4UX4A

Crystal structure of human tankyrase 2 in complex with 1-methyl-7-(4- methylphenyl)-5-oxo-5,6-dihydro-1,6-naphthyridin-1-ium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design, Synthesis and Evaluation in Vitro of Arylnaphthyridinones, Arylpyridopyrimidinones and Their Tetrahydro Derivatives as Inhibitors of the Tankyrases.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4ux4A00
4W6EA 4PNNA 4DVIA 1GS0A 4TKIA 5C5QA 4UVXA 4UVVA 5ADTA 4MSGA 3C49A 4BUXA 3BLJA 4MSKA 4BU9A 4R5WA 5FPFA 4LI7A 3GEYA 4HKKA 4PNSA 4OA7A 4BUVA 4TK0A 4BUIA 4BU5A 5AL4A 3PAXA 4L31A 4I9IA 4LI6A 4L7OA 3P0PA 4HL5A 4OQBC 4UFYA 4AVWA 4UVZA 3SMJA 3L3MA 4ZZXA 3GN7A 4M7BA 4UVLA 4L2FA 4U6AA 4GV2A 4UI6A 4UI7A 4HLMA 4HYFA 4J21A 5AL1A 5LX6A 4BJBA 4HLKA 3U9YA 4HKNA 5AL5A 3KCZA 4UVUA 4HMHA 5ECEA 3SE2A 4TVJA 3UA9A 4PJVA 4L7PA 4L0IA 4PNLA 4F1LA 4BUEA 3KJDA 4HLGA 4TORA 4L6SA 4BJCA 4BUFA 3KR8A 3UDDA 4F1QA 5C5PA 4UI4A 4L10A 4N4TA 4PNTA 3SMIA 5ADQA 4OPXC 4GV4A 3U9HA 3P0NA 4OQAC 4K4EA 4UUHA 5EBTA 1PAXA 4GV0A 1A26A 4X52A 4BU8A 4BFPA 5ADSA 4BUTA 2RF5A 5ADRA 4TKGA 3C4HA 5C5RA 3GOYA 4J22A 4L0TA 4HKIA 4R6EA 4F0EA 4UVNA 4PNRA 4DQYC 4AVUA 4LI8A 3FHBA 4PNQA 4RV6A 4L6ZA 3HKVA 4BUDA 4MT9A 4BUUA 4TJUA 3MHKA 4UVWA 4UVTA 4UX4A 4L0SA 5A00A 4N4VA 4ZZYA 4L33A 4BUSA 5AL3A 3MHJA 4PMLA 3KR7A 4L0BA 2RCWA 4ZZZA 4PY4A 4HHYA 4W5IA 1UK0A 4PJTA 4UVSA 4UVYA 4BU7A 4L34A 4J3LA 4KZQA 4IUEA 4L70A 4TJYA 4UI3A 1UK1A 4GV7A 4KZUA 4UVOA 4UI5A 5AKWA 4UHGA 5FPGA 5LYHA 4HLHA 1EFYA 4J1ZA 4L7RA 4TK5A 4TKFA 5AKUA 4L7NA 3L3LA 4BS4A 4BJ9A 4TJWA 2RD6A 2PQFA 4HLFA 3W51A 3P0QA 4UW1A 4BUAA 4K4FA 4L09A 4PAXA 4UFUA 4UVPA 5AL2A 4L2KA 4KZLA 4L7LA 4TOSA 3CE0A 4UNDA 4W5SA 5AEHA 4L2GA 4L7UA 4BU3A 4L32A 4KRSA 3GJWA 2X5YA 4J3MA 4UXBA 4XHUA 3UH4A 4L0VA 2PAWA 4PNMA 4UI8A 4BU6A 5DCZA 2PAXA 4BUYA 4N3RA 1WOKA 3UH2A 5ETYA 4BUWA 4HHZA 5LXPA
chains in the Genus database with same CATH superfamily
