4UVWA

Crystal structure of human tankyrase 2 in complex with 4,5-dimethyl-3- phenyl-1,2-dihydroisoquinolin-1-one
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploration of the Nicotinamide-Binding Site of the Tankyrases, Identifying 3-Arylisoquinolin-1-Ones as Potent and Selective Inhibitors in Vitro.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4uvwA00
4BU7A 3P0QA 4L2FA 4BFPA 4W6EA 4L0VA 4U6AA 4BUXA 4OQAC 3L3LA 4UVUA 5DCZA 4OQBC 4R6EA 1GS0A 4UVZA 4KRSA 3L3MA 4HKIA 4M7BA 4BUWA 4W5IA 5ADTA 4UW1A 4TKGA 3P0NA 4N4TA 4UVXA 4TK5A 4BU8A 4UVVA 1PAXA 4TK0A 3MHJA 3W51A 3C4HA 4TJYA 5AL2A 3KR7A 4L31A 4PNMA 4I9IA 5LXPA 4GV0A 4R5WA 4UVTA 4F0EA 4UI8A 4XHUA 5AL4A 4KZQA 5EBTA 4BUUA 4UVYA 5AEHA 4BUSA 5ECEA 4LI6A 5AKUA 4BUTA 2X5YA 4LI8A 4TORA 4K4EA 4OA7A 2PAXA 4L7UA 4BUYA 4HHZA 4N4VA 4BUVA 3GEYA 4L33A 4PNTA 4L6SA 3UH2A 4OPXC 4UI5A 3UDDA 4L7PA 4X52A 4J22A 4L0SA 2PAWA 1A26A 4HLMA 5AL1A 5AKWA 4ZZXA 3KR8A 4PNQA 4K4FA 4BUEA 5ADQA 4PNLA 5A00A 4PAXA 4DVIA 4HLHA 3SMIA 4GV4A 4BUFA 5ADRA 4DQYC 1UK0A 3GOYA 4TJWA 4L7OA 4UHGA 4LI7A 4UVNA 4BUIA 3PAXA 4PJTA 4BU3A 4BJCA 4TJUA 1EFYA 5ETYA 5FPGA 4BUDA 4TKFA 3HKVA 4HLGA 4HLKA 4L10A 4L2GA 4UVSA 4W5SA 3SE2A 4BJ9A 1UK1A 2RCWA 3BLJA 5AL5A 4ZZYA 4L7LA 5AL3A 4UVOA 3UA9A 4UI6A 5C5RA 4L09A 4HHYA 4GV7A 4L7RA 4UUHA 4UX4A 1WOKA 4L32A 4GV2A 4TKIA 4UVWA 4F1LA 4HLFA 4BU6A 5LX6A 3P0PA 4UI7A 4UI4A 3FHBA 4L0BA 4N3RA 4J1ZA 3UH4A 4F1QA 4ZZZA 4UFYA 4UNDA 5FPFA 2RD6A 4HL5A 3KCZA 4UXBA 5C5PA 5ADSA 4L2KA 3KJDA 4UVLA 4L6ZA 3GJWA 4HMHA 2RF5A 4MSGA 4BS4A 4HYFA 3U9YA 4MT9A 4L70A 5C5QA 3SMJA 4PJVA 4PY4A 4UFUA 4L7NA 3GN7A 4BUAA 4L0IA 4KZLA 4AVWA 4BJBA 4J21A 4TOSA 4IUEA 4PMLA 3CE0A 4RV6A 4AVUA 4KZUA 4PNNA 2PQFA 4MSKA 4TVJA 3U9HA 4J3MA 4PNSA 4UI3A 4UVPA 4HKKA 4J3LA 4PNRA 4BU5A 3MHKA 3C49A 4HKNA 4L0TA 5LYHA 4BU9A 4L34A
chains in the Genus database with same CATH superfamily
