90L 4BYHA 1T0PB 1GZQB 3TNNA 4XI5C 1T66C 4M6OL 1UWGH 2ZG2A 2MQ3A 1AXTL 3LN5A 4Y0GA 1QBLH 3MRIA 1X3DA 4U1SA 4OCSL 1MWAB 1HOCB 5KS9B 4NCC2 4MWFB 4ZUTB 5SWZD 3TZVD 4MNQE 3CCHA 4LDEB 4H25A 1JFQL 4NDMB 3S4SA 1NFDF 3U2SB 4MNGB 1R3IL 4G8GD 2QSTA 4OF0A 3IDUA 3EDKA 5AZEL 4AEIL 4HKJA 4IRZL 5CJOL 4Q6IB 2A6IB 2WIMA 4PY8J 1LQSR 1XF3A 4WGVB 3LQAL 5D2LF 5JXAH 2Y36L 4YDIL 2Z8SA 2NY2B 3QP3A 3DETC 3T1FA 3QQ9C 2E7LA 5JZ7D 4OF6A 5HGAB 3LY6A 3E1F1 3FKUS 3CDYA 4DZBA 4HJGA 2XN9E 3ECBB 1IC7H 3SO3B 4C83B 2ORBL 2OXGA 3BAEL 4LHQB 1DBML 5L6YL 3QR2A 2FYYA 5D5MF 2YD8A 1QA9B 5IMMB 3S36L 5D1QC 5AD0A 3VW3H 2ARJA 2VRAA 2VITB 1PG7H 1R3HB 5B8CB 5HJ3B 3TBSA 3ROOA 1NGQL 2NMSA 5DTFB 1W0VA 5DK0B 4K2UL 3U36A 4KHXL 3MRDA 5IMOB 4DQOH 4MNHA 2FEEI 4Y8AA 4H0HB 1T0MA 5FA4A 3VFGL 3GSWB 3R4DA 2ENYA 3ULUC 4LCYB 2WWMC 4KZEH 3RVXD 3WS6C 4Y1AA 2QQKL 2ID5A 1VGKA 3D2UA 1Q72L 1ZHNB 5CSGA 5DYOA 3LKSA 4H26A 1R24A 3SGEI 5GGVH 1LE5A 3RWDA 2VXQL 4YHOH 3SPVA 4BKLA 2H6PA 5I73C 1LK2B 2A6KB 3S98A 2JELL 3E2HC 4NKMA 3H7BA 5FEBA 4M7JL 1FIGH 3TF7C 4Q6YA 1QOKA 4FQPA 3FB6A 4EUPH 2X4QB 3SE3A 4ODHL 2W9LA 1JGUH 1KJVB 1NUFA 4IOIA 3DVGB 1FO0B 4JFPB 3AM8C 4Y2OA 4EN3D 3PQYE 1U8NA 3SJVD 3W11D 1NSNL 4Y19E 2Z31D 2X4OB 3ROLA 3P0GB 5F9OH 2HP4A 1S7SA 2X4RB 4GW5B 4HUWA 5BS0B 3OB0K 2J12B 1E6OH 5TJWK 3V4VL 4XPAL 4QXUH 5LJYH 4PJ7F 1NGZB 4DFIA 5DSCA 3SGEH 1MRCL 1EERB 2GJ6D 3GNMH 1CLOH 4XGZA 2EYSB 3DSNA 4TVPL 4YHKH 5HGHB 3EFFA 2COQA 3TESA 2DQIL 2NTFA 2FBOJ 4WEBL 2JK5A 5A43C 5E00B 3RNKA 1F97A 4FTVD 4KDTA 2GJJA 5JW5B 2YN5A 4UILH 5EN2A 4HQQH 3ZHLA 4NWTH 3PABB 4J8RB 1ZGLP 4H88L 4RGOL 4DKAA 2P5WA 2BJML 3RQ3A 1MLCB 1DQJB 5LGHL 4L3AA 2A38A 1JWMA 3SDXE 4OZIE 5DMIH 4HS3B 2E5EA 4HC1H 1AFVL 1J11A 2AJXL 4OZFH 5ACZB 2A73A 4ZSOA 4NQCA 3DNKA 2P24A 3VD5A 1OARL 4JRXD 4LCWE 4NN6B 5E03A 5KTEH 3BRFA 2AEIT 4TRPL 4KRPC 3GUTA 1KTLB 1VADB 3P11L 5FYJD 2BCKB 1SEBB 5I66B 5ISZA 4OI9A 5ANMB 3ARRA 3UO1H 1ZANH 2DM4A 1BQHA 5AG8A 4ZAKC 1UH4A 4G9FB 4Y5VA 5DJAB 2B1HH 4IRJA 4JDVB 4U6VH 3C60D 3SEPA 4KPHL 5BJTA 1LHZA 5CGYD 5HXMA 4NOFA 1QUNA 1I75A 3LPGA 4PTTB 4EUPG 4M43H 4HIJB 4ODTL 1G9ML 3GMPB 4GW1A 1MIML 4CU8A 5F7EH 4X6DB 3U0TB 3G6JF 5EOQL 4D0BA 5I8OH 