4UXDA

2-keto 3-deoxygluconate aldolase from picrophilus torridus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
MYKGIVCPMITPLDAHGNIDYNATNILIKYLEGINVDYLFPMGSTGVFPYFTLKERKDFLKFVRENSKKPIMAGVGSSSINEVNELMKFSMDIGIEAAVLMPPYYIKLNQEAIYHYYKEILSSNDMDLLIYNIPQFTNKIDPETVKNLKSEFSSVKGVKDSSADIRGFMEMLSLSDDDFAVFQGQDDLLFTSLELGASGGVCGTTNFSDGIVRLYHEYKNNREMALKIEKNDVIPLMKKLGKYQFPNAYYEYFYKKNNINGGYRPPMYRVGIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-DEHYDRO-3-DEOXY-D-GLUCONATE/2-DEHYDRO-3-DEOXY-PHOSPHOGLUCO
publication title Insights into the Substrate Specificity of Archaeal Entner-Doudoroff Aldolases: The Structures of Picrophilus torridus 2-Keto-3-deoxygluconate Aldolase and Sulfolobus solfataricus 2-Keto-3-deoxy-6-phosphogluconate Aldolase in Complex with 2-Keto-3-deoxy-6-phosphogluconate.
pubmed doi rcsb
source organism Picrophilus torridus
molecule tags Lyase
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uxdA00
2CLMA 4Z0JA 5FF2A 3NPWA 4ORIA 3W84A 1WOBA 1T8XA 4O50A 3PBVA 4RLIA 4MUZA 2H90A 4LVBA 2R94A 2G5WA 4OT7A 1EX5A 5F4WA 3F03K 2W6RA 2VFIA 3VI2A 2YYTA 2V2DA 3EKLA 1TPVA 3W88A 1TIMA 5EL1A 3NXFA 3DENA 1EUAA 3GKFA 2C13A 4TR9A 1SQ7A 1GTEA 4MYXA 5G5IA 1FQ0A 2GQ8A 4TMCA 2CFFA 1U5JA 3EEGA 2B7OA 3ATYA 5HR7A 2BWGA 5LNWA 2RFGA 2Y63A 5KZMA 4HKPA 3PAJA 3C61A 1TYGA 4JTFA 2A4AA 3O07A 3IIOA 4LUIA 3T55A 3W2JA 4E2DA 3L5MA 2ZTKA 3RLVA 1XDMA 5KITA 4BI7A 3GNNA 3A23A 3W2LA 3FS2A 2HS8A 4ZQNA 1JUEA 2PC4A 2JGYA 1VYRA 3OVQA 2GVLA 3T78A 1QOQA 2ZRWA 4O14A 3LCWA 3LM7A 4DF1A 2NUWA 1TQJA 4LU0A 4DPQA 2WV8A 3B8DA 4RK8A 3OG3A 5C2XA 3JS3A 2WNQA 3W1AA 2R91A 2PRHA 1MEHA 2DZVA 1FWNA 5IBXA 3GDMA 1H60A 4A2SA 1H1YA 4IMEA 2NXHA 1PCWA 4CLMA 4IMDA 3NM3A 3WJXA 3UWQA 3MO7A 3PSVA 4Y8FA 1R47A 2YW3A 4AXKA 5AHIA 3L67A 1OX4B 1ZAIA 4ALDA 3W76A 3QQ0A 4MY1A 3ZR4A 3TK7A 1JCJA 1LP6A 4W9TA 3GNDA 3B0PA 2J6XA 3SSJA 3NL3A 4AH7A 4DBEA 1FCBA 2WO5A 3L21A 5KZEA 2JK2A 5FEZA 3W2UA 1D9EA 4QISA 3TU9A 1VQTA 4OBTA 3C52A 4ZMGA 4R33A 1VHCA 3TSDA 3W1LA 2H8ZA 1GG1A 3TDFA 3NL6A 4XBKA 2WNNA 1JRBA 5G4EA 4BWLA 4HNVA 2QEZA 3S5YA 2CLHA 1JRCA 3NAVA 2CZEA 4XTIA 1L6YA 4OWGA 4JDBA 3C4UA 1VCFA 4UXDA 1DKWA 1UUMA 5D30A 4XUGA 2CWNA 4E0CA 1W8SA 1GWJA 2CW6A 2NV2A 1KA9F 1P5BA 5CPMA 4N9EA 2J9YA 1OK6A 3OVPA 2ZFAA 2A1YA 3THQA 4X2RA 2F84A 4JY9A 5J5DA 1YXDA 5CZJA 8TIMA 3L0KA 4UUIA 3W7IA 4BR1A 4Z1BA 3N2MA 3LCIA 3N3MA 4Q32A 5CPOA 3I7SA 2TPSA 3A5FA 4JTGA 3O6YX 3VNDA 4IMFA 1LRQA 1DOSA 4GRSA 2ZZ5A 5LHEA 3GK0A 4Q4KA 4O13A 2NX9A 3HB9A 3F1QA 4LC8A 1RQBA 1TPDA 3UYCA 4WY0F 4NJJA 1XXXA 1XUUA 4Z1AA 2QJGA 3OEXA 1VC4A 4IMCA 4NNCA 3W7CA 2V81A 4NX0A 3O8AA 5CZTA 1ONRA 1G4SA 4AWUA 4TU1A 1TPB1 2YXGA 3IGXA 1G67A 3DFPA 3TCEA 2EAWA 4N9BA 2VXNA 3M5VA 4HT3A 4JY8A 2CLIA 3WJYA 4DXVA 3B03A 4ZL1A 2NUYA 1H50A 2ISWA 5KTLA 1SZNA 1F5ZA 1MEIA 2QCEA 5LSMA 1C29A 2ZTJA 4TIMA 5C5YA 1LBFA 1NF7A 2AAMA 1UBSA 1Z44A 4O11A 1B9BA 3C2RA 4DBDA 2PRMA 1SU5A 5T26A 3LCHA 4JNMA 1JCNA 4BI5A 5HJLA 4JTSA 2V0TA 1C8VA 5D04C 2H8XA 3PB0A 2IQTA 3KRUA 4QJ1A 2WJZA 4KWVA 1A5BA 2G97A 4HPJA 2A7PA 1OFPA 1S5TA 1GQNA 2VOMA 3MHUA 2B0MA 4HHPA 3IGUA 4LRSA 4CCCA 1F05A 5A8GA 3NEVA 2ZQ0A 1X6UA 2X1RA 3LDVA 1IGSA 1AW1A 3NZRA 3GB6A 2Y89A 1H7RA 4OV4A 4A22A 4HIBA 4M6VA 4YCOA 3IVUA 3EKZA 3FOKA 4FX8A 3RMJA 2Z0IA 1H5YA 1SO3A 1PS9A 3LTSA 3RF9A 3DGRA 3W7MA 3E02A 3W87A 3W2KA 1MXSA 4WD0A 5CPLA 1ML1A 4QQ3A 3INPA 3W1NA 4G1KA 3T4CA 3M44A 1UB3A 2QCDB 2YFNA 3L68A 1K3UA 4FHAA 3W2MA 3I65A 2JKPA 1W31A 3G22A 2E6FA 2GVGA 2R14A 3TROA 5HINA 3WJWA 5AHEA 3FLUA 1ICSA 3DXIA 3O15A 2NXGA 2XN1A 1TJRA 3IEBA 1ME7A 2QUTA 3PS7A 5D03A 3GAYA 3PC0A 4M5PA 4JYEA 3A22A 5AC8A 3SZ8A 1LROA 4U4MA 3F4WA 4N6FA 1T99A 1I2QA 2VFHA 3U2OA 2BSLA 4WUIA 4QAIA 1BEUA 4AB4A 4N2YA 5AHNA 3W07A 1KFEA 1QPOA 2NLIA 2QCDA 1G7VA 4C1LA 1R2RA 3O6DA 4Z1DA 3STGA 1A53A 3W7HA 1VRDA 1HUVA 1HO4A 4A3UA 4MFDA 3IIZA 1J5TA 3OIXA 5BW6A 1G4TA 4DPPA 3MYOA 4LNYA 3PUDA 1F74A 1KFKA 4WY0A 3M5YA 3KVMA 2NV1A 4I7UA 3PUEA 4KKXA 3HGOA 3AJXA 3W1UA 1QR7A 3S9YA 3B04A 1GTHA 3BG3A 4JTHA 1XKYA 5TBOA 4NUWA 5D2YA 2WQPA 2H6RA 3QPYA 1AK5A 1Q45A 4Y90A 2ZA3A 2GUUA 2I9EA 3NQVA 3T7VA 3ABQA 1P0KA 4UMCA 5ABTA 3DH7A 2UV8G 4FEZA 4LV4A 5D37A 2G96A 2Y88A 2CLOA 4N9CA 4GC4A 1VCGA 3MI6A 1Q6RA 1TRDA 3PR2A 3DKLA 4FXRA 1W37A 4UTMA 3RFAA 5C54A 1O5XA 4UNLA 3QPZA 3UNDA 1IF2A 3TJXA 4FX7A 3B0UX 3L2IA 3EWYA 4HN4A 4GNJA 3BGJA 1N7KA 2FB2A 3M0ZA 2YX0A 4XTDA 2DZSA 3W71A 3MHFA 5FF0A 3G3DA 3IIXA 4CQAA 3HMJG 3PULA 2ZZ1A 2FIQA 3H53A 4IXXA 1XFBA 2X30A 2YSWA 3TMLA 3W74A 5DBTA 3P62A 1K8ZA 1ZAHA 2RHGA 3NL5A 2FFCA 2YZRA 3W7RA 1H63A 2V2HA 4L4LA 3G0XA 1LDCA 1M7OA 3BVJA 3DI0A 3LERA 3WK2A 4M7TA 4GUFA 1GYLA 3C0JA 3O06A 1PCKA 3LCLA 1TPUA 1EEPA 2B4GA 4O1DA 1QOPA 2A85A 1E51A 2BZNA 4NJKA 1DQXA 2OMAA 2CU0A 5A5WA 3IVTA 4N4PA 5G2WA 3SY5A 5D2WA 5FESA 5L9FA 4AVFA 1ZCOA 1WV2A 3W7JA 1KM2A 2C15A 3UPBA 4GUJA 1OFAA 1YDOA 1ZENA 4NJGA 4CQ8A 3CHVA 4PTNA 1QO2A 1QCWA 1GVRA 1PHWA 1VJIA 3GXPA 5LNRA 2R8WA 3RLUA 1N8FA 1SW0A 1OX6A 4K8EA 1ZFJA 3R5EA 1N55A 1F76A 4EOUA 1RZMA 1TREA 3SIZA 1LLWA 1H7XA 3KRZA 4KFPA 4MY9A 4ZQCA 1XM3A 3KOFA 1FWRA 1KBIA 4IUOA 5L6UA 3ABRA 1GJPA 1OFOA 2QAPA 4LC6A 3C56A 3TNOA 