1OS1A 4W6EA 4PNNA 4DVIA 1GS0A 4TKIA 5C5QA 4UVXA 4UVVA 5ADTA 1II2A 4MSGA 3MOEA 3C49A 4WOUA 5I67A 4BUXA 1YGGA 2PXZX 2RK8A 3BLJA 5FH1A 5FH3A 4GMUA 4MSKA 4BU9A 4R5WA 5FPFA 4LI7A 3GEYA 4HKKA 4PNSA 4OA7A 4BUVA 4TK0A 3DT4A 4GNQA 4BUIA 4BU5A 5AL4A 3PAXA 4L31A 4I9IA 4WPUA 4LI6A 1KHEA 4L7OA 3P0PA 4HL5A 4OQBC 4UFYA 4AVWA 4UVZA 4YW8A 3SMJA 2QEYA 3L3MA 1K3CA 2QEWA 4GMZA 1J3BA 1YTMA 4ZZXA 3GN7A 4M7BA 4UVLA 4L2FA 4WIEA 4U6AA 4GV2A 2ZCIA 4UI6A 4HLMA 4HYFA 4J21A 4UI7A 5AL1A 1KHFA 4BJBA 2FAHA 4HLKA 3U9YA 4HKNA 5AL5A 3KCZA 3DTBA 4UVUA 4HMHA 4WIUA 5FH5A 5ECEA 3SE2A 4TVJA 2FAFA 4PJVA 4GNOA 4L0IA 4L7PA 4PNLA 3UA9A 4F1LA 4BUEA 2GMVA 3KJDA 4HLGA 4L6SA 2RK7A 4TORA 1KHGA 4BJCA 3KR8A 1NHXA 1AYLA 3UDDA 4F1QA 5FH4A 4UI4A 5C5PA 4L10A 4N4TA 4PNTA 3SMIA 5ADQA 4OPXC 4GV4A 3U9HA 3P0NA 4BUFA 4GNLA 4K4EA 4UUHA 5EBTA 4OQAC 1PAXA 4GNPA 4GV0A 1A26A 4UVOA 4X52A 4YW9A 4HHZA 4BU8A 4BFPA 5ADSA 4BUTA 2RF5A 5ADRA 4TKGA 3C4HA 2RKEA 5C5RA 3GOYA 2OLQA 4J22A 2PC9A 4L0TA 4OX2A 4HKIA 4R6EA 4F0EA 4UVNA 4YWDA 4PNRA 4DQYC 5FH0A 4AVUA 4LI8A 3FHBA 4PNQA 4RV6A 4L6ZA 3HKVA 4BUDA 4MT9A 4BUUA 3MOFA 3DT2A 4TJUA 3MHKA 1YVYA 4UVWA 1XKVA 4UVTA 4UX4A 4L0SA 2QZYA 5A00A 4N4VA 4WPVA 4ZZYA 4L33A 4BUSA 5LX6A 5AL3A 3MHJA 4PMLA 4WL8A 1K3DA 3KR7A 4L0BA 2QF2A 2RCWA 3DT7A 4PY4A 4ZZZA 4HHYA 4W5IA 1UK0A 4PJTA 4UVSA 4UVYA 4BU7A 4L34A 4J3LA 4KZQA 4IUEA 1OENA 4L70A 4TJYA 1UK1A 4GV7A 4KZUA 4R43A 4UI3A 3MOHA 4UI5A 5AKWA 5FPGA 4UHGA 5LYHA 4HLHA 1EFYA 4GMWA 4J1ZA 4L7RA 4TK5A 4TKFA 1AQ2A 5AKUA 2PY7X 4L7NA 3L3LA 4BS4A 4BJ9A 4TJWA 1M51A 2RD6A 4WPTA 2PQFA 4HLFA 3W51A 2RKDA 3P0QA 4UW1A 4BUAA 4K4FA 4L09A 4PAXA 4UFUA 4UVPA 5AL2A 4L2KA 4KZLA 4L7LA 4TOSA 3CE0A 4UNDA 4W5SA 5AEHA 4L2GA 4L7UA 4BU3A 4L32A 4KRSA 3GJWA 2X5YA 4J3MA 4UXBA 4XHUA 3UH4A 4L0VA 5FH2A 4GMMA 2PAWA 4PNMA 1KHBA 4UI8A 5DCZA 4BU6A 1YLHA 4YWBA 2PAXA 2RKAA 4BUYA 4N3RA 1WOKA 4RCGA 3UH2A 5ETYA 4BUWA 4GNMA 5LXPA 2OLRA 2QF1A
chains in the Genus database with same CATH topology