3U46A 5I76B 1OW0A 3GSUB 5JNYB 1K8DA 5EBLA 2AK1L 1MFDH 3P9LB 4NO2A 3D0LA 1UXSA 3SDAA 4LGPB 4MAYB 5EOCL 4UQ3A 1AI1H 2YD2A 3UTTB 5MEPB 3QULA 1FH5L 3U7YH 5EO0B 1MY5A 1FZKB 1IGML 2CQVA 2CXGA 1RUPH 3PWJB 5IB1B 4WO4B 5K9JL 4U1NB 2CGRH 2EDJA 1F4XH 1M1SA 2F5AL 3UYRH 4OM1H 1G6RL 4AK1A 1ZLWK 3B9KC 2ESVD 5FO9B 2XQYK 4QRPB 1Q9KB 1Q9OA 3GBML 3Q0HA 3VFMA 2FGZA 4ODWB 1AXSA 3BIKB 4PJAE 4P9MH 4OCYL 2W0KA 1CXFA 1QNZL 4UDUB 1TDQA 1KIUA 3LB6D 3QHZH 3G04A 3O4LD 4LEXL 3VG9B 3OZ9H 4WWKB 4GUPA 5C0RH 3QFJD 3TVMD 4F7TA 2OBGA 2BSTA 4QHLA 5D7IF 3RWEB 3QEGH 4CN6A 4FQXC 3DHJA 5DC0A 1FVDA 1SMOA 4PBVC 4RZCA 1VPOL 1T7YA 3NTCH 2ED9A 2M8XA 2A2QT 2AI0H 3MLXH 1T7XA 5GRYA 1ACYH 1X5IA 5GRJH 4JZOA 2IWGA 1CU4H 4OCRH 1U6AL 1TZIA 1UH2A 3FB5B 3F12B 3W0WB 1FC1A 3BN9D 4YQXH 2R2BB 4H8WC 5HVFB 3UCRA 1XGRB 2IAND 1IKNC 5SWQB 2X4TB 3D9AL 4RFOL 4S1QL 2BHZA 1AGFB 5C07A 3BD5A 5JDSA 1IAII 4WVRA 3MBXL 1FYTE 2P46B 5E9DA 1DBKH 2P5ED 2WBKA 5E08H 1AQDB 4WUUE 3RBGA 2RQ8A 4O9HH 2EE3A 5INCA 4X6FA 5AAMA 5HYEA 4XCEA 1U8LB 3JBG7 5IROA 4J4PC 2NY3B 4AJ0A 1AGCB 1CE1L 5I6XC 5C9JA 4DKEL 4M5ZH 1JZ3A 3SDDC 4NRYA 2JCCB 1AJ7L 1HXYA 3EJYC 3C6SB 3ARTA 5L88L 3CSBA 3HC3H 1LO2H 4DKFL 3T8XA 2D03H 3DO3A 2ZPKL 4XMKH 3RA7H 1QSZA 2JB5H 5IBLD 2YWZA 3HE6A 4XVTH 4XBEH 5EO1A 1DTUA 3GIZH 3QNZA 1IAIH 2Y6SC 5ESAB 4PJIA 1JF6A 1A1MA 4D9RE 3ABZA 5CBAB 3WFEL 3Q6GL 1WZ1L 5T1MB 3KHOA 4NM8H 4KI1A 2CK2A 2CMRL 4MXQD 3E6FA 3FCTA 3CU1A 2OI9B 4NUJA 3HS0B 4GKZB 3L3IB 5D7JA 3UJJH 5KN5B 1JWUA 4NRXB 3PHQB 2CR6A 1HSBB 4YHPA 2DICA 2Y06H 3LEYL 5B38G 3VXSA 1N3NB 1T22B 3HE7C 1X5YA 5FOBA 1IGYA 3DYMA 4U6HA 2BOCB 3OKOA 5MEND 4X6CA 2V2XA 5C7XH 4UUJA 3IFOB 5IW1B 2R1YB 3HCVB 3PUCA 4LSVH 5D9SA 2A6DA 5ETUA 1WLHA 5C0JA 5J89A 3TNNB 4F9LC 4PRIE 3LN5B 1EXUA 1TJHL 3MRIB 4U1SB 1I8LA 2CRYA 1GPOH 3P0VH 4EN3A 5C0BA 1U0QA 2Q20A 4J3VA 1UWEL 4XVJL 1KF9B 3CCHB 4I5BA 5D71L 5DMKA 4H25B 1AHWA 1FE8H 5SWZE 3N50A 3L3DA 3GSNA 4HKJB 2VUOA 3UPCA 2WAHA 3A67H 1F8TH 1B3JA 4G8GE 2LE9A 4X4XB 4AL8L 1XF3B 5C2BL 4JANB 5HPMA 2EKSA 2GIYA 1DUYA 5GRXG 4ZTOH 2VLJE 3F8UB 2X1PA 4DZBB 4G5ZH 4HJGB 3S8WA 4Z77B 4P3CL 2XRAH 2FYYB 2R4SL 4HJ0C 1S9XA 5AD0B 4P2RA 1VGEH 3O2VL 5HBBA 1RMFH 4HSQA 