1DVJA 4JTJA 4UR8A 2FDSA 3N9SA 1IXOA 2NWSA 2ZRZA 1GG0A 3N73A 2QCGA 4UTTC 2OJPA 3LV5A 5KMYA 1Z48A 3DHDA 3HO8A 1G7UA 2Z2UA 2QJHA 1LOLA 3IVSA 3FJLA 4UFJA 3A21A 1VYPX 2O7SA 1WAUA 5F1UA 5HMSA 1KFCA 1JR1A 1YXYA 2C16A 3QMRA 3ZFHA 3GYEA 4N9DA 4XKYA 4WOQA 1OF8A 3CWOX 4CNPA 4LT9A 3W7GA 1FCUA 1SSGA 1W5PA 3S1XA 5KSWA 5EY5A 2WSYA 3UWVA 3FFSA 3W7DA 3TQ0A 3QH2A 5CKSA 1XC4A 3SGZA 3CEPA 3G0UA 1M6JA 3KRSA 4JDYA 5DLCA 3BO9A 3PBYA 1PIIA 1QMLA 1H51A 1A5SA 1B4KA 4FX6M 4RZ6A 3EX6A 1W5QA 1WA3A 3UXDA 1UASA 4JN6A 4UFIA 1FXPA 2ZA1A 4LV9A 1MZHA 2C6QA 3LTPA 4X3ZA 1O60A 4FNSA 4GUHA 1TJPA 1KLZA 4O54A 3LXAA 5K2ZA 2E6AA 3M9YA 4GJ1A 3C6CA 4DEFA 5F2GA 3U8GA 3CTLA 1XBVA 2WPBA 2QF7A 4O17A 3KHJA 4RR4A 3W70A 1LRNA 1YTDA 4UTWC 3HOJA 3QW4B 3QM3A 1I2OA 3C2EA 1TQXA 3SJ3A 5DCDA 3NO5A 1DL3A 4I7WA 1LORA 1Q6OA 1XUZA 2YPIA 1QWGA 1P0NA 1GVSA 3TXVA 3DBPA 1W3NA 3I7RA 1YPIA 3IRDA 4K37A 4NX5A 4YXGA 2ALDA 1W54A 5FF3A 3MBDA 2YGYA 1DBTA 1KM6A 2GJLA 3M5XA 4PCFA 2X1TA 1VYSX 3GAKA 3NL2A 5AB3A 1FDJA 2J9XA 1X1OA 3QFEA 3GDLA 3TAKA 4JTUA 3W1RA 3EWZA 4HSOA 4WXYA 4UC5A 4M19A 3W1QA 2ZRYA 4UCGA 3I68A 2DP3A 4DF2A 4YWIA 3EWWA 4BI6A 2V9DA 3UY8A 1OX4A 5DBUA 3P81A 1GOXA 1EWEA 2OX1A 3KVJA 4K38A 4FNUA 5D02A 3LLFA 3HGRA 3CC1A 1DV7A 2FPYA 2Y70A 3W6YA 2ATMA 5MHBA 5AN7A 4Y96A 3W1MA 3TE9A 1EWDA 3HGJA 4Y6GA 3N9RA 2ZYFA 4LWWA 1L2UA 4EWND 5D05A 2NWRA 1EIXA 2QR6A 5K9DA 3P61A 1EUNA 2QDGA 5F4SA 2G95A 2P10A 3CWNA 3PBUA 3G1AA 4MFEA 5CGQA 3TC6A 5G2HA 1TSIA 4NVTA 3MI2A 2E68A 3W2NA 1W3IA 3LHTA 4UFMA 2NX1A 2FPVA 3NPUA 5LNUA 4FNTA 4PEKA 5AYZA 3EX4A 2D73A 2B7QA 1TPH1 3UWUA 1KTNA 2PURA 1ZJIA 3GXTA 1K7EA 1NEYA 2Q3OA 4B5NA 4A21A 4O1CA 4GE8A 3FYPA 3NQEA 3W3OA 4JTTA 1TPC1 4UTJA 2A2IA 2E77A 4J9JA 1H7OA 3G8EA 3LXBA 4JTEA 1V5XA 2VKZG 1EB3A 1HG3A 3HG5A 1SO4A 5KINA 2TRSA 3NQGA 3GDTA 1GVFA 1SR9A 2VFGA 2I1OA 3DZ1A 1BTMA 2BLEA 3JRKA 4GXMA 1RV8A 3ATZA 4O18A 3SR7A 3M6YA 4DO4A 4H4IA 1TV5A 2V30A 2XFWA 3PG8A 3KX6A 3G1HA 1AG1O 1S5VA 5LHFA 5DN1A 3N14A 3MMTA 1L9WA 5EA9A 4ZQMA 4KFOA 3W1PA 3G1DA 1Y0EA 4RZ4A 3GLCA 4KFNA 4LOCA 4OQVA 1JQXA 2YYUA 2E6DA 4XBSA 4O4VA 5U7SA 3S0CA 3Q94A 5HWNA 2GVJA 3QQ1A 5K4XA 3VE7A 3QF0A 3P67A 4NJHA 2QUUA 3BPWA 2ZA2A 3HBLA 4JGDA 3PUOA 3KXQA 3MW7A 3I6RA 3NVTA 4PA8A 3NQ7A 1TRIA 3MWAA 1P1XA 5AFDA 6TIMA 3NPXA 3FA5A 2WOQA 2ZDRA 1IIHA 5BNKA 4S2CA 4CCEA 2DZWA 3M47A 3TIMA 1ICQA 4BF9A 2TYSA 2ZZ2A 1F73A 1W5OA 1DHPA 4U28A 4AAJA 1K7FA 1TTJA 2GJNA 4OHQA 3OHIA 2QUVA 2C0AA 1RQEA 5C55A 1NSJA 1RVGA 3BK0A 3QRHA 1YXCA 4TMBA 2GQAA 5FF7A 5CG7A 1ME9A 4DF0A 3LCFA 4UMAA 4AF0B 3T44A 3G1YA 3NYZA 3TSBA 2FQIA 1A5CA 5DELA 4JX4A 3PWAA 2ZCGA 1P4CA 1F6KA 3U6WA 1UJPA 3A9IA 3V1PA 2Q8LA 2QCFA 2DZUA 4IPIA 3TW6A 3GZ3A 2Y7FA 3Q2DA 1AL8A 4BWLC 1OJXA 5I3GA 5HWJA 3USBA 2E5CA 2A21A 3STFA 5F2IA 3IIVA 1GEQA 3LOTA 5U4NA 4UTTA 4EIVA 1TV8A 1QNVA 3DKJA 4NXSA 3STEA 3C2OA 3QYQA 4O8RA 1FDYA 1JUBA 3FKKA 1LM1A 2JBMA 2Q3RA 4POCA 3UPWA 3L66A 4E38A 5AC7A 3BW2A 3E12A 1GPWA 3N19B 1DJNA 2NZLA 3ABOA 3OBKA 1WYIA 4K6AA 5DY2A 3TKFA 4IMGA 3EWBX 3O05A 3MBFA 3W7LA 1EP3A 3O16A 3R2GA 2J88A 1O95A 5F2LA 4LS0A 4DO5A 2A5HA 1OYBA 1TTPA 3IIPA 4CQ9A 2Z6IA 4O53A 4RZ5A 2X16A 3NQFA 4JEQA 3CIXA 5D32A 3LV6A 2EPHA 1XL9A 4MLJA 4M7SA 2PE4A 2J24A 1FUYA 3BV4A 1IXPA 3TUUA 4CNOA 4FNQA 4LVAA 1G69A 2A6NA 1ALDA 1Z42A 4MOZA 3LHZA 4XQ6A 3LXCA 3L5AA 3LCGA 3W7QA 4H6KA 1W1ZA 3GX9A 1H1ZA 1QAPA 3EB2A 3S1UA 1VPXA 2QDHA 2OCZA 4JX5A 1I2PA 5AHLA 3V75A 4PC8A 3S42A 1QDSA 3LRKA 3IV3A 3NPVA 3G1SA 2A7RA 4LVDA 3QJAA 3NZ1A 1RD5A 4IX0A 1JCXA 3R89A 4IGHA 4FF7A 1VR6A 2ZZ6A 3QMTA 4AHPA 5LNSA 3P84A 3ZWTA 4ONVA 5DXXA 3DI1A 1TB3A 3O6CA 4JX6A 2Z1BA 4JS3A 3W7EA 2ZZ7A 3JR2A 1D3GA 2DZTA 1R2SA 1F6PA 1D3HA 3A24A 3VKJA 1YPFA 3BLEA 2RH9A 4K8HA 3FIGA 2XN2A 1MEWA 2ZRUA 1CI1A 4Z1CA 4R34A 2A7NA 4YMZA 5HUPA 3DAQA 4JIPA 4N6EA 3EWXA 3W7OA 2BX7A 2ZBTA 4OE7A 4ADTA 1OG0A 4O57A 4UMBA 3P74A 4ICNA 5EYWA 1KFBA 4N02A 1TPFA 1K8YA 3HIJA 4RXGA 1G6CA 3W23A 4P61A 1SO6A 1L6WA 5AOUA 3C2VA 2YCEA 4BFAA 2JGQA 5F1VA 3NDOA 1XI3A 1ZHAA 3MUXA 5E93A 4OGZA 1PVNA 4PFMA 4WOZA 1LTDA 3STCA 1H7NA 2Z6JA 2CLFA 3HQ1A 1YLVA 2QCCA 4IWWA 1KTBA 3PM6A 5FEXA 3S1VA 3W22A 1PL9A 4FIRA 4O1BA 2E5BA 4E2BA 2WNZA 4O28A 4NU7A 2PRLA 4UTIA 4PODA 3NQAA 4Z08A 5CSSA 1I2NA 2FTPA 2CZ5A 1ZALA 1QO5A 4QITA 4JYDA 2NXIA 4R53A 3M1ZA 1NVMA 1G4EA 4QNEA 5G1TA 2ABBA 4JIQA 2Y62A 4QM1A 4NJIA 2EKCA 4LVFA 3LI0A 1W3TA 3HJZA 3BW4A 3TFXA 3MI3A 5TQLA 2BXVA 2V5BA 5EKYA 2X1UA 1KM0A 3DFNA 1RQHA 2YR1A 1SFLA 5E1QA 2B7PA 3Q37A 3PY2A 1X7FA 3NNTA 3CT7A 2E5DA 1AW5A 1KTCA 3KAOA 2YFOA 3TQVA 2VEMA 5AC6A 4HNTA 1R2TA 3DHFA 3ANYA 3VFLA 4MY8A 1YDVA 3P80A 1ME8A 2W79A 3CM4A 1UUOA 1VLIA 4M6QA 5I3JA 3G1VA 3S8HA 1OFDA 4NQ1A 3DFSA 4AMAA 1BWLA 4MIMA 3W7PA 4XZ9A 1WX0A 2PCQA 3G3MA 4UR7A 5K9CA 2HMCA 2NX3A 1LBMA 2Q8ZA 2VFDA 2DJLA 3TV8A 1Q6QA 5LGXA 2OZ0A 4AWSA 5EMUA 2P0OA 1DORA 2VENA 3OVRA 4BK9A 3UD6A 2E6YA 4ORMA 5FEWA 1AL7A 4WZHA 3EXTA 3D0CA 3UY7A 3EXSA 3Q58A 1LBLA 4AHOA 3A5VA 2AQWA 4IQLA 2NUXA 3QSRA 4ZZ9A 1NAL1 3OA3A 4AWTA 3BG5A 1KFJA 3QEZA 4HSNA 3ELFA 4O16A 4Y9AA 3ZS4A 3MP3A 1TPEA 4HNNA 4GWEA 1O94A 3FEMA 3S5ZA 5I3KA 1KM1A 3WFAA 1I4NA 4ADUA 3L65A 2Y7EA 3P82A 2H3BA 4QNWA 1SZFA 3EX1A 