4UVTA

Crystal structure of human tankyrase 2 in complex with 5-amino-4- methyl-1,2-dihydroisoquinolin-1-one
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploration of the Nicotinamide-Binding Site of the Tankyrases, Identifying 3-Arylisoquinolin-1-Ones as Potent and Selective Inhibitors in Vitro.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 69
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4uvtA00
4LI7A 4UVPA 4MSKA 4N4TA 4N4VA 4UVOA 1WOKA 4L2KA 4W5SA 4PNMA 2RF5A 3KCZA 4UUHA 5A00A 3SE2A 4BJCA 4HLFA 4R5WA 3KR8A 4J3MA 4GV4A 3GOYA 5C5RA 4BUWA 3GN7A 4TOSA 4KRSA 4L0BA 4R6EA 4TK0A 4L2FA 1GS0A 4HLGA 3UA9A 4HLMA 5FPGA 2PAWA 4BUAA 4BUVA 5LXPA 4BU5A 1A26A 4BUIA 4L09A 4BUDA 4HMHA 4KZQA 4I9IA 4UX4A 4BUYA 5ETYA 3L3LA 4L7OA 3U9YA 4M7BA 4PMLA 4BUUA 4BU6A 4U6AA 5AEHA 4L0IA 4PY4A 4TJUA 5C5PA 4HL5A 4UVLA 5ADQA 4L10A 4GV2A 4L7LA 4UI3A 2PQFA 4BUXA 4UXBA 4L7RA 3GEYA 4BUTA 5ADRA 4GV0A 2PAXA 3MHJA 4PJTA 4W6EA 4TORA 4J22A 4L0SA 4DQYC 4OQBC 5AL5A 3U9HA 4UVSA 4TKGA 4TJWA 4XHUA 4UI7A 4UVTA 4UNDA 5DCZA 4ZZYA 5ADTA 4TKFA 3C49A 4J21A 4HHZA 5ADSA 4HYFA 4IUEA 4L7PA 4BJ9A 4L0TA 5AL3A 4TKIA 4TJYA 4LI8A 3FHBA 3HKVA 4MSGA 5ECEA 4HLKA 4ZZXA 3W51A 4OQAC 4W5IA 4ZZZA 3CE0A 4OA7A 4UVXA 4BU9A 4HLHA 4PNNA 4L31A 4HKNA 4F0EA 4LI6A 3BLJA 4UVYA 4BU7A 4L0VA 4L33A 4KZLA 4J3LA 4RV6A 4TK5A 5EBTA 5LX6A 3L3MA 4HHYA 3MHKA 4DVIA 4UI8A 4X52A 2RD6A 1EFYA 4BS4A 5LYHA 4PNQA 4F1QA 2X5YA 4K4FA 5C5QA 3SMJA 3KJDA 4N3RA 4UFYA 4UFUA 4AVUA 4L34A 3P0NA 3PAXA 5AKWA 1PAXA 4HKKA 5FPFA 4L7UA 3P0PA 3P0QA 4PNSA 4L70A 4UVUA 4BUSA 4L7NA 4BU8A 4AVWA 4BUFA 3UDDA 4GV7A 1UK1A 4MT9A 4UVNA 4UVVA 4UW1A 4F1LA 3GJWA 4J1ZA 5AKUA 4BJBA 4BU3A 4UHGA 5AL2A 3SMIA 3UH2A 3C4HA 4UI6A 5AL4A 4K4EA 4UI4A 4BFPA 4TVJA 5AL1A 4HKIA 4UI5A 4UVWA 4L2GA 4PAXA 4PJVA 4L32A 4PNRA 4PNTA 4UVZA 4PNLA 1UK0A 4L6SA 3UH4A 4L6ZA 4KZUA 2RCWA 4BUEA 3KR7A 4OPXC
chains in the Genus database with same CATH superfamily