1OS1A 4W6EA 4PNNA 4DVIA 1GS0A 4TKIA 5C5QA 4UVXA 4UVVA 5ADTA 1II2A 4MSGA 3MOEA 3C49A 4WOUA 5I67A 4BUXA 1YGGA 2PXZX 2RK8A 3BLJA 5FH1A 5FH3A 4GMUA 4MSKA 4BU9A 4R5WA 5FPFA 4LI7A 3GEYA 4HKKA 4PNSA 4OA7A 4BUVA 4TK0A 3DT4A 4GNQA 4BUIA 4BU5A 5AL4A 3PAXA 4L31A 4I9IA 4WPUA 4LI6A 1KHEA 4L7OA 3P0PA 4HL5A 4OQBC 4UFYA 4AVWA 4UVZA 4YW8A 3SMJA 2QEYA 3L3MA 1K3CA 2QEWA 4GMZA 1J3BA 1YTMA 4ZZXA 3GN7A 4M7BA 4UVLA 4L2FA 4WIEA 4U6AA 4GV2A 2ZCIA 4UI6A 4HLMA 4HYFA 4J21A 4UI7A 5AL1A 1KHFA 4BJBA 2FAHA 4HLKA 3U9YA 4HKNA 5AL5A 3KCZA 3DTBA 4UVUA 4HMHA 4WIUA 5FH5A 5ECEA 3SE2A 4TVJA 2FAFA 4PJVA 4GNOA 4L0IA 4L7PA 4PNLA 3UA9A 4F1LA 4BUEA 2GMVA 3KJDA 4HLGA 4L6SA 2RK7A 4TORA 1KHGA 4BJCA 3KR8A 1NHXA 1AYLA 3UDDA 4F1QA 5FH4A 4UI4A 5C5PA 4L10A 4N4TA 4PNTA 3SMIA 5ADQA 4OPXC 4GV4A 3U9HA 3P0NA 4BUFA 4GNLA 4K4EA 4UUHA 5EBTA 4OQAC 1PAXA 4GNPA 4GV0A 1A26A 4UVOA 4X52A 4YW9A 4HHZA 4BU8A 4BFPA 5ADSA 4BUTA 2RF5A 5ADRA 4TKGA 3C4HA 2RKEA 5C5RA 3GOYA 2OLQA 4J22A 2PC9A 4L0TA 4OX2A 4HKIA 4R6EA 4F0EA 4UVNA 4YWDA 4PNRA 4DQYC 5FH0A 4AVUA 4LI8A 3FHBA 4PNQA 4RV6A 4L6ZA 3HKVA 4BUDA 4MT9A 4BUUA 3MOFA 3DT2A 4TJUA 3MHKA 1YVYA 4UVWA 1XKVA 4UVTA 4UX4A 4L0SA 2QZYA 5A00A 4N4VA 4WPVA 4ZZYA 4L33A 4BUSA 5LX6A 5AL3A 3MHJA 4PMLA 4WL8A 1K3DA 3KR7A 4L0BA 2QF2A 2RCWA 3DT7A 4PY4A 4ZZZA 4HHYA 4W5IA 1UK0A 4PJTA 4UVSA 4UVYA 4BU7A 4L34A 4J3LA 4KZQA 4IUEA 1OENA 4L70A 4TJYA 1UK1A 4GV7A 4KZUA 4R43A 4UI3A 3MOHA 4UI5A 5AKWA 5FPGA 4UHGA 5LYHA 4HLHA 1EFYA 4GMWA 4J1ZA 4L7RA 4TK5A 4TKFA 1AQ2A 5AKUA 2PY7X 4L7NA 3L3LA 4BS4A 4BJ9A 4TJWA 1M51A 2RD6A 4WPTA 2PQFA 4HLFA 3W51A 2RKDA 3P0QA 4UW1A 4BUAA 4K4FA 4L09A 4PAXA 4UFUA 4UVPA 5AL2A 4L2KA 4KZLA 4L7LA 4TOSA 3CE0A 4UNDA 4W5SA 5AEHA 4L2GA 4L7UA 4BU3A 4L32A 4KRSA 3GJWA 2X5YA 4J3MA 4UXBA 4XHUA 3UH4A 4L0VA 5FH2A 4GMMA 2PAWA 4PNMA 1KHBA 4UI8A 5DCZA 4BU6A 1YLHA 4YWBA 2PAXA 2RKAA 4BUYA 4N3RA 1WOKA 4RCGA 3UH2A 5ETYA 4BUWA 4GNMA 5LXPA 2OLRA 2QF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W6E A;  4PNN A;  4DVI A;  1GS0 A;  4TKI A;  5C5Q A;  4UVX A;  4UVV A;  5ADT A;  4MSG A;  3C49 A;  4BUX A;  