2HFFA 4JM4H 3TBSB 1IFHL 3ROOB 5DJ2A 2FHFA 4LHUG 4FQCL 4M7KL 1WSST 3BSZL 5J9PA 5HI3D 3QXVA 3MRDB 2WSKA 5FCUH 4PLNC 2B39A 2AAVA 1XFPA 1OP5H 3VFNA 3MLZH 1T0MB 5FA4B 4WI2A 3QIWA 2J5LB 1II4E 2HVJA 4M93C 1EH9A 2EIBA 3PWVA 4Y1AB 5TDOA 4A2MA 3CD4A 1G7HA 1VGKB 3FAXA 4BZ2L 4YEEA 3LDBB 5DYOB 3LKSB 4H26B 1R24B 3Q1SL 1LE5B 3RWDB 4PJGF 3SPVB 5I1GL 2H6PB 1LWRA 1ZKAA 2IPTH 1EMTL 4FFWD 5A16A 1Z3GH 4NKMB 3H7BB 5CIPA 3PL6B 5LKNA 1AE6L 2WQRA 1SY6L 2ZCKL 1I9RL 4ODSL 3S35H 3EYFB 2PNDA 4YXLH 4IOIB 1JNNH 4LPTA 1U8NB 4U6YA 2CD0A 1MUJA 4PRPD 4TTGA 3ROLB 3U9PH 2XZAH 1BJ8A 3WNKA 1UWGL 3D25A 3DURA 4HUWB 3SJVE 1WTGT 5CGMA 2C3VA 3ARBA 4NHCH 5DSCB 3QDJD 5GRVK 4KKLD 1LP9F 4JLRB 2M1KA 1W72H 3BWAA 4XGZB 4PJXF 2DIBA 3EFFB 1H3TA 5ESQA 1P9MA 2GJ6E 1IAOA 3A6OA 3N1PC 4NNPH 1CGUA 3WXWH 2JK5B 3RNKB 1MRFL 3VXPB 4Q74A 4HT1H 5JXAL 4G9DA 3MLSL 1YPZE 4U7MA 5DI8A 5F1NB 2P5WB 4I1NB 4JE4B 2HTKC 3MRNA 1IC7L 2E7CA 1JWMB 1S7XA 1Z9LA 3BRDA 5B4MD 5J13B 2HT4D 4LMQE 3VW3L 1BAFH 4MZ3A 1DN0B 1FG2A 5EULV 4BQ6A 1PGRB 1OVZA 2A73B 4ZSOB 4NQCB 4PP1D 5C6PB 5HYQA 3RVUD 2P24B 1NGXA 2APFA 1BF8A 4NKIH 4K7PX 4K55A 3HZVA 3H0TA 4WV1A 4JM2C 3GUTB 4HCRH 4XNYH 5EBGA 4MQSB 2X4NA 5ISZB 3IDYC 2I9TA 1KPVA 1BQHB 4KZEL 5H8DA 4Y5VB 1OSPH 5TDPA 4IRJB 5FYJE 4EBQH 3BD4A 4HAFA 3QRGH 5GGVL 4XNUH 5BJTB 4YHOL 4Z7QF 2Y9RT 1KB5H 3MV7A 1INQB 4KU1A 5EO9A 1FIGL 4GW1B 3TPKA 3TZVC 4JREB 4KJYA 4D0BB 1U36A 3U46B 1JGUL 1K8DB 1YEIL 9CGTA 5EBLB 3IAGC 2FEEL 3D39A 5FYJU 3LKPA 4NO2B 1DL7L 4LCIH 3D0LB 1XT5A 1UXSB 3SDAB 3AB0B 4W6XB 1U93A 5HHMD 5F9OL 2YR3A 3GJFB 3QULB 4KKAD 2A77H 2O5YH 4ELMF 4I18A 4G80B 4XC1L 5KVGH 4RX4A 4NC0B 5JZ7C 4JN2B 4QXUL 5IHLB 5L0QB 5GGUA 3KYKH 4HZLA 3ARVA 4PJBA 1IAIM 3X3GH 1PX3A 3OKLB 4WHTA 3VWKD 4YHKL 4E42A 3S96A 1F58L 3MJ7A 2ICWJ 1WWBX 5HDQH 5F1SA 4RGND 1Q9OB 4XPHH 3VFMB 1EEUA 4UILL 2ESVE 2W59A 1YNKL 3HRZA 4HQQL 5DVLA 3HG1D 4FZ8H 1Q9LA 3G04B 3DV6A 3DMMA 4LRNH 1Q94A 2YK1H 3RVXC 4WY7H 3O6LH 3HUJF 4P23C 3WHXA 4GUPB 5FHAH 2VDKL 4C58B 4F7TB 2EC9T 5DMIL 4QHLB 2BSTB 3O4LE 4HC1L 4LPUA 3MXVH 2D7TH 4HXBH 4PLOB 2A74B 3MJGX 3C87A 4X4YA 1FVDB 3QFJE 5KTEL 2B0SH 1OT2A 4JZOB 2NY0D 2KKQA 1H3PH 5T1KD 1TZIB 3RKPA 3QISA 3O9WD 