2QEWA 4BU7A 3P0QA 4GNOA 4L2FA 4BFPA 4W6EA 4L0VA 4U6AA 1KHGA 4BUXA 4OQAC 3L3LA 2OLQA 1AYLA 4UVUA 5DCZA 4OQBC 4R6EA 1GS0A 4UVZA 4KRSA 1YGGA 3L3MA 4HKIA 4M7BA 4BUWA 4W5IA 5ADTA 4UW1A 4TKGA 2ZCIA 3P0NA 3DT2A 4N4TA 4TK5A 4UVXA 4BU8A 4RCGA 4UVVA 1PAXA 4GNMA 4TK0A 3MHJA 3W51A 3C4HA 4TJYA 5AL2A 4GMUA 3KR7A 4L31A 4PNMA 4I9IA 5LXPA 4GV0A 5FH0A 4R5WA 4UVTA 4F0EA 4UI8A 4XHUA 5AL4A 4WPVA 4KZQA 2RKDA 5EBTA 4BUUA 4UVYA 5FH4A 5FH3A 5AEHA 4BUSA 1NHXA 5ECEA 4LI6A 5AKUA 4BUTA 2X5YA 2RK8A 4LI8A 4TORA 4WL8A 4K4EA 4OA7A 2PAXA 4L7UA 4BUYA 4HHZA 4N4VA 4BUVA 4WIUA 2QF1A 3GEYA 4L33A 4PNTA 4L6SA 3UH2A 4OPXC 4YWBA 4UI5A 3UDDA 4L7PA 4X52A 4WPTA 4J22A 4L0SA 2PAWA 1A26A 4HLMA 1KHEA 5AL1A 1M51A 5AKWA 4YW9A 4ZZXA 3KR8A 4PNQA 3DTBA 4K4FA 4BUEA 4WPUA 5ADQA 2QZYA 4PNLA 4PAXA 4WOUA 4HLHA 5A00A 3SMIA 4DVIA 4GV4A 3MOEA 4BUFA 5ADRA 4DQYC 1UK0A 3GOYA 4TJWA 4L7OA 3MOHA 4UHGA 4GNPA 4LI7A 1OENA 4UVNA 4BUIA 2GMVA 3PAXA 4GMZA 4PJTA 1J3BA 4BU3A 2PC9A 4BJCA 4TJUA 1EFYA 1XKVA 5ETYA 5FPGA 4BUDA 4TKFA 3HKVA 4HLGA 2RKAA 4HLKA 4L10A 4L2GA 4UVSA 4W5SA 3SE2A 4BJ9A 4GMWA 1UK1A 2RCWA 3BLJA 4OX2A 5AL5A 4ZZYA 1II2A 4L7LA 2FAFA 2PY7X 5FH2A 5AL3A 4UVOA 2QF2A 3UA9A 4UI6A 5C5RA 4L09A 4HHYA 4GV7A 4L7RA 4UUHA 4UX4A 1OS1A 1WOKA 4GV2A 4L32A 2RKEA 4TKIA 4HLFA 4UVWA 4BU6A 4F1LA 5LX6A 3P0PA 4UI7A 4UI4A 5FH1A 3FHBA 4L0BA 4N3RA 4J1ZA 1KHBA 3UH4A 4GNQA 4F1QA 4ZZZA 4UFYA 5FPFA 2PXZX 4UNDA 1KHFA 2RD6A 1YTMA 3KCZA 4HL5A 4UXBA 5C5PA 1K3CA 3KJDA 4GMMA 4L2KA 4UVLA 4L6ZA 5ADSA 4YW8A 2OLRA 5I67A 2QEYA 5FH5A 3GJWA 4HMHA 2RF5A 4MSGA 4BS4A 1AQ2A 4R43A 2FAHA 4HYFA 3U9YA 4MT9A 4L70A 1K3DA 3DT4A 5C5QA 3SMJA 4PJVA 1YVYA 4PY4A 4UFUA 4L7NA 3GN7A 4BUAA 4L0IA 4KZLA 4AVWA 4BJBA 1YLHA 4J21A 4TOSA 4IUEA 4PMLA 3CE0A 4RV6A 4AVUA 4KZUA 4PNNA 2PQFA 4MSKA 4TVJA 3U9HA 3DT7A 4J3MA 4WIEA 2RK7A 4PNSA 4GNLA 4UI3A 4UVPA 4HKKA 4J3LA 4PNRA 4BU5A 3MOFA 3MHKA 4YWDA 3C49A 4HKNA 4L0TA 5LYHA 4BU9A 4L34A
chains in the Genus database with same CATH topology