3BLJ A;  4MSK A;  4BU9 A;  4R5W A;  5FPF A;  4LI7 A;  3GEY A;  4HKK A;  4PNS A;  4OA7 A;  4BUV A;  4TK0 A;  4BUI A;  4BU5 A;  5AL4 A;  3PAX A;  4L31 A;  4I9I A;  4LI6 A;  4L7O A;  3P0P A;  4HL5 A;  4OQB C;  4UFY A;  4AVW A;  4UVZ A;  3SMJ A;  3L3M A;  4ZZX A;  3GN7 A;  4M7B A;  4UVL A;  4L2F A;  4U6A A;  4GV2 A;  4UI6 A;  4UI7 A;  4HLM A;  4HYF A;  4J21 A;  5AL1 A;  5LX6 A;  4BJB A;  4HLK A;  3U9Y A;  4HKN A;  5AL5 A;  3KCZ A;  4UVU A;  4HMH A;  5ECE A;  3SE2 A;  4TVJ A;  3UA9 A;  4PJV A;  4L7P A;  4L0I A;  4PNL A;  4F1L A;  4BUE A;  3KJD A;  4HLG A;  4TOR A;  4L6S A;  4BJC A;  4BUF A;  3KR8 A;  3UDD A;  4F1Q A;  5C5P A;  4UI4 A;  4L10 A;  4N4T A;  4PNT A;  3SMI A;  5ADQ A;  4OPX C;  4GV4 A;  3U9H A;  3P0N A;  4OQA C;  4K4E A;  4UUH A;  5EBT A;  1PAX A;  4GV0 A;  1A26 A;  4X52 A;  4BU8 A;  4BFP A;  5ADS A;  4BUT A;  2RF5 A;  5ADR A;  4TKG A;  3C4H A;  5C5R A;  3GOY A;  4J22 A;  4L0T A;  4HKI A;  4R6E A;  4F0E A;  4UVN A;  4PNR A;  4DQY C;  4AVU A;  4LI8 A;  3FHB A;  4PNQ A;  4RV6 A;  4L6Z A;  3HKV A;  4BUD A;  4MT9 A;  4BUU A;  4TJU A;  3MHK A;  4UVW A;  4UVT A;  4UX4 A;  4L0S A;  5A00 A;  4N4V A;  4ZZY A;  4L33 A;  4BUS A;  5AL3 A;  3MHJ A;  4PML A;  3KR7 A;  4L0B A;  2RCW A;  4ZZZ A;  4PY4 A;  4HHY A;  4W5I A;  1UK0 A;  4PJT A;  4UVS A;  4UVY A;  4BU7 A;  4L34 A;  4J3L A;  4KZQ A;  4IUE A;  4L70 A;  4TJY A;  4UI3 A;  1UK1 A;  4GV7 A;  4KZU A;  4UVO A;  4UI5 A;  5AKW A;  4UHG A;  5FPG A;  5LYH A;  4HLH A;  1EFY A;  4J1Z A;  4L7R A;  4TK5 A;  4TKF A;  5AKU A;  4L7N A;  3L3L A;  4BS4 A;  4BJ9 A;  4TJW A;  2RD6 A;  2PQF A;  4HLF A;  3W51 A;  3P0Q A;  4UW1 A;  4BUA A;  4K4F A;  4L09 A;  4PAX A;  4UFU A;  4UVP A;  5AL2 A;  4L2K A;  4KZL A;  4L7L A;  4TOS A;  3CE0 A;  4UND A;  4W5S A;  5AEH A;  4L2G A;  4L7U A;  4BU3 A;  4L32 A;  4KRS A;  3GJW A;  2X5Y A;  4J3M A;  4UXB A;  4XHU A;  3UH4 A;  4L0V A;  2PAW A;  4PNM A;  4UI8 A;  4BU6 A;  5DCZ A;  2PAX A;  4BUY A;  4N3R A;  1WOK A;  3UH2 A;  5ETY A;  4BUW A;  4HHZ A;  5LXP A; 