1CGVA 3BRGC 1ZANL 4ENEC 3BJLA 3C6LD 3W11C 4XBGB 3V0VA 2I07A 2PTTB 5C07B 2GK0B 2F5BH 3A0OA 2QQQA 5JDSB 3TPUA 2IANE 3FRPA 5E9DB 4UOJA 1QBAA 4M43L 2NW2A 1UFUA 3REWA 5INCB 4OT1L 4I3RH 4X6FB 3ESVF 5F7EL 1EUUA 1G7MA 2ZJSH 5DD3H 2P5EE 5A2FA 1BVKA 5D6CA 5C9JB 5I8OL 1IEAB 1KIPA 4CN1A 1AO7D 4NRYB 1HXYB 2D7MA 1MFDL 4APQA 3GMLB 1JGVH 3T8XB 1FFPA 1AI1L 4P4KC 3VXUD 5EOTA 2D9CA 5SX4I 3U7YL 5JPNA 3HLAA 3NCBB 3OJ2C 5EO1B 4F37F 5DGQA 2XNAB 3CDGA 3VXTA 3BZDA 5KJRH 3QNZB 1RUPL 2RGSA 1A8JH 2OP4L 2CGRL 4HIHA 4B0MM 1BFOB 1F4XL 5BVPL 1AY1H 1RK1A 3UYRL 1ZAGA 4HX1A 5H37H 2G60H 1C5DB 3OF6D 4H1LH 5E99H 1RFDH 3SO5A 3E6FB 4OBSA 1L0QA 3O11A 5L9DH 4NUJB 3DPBA 4S2SA 4YDLC 5D7JB 5DVOA 4P9ML 2AJ3A 2HWZH 3RWHA 1A02N 4XWOD 1JWUB 5DF0A 4YHPB 5T5NF 3VXSB 4N0CD 3CZJA 4L8SA 3HZMA 1IGYB 1M6OA 3EO1B 3OKOB 4E0RA 4X6CB 5SX4H 2V2XB 3LCYA 5LVEA 4UUJB 2NY4C 5E6ID 1YDPB 4UU9A 4MDJB 2HN7A 1OWWA 2EYRA 1IT9H 1JPFB 1U3HC 4OIIH 2GSIA 2ITCA 3QQNA 3W9EA 5MENE 3QEGL 5D9SB 2A6DB 4MQXC 5ETUB 1J12A 5C0JB 4I77H 4IMKA 1EXUB 2YWYA 6FABH 3NTCL 3MLXL 2Z9TA 3HZYA 1K9TA 5E7FA 4D8PA 5EZOH 4EN3B 4KRLB 1GGCH 1CU4L 1A3LH 4OCRL 5C0BB 1IEHA 4PRPA 35C8H 4FRWA 4YQXL 4LKCA 1N4XH 1MCDA 4I5BB 5DMKB 3H3PH 3CFDA 1AHWB 1V7NH 4CNIB 3L3DB 5KANI 3GSNB 1FORL 1K4DA 4XB7A 5DHVH 3JWOC 5FYKD 4CGTA 5E08L 1G9EA 3GMMA 5HPMB 2EKSB 4O9HL 1DUYB 4PP2A 4ZXBC 2APXA 5E5MA 5B39A 1VFUA 2MOVA 1QPXA 4FTVB 4PJ8D 5DT1H 3UZEA 3V52H 4M1GL 1EAPA 1S9XB 3HC3L 4P2RB 1V8HA 3QWRA 2D03L 5GPRA 2HFFB 3RA7L 2AXHA 2O5XH 5D1QA 5INDA 3WIHL 4U3XA 5JIHA 4XVTL 4XBEL 4CVUA 2LTQB 1WCBB 3GIZL 3VFNB 2J8UB 3K3QA 3QIWB 4WI8A 3RU8L 1IAIL 2HVJB 1IE5A 5I1CH 3T4YA 5DZOA 4H1LG 3PWVB 4UIMA 4F57H 1ZWIA 3U0PA 4JRXB 4MDIA 3T2OA 4NM8L 3KPMA 1YZZA 5DZLA 1HQ4A 4KK6D 4XTRC 4Z7UE 2FECI 5A16B 2NY6D 2JF1A 5CIPB 1KT2A 2FIKA 1AP2A 2CKBA 2Y06L 4HWBH 4Z7VE 4MSWA 2FX9H 3C60B 5ECJE 1LDPH 2XZCL 2MJWA 5L2KD 3LEXA 12E8H 3PV7A 4U6YB 4XB8A 4LSVL 4M7ZC 3DUUA 3DIFA 4PLJC 1MUJB 1YEEH 1RJCA 4X6BB 5JQ6H 5DJ6A 1KIQA 3D25B 3DURB 5IK3A 1CQKA 3ARBB 3P0VL 2F8VA 3P4NA 4ZMAT 4HS8H 3OB8A 2BSSA 2W0FA 3BWAB 5E2WH 3BW9A 3QDJE 4WDIA 4M1DH 5ESQB 4M5YL 1J0YA 1FE8L 2CRMA 2RFXA 4RISH 1MWAH 2EKJA 3DRQB 