2QEWA 4BU7A 3P0QA 4GNOA 4L2FA 4BFPA 4W6EA 4L0VA 4U6AA 1KHGA 4BUXA 4OQAC 3L3LA 2OLQA 1AYLA 4UVUA 5DCZA 4OQBC 4R6EA 1GS0A 4UVZA 4KRSA 1YGGA 3L3MA 4HKIA 4M7BA 4BUWA 4W5IA 5ADTA 4UW1A 4TKGA 2ZCIA 3P0NA 3DT2A 4N4TA 4TK5A 4UVXA 4BU8A 4RCGA 4UVVA 1PAXA 4GNMA 4TK0A 3MHJA 3W51A 3C4HA 4TJYA 5AL2A 4GMUA 3KR7A 4L31A 4PNMA 4I9IA 5LXPA 4GV0A 5FH0A 4R5WA 4UVTA 4F0EA 4UI8A 4XHUA 5AL4A 4WPVA 4KZQA 2RKDA 5EBTA 4BUUA 4UVYA 5FH4A 5FH3A 5AEHA 4BUSA 1NHXA 5ECEA 4LI6A 5AKUA 4BUTA 2X5YA 2RK8A 4LI8A 4TORA 4WL8A 4K4EA 4OA7A 2PAXA 4L7UA 4BUYA 4HHZA 4N4VA 4BUVA 4WIUA 2QF1A 3GEYA 4L33A 4PNTA 4L6SA 3UH2A 4OPXC 4YWBA 4UI5A 3UDDA 4L7PA 4X52A 4WPTA 4J22A 4L0SA 2PAWA 1A26A 4HLMA 1KHEA 5AL1A 1M51A 5AKWA 4YW9A 4ZZXA 3KR8A 4PNQA 3DTBA 4K4FA 4BUEA 4WPUA 5ADQA 2QZYA 4PNLA 4PAXA 4WOUA 4HLHA 5A00A 3SMIA 4DVIA 4GV4A 3MOEA 4BUFA 5ADRA 4DQYC 1UK0A 3GOYA 4TJWA 4L7OA 3MOHA 4UHGA 4GNPA 4LI7A 1OENA 4UVNA 4BUIA 2GMVA 3PAXA 4GMZA 4PJTA 1J3BA 4BU3A 2PC9A 4BJCA 4TJUA 1EFYA 1XKVA 5ETYA 5FPGA 4BUDA 4TKFA 3HKVA 4HLGA 2RKAA 4HLKA 4L10A 4L2GA 4UVSA 4W5SA 3SE2A 4BJ9A 4GMWA 1UK1A 2RCWA 3BLJA 4OX2A 5AL5A 4ZZYA 1II2A 4L7LA 2FAFA 2PY7X 5FH2A 5AL3A 4UVOA 2QF2A 3UA9A 4UI6A 5C5RA 4L09A 4HHYA 4GV7A 4L7RA 4UUHA 4UX4A 1OS1A 1WOKA 4GV2A 4L32A 2RKEA 4TKIA 4HLFA 4UVWA 4BU6A 4F1LA 5LX6A 3P0PA 4UI7A 4UI4A 5FH1A 3FHBA 4L0BA 4N3RA 4J1ZA 1KHBA 3UH4A 4GNQA 4F1QA 4ZZZA 4UFYA 5FPFA 2PXZX 4UNDA 1KHFA 2RD6A 1YTMA 3KCZA 4HL5A 4UXBA 5C5PA 1K3CA 3KJDA 4GMMA 4L2KA 4UVLA 4L6ZA 5ADSA 4YW8A 2OLRA 5I67A 2QEYA 5FH5A 3GJWA 4HMHA 2RF5A 4MSGA 4BS4A 1AQ2A 4R43A 2FAHA 4HYFA 3U9YA 4MT9A 4L70A 1K3DA 3DT4A 5C5QA 3SMJA 4PJVA 1YVYA 4PY4A 4UFUA 4L7NA 3GN7A 4BUAA 4L0IA 4KZLA 4AVWA 4BJBA 1YLHA 4J21A 4TOSA 4IUEA 4PMLA 3CE0A 4RV6A 4AVUA 4KZUA 4PNNA 2PQFA 4MSKA 4TVJA 3U9HA 3DT7A 4J3MA 4WIEA 2RK7A 4PNSA 4GNLA 4UI3A 4UVPA 4HKKA 4J3LA 4PNRA 4BU5A 3MOFA 3MHKA 4YWDA 3C49A 4HKNA 4L0TA 5LYHA 4BU9A 4L34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BU7 A;  3P0Q A;  4L2F A;  4BFP A;  4W6E A;  4L0V A;  4U6A A;  4BUX A;  4OQA C;  3L3L A;  4UVU A;  5DCZ A;  4OQB C;  4R6E A;  