4LI7A 4UVPA 4MSKA 4N4TA 4N4VA 4UVOA 1WOKA 4L2KA 4W5SA 4PNMA 2RF5A 3KCZA 4UUHA 2ZCIA 2PC9A 5A00A 3SE2A 4HLFA 4OX2A 4R5WA 3DT7A 3KR8A 4J3MA 4GV4A 3GOYA 5FH1A 5C5RA 4BUWA 3GN7A 4TOSA 4KRSA 4L0BA 4R6EA 4YWBA 4TK0A 4GNQA 4L2FA 5FH2A 1GS0A 4HLGA 3UA9A 4HLMA 5FPGA 2PAWA 4BUAA 4BUVA 5LXPA 4BU5A 1YTMA 1A26A 4BUIA 4L09A 4BUDA 2RK8A 4HMHA 4KZQA 4I9IA 1AYLA 4UX4A 4R43A 4BUYA 5ETYA 5FH3A 3L3LA 4L7OA 3U9YA 4M7BA 4PMLA 4BUUA 4BU6A 4U6AA 5AEHA 4L0IA 4PY4A 4TJUA 5C5PA 4HL5A 4UVLA 1YVYA 5ADQA 4L10A 4GV2A 4L7LA 4UI3A 2RKDA 2PQFA 4BUXA 4UXBA 4L7RA 3GEYA 4BUTA 1KHEA 4GV0A 2PAXA 2PY7X 3MHJA 4PJTA 4W6EA 4TORA 5ADRA 1AQ2A 5FH0A 4J22A 4L0SA 4DQYC 4OQBC 5AL5A 2OLQA 3U9HA 4WL8A 4UVSA 4TKGA 4TJWA 4XHUA 2RKAA 4UI7A 4UVTA 4UNDA 5DCZA 3DT2A 4GNMA 4TKFA 4ZZYA 3C49A 5ADTA 4J21A 3MOEA 4HHZA 5ADSA 4HYFA 4IUEA 4L7PA 4BJ9A 4L0TA 5AL3A 4TKIA 1NHXA 4TJYA 4LI8A 3FHBA 1KHFA 3HKVA 4MSGA 5ECEA 4HLKA 4ZZXA 3W51A 4OQAC 1M51A 2FAHA 4W5IA 4ZZZA 3CE0A 4OA7A 4UVXA 3DT4A 4HLHA 4BU9A 4PNNA 4L31A 4HKNA 4YW9A 4LI6A 4F0EA 3BLJA 4UVYA 4BU7A 4L0VA 4L33A 4KZLA 4BJCA 4J3LA 4RV6A 4TK5A 5EBTA 5LX6A 3L3MA 1K3DA 4HHYA 3MHKA 4WPVA 4DVIA 2PXZX 4UI8A 2RD6A 1EFYA 4X52A 4BS4A 4PNQA 5LYHA 4F1QA 2X5YA 4K4FA 3MOHA 5C5QA 4GMZA 3DTBA 3SMJA 3KJDA 1OENA 4N3RA 4UFYA 4UFUA 2QEYA 4YWDA 4AVUA 4L34A 4GNOA 3P0NA 3PAXA 4WOUA 5AKWA 1PAXA 4HKKA 5FH4A 5FPFA 2OLRA 4L7UA 3P0PA 3P0QA 2RK7A 4L70A 4PNSA 4UVUA 4YW8A 4BUSA 4WIEA 2QEWA 4GMWA 1J3BA 4L7NA 4WIUA 4BU8A 1II2A 1OS1A 2QZYA 2RKEA 3MOFA 5I67A 4AVWA 1YLHA 4BUFA 3UDDA 4GV7A 1UK1A 1KHGA 4GMMA 4MT9A 4UVNA 1YGGA 4UVVA 4UW1A 4F1LA 4RCGA 3GJWA 4J1ZA 5AKUA 4BJBA 4BU3A 2GMVA 4UHGA 5AL2A 4GMUA 3SMIA 2QF1A 3UH2A 1KHBA 3C4HA 4UI6A 5AL4A 4K4EA 2FAFA 4UI4A 4GNPA 4GNLA 4BFPA 4TVJA 5AL1A 4HKIA 5FH5A 4UI5A 4UVWA 4L2GA 2QF2A 1K3CA 4PAXA 4PJVA 4L32A 4PNRA 4PNTA 4UVZA 4WPTA 4PNLA 1XKVA 1UK0A 4L6SA 3UH4A 4L6ZA 4KZUA 2RCWA 4BUEA 3KR7A 4WPUA 4OPXC
chains in the Genus database with same CATH topology