3E0IA 3LB0A 3BGGA 2VFFA 3HG4A 1JVNA 5AYXA 5AHMA 2QCLA 1J2WA 5DXYA 1IXQA 4RKAA 3GVGA 1V7YA 2VFEA 3UWYA 2V2CA 1HO1A 2RKXA 4MKNA 4FB7A 3RNDA 1L6SA 4NT0A 3NG3A 2E1DA 3BLFA 3LCXA 2RDTA 4WX2A 3LRLA 2P1FA 4RJEA 1K7XA 1THFD 5J5RA 4LW7A 1VCVA 4O0ZA 3LGEA 3PSWA 1S5WA 2RDWA 3S6DA 3TJLA 4UTUA 3LHUA 4FIQA 2V82A 4MZYA 4LUJA 1YADA 2WSRA 3PF3A 1LYXA 3GDRA 1QFEA 3UXAA 4EF9A 4DQWA 3P60A 3UWWA 3PBWA 1VH7A 1SO5A 4UTLA 5G1YA 5CPNA 1EA0A 3W1TA 5LKYA 4L4MA 3KVKA 3THAA 2DZPA 5D33A 4NZFA 3R8RA 5G4WA 4JTKA 1XDLA 1FY6A 1LLZA 4A2RA 1SFJA 4IPJA 1XBXA 3UWZA 4RCXA 3ZWSA 4HNUA 3KFTA 4YL2A 3NGJA 1IIGA 1WXJA 1VHNA 2C3ZA 2J27A 5CZ0A 1BWKA 5K3VA 1TTQA 1ADOA 2QJIA 1LRTA 1W5NA 3QZEA 1OFQA 3N34A 2CZDA 5CSRA 1H62A 4ML9A 4PL2A 3DFQA 1EP1A 3CPRA 1AW2A 2V5LA 5HQEA 2HS6A 3LRMA 3WK0A 3E9AA 5HUOA 4EVZA 4YLWA 2E09A 5I3HA 2DJXA 3G1XA 4FO4A 1OFEA 3QMSA 4S2BA 1QPRA 5EPDA 5D2VA 3WK3A 3CLMA 1FWTA 4WXZA 2Y61A 5K7JA 4I9AA 1WBHA 3MHGA 3T40A 2DU2A 1FCQA 3IGSA 4JD4A 3MYPA 2GOUA 4TO8A 2TMDA 5D38A 3LHWA 4TX9A 3LTYA 2A0NA 3BG9A 3GR7A 5F4XA 1SUXA 1TV7A 5CZSA 3HPSA 1PV8A 3L5LA 1ZY9A 5HR6A 5KZDA 3H55A 3BLIA 4S1FA 1F7BA 2CLEA 3R13A 1IXNA 4ADSA 4UFLA 5F2MA 4GUGA 1VGAA 4OU1A 1EPXA 2Y7GA 3RU6A 1M5WA 1OABA 5BOOA 1TCDA 5FEPA 4O4WA 1W0MA 1RPXA 1VZWA 2QCMA 3HGSA 1MO0A 1QPNA 2VELA 2TSYA 1R30A 5LZLA 3MP4A 4UTKA 2C14A 5DCEA 1KLYA 1Q3NA 1ZAJA 1LZOA 2VC6A 4UNKA 3SGUA 5BRBA 3GKAA 3R12A 2FJKA 1S3HA 2CLKA 3TAOA 1XCFA 4ZQPA 3NR0A 1O4UA 2ISSA 1H7PA 1KM5A 4ZVJA 2Y6ZA 1SW3A 2C1HA 1AMKA 4PL1A 3ABSA 1FDZA 1KFLA 3KVLA 2WKJA 3PG9A 4QSHA 1H61A 3LI1A 1FWWA 1WOAA 1X1ZA 4IXHA 3F4NA 1M7PA 3W1XA 2C18A 2LLEA 3RK8A 3GR8A 5HNRA 1B3OA 4O10A 1KM3A 1GYNA 3LHVA 1PE1A 4FNRA 3QW3A 1DQWA 1NF0A 5IBXC 1K03A 1JQVA 5H91A 2FPTA 4X9SA 1YTKA 2OT1A 4UTHA 3G8RA 2ISVA 3S1WA 4GUIA 1OX5A 3UQNA 4YCPA 3WJSA 3TA6A 3AO0A 1TMHA 5SWUA 3M16A 2J9ZA 5IM51 2ZZ4A 3MJYA 3O1NA 1UCWA 3TX9A 2KZHA 3CB8A 3TSMA 3BARA 2RDUA 1KM4A 5BMXA 4JXCA 3H54A 3P8IA 4WJEA 3NQ8A 3HG2A 1FWSA 2I14A 4JR5A 2DORA 4H3DA 2X1SA 3G1FA 1SSDA 3TH6A 2O7QA 1H7WA 3B05A 4MPQA 4RXFA 5FF4A 3I7QA 3B06A 3HPZA 1DJQA 3LLDA 4LRTA 1B4EA 1R46A 2EGZA 3W75A 1K8XA 4AEOA 3GIYA 1GZGA 3DU0A 2F7FA 2JKEA 1O5KA 3W7KA 4DO6A 3E96A 3NM1A 1U83A 1SZEA 4QIUA 1GVQA 2BTMA 1OK4A 3O63A 3NQ2A 3P7YA 1NFBA 2EF9A 3GDKA 3LBCA 4WY0B 4O12A 5AYYA 3C8FA 4O1AA 4R7JA 3CU2A 1FCVA 3W86A 5AHFA 3M5ZA 1XBYA 1TPWA 3NQCA 1G4PA 6ALDA 2GPTA 2ZZ3A 3SECA 4Z0SA 3LHYA 5H2ZA 1CW2A 1WDWA 4M6PA 2QCNA 4IJBA 1GVOA 1SPQA 5HULA 2VEKA 5D2TA 5EBUA 3L0GA 2VEPA 4MZ1A 1WBJA 1OFRA 4RX0A 3S5OA 3EX3A 5K4ZA 3PB2A 4AF0A 1J4EA 3L0NA 1BKSA 3P5YA 3P8JA 5I3FA 3TFCA 3K30A 4A29A 3PVFA 2QCHA 1KV5A 2JKAA 2YW4A 3W85A 4AHQA 4LVGA 1LCOA 4PH6A 2V8ZA 2FB3A 5I3IA 4D2JA 2DZXA 4JICA 2ATSA 1SZGA 4GBUA 1KBJA 3LX9A 3TMQA 4K7VA 1ICPA 1HL2A 5DCBA 4FXSA 4KWWA 1FBAA 1OF6A 3NQMA 4UFHA 1JCMP 1Q6LA 1WQ5A 1XBZA 1T96A 2CLLA 1VS1A 4K39A 4FNPA 1I2RA 3FYOA 2B7NA 3B4UA 5LNVA 1OYCA 4IOTA 5GVJA 1C9DA 3HG3A 3FKRA 1A50A 4DELA 3W72A 3QSTA 5D2XA 3GXNA 3TR2A 1ZNNA 4UIOA 2W0UA 1JCYA 3W73A 3EX2A 4P2VA 3FJ6A 1MSSA 2OT0A 3SW6A 4K36A 2FLIA 2GQ9A 1K02A 2YDAA 3M43A 3NQ6A 3HPXA 1W56A 4JYFA 5G2IA 3SI9A 1B57A 1JULA 3CEUA 4XWUA 3W9ZA 3UZJA 3NA8A 4UTWA 1HTIA 2X2GA 3QC3A 3G24A 1KW1A 4MJZA 4MVAA 1FXQA 2ABAA 1LOQA 2AGKA 4OV9A 4LS1A 1T0OA 1JCLA 4Q33A 3TQKA 5E0KA 2Y85A 2ZRXA 3CQ0A 4ZQRA 4JTLA 3S5NA 3EWUA 3G0SA 1RR2A 3DFTA 3L9CA 5FI8A 4LY8A 4GFSA 3HF3A 3BW3A 5D09A 4X22A 4C1KA 3VE9A 4K7YA 4MZ8A 2EHHA 4MLRA 3TC7A 2ZRVA 3C2FA 1GT8A 3DFOA 1QPQA 1OFBA 4NXKA 4WQ6A 2CZFA 4LS2A 4NZJA 5C6MA 5BMWA 4HPXA 1I8JA 2H3DA 4RV8A 1VLWA 3W83A 1YTEA 1OYAA 3W7NA 7TIMA 2QKFA 1TTIA 3LBMA 4IX2A 1HFBA 4NNBA 1PHQA 4O52A 4UFKA 5DY3A 3TXZA 1YDNA 2HTMA 2A6LA 4ZQOA 4LTSA 3B0VC 1A5AA 2VEIA 3N2XA 3UZ5A 1SW7A 4I7VA 4MJMA 3E49A 3CIWA 3SFKA 4CNNA 4MYAA 1FX6A 1YYAA 4NNAA 3G18A 5TIMA 4CCDA 5HWMA 3MP5A 4O19A 1I45A 4XKYB 3NOEA 1Z41A 3VCRA 1OVDA 4O15A 3P5ZA 1W5MA 3YPIA 4EF8A 3C3NA 3M7WA 1EP2A 2QAFA 2C19A 2WSQA 3M41A 1TO3A 1OHLA 1KV8A 3TW7A 1JJKA 1X8FA 2XN0A 2HSAA 5LGZA 1LOSA 3EXRA 3WJZA 3NQDA 5K9XA 2Y7DA 4O0KA 4N4QA 1JUKA 3WK1A 1CX9A 4JTIA 1F2JA
chains in the Genus database with same CATH superfamily
3W84A 1UR0A 1MUWA 2R94A 4J4KA 1GZ1A 3U7VA 5DT7A 4C6EA 1US0A 2OXNA 3AYRA 3QY8A 1XLMA 3ECQA 2C13A 3CQKA 3W53A 1Q4NX 1GTEA 2DEPA 1OC7A 2JALA 3ZSSA 1OGSA 3PZ9A 4TMCA 1FP9A 2BWGA 5CPTA 4REQB 2RFGA 4L4OA 1MI3A 3RUBL 2VURA 4HKPA 3V4BA 3PAJA 3EMQA 3RN6A 4JTFA 3UXIA 2A4AA 4C91A 3E2QA 4BQ5A 3GH5A 4D1JA 1FWAC 3MY9A 3L5MA 3RLVA 1UWAA 2HRWA 4GVGA 3SUTA 1CBGA 3GNNA 2XISA 3FS2A 4MWAB 3T78A 1O6IA 1QOQA 2ZRWA 3LM7A 4DF1A 2FZMA 1RBOB 1TQJA 3PWGA 2WV8A 2UZ9A 1CXEA 1NOUA 5ENLA 3B9OA 3JS3A 4MAVA 3BSMA 3VKCA 4F79A 1NDZA 3TYUA 1R87A 4QS5A 1MYRA 1H60A 4N42A 5CXPA 3NM3A 3WJXA 3PSVA 5A2CA 1R47A 3A4XA 3FAXA 2V5CA 4DZ5A 4ALDA 1JDAA 3WQPA 1CNVA 3QQ0A 3ZR4A 3TW9A 1A0EA 3B8IA 4W9TA 3GNDA 2WMJA 5EFDA 3NL3A 4PMUA 3FW6A 1FCBA 2WO5A 5KZEA 2JK2A 5FEZA 3BE7A 5CZKA 3GG0A 5E6YA 1XIFA 5HBFA 3TU9A 2OG9A 1PKNA 4XZWA 3URAA 3BAYA 3TSDA 4C6DA 4YS1A 1NM9A 3PZVA 2IQ0A 2WNNA 1JRBA 1ZU8A 3EGJA 4OWGA 3C4UA 1FH7A 1W8SA 4BA0A 1GWJA 3DEQA 2WBKA 2J9YA 