#chains in the Genus database with same CATH topology
 1OS1 A;  4W6E A;  4PNN A;  4DVI A;  1GS0 A;  4TKI A;  5C5Q A;  4UVX A;  4UVV A;  5ADT A;  1II2 A;  4MSG A;  3MOE A;  3C49 A;  4WOU A;  5I67 A;  4BUX A;  1YGG A;  2PXZ X;  2RK8 A;  3BLJ A;  5FH1 A;  5FH3 A;  4GMU A;  4MSK A;  4BU9 A;  4R5W A;  5FPF A;  4LI7 A;  3GEY A;  4HKK A;  4PNS A;  4OA7 A;  4BUV A;  4TK0 A;  3DT4 A;  4GNQ A;  4BUI A;  4BU5 A;  5AL4 A;  3PAX A;  4L31 A;  4I9I A;  4WPU A;  4LI6 A;  1KHE A;  4L7O A;  3P0P A;  4HL5 A;  4OQB C;  4UFY A;  4AVW A;  4UVZ A;  4YW8 A;  3SMJ A;  2QEY A;  3L3M A;  1K3C A;  2QEW A;  4GMZ A;  1J3B A;  1YTM A;  4ZZX A;  3GN7 A;  4M7B A;  4UVL A;  4L2F A;  4WIE A;  4U6A A;  4GV2 A;  2ZCI A;  4UI6 A;  4HLM A;  4HYF A;  4J21 A;  4UI7 A;  5AL1 A;  1KHF A;  4BJB A;  2FAH A;  4HLK A;  3U9Y A;  4HKN A;  5AL5 A;  3KCZ A;  3DTB A;  4UVU A;  4HMH A;  4WIU A;  5FH5 A;  5ECE A;  3SE2 A;  4TVJ A;  2FAF A;  4PJV A;  4GNO A;  4L0I A;  4L7P A;  4PNL A;  3UA9 A;  4F1L A;  4BUE A;  2GMV A;  3KJD A;  4HLG A;  4L6S A;  2RK7 A;  4TOR A;  1KHG A;  4BJC A;  3KR8 A;  1NHX A;  1AYL A;  3UDD A;  4F1Q A;  5FH4 A;  4UI4 A;  5C5P A;  4L10 A;  4N4T A;  4PNT A;  3SMI A;  5ADQ A;  4OPX C;  4GV4 A;  3U9H A;  3P0N A;  4BUF A;  4GNL A;  4K4E A;  4UUH A;  5EBT A;  4OQA C;  1PAX A;  4GNP A;  4GV0 A;  1A26 A;  4UVO A;  4X52 A;  4YW9 A;  4HHZ A;  4BU8 A;  4BFP A;  5ADS A;  4BUT A;  2RF5 A;  5ADR A;  4TKG A;  3C4H A;  2RKE A;  5C5R A;  3GOY A;  2OLQ A;  4J22 A;  2PC9 A;  4L0T A;  4OX2 A;  4HKI A;  4R6E A;  4F0E A;  4UVN A;  4YWD A;  4PNR A;  4DQY C;  5FH0 A;  4AVU A;  4LI8 A;  3FHB A;  4PNQ A;  4RV6 A;  4L6Z A;  3HKV A;  4BUD A;  4MT9 A;  4BUU A;  3MOF A;  3DT2 A;  4TJU A;  3MHK A;  1YVY A;  4UVW A;  1XKV A;  4UVT A;  4UX4 A;  4L0S A;  2QZY A;  5A00 A;  4N4V A;  4WPV A;  4ZZY A;  4L33 A;  4BUS A;  5LX6 A;  5AL3 A;  3MHJ A;  4PML A;  4WL8 A;  1K3D A;  