4LI7A 4UVPA 4MSKA 4N4TA 4N4VA 4UVOA 1WOKA 4L2KA 4W5SA 4PNMA 2RF5A 3KCZA 4UUHA 2ZCIA 2PC9A 5A00A 3SE2A 4HLFA 4OX2A 4R5WA 3DT7A 3KR8A 4J3MA 4GV4A 3GOYA 5FH1A 5C5RA 4BUWA 3GN7A 4TOSA 4KRSA 4L0BA 4R6EA 4YWBA 4TK0A 4GNQA 4L2FA 5FH2A 1GS0A 4HLGA 3UA9A 4HLMA 5FPGA 2PAWA 4BUAA 4BUVA 5LXPA 4BU5A 1YTMA 1A26A 4BUIA 4L09A 4BUDA 2RK8A 4HMHA 4KZQA 4I9IA 1AYLA 4UX4A 4R43A 4BUYA 5ETYA 5FH3A 3L3LA 4L7OA 3U9YA 4M7BA 4PMLA 4BUUA 4BU6A 4U6AA 5AEHA 4L0IA 4PY4A 4TJUA 5C5PA 4HL5A 4UVLA 1YVYA 5ADQA 4L10A 4GV2A 4L7LA 4UI3A 2RKDA 2PQFA 4BUXA 4UXBA 4L7RA 3GEYA 4BUTA 1KHEA 4GV0A 2PAXA 2PY7X 3MHJA 4PJTA 4W6EA 4TORA 5ADRA 1AQ2A 5FH0A 4J22A 4L0SA 4DQYC 4OQBC 5AL5A 2OLQA 3U9HA 4WL8A 4UVSA 4TKGA 4TJWA 4XHUA 2RKAA 4UI7A 4UVTA 4UNDA 5DCZA 3DT2A 4GNMA 4TKFA 4ZZYA 3C49A 5ADTA 4J21A 3MOEA 4HHZA 5ADSA 4HYFA 4IUEA 4L7PA 4BJ9A 4L0TA 5AL3A 4TKIA 1NHXA 4TJYA 4LI8A 3FHBA 1KHFA 3HKVA 4MSGA 5ECEA 4HLKA 4ZZXA 3W51A 4OQAC 1M51A 2FAHA 4W5IA 4ZZZA 3CE0A 4OA7A 4UVXA 3DT4A 4HLHA 4BU9A 4PNNA 4L31A 4HKNA 4YW9A 4LI6A 4F0EA 3BLJA 4UVYA 4BU7A 4L0VA 4L33A 4KZLA 4BJCA 4J3LA 4RV6A 4TK5A 5EBTA 5LX6A 3L3MA 1K3DA 4HHYA 3MHKA 4WPVA 4DVIA 2PXZX 4UI8A 2RD6A 1EFYA 4X52A 4BS4A 4PNQA 5LYHA 4F1QA 2X5YA 4K4FA 3MOHA 5C5QA 4GMZA 3DTBA 3SMJA 3KJDA 1OENA 4N3RA 4UFYA 4UFUA 2QEYA 4YWDA 4AVUA 4L34A 4GNOA 3P0NA 3PAXA 4WOUA 5AKWA 1PAXA 4HKKA 5FH4A 5FPFA 2OLRA 4L7UA 3P0PA 3P0QA 2RK7A 4L70A 4PNSA 4UVUA 4YW8A 4BUSA 4WIEA 2QEWA 4GMWA 1J3BA 4L7NA 4WIUA 4BU8A 1II2A 1OS1A 2QZYA 2RKEA 3MOFA 5I67A 4AVWA 1YLHA 4BUFA 3UDDA 4GV7A 1UK1A 1KHGA 4GMMA 4MT9A 4UVNA 1YGGA 4UVVA 4UW1A 4F1LA 4RCGA 3GJWA 4J1ZA 5AKUA 4BJBA 4BU3A 2GMVA 4UHGA 5AL2A 4GMUA 3SMIA 2QF1A 3UH2A 1KHBA 3C4HA 4UI6A 5AL4A 4K4EA 2FAFA 4UI4A 4GNPA 4GNLA 4BFPA 4TVJA 5AL1A 4HKIA 5FH5A 4UI5A 4UVWA 4L2GA 2QF2A 1K3CA 4PAXA 4PJVA 4L32A 4PNRA 4PNTA 4UVZA 4WPTA 4PNLA 1XKVA 1UK0A 4L6SA 3UH4A 4L6ZA 4KZUA 2RCWA 4BUEA 3KR7A 4WPUA 4OPXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LI7 A;  4UVP A;  4MSK A;  4N4T A;  4N4V A;  4UVO A;  1WOK A;  4L2K A;  4W5S A;  4PNM A;  2RF5 