1Q7MA 3OVPA 5AC4A 1GKQA 1S2VA 1H0IA 5I00A 3THQA 4X2RA 4Q8UA 4JY9A 5BRPA 1OWQA 3EPMA 4XZLX 4EPEC 2ZE3A 4BR1A 3N2MA 3AUJA 3AXMA 4OVXA 2OZTA 3A5FA 2F6XA 3VNDA 4P7OA 1UZ4A 2ZC1A 3WD3A 4IMAA 1M3UA 3RPTA 2OODA 3U9IA 1TPDA 4WY0F 4KH2A 1XXXA 4Z1AA 1VC4A 3KOZA 4NNCA 1OIFA 1RCXB 1E6QM 2V81A 4NX0A 3O8AA 1RD6A 3ARWA 5CZTA 2AOSA 2PDHA 4TU1A 4F3HA 2G50A 4HA0A 1Y5XA 1G67A 3DFPA 3GW0A 3SRFA 3M5VA 2CLIA 3B03A 3CL8A 1SMAA 3MV01 4XISA 2GJRA 4H9VA 1QI2A 1BRLA 4S39A 3IJIA 2QCEA 2ZTJA 4GQRA 1I1XA 1LBFA 4M1BA 4C5ZA 1UBSA 3WF1A 3C2RA 2PRMA 1RPKA 5T91A 3LCHA 5BCAA 4PBEA 2XIQA 1O66A 1ZQ5A 1M04A 2PWUA 4JTSA 1JF6A 1TVLA 2FDMA 1TX0A 1PJ9A 3KRUA 4QJ1A 2WJZA 4AVNA 2G97A 1S5TA 1F4HA 2VOMA 3DESA 3WH5A 3MHUA 4HHPA 5HPCA 4PUNA 1F05A 3NWRA 4DYEA 1Q63A 3FCPA 4X60A 3EA1A 1XS2A 1PDZA 1H7RA 1YE4A 4HIBA 4DJDC 4WLCA 3WN6A 3WH6A 1E1EA 2YCKX 4GH1A 3K8MA 2Z24A 4JN8A 1SO3A 1ZPTA 2ZXBA 4HK6A 1GVIA 4LSBA 1GORA 1NDWA 3V35A 3THCA 3INPA 3T4CA 1FHLA 4JIHA 4I8DA 2E9MA 3E38A 4FHAA 4GZ7A 2CHOA 2PDGA 3N2TA 2YKKA 2JKPA 4OJYA 2GVGA 2R14A 5C9WA 5HINA 4KT2A 4RPPA 5AHEA 3KWXA 1B1YA 4J2MA 3WQVA 4G2DA 3DXIA 3H6OA 4EPBC 2NXGA 3ME3A 4DBUA 1BKHA 4WSHA 3T42A 3QKEA 1C8XA 3A22A 5AC8A 3OGVA 3QN3A 2OOGA 4AVOA 3WEMA 1O68A 4KRTA 4AB4A 5AHNA 3TJIA 2OO6A 3EWDA 5FKYA 4H8UA 2QCDA 3EWCA 5C9RA 4C1LA 1R2RA 3O6DA 3OO2A 3STGA 3W7HA 1WZAA 2PZNA 1HXJA 5CCZA 1J5TA 2FHBA 3SCPA 5BW6A 4PCPA 5I24A 2OEKA 3M6DA 3A9BA 2P3ZA 4HSHA 1KFKA 3PUEA 4KKXA 2C0HA 4MKSA 3AJXA 1D7FA 1VBUA 3IWPA 1RJQA 2OLAA 3NZGA 1QI3A 1AK5A 2IPFA 1CGUA 4DYJA 1Q45A 1AA1B 4M51A 3OU8A 3MUCA 3ABQA 4PMZA 4GJIA 4UMCA 3VABA 2WJFA 2PGFA 4LV4A 2NW0A 1XC6A 1X96A 1CXFA 2CLOA 4A05A 4N9CA 3WQ6A 1SYTA 3XISA 4UTMA 5C54A 4S3FA 4Q6XA 2V5JA 3NURA 1IF2A 2OVLA 3TJXA 3RM4A 1KCZA 3WD0A 4GNJA 3LM3A 3VDHA 4JL1A 4XTDA 5FF0A 3IIXA 1ZTVA 4GH3A 1R9ZA 2HXTA 3TMLA 3VCCA 1KWGA 1E0TA 3F2DA 1E6NA 4RDWA 3T0TA 4ENLA 3QY7A 3UR7A 3NL5A 5CSUA 3W7RA 4E4UA 4IIGA 3F5LA 4RDZA 4DJED 2QGYA 3BVJA 4LUSB 1JCTA 4HK7A 4G56A 1IWBA 4HCDA 3USZA 4F4RA 4Q6JA 3C0JA 1GQKA 4L56A 3O06A 4QE4A 1L0PA 3JW7A 1LL4A 1E51A 4UBPC 2GJXA 2BZNA 2OMAA 4P8XA 2ZUTA 4N4PA 5A8OA 3KTCA 5D2WA 3VGEA 1H49A 1ZCOA 3ZJ6A 3OW1A 1KM2A 2C15A 4GVFA 3UPBA 4GUJA 1YDOA 1ZENA 1IEXA 4XSMA 2DSZA 4CQ8A 3B8SA 3E5PA 1V6WA 4S3JA 1ONEA 4GO8A 3N4EA 3G5EA 1PHWA 3GXPA 1FWFC 5LNRA 5DRCA 1YW1A 3JUGA 3L23A 1NDYA 1SW0A 1ZFJA 3R5EA 3V36A 3GS6A 1N55A 3RG6A 2DH3A 1RZMA 3UR5A 1LLWA 4ZQCA 1ZUAX 3N6JA 2FHCA 4K8GA 3AICA 1IE7C 3ITXA 1DVJA 4JTJA 4UR8A 2CIPA 1MZRA 2VEFA 5JUVA 2IPGA 1UKPA 1VBRA 4UTTC 1AQHA 7ODCA 4ZOEA 5CC5A 1Z48A 1G7UA 3UR8A 3BL3A 4A8NA 2E0PA 4ICMA 2GLKA 1R9XA 4IM4A 1C8YA 3L4YA 4QJ4B 5F1UA 1WAUA 1X8CA 2Z1VA 3VM5A 4HZMA 1TV3A 5DMNA 3BAWA 2UWFA 3W7GA 1ODZA 3ONBA 4HQVA 2QIWA 3W7DA 4C7FA 2AMGA 3QH2A 4ZODA 3CEPA 3G0UA 3QGKC 1E4NA 3S2CA 1C91A 4HK5A 1XW8A 2XVKA 1H51A 1YHTA 4X9YA 3WF3A 1E56A 3MV11 1TG7A 3SBFA 2ZA1A 4LV9A 1QNPA 4NRSA 3R8GA 1MZHA 2DH2A 5A8NA 1Q65A 4FNSA 1R3WA 2ZUUA 3TYZA 1R3TA 4V2XA 2VRKA 3VIFA 4MNKA 2ESCA 1A5MC 4O54A 5D8ZA 3M9YA 2R9RA 1GGOA 1BD0A 1N8IA 5FJUA 4JFWA 3H23A 2J79A 3CHDA 3AAMA 3W70A 4RR4A 1LRNA 3HOJA 3ZYZA 3QW4B 3VGDA 3ARUA 3EOOA 3NO5A 1OG6A 4LCQA 1QWGA 4GI4A 3RM9A 4NRRA 4WGXA 1GQIA 1YPIA 4NX5A 3TOYA 4YXGA 1XLJA 2GK1A 3FA4A 2POZA 4Z17A 2PAJA 2R6OA 3GU9A 2NT1A 3C0LA 2OO0A 4PRTA 1X1OA 1ZJAA 3GDLA 3TAKA 1AMYA 4JTUA 2V3DA 1XINA 1C92A 1TV4A 4H1ZA 2ZRYA 4UCGA 1EKOA 4DF2A 4EK7A 3EWWA 5HMEA 3UY8A 1OX4A 4L9XA 3P81A 2OX1A 1GW9A 2KX9A 5FJRA 3W0KA 2D0GA 3WF0A 1EC9A 2BXZA 5D02A 3CC1A 3CAVA 1DV7A 4L1GA 2Y70A 4IIHA 2GSJA 2HQAA 4N0RA 3OPSA 2EPLX 3CZLA 4Y96A 3BSHA 3U5UA 4LPCA 2WXDM 3OLGA 3Q45A 1EIXA 5K9DA 1K8CA 4PEEA 1W3KA 4NKCA 1XYLA 2J7FA 2CESA 2O92A 4MFEA 3TC6A 1ADDA 5C9ZA 3MI2A 2E68A 3GNXA 4HOWA 4CGTA 4H8VA 3R1ZA 1W3IA 3LHTA 2NX1A 4LFYA 4FNTA 2VX6A 1RHCA 2D73A 3S9ZA 4NZCA 1Y7VA 1NEYA 4O1CA 4PRWA 4DUOA 3MKKA 3NTYA 4GC3A 3T8LA 3G8EA 1HG3A 3H4WA 1SO4A 2I17A 2QIIA 2YJQA 3GDTA 4CQCA 1CXIA 4QXIA 4PGLA 2BLEA 3M6YA 1DJIA 4RE4A 3II1A 1TV5A 3DFHA 1UD4A 3EAUA 1L8PA 1AG1O 1S5VA 4KERA 4QG6A 3A3XA 3N14A 3MMTA 4ATDA 4ZQMA 1C90A 2ANUA 4HA3A 3VX0A 1QOXA 2C71A 4OQVA 3CQIA 3VZZA 1EC8A 3N1AA 1UROA 1E0WA 1ONWA 1HJWA 2GVJA 2G0WA 4PSRA 3V3WA 2Y4SA 3KXQA 3I6RA 2ZC8A 5A6BA 3ITYA 3N9KA 3NQ7A 3GXDA 3MWAA 3LEPA 3ITTA 1JNEA 2ZDRA 1L8NA 5HPOA 4A4AA 3KBSA 3S83A 3TIMA 4BF9A 1F73A 1W5OA 2NVDA 3DIPA 1E0VA 1UPPA 1EC7A 1U1UA 2PDMA 1IQ8A 2GJNA 4F9JA 5TNVA 3OHIA 3NSMA 4C6OA 1NSJA 3WUBA 1TWWA 1RVGA 3VIKA 1UKTA 4FP1A 2IXVA 3UERA 2QMJA 1CENA 3NYZA 4LUYA 4DRSA 3F2CA 4L65A 2TAAA 1V3JA 3PWAA 2ZCGA 5IHSA 1KRMA 3A9IA 3V1PA 4ERAA 2QCFA 2DZUA 1TMLA 3Q2DA 4KEZA 4BWLC 1OJXA 4MB3A 4C1NB 1CEOA 4XZBA 5HWJA 2B81A 5FCZA 3UJFA 3VXGA 5F2IA 4C6NA 1WPCA 4MNJA 3MCOA 3R58A 1HL9A 3M7SA 3LOTA 4WF7A 3SJNA 5U4NA 5HMDA 3RDKA 4WJXA 1QNVA 3DKJA 1S1RA 3C2OA 3QYQA 1LWIA 2ZX7A 3FKKA 3LSCA 2Q3RA 4E38A 5T9CE 1DJNA 4GZEA 2NZLA 3IACA 2VZOA 4K6AA 3EDKA 3EWBX 3I3EA 3W7LA 1EP3A 2DVXA 4CN4A 2GQ3A 1F3TA 2J88A 5F2LA 2QLYA 4LS0A 1TR9A 1OZMA 4O53A 3NQFA 3SFWA 4W7WA 1XL9A 1IXPA 1PIGA 2HVOA 1PIFA 2WM0A 1Z42A 4MOZA 4XQ6A 3VNZA 1V3MA 3OZOA 2R1PA 3L5AA 5DANA 1RLDA 1UWUA 