4XP6H 1F8TL 5ID1A 1DE4B 5ELIA 4JFDA 2HJKA 2ZUWA 1RZGA 3M8OH 1UEYA 3ZYOA 2A9MH 4G9DB 1Q1JH 4ZTOL 3KLAA 2Q1EA 5DI8B 1L7IH 3MRNB 2XRAL 1S7XB 1LE9B 1QRNA 1E27A 4MXQC 4DK6A 1VGEL 1RMFL 3HMXH 1FG2B 5KANG 4JM4L 1EO8H 2VLRD 5HYQB 1NGXB 3U30B 2Q8BH 4CKVX 3H0TB 5CZXC 3BP7A 2C4XA 2XA8H 3MLZL 2NXZB 3TVMB 4DVBA 4MXVF 5C0GA 4Y5XB 1MAML 5GS0H 1NLBH 4JHAH 3ULVH 3TO4D 4F7MA 4YIQB 2I9TB 1KPVB 4X5WA 5I74C 3ZSSA 4JKLA 5TDPB 4JQIL 4IRSA 4KVNL 4ZAKA 2HG5B 3NCMA 4PJ7A 2PETA 1GC1L 4PJHF 3ARUA 5TQ2H 2IPTL 1NFDE 3K81A 4HDIA 5EO9B 1DP0A 1Z3GL 1EDQA 4Y5YA 5DHYA 4EVNA 5T3XD 4KJYB 5CKGA 3NPZB 4YXLL 1JNNL 1K3IA 3D39B 3LKPB 2LAGB 4NWUH 4X4ZA 3BIAX 1RJYA 5J7CC 4ZD3H 1A14H 1J9CT 3LZFL 1U93B 2ZWLT 1X5JA 3MBED 4I18B 1HCVA 4P2QD 4GT7A 1FO0H 5DJ8A 1EEQA 2A9NH 4HZLB 1QSED 5JDJA 4AZ8A 4I3SL 4FN0A 4PJBB 3ARSA 1WT5C 5FGCB 1DVFA 1W72L 4P3WA 1AQKL 2E8ZA 3EZJB 3RP1A 5KAQF 4E42B 3S96B 1ZOXA 5LG1A 4KKBC 4NNPL 3MJ7B 2ZUVA 1WF5A 4QT5B 1KGCD 1RZFH 1SBSH 3NACH 4E5XA 4EDXA 1HNGA 4DFHA 5IMLA 5HI3C 1OTSD 4EZMA 4HT1L 4AT6A 5DD5H 3HRZB 2D3VA 3BT2H 4RGNE 1FYHB 4R97B 1OY3B 3QIUA 1Q9LB 3EDFA 5IFJA 4F80A 2PXYD 3FMGH 2HYMA 3DV6B 3DMMB 2GUOA 1Q94B 5JIKA 3HG1E 3QUXC 3SCMC 1MCFA 3WHXB 1RUAH 4WCYH 4PG2A 2X70A 1EAJA 2NPLX 3IXAA 4X4YB 4J3OC 1A7OL 4OZHF 1F00I 4FQXA 1WZLA 2CUHA 1UCBH 5E2VH 3EJJX 5D4QA 4RMWA 4Y19A 3SDCC 3QEQD 2IMNA 3V0VB 5J3HC 4G7YL 1OSPL 4GO6B 4EBQL 1SJEA 3MXWH 3L3GA 4L4VE 2DIAA 4O58H 2NNAA 2BNRA 4N68A 4FMFA 2LU7A 2B1AH 4X0KB 4XNUL 3TPUB 1QPPA 4IMLA 2X1WL 2NW2B 4LLVA 1DEDA 2BX5A 3REWB 3ZDZF 1CDIA 4GH7B 4G3YH 5F89A 3GBLA 1S9VA 1G7MB 2VERN 3TCLA 5D6CB 5EU7E 4XCCH 5IQ7L 1KIPB 1XF5B 4P0DA 3ZLQC 3QH3A 4J4PA 3BUYA 4LCIL 3SDDA 1I9JH 4NBXB 3L5XH 1QYGH 1FFPB 1H3GA 1AO7E 5EOTB 5JPNB 2DBJA 4YXKH 3HLAB 4X7DC 4TTDC 4UTAH 3NZHL 3VXUE 3CDGB 1UM6H 3VXTB 3KYKL 1OD9A 1T1WA 2EDDA 5D7IA 1I1RA 3K4AA 4HIHB 1ED3B 4M62H 4EOWH 2VO5A 4HX1B 4JFED 5B4MC 3DJ9A 1RUQH 1LNUA 4R7DA 3QCTH 1IQWH 3O11B 3VE0B 5F7DA 4S2SB 5JQHC 2AJ3B 3RWHB 1JBJA 5D7SH 4FABH 4L8SB 2XKNA 3HZMB 4GG8A 1M6OB 1PJ9A 2YK1L 2W60A 4WJ5A 4WY7L 2N56A 3O6LL 2IAMD 3HHRB 3TWCL 2GT9A 3HE7A 3BKML 2HN7B 1JNLL 2EYRB 2ITCB 1JTPA 4QO1A 3W9EB 1JF5A 3MXVL 