A;  3KCZ A;  4UUH A;  5A00 A;  3SE2 A;  4BJC A;  4HLF A;  4R5W A;  3KR8 A;  4J3M A;  4GV4 A;  3GOY A;  5C5R A;  4BUW A;  3GN7 A;  4TOS A;  4KRS A;  4L0B A;  4R6E A;  4TK0 A;  4L2F A;  1GS0 A;  4HLG A;  3UA9 A;  4HLM A;  5FPG A;  2PAW A;  4BUA A;  4BUV A;  5LXP A;  4BU5 A;  1A26 A;  4BUI A;  4L09 A;  4BUD A;  4HMH A;  4KZQ A;  4I9I A;  4UX4 A;  4BUY A;  5ETY A;  3L3L A;  4L7O A;  3U9Y A;  4M7B A;  4PML A;  4BUU A;  4BU6 A;  4U6A A;  5AEH A;  4L0I A;  4PY4 A;  4TJU A;  5C5P A;  4HL5 A;  4UVL A;  5ADQ A;  4L10 A;  4GV2 A;  4L7L A;  4UI3 A;  2PQF A;  4BUX A;  4UXB A;  4L7R A;  3GEY A;  4BUT A;  5ADR A;  4GV0 A;  2PAX A;  3MHJ A;  4PJT A;  4W6E A;  4TOR A;  4J22 A;  4L0S A;  4DQY C;  4OQB C;  5AL5 A;  3U9H A;  4UVS A;  4TKG A;  4TJW A;  4XHU A;  4UI7 A;  4UVT A;  4UND A;  5DCZ A;  4ZZY A;  5ADT A;  4TKF A;  3C49 A;  4J21 A;  4HHZ A;  5ADS A;  4HYF A;  4IUE A;  4L7P A;  4BJ9 A;  4L0T A;  5AL3 A;  4TKI A;  4TJY A;  4LI8 A;  3FHB A;  3HKV A;  4MSG A;  5ECE A;  4HLK A;  4ZZX A;  3W51 A;  4OQA C;  4W5I A;  4ZZZ A;  3CE0 A;  4OA7 A;  4UVX A;  4BU9 A;  4HLH A;  4PNN A;  4L31 A;  4HKN A;  4F0E A;  4LI6 A;  3BLJ A;  4UVY A;  4BU7 A;  4L0V A;  4L33 A;  4KZL A;  4J3L A;  4RV6 A;  4TK5 A;  5EBT A;  5LX6 A;  3L3M A;  4HHY A;  3MHK A;  4DVI A;  4UI8 A;  4X52 A;  2RD6 A;  1EFY A;  4BS4 A;  5LYH A;  4PNQ A;  4F1Q A;  2X5Y A;  4K4F A;  5C5Q A;  3SMJ A;  3KJD A;  4N3R A;  4UFY A;  4UFU A;  4AVU A;  4L34 A;  3P0N A;  3PAX A;  5AKW A;  1PAX A;  4HKK A;  5FPF A;  4L7U A;  3P0P A;  3P0Q A;  4PNS A;  4L70 A;  4UVU A;  4BUS A;  4L7N A;  4BU8 A;  4AVW A;  4BUF A;  3UDD A;  4GV7 A;  1UK1 A;  4MT9 A;  4UVN A;  4UVV A;  4UW1 A;  4F1L A;  3GJW A;  4J1Z A;  5AKU A;  4BJB A;  4BU3 A;  4UHG A;  5AL2 A;  3SMI A;  3UH2 A;  3C4H A;  4UI6 A;  5AL4 A;  4K4E A;  4UI4 A;  4BFP A;  4TVJ A;  5AL1 A;  4HKI A;  4UI5 A;  4UVW A;  4L2G A;  4PAX A;  4PJV A;  4L32 A;  4PNR A;  4PNT A;  4UVZ A;  4PNL A;  1UK0 A;  4L6S A;  3UH4 A;  4L6Z A;  4KZU A;  2RCW A;  4BUE A;  3KR7 A;  4OPX C; 