2V3EA 3V75A 1ITXA 3LRKA 3UG8A 4H2HA 2BMBA 4LVDA 3VGGA 2D3LA 3POHA 1B3VA 1VFTA 1JCXA 1ZP4A 3R89A 1VR6A 3QMTA 5LNSA 1XYAA 2G3FA 1UMLA 3KE0A 3AHVA 3B4YA 5LIYX 4H9ZA 4ONVA 5DXXA 3UWEA 1TB3A 3O6CA 3W7EA 4JS3A 1REQB 3VKJA 1YPFA 1XIMA 3BLEA 1AH4A 2G3IA 2VT0A 1TZZA 1XYCA 4EXAA 4YMZA 3ARZA 3DAQA 4LH8A 3RLGA 4BKNA 4GCAA 3EWXA 5HQLA 4OE7A 4A8IA 4C6BA 4H7CA 4MHBA 1K8YA 2QXWA 4RXGA 1E6SM 3CT2A 3EOEA 4EWJA 4P61A 2ZVIA 2JGQA 3NDOA 1XI3A 4MADA 3TYBA 3PHAA 3CLWA 1FTXA 1YNPA 3ZJ8A 4WOZA 2PP0A 5B80A 1LTDA 3O2LA 3S2JA 2Z6JA 1MQQA 2XWDA 2NQJA 1ITQA 2QCCA 1WKFA 1EPVA 4YTUA 4RDYA 2X0HA 1R6WA 5A6KA 5FEXA 3S1VA 2O0TA 3M0JA 4HCLA 4KCUA 4O1BA 1S46A 4CUCA 3B8UA 1M01A 3EA3A 1K9FA 4EPDC 5C71A 4PODA 3NQAA 4TXEA 2FFIA 2CZ5A 4F66A 1QO5A 1PWMA 2PDJA 1EJVC 2D23A 4HHHA 4J28A 1PX4A 1EF2A 3FXGA 3GD6A 4QM1A 4NJIA 2EKCA 4U3AA 1W3TA 4GIYA 3BW4A 4L1WA 3MI3A 4JFSA 1KM0A 3B8WA 4AXNA 1A4MA 1IEIA 2IQDA 4US5D 1SFLA 1MWOA 1X7FA 1E3XA 3NZPA 3CZGA 3WMLA 2YFOA 1FRBA 1WXYA 2DSWA 1ZZMA 1Q2SA 2J66A 4ZBCA 4HNTA 3DHFA 3VFLA 4MY8A 3W6MA 3RX3A 1UUOA 4M6QA 3UP8A 5I3JA 3S8HA 4NQ1A 1IT0A 2GWGA 1H0GA 3GU2A 2PCQA 4UR7A 1EDQA 1VFOA 2PF0A 1ISVA 2RUSA 2PA6A 2QQ6A 3PZMA 3CUIA 2DJLA 5LGXA 4AWSA 5EMUA 3BH4A 2P0OA 1DORA 2WHJA 1P7TB 1SZRA 2GL5A 2WMIA 5JBFA 1LBLA 1P6BA 4LEFA 4AHOA 1FHDA 2AQWA 3BCDA 1ZCCA 1NAL1 1KFJA 3ELFA 1W9VA 1TPEA 3O0FA 1JNDA 3S5ZA 2EG6A 4H7VA 3D6NA 3WFAA 2CERA 4ADUA 5LA1A 5AYBA 4F9DA 2H3BA 4QNWA 1SZFA 3EX1A 1MQPA 4P7RA 3M0VA 1W1A1 2DVTA 3HG4A 2E3ZA 1VENA 2QCLA 3CUHA 4S38A 3OVGA 2VFEA 1E1CB 2RKXA 4MKNA 4Q4RA 3LCXA 1B5TA 3T09A 2CITA 3LRLA 1RVKA 4RJEA 1JEZA 1Q5MA 4B9YA 3QOKA 4O0ZA 3LGEA 1U22A 1E3ZA 5FJIA 3TJLA 4F0HA 3UA3A 2WSRA 2VEGA 4EF9A 4AYSA 2HWGA 3VDBA 5I09A 1VH7A 4NAFA 4UTLA 5M5DA 3M0MA 4L4MA 3KVKA 3THAA 2DZPA 1IYXA 3BWWA 5MF5A 4XB3A 3W00A 4NZFA 1EIBA 1Q85A 1DYSA 2I56A 2H9AA 3NIYA 4HNUA 4RCXA 1VEOA 4FLSA 5B7ZA 3KFTA 5EB8A 2WZHA 3E0FA 1GVYA 4GX9A 1FFQA 3VZXA 2IKJA 1XPGA 5K3VA 1ADOA 1CB2A 3VPLA 2JEQA 3RGTA 5CSRA 3WNPA 1EP1A 3CPRA 5IXEA 2V5LA 4PMRA 1UKOA 1MW3A 3LRMA 1BWVA 2I57A 2PTWA 3UR2A 5HUOA 4EVZA 5A6AA 3G1XA 4FO4A 1OFEA 3QMSA 1H09A 2WB5A 3URQA 1TWZA 2C1GA 3QC0A 3CLMA 1FWTA 4PMDA 3MHGA 4W8LA 1MRQA 2AQVA 4AY1A 5EMKA 1SUXA 1TZ9A 4WKFA 2OGJA 2XIBA 3GE7A 1HVXA 3FVMA 1OC6A 1IXNA 4ADSA 3E0WA 4GUGA 2Z1SA 2VDGA 3RU6A 1P6WA 5FEPA 4O4WA 4Q4OA 1XR2A 1GW1A 1BTCA 3DHUA 3HGSA 2DSVA 3WL0A 2W91A 3R25A 2C14A 2DFAA 5DCEA 4UZUA 1B3ZA 4ZE4A 2PD5A 4KQNA 1FWJC 1ZAJA 1JF5A 4MJ2A 3EDDA 5BRBA 3R10A 1S3HA 2WCSA 2CLKA 3GHTA 1H7PA 2J7CA 4GQGA 3BICA 4ZVJA 3AHZA 4PL1A 1FDZA 2WKJA 1FWWA 3KBNA 1X1ZA 3F4NA 2LLEA 1LG1A 3OYZA 3MANA 1GYNA 5REQB 5GNZA 1NF0A 1DE5A 1K03A 5H91A 4X9SA 3SCOA 3FA3A 3WLMA 1ONXA 4UTHA 1UPMB 1O5QA 1OX5A 4J40A 4U5KA 5IM51 2ZZ4A 1AZ2A 3MJYA 1UCWA 1UD3A 1VFUA 3RCYA 7PTDA 3MMWA 1VB9A 1MDRA 1VFMA 2JF7A 4JR5A 1V0KA 4H3DA 3MO4A 1SSDA 1JZ2A 1PYMA 4MPQA 1W6TA 4P8VA 4AZCA 1B4EA 3ZVHB 1GZGA 3K4WA 4WIWA 4QBXA 2JKEA 2QHAA 4DO6A 1U83A 5T8GA 3UA4A 3ABXA 1C7TA 4D8LA 3P7YA 3GDKA 4KWSA 3LBCA 2I5GA 5AYYA 4RV3A 3CU2A 4Z42C 3GTFA 3MU7A 5AHFA 1XBYA 1TPWA 2XVGA 5XINA 3NQCA 4EP8C 2EO7A 2ZZ3A 5A6MA 5H2ZA 2PLKA 2QVHA 1JG9A 2WZIA 3Q65A 4M6PA 5JBDA 2WYSA 4HD5A 5EBUA 4MZ1A 5DF0A 3ARVA 1OFRA 3EX3A 2WC7A 5ABEA 1XLFA 1K4HA 5I3FA 3TFCA 2XWEA 3PVFA 2QCHA 2YW4A 4PH6A 3BJFA 2V8ZA 2FB3A 3AZRA 1SZGA 5HXMA 3R4IA 1LJYA 3TMQA 1XWYA 4CU6A 4K7VA 1MNSA 2HJPA 1BAGA 1XRFA 4GYPC 1JD7A 5J8LA 1JCMP 2CLLA 4FF5A 4XAYA 2VZVA 4FNPA 3FYOA 1QW8A 5GVJA 2VWSA 3FKRA 1JDDA 3AIEA 3QSTA 5D2XA 1WP6A 3FXYA 4TOQA 3SCWA 3GH7A 2VUNA 4JNZA 2XH7A 2EPMX 1X38A 3EX2A 3K2GA 4GYFA 2FLIA 2YDAA 5C2CA 2EEXA 4IL0A 1VPQA 4EX4A 2G3MA 3W9ZA 5PTDA 1XH0A 2YBUA 4JL2A 1B54A 2VTFA 3TTSA 4JPGA 1KW1A 4MJZA 3ICJA 2ABAA 1LOQA 4OV9A 4J3VA 4Q33A 3TQKA 4JTLA 1QU4A 4P7QA 1U5HA 3I4EA 2D2GA 3G0SA 4HB7A 4LY8A 3LUTA 1XRTA 4GFSA 3R0UA 3BW3A 1IEQA 4MM1A 3KS6A 4D8AA 1N8WA 1BYCA 1K1DA 2X0SA 4HYRA 3FAWA 3IK2A 3T05A 1E15A 2XZ7A 1F3EA 1GT8A 2XH0A 1OFBA 4NXKA 2PB1A 4WQ6A 4LS2A 1UKSA 1Q6FA 5C6MA 1ECQA 4RV8A 7TIMA 2WJDA 3VC6A 1PHQA 1WZMA 4UFKA 2QNEA 3KOWA 1QNSA 5IFPA 1OD8A 3WFLA 4KIRA 1YIXA 3HPAA 1YDYA 1SW7A 4W8AA 3OQ8A 3E49A 3CIWA 1W91A 3PZUA 4CNNA 4MYAA 4Z2LA 1FX6A 1YYAA 4FS9A 4PUJA 3AS0A 4NZ4A 3QXBA 4O19A 4XKYB 1Z41A 1JZ3A 2WZTA 1W5MA 2MUCA 3WEOA 3C3NA 3N29A 2BASA 3N15A 5F7UA 1TO3A 2EPKX 4F0LA 5ECVA 5LGZA 1ZBCA 3GUWA 2OKOA 1F2JA 1JXJA 3L12A 2OOFA 1XQKA 4MUZA 3BAXA 2H90A 4NI8A 2AGTA 3XINA 4W87A 5LA2A 5F4WA 1POJA 3VI2A 3EKLA 3ZLFA 3CK5A 4P8WA 3FJ4A 2VDIA 3NXFA 3DENA 3WEZA 1B9ZA 3QZ6A 3N3TA 1X39A 3GKFA 2WKGA 3PBGA 1MRAA 3HA1A 2ZXQA 2GQ8A 3T1GA 1U5JA 1K6AA 2B7OA 2VQTA 3CWHA 3IUHA 3UW6A 5LNWA 4Z1YA 5AECA 2Y63A 1B0IA 1VEMA 3OB8A 3C61A 5I79A 3STPA 3W2JA 2WK2A 2ZTKA 1XDMA 4JEJA 3SB0A 3PPGA 3PZTA 3SGGA 3A23A 4ZQNA 1E71M 2PC4A 5BXPA 4B3ZA 4O14A 2KAUC 4ECLA 2NUWA 4KF1A 1PZ0A 4V1XA 4DPQA 3KP0A 1J79A 4RK8A 3OG3A 5ABFB 2VQUA 5C2XA 4R88A 2R91A 4AC7C 1HJSA 3OHMB 4U3CA 5IBXA 7REQB 4A2SA 1CCWB 4IMEA 2NXHA 4CLMA 4QJ5B 2XFRA 5I77A 4W4QA 4IH3A 1XKJA 3H2FA 3UWQA 5CC7A 4FOKA 4AXKA 1KWKA 5AHIA 3L67A 2WVTA 2WZEA 1ZAIA 4PUEA 4MY1A 1LP6A 4D1IA 2YDRA 3B0PA 