3KR7 A;  4L0B A;  2QF2 A;  2RCW A;  3DT7 A;  4PY4 A;  4ZZZ A;  4HHY A;  4W5I A;  1UK0 A;  4PJT A;  4UVS A;  4UVY A;  4BU7 A;  4L34 A;  4J3L A;  4KZQ A;  4IUE A;  1OEN A;  4L70 A;  4TJY A;  1UK1 A;  4GV7 A;  4KZU A;  4R43 A;  4UI3 A;  3MOH A;  4UI5 A;  5AKW A;  5FPG A;  4UHG A;  5LYH A;  4HLH A;  1EFY A;  4GMW A;  4J1Z A;  4L7R A;  4TK5 A;  4TKF A;  1AQ2 A;  5AKU A;  2PY7 X;  4L7N A;  3L3L A;  4BS4 A;  4BJ9 A;  4TJW A;  1M51 A;  2RD6 A;  4WPT A;  2PQF A;  4HLF A;  3W51 A;  2RKD A;  3P0Q A;  4UW1 A;  4BUA A;  4K4F A;  4L09 A;  4PAX A;  4UFU A;  4UVP A;  5AL2 A;  4L2K A;  4KZL A;  4L7L A;  4TOS A;  3CE0 A;  4UND A;  4W5S A;  5AEH A;  4L2G A;  4L7U A;  4BU3 A;  4L32 A;  4KRS A;  3GJW A;  2X5Y A;  4J3M A;  4UXB A;  4XHU A;  3UH4 A;  4L0V A;  5FH2 A;  4GMM A;  2PAW A;  4PNM A;  1KHB A;  4UI8 A;  5DCZ A;  4BU6 A;  1YLH A;  4YWB A;  2PAX A;  2RKA A;  4BUY A;  4N3R A;  1WOK A;  4RCG A;  3UH2 A;  5ETY A;  4BUW A;  4GNM A;  5LXP A;  2OLR A;  2QF1 A; 
#chains in the Genus database with same CATH homology
 1OS1 A;  4W6E A;  4PNN A;  4DVI A;  1GS0 A;  4TKI A;  5C5Q A;  4UVX A;  4UVV A;  5ADT A;  1II2 A;  4MSG A;  3MOE A;  3C49 A;  4WOU A;  5I67 A;  4BUX A;  1YGG A;  2PXZ X;  2RK8 A;  3BLJ A;  5FH1 A;  5FH3 A;  4GMU A;  4MSK A;  4BU9 A;  4R5W A;  5FPF A;  4LI7 A;  3GEY A;  4HKK A;  4PNS A;  4OA7 A;  4BUV A;  4TK0 A;  3DT4 A;  4GNQ A;  4BUI A;  4BU5 A;  5AL4 A;  3PAX A;  4L31 A;  4I9I A;  4WPU A;  4LI6 A;  1KHE A;  4L7O A;  3P0P A;  4HL5 A;  4OQB C;  4UFY A;  4AVW A;  4UVZ A;  4YW8 A;  3SMJ A;  2QEY A;  3L3M A;  1K3C A;  2QEW A;  4GMZ A;  1J3B A;  1YTM A;  4ZZX A;  3GN7 A;  4M7B A;  4UVL A;  4L2F A;  4WIE A;  4U6A A;  4GV2 A;  2ZCI A;  4UI6 A;  4HLM A;  4HYF A;  4J21 A;  4UI7 A;  5AL1 A;  1KHF A;  4BJB A;  2FAH A;  4HLK A;  3U9Y A;  4HKN A;  5AL5 A;  3KCZ A;  3DTB A;  4UVU A;  4HMH A;  4WIU A;  5FH5 A;  5ECE A;  3SE2 A;  4TVJ A;  2FAF A;  4PJV A;  4GNO A;  4L0I A;  4L7P A;  4PNL A;  