1GS0 A;  4UVZ A;  4KRS A;  3L3M A;  4HKI A;  4M7B A;  4BUW A;  4W5I A;  5ADT A;  4UW1 A;  4TKG A;  3P0N A;  4N4T A;  4UVX A;  4TK5 A;  4BU8 A;  4UVV A;  1PAX A;  4TK0 A;  3MHJ A;  3W51 A;  3C4H A;  4TJY A;  5AL2 A;  3KR7 A;  4L31 A;  4PNM A;  4I9I A;  5LXP A;  4GV0 A;  4R5W A;  4UVT A;  4F0E A;  4UI8 A;  4XHU A;  5AL4 A;  4KZQ A;  5EBT A;  4BUU A;  4UVY A;  5AEH A;  4BUS A;  5ECE A;  4LI6 A;  5AKU A;  4BUT A;  2X5Y A;  4LI8 A;  4TOR A;  4K4E A;  4OA7 A;  2PAX A;  4L7U A;  4BUY A;  4HHZ A;  4N4V A;  4BUV A;  3GEY A;  4L33 A;  4PNT A;  4L6S A;  3UH2 A;  4OPX C;  4UI5 A;  3UDD A;  4L7P A;  4X52 A;  4J22 A;  4L0S A;  2PAW A;  1A26 A;  4HLM A;  5AL1 A;  5AKW A;  4ZZX A;  3KR8 A;  4PNQ A;  4K4F A;  4BUE A;  5ADQ A;  4PNL A;  5A00 A;  4PAX A;  4DVI A;  4HLH A;  3SMI A;  4GV4 A;  4BUF A;  5ADR A;  4DQY C;  1UK0 A;  3GOY A;  4TJW A;  4L7O A;  4UHG A;  4LI7 A;  4UVN A;  4BUI A;  3PAX A;  4PJT A;  4BU3 A;  4BJC A;  4TJU A;  1EFY A;  5ETY A;  5FPG A;  4BUD A;  4TKF A;  3HKV A;  4HLG A;  4HLK A;  4L10 A;  4L2G A;  4UVS A;  4W5S A;  3SE2 A;  4BJ9 A;  1UK1 A;  2RCW A;  3BLJ A;  5AL5 A;  4ZZY A;  4L7L A;  5AL3 A;  4UVO A;  3UA9 A;  4UI6 A;  5C5R A;  4L09 A;  4HHY A;  4GV7 A;  4L7R A;  4UUH A;  4UX4 A;  1WOK A;  4L32 A;  4GV2 A;  4TKI A;  4UVW A;  4F1L A;  4HLF A;  4BU6 A;  5LX6 A;  3P0P A;  4UI7 A;  4UI4 A;  3FHB A;  4L0B A;  4N3R A;  4J1Z A;  3UH4 A;  4F1Q A;  4ZZZ A;  4UFY A;  4UND A;  5FPF A;  2RD6 A;  4HL5 A;  3KCZ A;  4UXB A;  5C5P A;  5ADS A;  4L2K A;  3KJD A;  4UVL A;  4L6Z A;  3GJW A;  4HMH A;  2RF5 A;  4MSG A;  4BS4 A;  4HYF A;  3U9Y A;  4MT9 A;  4L70 A;  5C5Q A;  3SMJ A;  4PJV A;  4PY4 A;  4UFU A;  4L7N A;  3GN7 A;  4BUA A;  4L0I A;  4KZL A;  4AVW A;  4BJB A;  4J21 A;  4TOS A;  4IUE A;  4PML A;  3CE0 A;  4RV6 A;  4AVU A;  4KZU A;  4PNN A;  2PQF A;  4MSK A;  4TVJ A;  3U9H A;  4J3M A;  4PNS A;  4UI3 A;  4UVP A;  4HKK A;  4J3L A;  4PNR A;  4BU5 A;  3MHK A;  3C49 A;  4HKN A;  4L0T A;  5LYH A;  4BU9 A;  4L34 A; 