3H7RA 3L21A 4GFIA 4K3ZA 1HP5A 3W2UA 2NVAA 4L6DA 1VQTA 4F0KA 4MDPA 4OBTA 2NSXA 3GBDA 3H21A 4B90A 4ATLA 4B2DD 4WDTA 3TWBA 1EF3A 2Z26A 3PP7A 3DG7A 5CJMA 4YWSA 3H4XA 1NARA 1SJCA 1IT7A 2INZA 2QEZA 1VAHA 1JRCA 1XSJA 2CNCA 3N6HA 3NAVA 2CZEA 4PMJA 5D30A 1VCFA 3GH4A 4UXDA 3LZ5A 1JPMA 1W1VA 4XUGA 2CW6A 2NV2A 1P5BA 2PC8A 2OGYA 1M03A 4I5RA 1OK6A 2ZFAA 1WUFA 2A1YA 1IEVA 4QCFA 1NOFA 4RE0A 1J01A 1J8VA 1E6RA 1XGDA 1P43A 1PTGA 3O6YX 3L2LA 1MQRA 5GJPA 4IMFA 1LRQA 2OX4A 1W1YA 3PZNA 3F1QA 4DAFA 4ROPA 1WDDA 4NJJA 1I0DA 1XUUA 2QJGA 4BJHA 4TVCA 2QULA 3PJTA 1AZ1A 2NT0A 1TE6A 4DBWA 1UD8A 4GPNA 3AROA 3SRKA 2YXGA 1T6MA 2W9MA 3TCEA 2EAWA 4YTRA 3O9NA 2ODOA 3WJYA 1K6WA 1H50A 3WLKX 1IR1A 1SZNA 1MEIA 2YA1A 4TIMA 3OG2A 4CN1A 2QMKA 1NF7A 2ZX5A 1Z44A 4D8ZA 4O11A 1B9BA 2QJJA 3LSBA 4IG2A 1BXCA 4BI5A 2HXUA 5HJLA 3KUMA 4AEEA 1S3TC 1C8VA 4HYWA 2H8XA 2XSAA 2IQTA 3MSGA 1K9TA 5LIKX 2A7PA 4KCVA 3H2MA 4C6QA 4EAMA 1HJVA 3RPDA 5A8GA 3S1GA 3LDVA 4GJJA 4DWSA 2Q01A 4D71A 3KTSA 1E4IA 1EGZA 4RNIA 4F0RA 3V16A 3EYPA 4KWUA 4KWOA 2VD9A 2REQA 3EKZA 3SY8A 2A3CA 1UOKA 3RMJA 1XIHA 2Z0IA 1VIZA 1KR0A 2ZUSA 5FSDC 4X0VA 2J7GA 3DGRA 3W7MA 3E02A 3W87A 3NO1A 5CPLA 3WMBA 4DBSA 4RW3A 1NWTA 4J3ZA 3WNNA 1UB3A 2DZAA 1ZL1A 1DWIM 2QCDB 2YFNA 1K3UA 4XVEA 3UG5A 3G22A 1WDRA 1ZRQA 1V6TA 1V3LA 4U10A 1YX1A 1E9YB 3OODA 3WUGA 3FLUA 1CLXA 2G4FA 1ICSA 4QS6A 1E43A 1WUEA 3IEBA 4KEMA 4WKAA 3GTXA 4EAYA 3PC0A 4PCSA 3SZ8A 2W27A 3S6OA 4U4MA 3FV9A 2EXOA 1T99A 5DMMA 3AMGA 2VFHA 1UQYA 5G4HC 4DZIA 4AD1A 4WUIA 4C90A 4AUBA 2NLIA 1FWBC 3B8TA 4NL1A 2VM8A 4DWDA 2PDXA 1Z6KA 3RLHA 2VGIA 5M3WA 1VRDA 2CXGA 1ZBVA 2POTA 1HO4A 2PODA 3IIZA 3VDCA 5FD0A 1OD0A 1XCXA 2PDKA 3MYOA 3WDIA 1V6VA 3DGBA 4WY0A 3M5YA 4KEUA 3VU2A 3LD5A 2EPNA 1ADSA 2W62A 4JTHA 3CMJA 1ZB5A 5EMLA 1N2VA 2H6RA 2WQPA 3VKBA 1A0DA 4Y2WA 3V5CA 4MB1A 3UJEA 2UV8G 4FEZA 2XFYA 1PX8A 2Y88A 4C6MA 5I5RA 2JE8A 4GC4A 1TRDA 1OCNA 4FXRA 4AMCA 2DUZA 4LBRA 4F2UA 4DY1A 4UNLA 1WXZA 1BYDA 2BB0A 2QDEA 3QY6A 3SCNA 5CGMA 5BU6A 1JZ6A 1V6YA 3WQ4A 3B0UX 3BGJA 4I90A 3M0ZA 2YX0A 4HU3A 2DZSA 5A8PA 1MFUA 3HMJG 3ZT5A 2FIQA 3FHQA 4HZ8A 1VIWA 4KGLA 5DBTA 3P62A 1EO5A 4ACZA 4W86A 2YZRA 1H63A 3H70A 4L4LA 1M7OA 4YJ5A 1IEWA 4FZIA 3V0SA 3DI0A 3DECA 3LERA 5TF0A 4A6GA 3WK2A 2F38A 4M7TA 1GYLA 1CECA 3MVTA 1PTDA 1TWSA 4JQ3A 2B4GA 3F4DA 4O1DA 1QOPA 2O4QA 3EB4A 1IGWA 2A85A 1YNYA 3AHYA 3IVTA 1ISYA 5FESA 3M0IA 2J13A 4GGHA 2YL8A 3UCDA 1DWFM 1Q8JA 4FOUA 4UQ9A 4R5EA 2PDCA 3N13A 4FR1A 1QCWA 3APYA 3B0XA 1GVRA 2RAGA 1G94A 2ALRA 1N8FA 4CD5A 2GDQA 1RJRA 2DPEA 2P50A 2X42A 3ZM8A 1JDFA 1F76A 4EOUA 1TREA 3KRZA 4KFPA 4MY9A 2D1ZA 1YPXA 1FWRA 3CV1A 5L6UA 1GJPA 4LC6A 4Y9MA 3DFYA 1J0JA 2VYOA 3B3DA 1ESWA 3N73A 1UWQA 3K8LA 2QCGA 4MMWA 4UOZA 3GG1A 2HROA 3BUVA 2BY1A 6XIMA 4NZ5A 4UFJA 2O7SA 1KFCA 3DC0A 4JKLA 3RX2A 3ZFHA 1UR8A 4XZIA 2PDPA 3GYEA 4CD6A 4CNPA 1WDPA 4LT9A 1W5PA 4A8LA 3TNBA 2CBVA 1YEYA 5KSWA 5EY5A 2WSYA 5HNUA 4KS0A 2DDXA 3TQ0A 4B5UA 3S5SA 3SGZA 1E72M 3KRSA 2PBGA 5C0QA 2OKTA 4AZBA 4ZFMA 2PDFA 3PBYA 3ANUA 4M1RA 1EJTC 4DXXA 1Q8AA 1EOKA 4PFHA 1A5SA 1XH2A 4FX6M 4RZ6A 1V3KA 2XH4A 1W5QA 4JN6A 3E5BA 1FXPA 4UQCA 4X3ZA 3LTPA 2Y5JA 1XJBA 4XG1A 1O60A 3MSDA 4FMVA 2BGQA 4AD2A 1FWHC 1TJPA 1XG4A 3LXAA 1EQPA 5HJXA 3AXHA 3VIOA 3H4GA 1EZWA 2WPBA 4PZVA 4CCZA 1W9UA 4XVDA 1XISA 1I2OA 3VMNA 4GQ0A 3QV8A 5DCDA 4UQDA 1T40A 4I7WA 1LORA 4D6HA 5A69A 3EBVA 1XRSA 3ENLA 2YPIA 4AX6A 1P0NA 4MWAA 4G7FA 1LT8A 3DBPA 4K2SA 2W67A 5BWFA 3FN9A 1R86A 3IRDA 1M53A 3MBDA 1BYBA 1GPFA 1DBTA 3EMZA 3M5XA 2XZ9A 4PCFA 5AB3A 1FDJA 4OOZA 3SEPA 2X7WA 3VK5A 1UZHA 4IIEA 4UC5A 4M19A 3W1QA 3GTNA 1CGXA 5DBUA 3SCUA 2VZUA 4K38A 2XSBA 1U1HA 3HV8A 2FPYA 1D7KA 2ATMA 1UMYA 3TE9A 1EWDA 4Y9PA 2JF6A 2FH6A 3OP2A 4LWWA 1XQLA 3KOYA 4EWND 1C9WA 5D05A 3P61A 1EUNA 2QDGA 5F4SA 2XUCA 2PPGA 5A6SA 1LG2A 3EOUA 1EJWC 1TSIA 4QE1A 1TJ2A 2O9RA 5IDIA 4Q8TA 4Q4QA 3ZMRA 5LNUA 4M82A 5AYZA 1TWDA 1R3RA 2Y8VA 2B7QA 1TPH1 4DJFA 1ZJIA 2Q3OA 4B5NA 5H1WA 4GYJA 1C8QA 3ABZA 3BC9A 3MUIA 4GE8A 3NQEA 3W3OA 4JTTA 3ZZ1A 4I6VA 5EMMA 4GKLA 3CL7A 4Q7BA 1H5VA 1QK2A 5IHRA 2TRSA 3NQGA 2I9UA 1I1WA 2DT2A 1GVFA 1SR9A 4R9OA 3VILA 4GXMA 4H6QA 1NIUA 3ATZA 1MFVA 5I3DA 3W02A 3PG8A 4HA4A 2V30A 4NIRA 1UBPC 2ZUWA 3G1HA 1XIDA 5I03A 4MB4A 4IQDA 9RUBA 4B92A 5DN1A 1L9WA 3WF4A 1ITCA 1UD6A 3PFRA 1GJUA 4G9PA 1C3FA 2VX5A 3Q4DA 3GLCA 3TN5A 4MDOA 3ALFA 1FH9A 3LNPA 2WSPA 2E6DA 3L4ZA 5U7SA 1LQ0A 3CTTA 2PWGA 3QQ1A 4L6HA 2YBTA 4JGDA 2WLYA 4U31A 3B9EA 6TIMA 3MUY1 2WOQA 3MCNA 5BNKA 4S2CA 1PB0A 3OYXA 1ICQA 3ZR6A 2TYSA 4LYKA 4Q7IA 2ZZ2A 4ICCX 1DHPA 4L64A 2GGHA 1QBBA 4AAJA 3MVIA 3AALA 1TTJA 3DDMA 3QLDA 1CYGA 4OHQA 2QUVA 1UR2A 3U7BA 2C0AA 4TTGA 3VOGA 1RQEA 3WL1A 1AJ2A 5DMLA 2NQ9A 3RYSA 3BK0A 3ONCA 3CJPA 2XVLA 4TMBA 1RK5A 4HMNA 4UB9A 4AX7A 4DF0A 4UMAA 1OEPA 3SN1A 3T44A 3G1YA 5CPQA 2EBNA 1A5CA 5DELA 4DLMA 1BG9A 3VNYA 1P4CA 3GNPA 5A6JA 4IPIA 3WDRA 3TW6A 4EKJA 1HKJA 4J5NA 3NZQA 3S2MA 2YDSA 4YNGA 3USBA 2VP8A 2E5CA 2A21A 2C79A 4B9ZA 3L4WA 1J10A 3AS2A 4AZGA 4IP7A 1B3YA 4EXBA 3IIVA 1SFSA 3I3DA 3VKDA 1TV8A 5LYRA 1W3HA 3B9NA 1LF1A 3PK7A 4QTGA 3E1F1 1JUBA 4QP0A 1TKKA 1IR2A 4Q4MA 1RP8A 5AC7A 1X98A 3N19B 1GPWA 2X05A 3ABOA 