3UA9 A;  4F1L A;  4BUE A;  2GMV A;  3KJD A;  4HLG A;  4L6S A;  2RK7 A;  4TOR A;  1KHG A;  4BJC A;  3KR8 A;  1NHX A;  1AYL A;  3UDD A;  4F1Q A;  5FH4 A;  4UI4 A;  5C5P A;  4L10 A;  4N4T A;  4PNT A;  3SMI A;  5ADQ A;  4OPX C;  4GV4 A;  3U9H A;  3P0N A;  4BUF A;  4GNL A;  4K4E A;  4UUH A;  5EBT A;  4OQA C;  1PAX A;  4GNP A;  4GV0 A;  1A26 A;  4UVO A;  4X52 A;  4YW9 A;  4HHZ A;  4BU8 A;  4BFP A;  5ADS A;  4BUT A;  2RF5 A;  5ADR A;  4TKG A;  3C4H A;  2RKE A;  5C5R A;  3GOY A;  2OLQ A;  4J22 A;  2PC9 A;  4L0T A;  4OX2 A;  4HKI A;  4R6E A;  4F0E A;  4UVN A;  4YWD A;  4PNR A;  4DQY C;  5FH0 A;  4AVU A;  4LI8 A;  3FHB A;  4PNQ A;  4RV6 A;  4L6Z A;  3HKV A;  4BUD A;  4MT9 A;  4BUU A;  3MOF A;  3DT2 A;  4TJU A;  3MHK A;  1YVY A;  4UVW A;  1XKV A;  4UVT A;  4UX4 A;  4L0S A;  2QZY A;  5A00 A;  4N4V A;  4WPV A;  4ZZY A;  4L33 A;  4BUS A;  5LX6 A;  5AL3 A;  3MHJ A;  4PML A;  4WL8 A;  1K3D A;  3KR7 A;  4L0B A;  2QF2 A;  2RCW A;  3DT7 A;  4PY4 A;  4ZZZ A;  4HHY A;  4W5I A;  1UK0 A;  4PJT A;  4UVS A;  4UVY A;  4BU7 A;  4L34 A;  4J3L A;  4KZQ A;  4IUE A;  1OEN A;  4L70 A;  4TJY A;  1UK1 A;  4GV7 A;  4KZU A;  4R43 A;  4UI3 A;  3MOH A;  4UI5 A;  5AKW A;  5FPG A;  4UHG A;  5LYH A;  4HLH A;  1EFY A;  4GMW A;  4J1Z A;  4L7R A;  4TK5 A;  4TKF A;  1AQ2 A;  5AKU A;  2PY7 X;  4L7N A;  3L3L A;  4BS4 A;  4BJ9 A;  4TJW A;  1M51 A;  2RD6 A;  4WPT A;  2PQF A;  4HLF A;  3W51 A;  2RKD A;  3P0Q A;  4UW1 A;  4BUA A;  4K4F A;  4L09 A;  4PAX A;  4UFU A;  4UVP A;  5AL2 A;  4L2K A;  4KZL A;  4L7L A;  4TOS A;  3CE0 A;  4UND A;  4W5S A;  5AEH A;  4L2G A;  4L7U A;  4BU3 A;  4L32 A;  4KRS A;  3GJW A;  2X5Y A;  4J3M A;  4UXB A;  4XHU A;  3UH4 A;  4L0V A;  5FH2 A;  4GMM A;  2PAW A;  4PNM A;  1KHB A;  4UI8 A;  5DCZ A;  4BU6 A;  1YLH A;  4YWB A;  2PAX A;  2RKA A;  4BUY A;  4N3R A;  1WOK A;  4RCG A;  3UH2 A;  5ETY A;  4BUW A;  4GNM A;  5LXP A;  2OLR A;  2QF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...