3NFPB 2D7TL 1RAMA 4HXBL 2FD6H 2FX7H 1T83C 4OQTH 2NZ9D 2YRZA 2B0SL 5L2KA 3ME0A 5F96H 2XTJE 3HZYB 3WKMH 5DR5H 4U4BA 1OF2B 4D8PB 1H3PL 4XPGH 5I0DA 5I1JL 3EHBD 4PRPB 1F4YH 4PY7B 4LKCB 2BNQD 3IDJA 1HH6A 5JOFB 3CFDB 3UAJC 4FQIL 4Y4KD 1CICD 2F5BL 1ITCA 3DBXA 4KKAC 5HGBA 2OZ4A 1AR1D 1F45A 2X4UA 4NM4H 4POZD 3RX5A 2VL4A 3L3OA 4PP2B 4I3RL 3AS1A 4P9HC 5E5MB 5FYKE 2ZJSL 5DD3L 2N4IA 3VWKC 2JJSC 1J1XH 5T5FH 1FNAA 2FZ3A 2DLEA 5GGTH 1MFNA 2H26A 1KOAA 2FDBP 4RGNC 1X4ZA 5E4EC 3N9GL 3VI3E 2CUMA 3O3DB 4JKKA 5D1QB 5INDB 3QWQB 1KB9J 2HH0L 4FQ2H 4HH9B 4KDVA 3NCCB 4OBRA 5FYKU 3TM6A 5CFHA 5KJRL 4HWZA 3T4YB 2XQBH 4W68A 5HSFA 2ZP0T 1AY1L 2VOTA 4UIMB 1ZWIB 3U0PB 1EX0A 5I1DA 1FRGH 3B9VA 4MDIB 5DMGC 3QUMB 3KPMB 5E99L 1RFDL 2DYPA 1U8PA 4JFFD 1HQ4B 3I6KA 1I1YB 5L9DL 4DCQB 3V6ZA 3MZTA 5SV3A 5F71A 2HWZL 4XHJD 3IDMA 1PBYA 4BQ8A 5B21A 1KT2B 2FIKB 1AP2B 2CKBB 2VE6A 2NY7H 4MSWB 4UNTA 2EXWC 3PG2A 1GL4B 4GKNA 1A5FH 3LEXB 3MLYH 1IT9L 3UEZA 4OIIL 5D2LB 3DUUB 4QXGL 3BQUA 3F7QA 2ED8A 3QCUL 5DJ6B 1KIQB 4GRLA 1QFWI 5EU7C 5IK3B 4JVPA 4L4TA 1IGCL 3P4NB 2OL3B 5EZOL 4U49A 5D5MB 4LVHB 4OFDA 2P7TA 35C8L 3DX8B 3MREA 2KQNA 3WO4C 2BSSB 2W0FB 5HHMB 5E8DH 5J0BA 3S9DB 1N4XL 3BW9B 3H3PL 2DQHH 1DCLA 1V7NL 4R2GB 2VUYA 3H42H 2RFXB 4ZTPH 5I71B 3GSQA 3QG6A 1MPAH 1AD0A 5ID1B 4JFDB 3B8SA 2HJKB 1RZGB 1MCWM 5GZND 2QADD 4G7VH 1C5CH 3KLAB 1BBDH 4GAJL 3I85A 3KPSA 1QFWH 4L9DA 3SGDI 3V52L 2X40A 4KC3B 1O5DT 1QRNB 1E27B 4LQFH 4JO3H 4BFGA 3HZKA 4X7TA 2E6QA 2O5XL 2PXYA 3EOAA 2CO6B 4L8DA 5DJXB 5EU4A 4U2ZA 3QCVL 3BP7B 2ICEA 3MYJB 4PJFF 2VLRE 4DVBB 3QUZD 5C0GB 5I75C 3WDJA 2B2XH 3ZHKA 3LPWA 5I1CL 4JM2A 4P99A 1A6UH 4F7MB 4Q7DA 1CLYH 4X5WB 3RGVD 5JMOC 4TSCH 3O8XD 2XWTA 4F57L 1T89C 2V9QA 4W81A 2XTJC 3PXJA 1NMCC 4IRSB 2FO4A 1MFCH 4Y16C 1I1AD 3GMRA 4ZAKB 4PJ7B 3DHMA 1ZLSH 4WHCA 3SGDH 3G5ZA 2C1PA 4HDIB 1TLKA 1HHHA 4J12A 5BW7A 5FHBH 3RL2A 3RKDC 4MJIA 3C6LB 1FNSL 3H9SD 4HWBL 5A3IC 4XPTL 4HH8A 2FO1A 4Y5YB 2FX9L 5DHYB 4EVNB 1LDPL 3ARQA 1HHJA 1X5GA 3ZKQD 12E8L 3TCXA 1RJYB 1HQRA 1A21A 5T3XE 4OCWL 2DQEL 2OJEB 3FTGA 3MUGA 4R0LA 4QWWD 3SGKC 3MV01 1DSFL 3QDGA 1W8OA 4OLZH 2VLJA 1H8SA 5DJ8B 2G9HA 1KEGH 2R0WH 3BVNB 3FB7A 1NKOA 