2PLJA 3AS1A 5DY2A 4IMGA 4FLOA 3PAOA 1A49A 1GOMA 5EU9A 3B8VA 1JGMA 3MUAA 4DO5A 2A5HA 3A4JA 1XIEA 4NI3A 1XD0A 4RZ5A 5B7YA 3HM7A 1DJGA 2J24A 2WW5A 1FUYA 3RJYA 3MS8A 2V6AA 4M24A 3BV4A 3GIQA 3K8KA 3QKZA 1QRQA 4KMQA 2Z2AA 1J0KA 2OQLA 1W1ZA 3GX9A 4JQ1A 3SCVA 3W25A 3EB2A 2OEMA 1DJHA 5RUBA 1VPXA 2QDHA 5CQ1A 4JX5A 1FFRA 1I2PA 5AHLA 1QDSA 3IV3A 4H9TA 3G1SA 2A7RA 3AOFA 3NZ1A 1BGGA 2YLAA 4IX0A 4S3EA 3CQJA 4IGHA 2CLPA 2BOGX 4LGXA 5JH2A 3ZWTA 1DEDA 3RILA 3QQWA 1W1IE 1OT1A 4C6JA 3ARPA 2DZTA 5C7VA 4C6PA 4XUYA 1D3HA 3A24A 4YTQA 1OADA 1CXLA 4Z1CA 2ZRUA 1CI1A 4R34A 1VBJA 3AHTA 4YVPA 4F2BA 2WCAA 3FYYA 4JIPA 4N6EA 3H8AA 4RUBA 1UUQA 3W7OA 2BX7A 4UQEA 1OG0A 4GGBA 3S46A 3HIJA 2VX4A 3PPFA 1SO6A 3C86A 3FY1A 1MUCA 1Q6DA 3IAQA 4HBKA 3CNYA 3MUXA 3STCA 3AQUA 1UP0A 3LYEA 2CLFA 3HQ1A 1YLVA 1XLHA 1E1FA 4MPKA 4DJEC 2VGBA 4FIRA 2E5BA 1GHRA 1XH1A 2IPJA 2WNZA 2PRLA 4UTIA 5H8MA 3KRBA 1QHPA 4DX3A 3COTA 1GOWA 4ZB2A 2VC7A 4JYDA 4R53A 3VNLA 4AZ7A 3TYCA 1OT2A 4B2DA 1G4EA 4QNEA 4TQTA 5IRPA 4L9ZA 2Y62A 3SIMA 2PDNA 3VGFA 4A3HA 3HJZA 3TFXA 2BXVA 2Z7KA 4L5ZA 1W9PA 1SVDA 1UR4A 1KB3A 2YR1A 2IW0A 1GVEA 4WDXA 4MSSA 3CT7A 2FMNA 1AW5A 4HN8A 3W01A 5KEZA 3F5JA 2MNRA 4LUTB 1QATA 4GG9A 5AC6A 3AWNA 3IUIA 4IGNA 4JQ2A 3ANYA 1SJBA 2CHRA 2YXXA 2GVYA 4ZO6A 3GSMA 3FDGA 4MIMA 3W7PA 3MPGA 2NX3A 2Q8ZA 3ITOA 3IAPA 2VFDA 1F6YA 3TV8A 3B9DA 2PP1A 2CBIA 4MWAE 4BK9A 3UD6A 2E6YA 4ORMA 1XYBA 4C6FA 1AL7A 3TR9A 3SQSA 2E8YA 3GG7A 3AMLA 1XLKA 5LXXA 3BG5A 4I3GA 3CUJA 4HSNA 4Y9AA 3ZS4A 3GXIA 3MP3A 1GJWA 4HNNA 3CHEA 3G6MA 9XIAA 1WAWA 5FACA 1I4NA 2BDQA 3MDUA 2F6UA 4NAFB 3P82A 3EZ4A 3RRAA 3SADA 4HNOA 3LB0A 1GUVA 3BGGA 1JVNA 3NYDA 5AYXA 3BOLA 1QVBA 5AHMA 5C70A 1UWSA 4QDMA 5DXYA 4DJDA 1JYXA 2O9TA 3GFXA 2V2CA 4GISA 2FZ8A 1ZBWA 2P5NA 4FB7A 1L6SA 3NG3A 3BLFA 4NG3A 1V7AA 4HPGA 3IJ9A 1OCBA 3T4WA 4GO9A 4LW7A 1HF6A 3SUUA 5E9XA 4DXKA 3PSWA 1BF2A 4B91A 3NDYA 3F5KA 4KCWA 4FIQA 4UTUA 5H8PA 2V82A 5JH1A 4LUJA 1UH2A 3WQ5A 4B5WA 1YADA 3PF3A 1LYXA 1QFEA 2UY4A 5G1YA 5CPNA 5LKYA 1R3VA 3UJRA 5HMFA 4JN7A 1CPUA 3W27A 3R8RA 4GY7A 2Y2WA 1XDLA 2E9BA 2VO5A 4RZBA 1FY6A 2FYMA 2UY3A 4A2RA 6A3HA 1XBXA 3H2CA 3WQDA 4GOAA 3D3AA 4YL2A 2V69A 4L7ZA 1IIGA 3SUSA 2J27A 3OGRA 4CD8A 2GSEA 1TTQA 4ZB0A 2QJIA 1LRTA 4WR3A 5A1AA 3N34A 4GXWA 1EL3A 1LWJA 1H62A 4ML9A 3RMEA 4MG4A 1OCJA 1X7IA 3BCJA 4I5XA 4YLWA 2DJXA 4S23A 1E0UA 5D9OA 3ERPA 3KHDA 5D2VA 2SFPA 5K7JA 1WBHA 1HL8A 4MB5A 4DI8A 3LTYA 2A0NA 3BG9A 3GR7A 5F4XA 4AY7A 1TV7A 5CZSA 2GUYA 1EEXA 3CB3A 4X2PA 1ZY9A 2ZXAA 1F9CA 4TV5A 2GOKA 2CXEA 3VUSA 3CO8A 3D5HA 3BLIA 5M17A 1CGVA 3R13A 2VRJA 1XF0A 1EFZA 1A3WA 4GI6A 1WNOA 1OABA 3EOLA 4WRHA 3VFCA 5BOOA 4XK2A 1W0MA 1VZWA 1MW2A 2J78A 3LPFA 1J11A 1PKMA 2VELA 2TSYA 1R30A 3MP4A 4DAIA 4UTKA 2E40A 3MT1A 2X2YA 1KLYA 4ZEPA 1Q3NA 4QLLA 3UVAA 2QYGA 2VC6A 3R12A 5C2GA 2PTDA 4LAUA 3OTRA 1W1PA 5CBBA 1O4UA 2ISSA 1NP0A 4GA8A 3S3GA 1AMKA 3ZLHA 1KFLA 1F8MA 1S5MA 1H61A 3LI1A 3ZLGA 2IKHA 3KOXA 2TODA 1M7PA 3T6CA 4JHOA 4AZCB 3W1XA 3ID7A 1B3OA 4OZOA 3W29A 1KM3A 4FNRA 5FJTA 4IZGA 1J0IA 1Z89A 5IBXC 3H2EA 3WSUA 3CZKA 4FAMA 1O1ZA 3VIGA 4FSAA 1YTKA 4MJ4A 4IPPA 2OT1A 4GXPA 4QLKA 3TZFA 4OFCA 3S1WA 3NDZA 4O0QA 3C3UA 4BQ4A 4DM1A 8A3HA 3TA6A 1TMHA 1FKWA 3G6LA 3M16A 1XRVA 2J7BA 2KZHA 4IQJA 3TSMA 4US6A 4JXCA 3H54A 2VCCA 4WJEA 4IPLA 3IARA 5A6LA 5C7HA 3CIVA 3LMYA 2O7QA 2QF8A 3SM0A 1CIUA 1H7WA 2PLMA 3WIJA 3I7QA 3HPZA 1DJQA 4QDWA 4J27A 4LRTA 2EGZA 4AEOA 4D6EA 3QYSA 3DU0A 2F7FA 1O5KA 2Y1HA 3E96A 2YCLA 3VDAA 4QIUA 1QBAA 2QW5A 1FHUA 3AISA 1OK4A 4Z2KA 1NFBA 3WLQA 3P14A 3WZ0E 3U4FA 4KRZA 1FCVA 2EKGA 3GNRA 3W86A 3M5ZA 3MSYA 5DQPA 6ALDA 3LMZA 1ITUA 1KXTA 5AY7A 4PTWA 5JIWA 3LHYA 2E4TA 2J7EA 2QCNA 3B97A 1GVOA 5HULA 1UR9A 4AEFA 4CKQA 3QGAC 5CAHA 4GZIA 2OTDA 2PU0A 2XVPA 1K77A 2Q09A 5I0DA 1DXIA 2CPUA 3L0NA 5CC3A 4ZO8A 1BKSA 3P5YA 4MNMA 3KCJA 5GQBA 2BHUA 2RJHA 4A29A 3W85A 1KV5A 2Z27A 3W81A 4LVGA 4LBUA 3ES8A 5I3IA 4IISA 3LX9A 1DQUA 3JZEA 5DEZA 3N6QA 5DCBA 3AMKA 3EDEA 4TUFA 1Q6CA 3NFUA 4AIOA 5DFAA 1TVNA 5LXEA 2AL2B 2B7NA 3I3BA 4Y7EA 3HG3A 4NYUA 3VOCA 3W72A 4IFKB 3WUEA 9CGTA 3TR2A 3RRXA 3ITCA 4UIOA 2W0UA 4HOXA 2QPSA 3T8QA 1MSSA 4K36A 2GQ9A 3M43A 4L4PA 3NQ6A 4R7OA 3GHSA 4MAZA 1GOKA 1CDGA 3UZJA 2JIWA 4LF1A 3VDGA 1B2YA 4PTMA 5M03A 2PDIA 4H01A 3QC3A 1FXQA 3VX1A 4M0XA 3AWOA 2AGKA 1M7XA 1JCLA 5E0KA 2Y85A 2ZRXA 4ZQRA 4H6RA 2E25A 3S5NA 2VDHA 1YQ2A 2PTXA 2ZOXA 3DFTA 3L9CA 1KQZA 3MMUA 5FI8A 2ACSA 5DO8A 1Q7ZA 2OEJA 4QJ3B 5H8UA 3VE9A 4MZ8A 3UNTA 4AZ6A 3PZQA 4BF5A 2WMHA 4MLRA 2YL5A 2HDJA 4Q4PA 2YL6A 4F48A 3C2FA 1QPQA 4BEUA 4F2TA 3EB3A 5I78A 5FL0A 1YTEA 1REQA 3REQB 4IX2A 2FGBA 2W92A 5DY3A 2OWCA 2A6LA 1PX3A 1A5AA 2ACRA 4MJMA 1YRRA 4NNAA 5TIMA 1MVYA 3MP5A 4MKVA 1I45A 3BXWA 3NOEA 4LCSA 3OBAA 4EXQA 4O15A 2A3HA 4EF8A 4K1GA 4DI9A 1EP2A 3LPPA 1UIOA 1OHLA 3L4XA 3TYAA 1KV8A 4NSBA 1X8FA 2HSAA 1LOSA 3EXRA 3WJZA 3HU7A 3CUXA 1KD0A 3TWAA 3IGHX 2P0IA 4GINA 4RPQA 4XZNX 1Q2RA 4Z0JA 5FF2A 4GZJA 4XBJA 4ORIA 4URIA 1T8XA 3WLHA 2PWFA 3PBVA 4HMEA 2D69A 4JKMA 2G5WA 4OT7A 1EDGA 4ZOBA 3F03K 2VFIA 2CEQA 2YYTA 3QV6A 2V2DA 3SUWA 5EL1A 2BVWA 3WLOA 1EUAA 3LQLA 5G5IA 4KESA 4O1FA 3EEGA 5KETA 3ATYA 3LQGA 5HR7A 