#chains in the Genus database with same CATH topology
 2QEW A;  4BU7 A;  3P0Q A;  4GNO A;  4L2F A;  4BFP A;  4W6E A;  4L0V A;  4U6A A;  1KHG A;  4BUX A;  4OQA C;  3L3L A;  2OLQ A;  1AYL A;  4UVU A;  5DCZ A;  4OQB C;  4R6E A;  1GS0 A;  4UVZ A;  4KRS A;  1YGG A;  3L3M A;  4HKI A;  4M7B A;  4BUW A;  4W5I A;  5ADT A;  4UW1 A;  4TKG A;  2ZCI A;  3P0N A;  3DT2 A;  4N4T A;  4TK5 A;  4UVX A;  4BU8 A;  4RCG A;  4UVV A;  1PAX A;  4GNM A;  4TK0 A;  3MHJ A;  3W51 A;  3C4H A;  4TJY A;  5AL2 A;  4GMU A;  3KR7 A;  4L31 A;  4PNM A;  4I9I A;  5LXP A;  4GV0 A;  5FH0 A;  4R5W A;  4UVT A;  4F0E A;  4UI8 A;  4XHU A;  5AL4 A;  4WPV A;  4KZQ A;  2RKD A;  5EBT A;  4BUU A;  4UVY A;  5FH4 A;  5FH3 A;  5AEH A;  4BUS A;  1NHX A;  5ECE A;  4LI6 A;  5AKU A;  4BUT A;  2X5Y A;  2RK8 A;  4LI8 A;  4TOR A;  4WL8 A;  4K4E A;  4OA7 A;  2PAX A;  4L7U A;  4BUY A;  4HHZ A;  4N4V A;  4BUV A;  4WIU A;  2QF1 A;  3GEY A;  4L33 A;  4PNT A;  4L6S A;  3UH2 A;  4OPX C;  4YWB A;  4UI5 A;  3UDD A;  4L7P A;  4X52 A;  4WPT A;  4J22 A;  4L0S A;  2PAW A;  1A26 A;  4HLM A;  1KHE A;  5AL1 A;  1M51 A;  5AKW A;  4YW9 A;  4ZZX A;  3KR8 A;  4PNQ A;  3DTB A;  4K4F A;  4BUE A;  4WPU A;  5ADQ A;  2QZY A;  4PNL A;  4PAX A;  4WOU A;  4HLH A;  5A00 A;  3SMI A;  4DVI A;  4GV4 A;  3MOE A;  4BUF A;  5ADR A;  4DQY C;  1UK0 A;  3GOY A;  4TJW A;  4L7O A;  3MOH A;  4UHG A;  4GNP A;  4LI7 A;  1OEN A;  4UVN A;  4BUI A;  2GMV A;  3PAX A;  4GMZ A;  4PJT A;  1J3B A;  4BU3 A;  2PC9 A;  4BJC A;  4TJU A;  1EFY A;  1XKV A;  5ETY A;  5FPG A;  4BUD A;  4TKF A;  3HKV A;  4HLG A;  2RKA A;  4HLK A;  4L10 A;  4L2G A;  4UVS A;  4W5S A;  3SE2 A;  4BJ9 A;  4GMW A;  1UK1 A;  2RCW A;  3BLJ A;  4OX2 A;  5AL5 A;  4ZZY A;  1II2 A;  4L7L A;  2FAF A;  2PY7 X;  5FH2 A;  5AL3 A;  4UVO A;  2QF2 A;  3UA9 A;  4UI6 A;  5C5R A;  4L09 A;  4HHY A;  4GV7 A;  4L7R A;  4UUH A;  4UX4 A;  1OS1 A;  1WOK A;  4GV2 A;  4L32 A;  