#chains in the Genus database with same CATH topology
 4LI7 A;  4UVP A;  4MSK A;  4N4T A;  4N4V A;  4UVO A;  1WOK A;  4L2K A;  4W5S A;  4PNM A;  2RF5 A;  3KCZ A;  4UUH A;  2ZCI A;  2PC9 A;  5A00 A;  3SE2 A;  4HLF A;  4OX2 A;  4R5W A;  3DT7 A;  3KR8 A;  4J3M A;  4GV4 A;  3GOY A;  5FH1 A;  5C5R A;  4BUW A;  3GN7 A;  4TOS A;  4KRS A;  4L0B A;  4R6E A;  4YWB A;  4TK0 A;  4GNQ A;  4L2F A;  5FH2 A;  1GS0 A;  4HLG A;  3UA9 A;  4HLM A;  5FPG A;  2PAW A;  4BUA A;  4BUV A;  5LXP A;  4BU5 A;  1YTM A;  1A26 A;  4BUI A;  4L09 A;  4BUD A;  2RK8 A;  4HMH A;  4KZQ A;  4I9I A;  1AYL A;  4UX4 A;  4R43 A;  4BUY A;  5ETY A;  5FH3 A;  3L3L A;  4L7O A;  3U9Y A;  4M7B A;  4PML A;  4BUU A;  4BU6 A;  4U6A A;  5AEH A;  4L0I A;  4PY4 A;  4TJU A;  5C5P A;  4HL5 A;  4UVL A;  1YVY A;  5ADQ A;  4L10 A;  4GV2 A;  4L7L A;  4UI3 A;  2RKD A;  2PQF A;  4BUX A;  4UXB A;  4L7R A;  3GEY A;  4BUT A;  1KHE A;  4GV0 A;  2PAX A;  2PY7 X;  3MHJ A;  4PJT A;  4W6E A;  4TOR A;  5ADR A;  1AQ2 A;  5FH0 A;  4J22 A;  4L0S A;  4DQY C;  4OQB C;  5AL5 A;  2OLQ A;  3U9H A;  4WL8 A;  4UVS A;  4TKG A;  4TJW A;  4XHU A;  2RKA A;  4UI7 A;  4UVT A;  4UND A;  5DCZ A;  3DT2 A;  4GNM A;  4TKF A;  4ZZY A;  3C49 A;  5ADT A;  4J21 A;  3MOE A;  4HHZ A;  5ADS A;  4HYF A;  4IUE A;  4L7P A;  4BJ9 A;  4L0T A;  5AL3 A;  4TKI A;  1NHX A;  4TJY A;  4LI8 A;  3FHB A;  1KHF A;  3HKV A;  4MSG A;  5ECE A;  4HLK A;  4ZZX A;  3W51 A;  4OQA C;  1M51 A;  2FAH A;  4W5I A;  4ZZZ A;  3CE0 A;  4OA7 A;  4UVX A;  3DT4 A;  4HLH A;  4BU9 A;  4PNN A;  4L31 A;  4HKN A;  4YW9 A;  4LI6 A;  4F0E A;  3BLJ A;  4UVY A;  4BU7 A;  4L0V A;  4L33 A;  4KZL A;  4BJC A;  4J3L A;  4RV6 A;  4TK5 A;  5EBT A;  5LX6 A;  3L3M A;  1K3D A;  4HHY A;  3MHK A;  4WPV A;  4DVI A;  2PXZ X;  4UI8 A;  2RD6 A;  1EFY A;  4X52 A;  4BS4 A;  4PNQ A;  5LYH A;  4F1Q A;  2X5Y A;  4K4F A;  3MOH A;  5C5Q A;  4GMZ A;  3DTB A;  3SMJ A;  3KJD A;  1OEN A;  4N3R A;  4UFY A;  4UFU A;  2QEY A;  4YWD A;  4AVU A;  4L34 A;  4GNO A;  3P0N A;  3PAX A;  4WOU A;  5AKW A;  1PAX A;  4HKK A;  5FH4 A;  5FPF A;  2OLR A;  4L7U A;  3P0P A;  3P0Q A;  2RK7 A;  4L70 A;  4PNS A;  4UVU A;  4YW8 A;  4BUS A;  4WIE A;  2QEW A;  4GMW A;  1J3B A;  4L7N A;  4WIU A;  4BU8 A;  1II2 A;  1OS1 A;  2QZY A;  2RKE A;  3MOF A;  5I67 A;  4AVW A;  1YLH A;  4BUF A;  3UDD A;  4GV7 A;  1UK1 A;  1KHG A;  4GMM A;  4MT9 A;  4UVN A;  1YGG A;  4UVV A;  4UW1 A;  4F1L A;  4RCG A;  3GJW A;  4J1Z A;  5AKU A;  4BJB A;  4BU3 A;  2GMV A;  4UHG A;  5AL2 A;  4GMU A;  3SMI A;  2QF1 A;  3UH2 A;  1KHB A;  3C4H A;  4UI6 A;  5AL4 A;  4K4E A;  2FAF A;  4UI4 A;  4GNP A;  4GNL A;  4BFP A;  4TVJ A;  5AL1 A;  4HKI A;  5FH5 A;  4UI5 A;  4UVW A;  4L2G A;  2QF2 A;  1K3C A;  4PAX A;  4PJV A;  4L32 A;  4PNR A;  4PNT A;  4UVZ A;  4WPT A;  4PNL A;  1XKV A;  1UK0 A;  4L6S A;  3UH4 A;  4L6Z A;  4KZU A;  2RCW A;  4BUE A;  3KR7 A;  4WPU A;  4OPX C; 
#chains in the Genus database with same CATH homology
 4LI7 A;  4UVP A;  4MSK A;  4N4T A;  4N4V A;  4UVO A;  1WOK A;  4L2K A;  4W5S A;  4PNM A;  2RF5 A;  3KCZ A;  4UUH A;  2ZCI A;  2PC9 A;  5A00 A;  3SE2 A;  4HLF A;  4OX2 A;  4R5W A;  3DT7 A;  3KR8 A;  4J3M A;  4GV4 A;  3GOY A;  5FH1 A;  5C5R A;  4BUW A;  3GN7 A;  4TOS A;  4KRS A;  4L0B A;  4R6E A;  4YWB A;  4TK0 A;  4GNQ A;  4L2F A;  5FH2 A;  1GS0 A;  4HLG A;  3UA9 A;  4HLM A;  5FPG A;  2PAW A;  4BUA A;  4BUV A;  5LXP A;  4BU5 A;  1YTM A;  1A26 A;  4BUI A;  4L09 A;  4BUD A;  2RK8 A;  4HMH A;  4KZQ A;  4I9I A;  1AYL A;  4UX4 A;  4R43 A;  4BUY A;  5ETY A;  5FH3 A;  3L3L A;  4L7O A;  3U9Y A;  4M7B A;  4PML A;  4BUU A;  4BU6 A;  4U6A A;  5AEH A;  4L0I A;  4PY4 A;  4TJU A;  5C5P A;  4HL5 A;  4UVL A;  1YVY A;  5ADQ A;  4L10 A;  4GV2 A;  4L7L A;  4UI3 A;  2RKD A;  2PQF A;  4BUX A;  4UXB A;  4L7R A;  3GEY A;  4BUT A;  1KHE A;  4GV0 A;  2PAX A;  2PY7 X;  3MHJ A;  4PJT A;  4W6E A;  4TOR