1J6OA 2F8QA 6PTDA 5KZMA 4HTYA 5GNYA 1TYGA 2OB3A 3E74A 3O07A 4IICA 3DYPA 3R94A 3T08A 1G0CA 4HPNA 3T55A 4X63A 2Y0FA 4E2DA 1XHGA 3R11A 5KITA 4BI7A 4I5UA 4AD5A 1UR1A 4GVIA 1S2UA 3W2LA 5XIMA 2HS8A 1JUEA 1CLKA 2HE5A 2JGYA 2GDVA 1XG3A 3TTEA 4IJRA 2DW6A 5ECUA 3V18A 1EJUC 3LCWA 1UOZA 1MUMA 4NASA 1UD5A 1D2KA 2WNQA 3RX4A 3W1AA 4V27A 5ABHA 2PRHA 2PSNA 4YTSA 1DWGM 1FWNA 3TQPA 3AC0A 4FA3A 4ZGYA 4A3YA 2WVVB 1H1YA 1P7TA 3BQ5A 1NDVA 3L4VA 1BQCA 2HZGA 3OA5A 4IMDA 2WSKA 3MO7A 3WQGA 4Y8FA 5FJJA 2OYKA 1R3QA 2NQLA 3W76A 2D3NA 4DN1A 1LUCB 3TK7A 1X6NA 4CNSA 1VPYA 2Z7GA 3OOQA 4AQLA 3QTPA 4KCTA 3WLLA 2Z28A 4RW5A 1D9EA 4XD6A 4Q7NA 2W66A 3C52A 3U57A 1XYMA 4Q8MA 1HKIA 3PPCA 4R33A 1GKPA 2VX7A 3W1LA 3KBJA 1QASA 4PN2A 1G5AA 3OGSA 1J6PA 4B15A 3TDFA 3NL6A 3NSNA 1E1CA 3M0XA 4BWLA 3S5YA 2CLHA 4A8RA 4QR6A 4P5UA 1ZJBA 4JDBA 4Q8VA 1DKWA 1UUMA 1HN1A 2CWNA 3WH7A 4E0CA 3TN6A 2FTWA 1P0EA 1I6NA 1KA9F 5CPMA 4N9EA 4YTTA 4AIEA 4HA1A 1CT5A 2JQXA 2F84A 3BMXA 1XSIA 5D4YA 5J5DA 5CZJA 4TV6A 8TIMA 3L0KA 3D47A 2D0FA 4Z1BA 3LCIA 3N3MA 5CPOA 2FKPA 3I7SA 2TPSA 3KDNA 3LY0A 4R9XA 1DWJM 2ZZ5A 5LHEA 3GK0A 3U4AA 5HNTA 1J93A 4H41A 2NX9A 4LYRA 2MANA 3A13A 3HB9A 3CHFA 3U3HA 4LC8A 1JGIA 2EPOA 3UYCA 3N2BA 3OEXA 3WY1A 2D24A 4AG0A 1QI5A 4ZOAA 3ZSTA 2ZUNA 1G4SA 4AWUA 1TPB1 1TUXA 4B5XA 3IGXA 4N9BA 2PTYA 4HT3A 2HPIA 1EXBA 3GC5A 1JFXA 5D8WA 2NUYA 2REQB 1S2CA 4UNIA 3HV9A 2ZWZA 2E9LA 1UWIA 3BV7A 1Q4WA 1EOMA 3PTDA 4E8DA 2NQHA 3RR1A 3BCFA 2BXYA 4KETA 3QOMA 6ENLA 4UOQA 5E9AA 3VNIA 1LQAA 4DBDA 1SU5A 5T26A 5BOFA 4JNMA 1JCNA 4JAWA 3WLNA 3WF2A 3UZXA 1KNWA 4RDVA 2BP1A 3S47A 1HNYA 1UH3A 4WJ8A 4AZ5A 4HPJA 1OFPA 1GQNA 3NUKA 2B0MA 2YXOA 3IGUA 4W89A 1ODUA 4CCCA 3NEVA 2X1RA 3LLXA 3B9AA 1IGSA 1AW1A 3NZRA 2Z1XA 3GB6A 1T5AA 1RXOB 4M6VA 3IVUA 2PUZA 3RIKA 4FX8A 3BJSA 1H5YA 3VNMA 1PS9A 2VZSA 2P88A 3H12A 3W2KA 1ML1A 5M1TA 4BS0A 3W1NA 5A8MA 4YVXA 3M44A 3UXKA 3T2OA 1GQJA 4M80A 5GJMA 5E6ZA 1TR1A 1JPIA 3PJUA 2WCGA 3I65A 1W31A 3PNZA 2FZDA 2QPXA 2E6FA 5REQA 1ZBKA 3NEHA 1W17A 3MDWA 3TROA 4GQBA 3SAZA 4CVWA 3ZOAA 4CNUA 3L7RA 3HFTA 2XH2A 3O15A 2XN1A 2J4GA 3M0LA 1S2TA 1EDTA 1TJRA 5BXRA 1YNQA 2VD8A 4Z2JA 1A5UA 3T07A 2QUTA 3PS7A 5D03A 3GAYA 2INEA 3QLLA 4FLQA 4JYEA 1R85A 3HFYA 4ZE5A 2PWHA 2DGAA 3F4WA 4TVUA 3R7MA 1AD1A 3HPFA 3TZNA 3U2OA 4UZSA 1W2VA 4QAIA 4N2YA 4LAKA 3W07A 1JDEA 4M81A 2XU2A 1G7VA 3MQTA 1WO2A 3ZVHA 4Z1DA 2GGJA 5E09A 5G1MA 2NLYA 1QHZA 4H9UA 2G8ZA 2G37A 5FJOA 4DPPA 5BROA 2XVNA 3PUDA 2BVDA 3KVMA 2NV1A 4WGHA 4I7UA 4G5DA 2DT3A 2WHLA 3W1UA 3WLJA 3S9YA 3UCQA 8CGTA 4Z2IA 3BG3A 2A3BA 4W5ZA 1XKYA 3CS2A 5TBOA 1BFNA 4NUWA 4QDPA 5D2YA 3QPYA 4IFRA 3K1GA 4EANA 3UJSA 4Y90A 2GUUA 2I9EA 4QEHA 3NQVA 4GK8A 3T7VA 3AIVA 3BMWA 5ABTA 4OBSA 5D37A 2G96A 4OOUA 1CB7B 1E9ZB 2VHLA 1Y5VA 1VCGA 1Q6RA 2G4JA 1RCOB 3DKLA 1VJSA 1V4YA 1W37A 3RFAA 3GTHA 4LEQA 2FVLA 2XG9A 1U1JA 4GI9A 1CTNA 4KBXA 3V1HA 2WM1A 1QT1A 3GZAA 5CAKA 3EWYA 4HN4A 5CH9A 2Q71A 2FB2A 1TUFA 1HQTA 4DWSD 2CCRA 3MHFA 4L80A 3V0UA 4G8TA 2ZZ1A 3H53A 4IXXA 1XFBA 2YSWA 3W74A 3TTYA 4CD4A 1K8ZA 1ZAHA 3CUZA 5T9BG 5HQMA 4V15A 5I6SA 4H9MA 4CQBA 4ZSUA 4ZO7A 3ZVIA 1XYZA 4KRUA 1PCKA 3UGVA 1TPUA 1EEPA 3SCSA 3UJ2A 4FR6A 3TTOA 4M29A 4E3VA 1TCMA 4NJKA 1DQXA 2Z2BA 3UYIA 2CU0A 5A5WA 4OIFA 3VGBA 5D9PA 3SY5A 2UY2A 1WZKA 4HU8A 4AVFA 4PUWA 3W7JA 3PN8A 4NJGA 3CHVA 4PTNA 4J3UA 3BQ6A 3CZJA 2R8WA 1UZDA 3VTRA 1OX6A 3M07A 4NHVA 3SIZA 1H7XA 2HBVA 3KOFA 4ZTXA 3F4VA 1JDCA 2QAPA 4PUMA 2DVUA 2XGIA 4AZIA 3TNOA 1QK0A 1VEPA 2FDSA 4JHZA 3N9SA 1GG0A 3WNKA 2OJPA 4OUIA 3LV5A 5KMYA 2Z2UA 3KCLA 2QJHA 4AD3A 3FJLA 5CJNA 3HURA 1RH9A 2Y5EA 2C16A 3QMRA 4D6DA 4FLRA 4XKYA 1B3WA 4WOQA 4HOZA 2ISDA 1HX0A 1NP2A 2O9OA 2WAGA 4G6CA 1FCUA 1W2PA 3UWVA 3A3WA 4DNMA 3EOSA 2NQ5A 1JZ8A 4DHGA 5DX7A 2BOFX 3EA2A 3WCZA 4JDYA 2YL9A 5DLCA 4E2VA 2QZRA 1PIIA 1QMLA 3TYDA 3HQPA 1EXPA 1HP4A 3LPGA 3EX6A 3UXDA 3THUA 3GG8A 2C6QA 3WDHA 3KW3A 3FGCA 1OQFA 1E0XA 2E6AA 3DN5A 4WCJA 4HVXA 4GX8A 2R1MA 5BWAA 1XCWA 4DEFA 1F07A 2Y24A 5F2GA 3U8GA 3CTLA 1XBVA 1SGJA 4IP4A 5H6HA 4B5TA 2QF7A 3KZPA 3TJ4A 4UTWC 5GPRA 3QHMA 3C2EA 4CEXC 1J9YA 1DL3A 3URNA 3O0KA 1UR3M 1GNXA 2D2HA 1Q6OA 1XUZA 4HGXA 1RA5A 1S2WA 3I7RA 2DY3A 3VD3A 4YIWA 3BTNA 1W54A 5FF3A 5BXTA 3U2ZA 3UGRA 2ZX9A 1ISZA 5ABFA 2X8RA 1KM6A 2GJLA 2OFJA 3GAKA 2VR5A 2J9XA 3RHGA 3ARRA 1KXHA 4KEVA 7REQA 2G3NA 3EWZA 1X97A 3SY1A 3F7JA 3I68A 2DP3A 2V9DA 3BOXA 1GOXA 1EWEA 3KVJA 4FNUA 1K9DA 3LLFA 2YLLA 3HGRA 1DWAM 2OZ8A 3EPNA 3VIPA 3UU0A 3E3HA 3L2MA 5MHBA 5LIUX 4E2OA 3TP4A 2XIIA 5AN7A 5IDZA 3W1MA 4PMQA 1XLLA 3NSXA 4R27A 3N9RA 4LYQA 2EG8A 1L2UA 3GDBA 4C7GA 4B16A 2QR6A 4YU1A 4UTFA 1R7AA 3R6IA 5I7GA 2P10A 1X1NA 4JTCA 1J0YA 5CGQA 1BGAA 1RLCL 4IP5A 4NVTA 1Z8AA 5EGRA 1CGWA 3IRSA 3B40A 1BQGA 4UFMA 2UY5A 2FPVA 3NPUA 1H1NA 4PEKA 4GYPA 1RP9A 3GVQA 3CH9A 1KTNA 2PWEA 3V5FA 1NWRA 3GXTA 1K7EA 4G7EA 3WH9A 1PZ1A 3FYPA 1QNQA 3ANVA 2WJEA 2A2IA 4J9JA 3MKVA 1I9CB 1H7OA 2FGLA 4WVXA 3LXBA 1EB3A 4LY4A 3WENA 3HG5A 5KINA 2I1OA 3DZ1A 1GQLA 3N25A 1XD1A 3JRKA 1RV8A 4O18A 3SR7A 1EYWA 4DO4A 2XFWA 3KX6A 5CG0A 1E5JA 5LHFA 3CMFA 3UBPC 2PWVA 5M2FX 3G1DA 1Y0EA 4WKHA 1JFHA 3F2BA 4KFNA 3VIMA 3U2EA 4JTRA 2YYUA 1PKLA 4MWAD 4HHLA