2RKE A;  4TKI A;  4HLF A;  4UVW A;  4BU6 A;  4F1L A;  5LX6 A;  3P0P A;  4UI7 A;  4UI4 A;  5FH1 A;  3FHB A;  4L0B A;  4N3R A;  4J1Z A;  1KHB A;  3UH4 A;  4GNQ A;  4F1Q A;  4ZZZ A;  4UFY A;  5FPF A;  2PXZ X;  4UND A;  1KHF A;  2RD6 A;  1YTM A;  3KCZ A;  4HL5 A;  4UXB A;  5C5P A;  1K3C A;  3KJD A;  4GMM A;  4L2K A;  4UVL A;  4L6Z A;  5ADS A;  4YW8 A;  2OLR A;  5I67 A;  2QEY A;  5FH5 A;  3GJW A;  4HMH A;  2RF5 A;  4MSG A;  4BS4 A;  1AQ2 A;  4R43 A;  2FAH A;  4HYF A;  3U9Y A;  4MT9 A;  4L70 A;  1K3D A;  3DT4 A;  5C5Q A;  3SMJ A;  4PJV A;  1YVY A;  4PY4 A;  4UFU A;  4L7N A;  3GN7 A;  4BUA A;  4L0I A;  4KZL A;  4AVW A;  4BJB A;  1YLH A;  4J21 A;  4TOS A;  4IUE A;  4PML A;  3CE0 A;  4RV6 A;  4AVU A;  4KZU A;  4PNN A;  2PQF A;  4MSK A;  4TVJ A;  3U9H A;  3DT7 A;  4J3M A;  4WIE A;  2RK7 A;  4PNS A;  4GNL A;  4UI3 A;  4UVP A;  4HKK A;  4J3L A;  4PNR A;  4BU5 A;  3MOF A;  3MHK A;  4YWD A;  3C49 A;  4HKN A;  4L0T A;  5LYH A;  4BU9 A;  4L34 A; 
#chains in the Genus database with same CATH homology
 2QEW A;  4BU7 A;  3P0Q A;  4GNO A;  4L2F A;  4BFP A;  4W6E A;  4L0V A;  4U6A A;  1KHG A;  4BUX A;  4OQA C;  3L3L A;  2OLQ A;  1AYL A;  4UVU A;  5DCZ A;  4OQB C;  4R6E A;  1GS0 A;  4UVZ A;  4KRS A;  1YGG A;  3L3M A;  4HKI A;  4M7B A;  4BUW A;  4W5I A;  5ADT A;  4UW1 A;  4TKG A;  2ZCI A;  3P0N A;  3DT2 A;  4N4T A;  4TK5 A;  4UVX A;  4BU8 A;  4RCG A;  4UVV A;  1PAX A;  4GNM A;  4TK0 A;  3MHJ A;  3W51 A;  3C4H A;  4TJY A;  5AL2 A;  4GMU A;  3KR7 A;  4L31 A;  4PNM A;  4I9I A;  5LXP A;  4GV0 A;  5FH0 A;  4R5W A;  4UVT A;  4F0E A;  4UI8 A;  4XHU A;  5AL4 A;  4WPV A;  4KZQ A;  2RKD A;  5EBT A;  4BUU A;  4UVY A;  5FH4 A;  5FH3 A;  5AEH A;  4BUS A;  1NHX A;  5ECE A;  4LI6 A;  5AKU A;  4BUT A;  2X5Y A;  2RK8 A;  4LI8 A;  4TOR A;  4WL8 A;  4K4E A;  4OA7 A;  2PAX A;  4L7U A;  4BUY A;  4HHZ A;  4N4V A;  4BUV A;  4WIU A;  2QF1 A;  3GEY A;  4L33 A;  4PNT A;  4L6S A;  3UH2 A;  4OPX C;  4YWB A;  4UI5 