1XAUA 1OAZL 1UJ3A 5KZCD 5M7QA 1FVCA 4HS8L 5FGBC 2EZ0D 1SJHA 1DVFB 4P2QE 4JPIA 5E2WL 5J56B 1U8HA 2FECL 5IB3A 3FL7A 2ICWB 1QSEE 5CSBA 5F70A 4RISL 1MWAL 4C59B 4E5XB 4XP6L 2VNCA 1QQDA 5IMLB 2I25N 5F1KC 1PD6A 4AT6B 2R2HA 1AKJD 1KGCE 3QIUB 1ADQH 2YPLD 4XCNA 2A9ML 1Q1JL 1U42A 3OKDA 4LCCC 5IFJB 4PJGE 4TNVK 2CJUH 4XRCA 2GUOB 2B5IB 1L7IL 3K2UH 2ARWA 3C5JA 4QRQB 3MLRL 1CFNA 4P23A 3VXRE 5DLML 5EB9A 2X70B 3HMXL 4XP9H 3IXAB 1EO8L 1FG9C 1VHPA 5GZOC 5EU3A 3L6FA 4OKVA 3G6JB 2Q8BL 4JFZL 4S11A 5E6IB 4JFQA 3GI8H 3FT3A 2XA8L 1T1ZA 5GS0L 3CC5A 1F90H 4JHAL 3ULVL 5ICZA 3WD5L 2GSGA 1B90A 4CU7A 1SJEB 1LP9E 3L3GB 1RK0A 5JMRA 4FQ1L 1P84K 2Y25A 2BNRB 5IW6A 2ZCLH 5ILTH 5C0DA 4PJXE 3QEQE 3MLUL 1ZHBA 3EYQD 4IMLB 1VFOA 2JIXD 2H45A 5E94A 4LLVB 4PJ9A 4K23L 1KCVH 1BD2E 4JKPH 5F89B 1NCCH 3QA3A 4C4KO 3TCLB 3MCG1 1KJ3H 1TXKA 3QRFM 3W9DA 1PG7W 3QH3B 5T3ZH 1C1EH 1MJUH 1G0DA 3BUYB 4NWUL 5EBMB 4YBQC 5IWLC 1JV5A 4ZD3L 1MI5A 4XX1G 1RZ7H 1AGEA 3T1WA 1JPSL 5FDWB 1YPZA 4JZJA 4NYLA 4PJ8B 4P4KA 2DM7A 4K8RH 1PYWB 2A9NL 3MUZ1 1RZJL 1T1WB 2PKDA 5D7IB 1YQ2A 2Q86A 1S7VA 3GJFH 3UJIH 3QDMA 1BWWA 2P47B 2ADJA 1U95B 4PJCA 1RZFL 1SBSL 3NACL 1LNUB 3UP1A 4JFEE 2E8YA 1AH1A 1IM9A 5F7DB 5TGBA 5DD5L 3EKCA 3BT2L 1B4JH 4MA1C 4ODVL 3TIDA 1U8QA 4GRWF 4RMTA 4NT6A 4FXGA 1FN4A 1XF4A 3FMGL 4TULH 2XKNB 4GG8B 3LEVH 5HY9A 2W60B 5F44A 4P2YA 3NA9H 3VFUA 5CEZD 2HVKA 2GT9B 3HE7B 2MKWA 4RMVA 1XF2B 2NY6B 3BEWA 4ONOA 1WQVT 2VZVA 4WENB 3QI9C 1CZ8L 1OLZA 1U3HA 1YEHH 1A6ZB 5M95B 4HXAH 4OIAA 3KR3H 5I17A 3OX8A 5L2KB 1MCOH 1L0XA 3MOQA 5E2VL 1NANI 3MYZA 5HHPA 2JJUA 1FBIH 1T2JA 4I0KA 3IDJB 1HH6B 2GW5A 2HT3D 3PGDA 3WFZA 1MCHA 1UB6A 4NOBA 3NIFF 4OKDA 3F7PC 3FHQA 1NBVL 1OPGH 3MXWL 2VJXA 5DD0H 1N2RA 4O58L 3DBXB 4HGKC 4HMCA 2BNQE 3TJEL 3UTSD 2B1AL 2VXVL 3WFHB 1W0YT 1YEDA 5HGBB 4IBLT 3IS0X 2XIDA 2H8PA 3BI9X 3D5OF 3NFSH 3BX7C 5ALBH 4IJ3C 3DECA 3L3OB 2AQ2A 1DBAH 4G3YL 4ZNEA 4K7PH 1NEZA 5EPMA 1E4JA 3MV9D 2R0ZH 3DROA 2J6EA 4XCCL 1QFWM 2CK0H 2FZ3B 1KCKA 3U0WL 2RB8A 4POYA 1J0ZA 4X98B 3RY4A 2ATKA 2H26B 2K9UA 3NGBC 5LWYL 1I9JL 1NANH 4LSTH 1QYGL 4Q2ZB 3HUJE 4TSBH 2OS7A 5E2TH 5ADPH 2PYEE 3IT8D 5I1EH 5J1AA 4YXKL 4X9BA 5H35A 1F2QA 4O4YL 3H9ZA 4UTAL 3F5WA 2DD8H 1UM6L 5IVXA 1JNJA 1HXMB 4HWZB 3RVWD 4XVUC 5HI5C 1NAML 3WL9A 4EOWL 4TUOA 4M93B 5I1DB 1CDUA 5TDNA 5LXGH 3Q5OA 4OV5A 2DYPB 1RUQL 1U8PB 1OAXH 3QCTL 1IQWL 3I6KB 3AAZA 4LVOC 2VDPH 3V6ZB 1E4XL 3GEWB 5IMKA 5F3HA 3MRCA 3IDMB 1LO5B 4JFFE 4YFLI 3VCLA 2VE6B 4P46C 4FABL 3M07A 5CILH 4LPYA 1BHGA 1TTUA 4GKNB 5IB4A 4BQBA 3KS0H 3QJHB 1M71A 3KLDA 4GSDL 5EC1A 4WGWB 3KPTA 4BUGA 3BQUB 4S10A 2FD6L 1TVBA 4GRLB 4PY8I 2R29H 4YDKH 1N0LA 3R0MA 1TZHB 2YD4A 2P1YA 3WKML 4L4TB 15C8H 4UDTA 3ETBF 3VJ6A 4XCYA 1B4RA 4QRRA 2P7TB 4X4ME 1M4KA 4PGCA 1F4YL 3MREB 1E28A 3ALPA 2WBJD 4PRAA 4HGMA 1J0JA 3FQTB 4R4FL 2BRQA 3NAAL 1JTTA 2D4DA 5D8JH 3GSQB 3HRPA 1YQVL 4UT6L 3QG6B 4YGAB 1K5NA 2P8MA 1YUHB 1AD0B 1OQXA 4NM4L 3ZE1F 1JYNA 6CGTA 3EZ8A 4LSQH 4UIKL 2AV7B 1HZHH 3Q3GB 3GSNH 3KPSB 2BVQA 2J1KA 4XXDA 1J1XL 5T5FL 4LP4A 1YC8A 3MRKB 4YAQB 3C2AH 1P69B 5GGTL 3SKNA 5FF6B 2VIRA 1QFUH 4HIEA 5CEYA 1NC4D 3S5LA 3HZKB 4X7TB 1KJ2L 2PXYB 3CH8A 4HUNB 3EOAB 4L8DB 5DQDH 5EU4B 4FQ2L 4ZFOA 3QXUA 5CUSH 2ICEB 3O4OC 3DI3B 3BGFC 1XIWD 4BUHA 5HD8D 2IAMC 2XQBL 2DQJH 4XAWH 4ZFGH 1QFOA 2DMKA 2XWTB 3MNVA 3LPFA 1FRGL 2FO4B 3GMRB 3OKYA 2GTWA 5CZKA 4HWEL 4JFYA 3G5ZB 4UBDD 2VR4A 3QIBC 1HHHB 3RZCC 3RL2B 2LABA 4MJIB 3KJ4C 1JPST 4IOFC 3EHBC 4TUJA 3T2QA 1VESA 1UENA 1ZV5A 3CK0L 5MERA 1UGNA 5L8KB 3FZUD 3PWLA 5E1AA 2PF6A 3CVHB 4Y4KC 3TFKD 3NIGF 3H9SE 1A5FL 5DURD 4ERSH 3MLYL 1OWRM 1HQRB 3IDGA 3REVA 1Z0MA 1YMMD 5IBUG 2MNUA 4P2OC 3MUGB 4R0LB 3NIDF 1CFTA 3QDGB 3H8NA 3QJFA 3PNWA 1RVFH 4XVSL 4Z0BH 5CKAA 3OAUH 4H20H 2G9HB 3QO0A 3FB7B 5IESH 1UJ3B 1FVCB 4EI5C 1MAJA 4EXPX 4CAGA 1E4WH 1SJHB 3O6KH 5IT2L 5E8DL 3OWEA 3QHTC 4JPIB 1U8HB 4KV5F 1TCRA 2HFEA 3IVKB 5IV2A 4ZTPL 2D31A 2JCCF 1F2XK 1QQDB 3DYOA 1I8KA 4N5EC 3V0AC 1CI5A 1GOHA 4RFNB 3WUWG 1P5VA 1OAQH 1I1FA 3B43A 4G7VL 4XCNB 1C5CL 1RUKH 1HSAA 3OKDB 1N64L 1J05A 4YUEL 4XRCB 4PRNA 2YPLE 3C5JB 2LV4A 5HTSA 4Y4HC 4YHYC 1CFNB 3QUXA 1FHGA 3SCMA 1T3FA 3CLFH 5K59F 1NCTA 5DJYA 4Y4FC 5EU3B 1PSKH 1Z6JT 3ES6A 4OKVB 3G5YA 1J8HE 4R9HA 1H3XA 4LSSL 5GGRA 4JFQB 4KK9D 3FT3B 1ZT1A 4HEME 1RZ8A 1XGYH 1T1ZB 4ELKA 4OD3L 5D7LD 5FXCH 2B2XL 1ZTXH 3CC5B 1A6UL 3VRLE 5ICZB 4M61A 4HW6A