A;  5ADR A;  1AQ2 A;  5FH0 A;  4J22 A;  4L0S A;  4DQY C;  4OQB C;  5AL5 A;  2OLQ A;  3U9H A;  4WL8 A;  4UVS A;  4TKG A;  4TJW A;  4XHU A;  2RKA A;  4UI7 A;  4UVT A;  4UND A;  5DCZ A;  3DT2 A;  4GNM A;  4TKF A;  4ZZY A;  3C49 A;  5ADT A;  4J21 A;  3MOE A;  4HHZ A;  5ADS A;  4HYF A;  4IUE A;  4L7P A;  4BJ9 A;  4L0T A;  5AL3 A;  4TKI A;  1NHX A;  4TJY A;  4LI8 A;  3FHB A;  1KHF A;  3HKV A;  4MSG A;  5ECE A;  4HLK A;  4ZZX A;  3W51 A;  4OQA C;  1M51 A;  2FAH A;  4W5I A;  4ZZZ A;  3CE0 A;  4OA7 A;  4UVX A;  3DT4 A;  4HLH A;  4BU9 A;  4PNN A;  4L31 A;  4HKN A;  4YW9 A;  4LI6 A;  4F0E A;  3BLJ A;  4UVY A;  4BU7 A;  4L0V A;  4L33 A;  4KZL A;  4BJC A;  4J3L A;  4RV6 A;  4TK5 A;  5EBT A;  5LX6 A;  3L3M A;  1K3D A;  4HHY A;  3MHK A;  4WPV A;  4DVI A;  2PXZ X;  4UI8 A;  2RD6 A;  1EFY A;  4X52 A;  4BS4 A;  4PNQ A;  5LYH A;  4F1Q A;  2X5Y A;  4K4F A;  3MOH A;  5C5Q A;  4GMZ A;  3DTB A;  3SMJ A;  3KJD A;  1OEN A;  4N3R A;  4UFY A;  4UFU A;  2QEY A;  4YWD A;  4AVU A;  4L34 A;  4GNO A;  3P0N A;  3PAX A;  4WOU A;  5AKW A;  1PAX A;  4HKK A;  5FH4 A;  5FPF A;  2OLR A;  4L7U A;  3P0P A;  3P0Q A;  2RK7 A;  4L70 A;  4PNS A;  4UVU A;  4YW8 A;  4BUS A;  4WIE A;  2QEW A;  4GMW A;  1J3B A;  4L7N A;  4WIU A;  4BU8 A;  1II2 A;  1OS1 A;  2QZY A;  2RKE A;  3MOF A;  5I67 A;  4AVW A;  1YLH A;  4BUF A;  3UDD A;  4GV7 A;  1UK1 A;  1KHG A;  4GMM A;  4MT9 A;  4UVN A;  1YGG A;  4UVV A;  4UW1 A;  4F1L A;  4RCG A;  3GJW A;  4J1Z A;  5AKU A;  4BJB A;  4BU3 A;  2GMV A;  4UHG A;  5AL2 A;  4GMU A;  3SMI A;  2QF1 A;  3UH2 A;  1KHB A;  3C4H A;  4UI6 A;  5AL4 A;  4K4E A;  2FAF A;  4UI4 A;  4GNP A;  4GNL A;  4BFP A;  4TVJ A;  5AL1 A;  4HKI A;  5FH5 A;  4UI5 A;  4UVW A;  4L2G A;  2QF2 A;  1K3C A;  4PAX A;  4PJV A;  4L32 A;  4PNR A;  4PNT A;  4UVZ A;  4WPT A;  4PNL A;  1XKV A;  1UK0 A;  4L6S A;  3UH4 A;  4L6Z A;  4KZU A;  2RCW A;  4BUE A;  3KR7 A;  4WPU A;  4OPX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...