A;  3UDD A;  4L7P A;  4X52 A;  4WPT A;  4J22 A;  4L0S A;  2PAW A;  1A26 A;  4HLM A;  1KHE A;  5AL1 A;  1M51 A;  5AKW A;  4YW9 A;  4ZZX A;  3KR8 A;  4PNQ A;  3DTB A;  4K4F A;  4BUE A;  4WPU A;  5ADQ A;  2QZY A;  4PNL A;  4PAX A;  4WOU A;  4HLH A;  5A00 A;  3SMI A;  4DVI A;  4GV4 A;  3MOE A;  4BUF A;  5ADR A;  4DQY C;  1UK0 A;  3GOY A;  4TJW A;  4L7O A;  3MOH A;  4UHG A;  4GNP A;  4LI7 A;  1OEN A;  4UVN A;  4BUI A;  2GMV A;  3PAX A;  4GMZ A;  4PJT A;  1J3B A;  4BU3 A;  2PC9 A;  4BJC A;  4TJU A;  1EFY A;  1XKV A;  5ETY A;  5FPG A;  4BUD A;  4TKF A;  3HKV A;  4HLG A;  2RKA A;  4HLK A;  4L10 A;  4L2G A;  4UVS A;  4W5S A;  3SE2 A;  4BJ9 A;  4GMW A;  1UK1 A;  2RCW A;  3BLJ A;  4OX2 A;  5AL5 A;  4ZZY A;  1II2 A;  4L7L A;  2FAF A;  2PY7 X;  5FH2 A;  5AL3 A;  4UVO A;  2QF2 A;  3UA9 A;  4UI6 A;  5C5R A;  4L09 A;  4HHY A;  4GV7 A;  4L7R A;  4UUH A;  4UX4 A;  1OS1 A;  1WOK A;  4GV2 A;  4L32 A;  2RKE A;  4TKI A;  4HLF A;  4UVW A;  4BU6 A;  4F1L A;  5LX6 A;  3P0P A;  4UI7 A;  4UI4 A;  5FH1 A;  3FHB A;  4L0B A;  4N3R A;  4J1Z A;  1KHB A;  3UH4 A;  4GNQ A;  4F1Q A;  4ZZZ A;  4UFY A;  5FPF A;  2PXZ X;  4UND A;  1KHF A;  2RD6 A;  1YTM A;  3KCZ A;  4HL5 A;  4UXB A;  5C5P A;  1K3C A;  3KJD A;  4GMM A;  4L2K A;  4UVL A;  4L6Z A;  5ADS A;  4YW8 A;  2OLR A;  5I67 A;  2QEY A;  5FH5 A;  3GJW A;  4HMH A;  2RF5 A;  4MSG A;  4BS4 A;  1AQ2 A;  4R43 A;  2FAH A;  4HYF A;  3U9Y A;  4MT9 A;  4L70 A;  1K3D A;  3DT4 A;  5C5Q A;  3SMJ A;  4PJV A;  1YVY A;  4PY4 A;  4UFU A;  4L7N A;  3GN7 A;  4BUA A;  4L0I A;  4KZL A;  4AVW A;  4BJB A;  1YLH A;  4J21 A;  4TOS A;  4IUE A;  4PML A;  3CE0 A;  4RV6 A;  4AVU A;  4KZU A;  4PNN A;  2PQF A;  4MSK A;  4TVJ A;  3U9H A;  3DT7 A;  4J3M A;  4WIE A;  2RK7 A;  4PNS A;  4GNL A;  4UI3 A;  4UVP A;  4HKK A;  4J3L A;  4PNR A;  4BU5 A;  3MOF A;  3MHK A;  4YWD A;  3C49 A;  4HKN A;  4L0T A;  5LYH A;  4BU9 A;  4L34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...