4UXDA

2-keto 3-deoxygluconate aldolase from picrophilus torridus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
MYKGIVCPMITPLDAHGNIDYNATNILIKYLEGINVDYLFPMGSTGVFPYFTLKERKDFLKFVRENSKKPIMAGVGSSSINEVNELMKFSMDIGIEAAVLMPPYYIKLNQEAIYHYYKEILSSNDMDLLIYNIPQFTNKIDPETVKNLKSEFSSVKGVKDSSADIRGFMEMLSLSDDDFAVFQGQDDLLFTSLELGASGGVCGTTNFSDGIVRLYHEYKNNREMALKIEKNDVIPLMKKLGKYQFPNAYYEYFYKKNNINGGYRPPMYRVGIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-DEHYDRO-3-DEOXY-D-GLUCONATE/2-DEHYDRO-3-DEOXY-PHOSPHOGLUCO
publication title Insights into the Substrate Specificity of Archaeal Entner-Doudoroff Aldolases: The Structures of Picrophilus torridus 2-Keto-3-deoxygluconate Aldolase and Sulfolobus solfataricus 2-Keto-3-deoxy-6-phosphogluconate Aldolase in Complex with 2-Keto-3-deoxy-6-phosphogluconate.
pubmed doi rcsb
source organism Picrophilus torridus
molecule tags Lyase
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uxdA00
4N9BA 5BOOA 1EP2A 2VEPA 1HO1A 3L66A 5FF3A 1YXYA 1O95A 2WJZA 4QQ3A 3S5NA 4N6FA 3DKJA 1BTMA 3HGSA 2Z6IA 3GDMA 2JKAA 2JKEA 2ZZ2A 3O1NA 4PEKA 3USBA 2QCDB 1S5WA 3RMJA 2DJLA 3VKJA 2AGKA 3GYEA 3N9RA 3R8RA 1V7YA 4LC8A 1ZNNA 4WXZA 3BVJA 3RNDA 4DO5A 3LXBA 1KLYA 2V2HA 3T55A 3NZRA 2YZRA 4OV9A 1QMLA 5I3JA 1Z42A 3WK0A 1RQBA 1OFEA 4O19A 2NV2A 1WBHA 4DF2A 4R33A 4QSHA 4IMFA 1N8FA 1GZGA 4EVZA 3QEZA 1VH7A 1GTEA 4XQ6A 5HNRA 2C18A 3E49A 1TCDA 4FNUA 1EA0A 2HS8A 1IGSA 3S5YA 1WXJA 4ZQMA 4PCFA 3L67A 3EB2A 1WQ5A 3GKFA 3TMLA 1FUYA 1HL2A 5TIMA 5DELA 3TAKA 1ME9A 2NLIA 1A53A 2OT0A 2PRHA 4PFMA 2WSYA 2OMAA 5D02A 4ORMA 3IGXA 3M5XA 3P61A 1LZOA 3F4WA 4S2BA 4RZ5A 5D2TA 5HWMA 1M6JA 4GNJA 2J6XA 4RCXA 4MYAA 1O5KA 4M6QA 1Q6RA 1JJKA 1YXDA 4LY8A 1EX5A 1WDWA 1PHQA 1H7PA 3OVQA 4JYEA 3KVKA 1WAUA 1SO4A 2GQ8A 3NXFA 3W83A 4MFEA 4U28A 3NL6A 1AK5A 3TUUA 3FA5A 4YMZA 1H1ZA 3HPZA 3L5AA 3G18A 5C54A 3EKLA 5F4XA 5D37A 3I7QA 1OYBA 1H7RA 4J9JA 4RLIA 1TPDA 1RQHA 3LI0A 3CPRA 1KFLA 1LCOA 3EX1A 1SPQA 3OVPA 1YTDA 1OX6A 1JUEA 4WX2A 3ZWTA 1HO4A 2NXHA 2Z2UA 4QIUA 5DY2A 3D0CA 3W87A 2FB2A 3DKLA 4K39A 1OFBA 2Y70A 3W70A 4QAIA 2YFNA 2ATSA 1H7OA 1BWKA 4AWTA 4IMCA 1UJPA 3DFSA 3SFKA 3L0KA 2R14A 4IX0A 1FDYA 1FDZA 4Z0SA 3O07A 4A22A 4BK9A 4G1KA 4OHQA 1GJPA 1H62A 3RF9A 4BI5A 3A22A 4OV4A 5LZLA 1AW1A 3VE7A 3T44A 1EP3A 4UFLA 5LNWA 3IGUA 3LHVA 5D30A 4O57A 3DFOA 1AL8A 1ICQA 3ELFA 2E6YA 2C1HA 2B7QA 4GWEA 3O06A 3W1LA 1EP1A 1P5BA 4O50A 5GVJA 4UNLA 4O13A 4HPXA 3PAJA 3U6WA 5BMWA 3BK0A 2B7NA 1TQJA 5D03A 1W3NA 3STGA 3TC6A 4CQ9A 3DFQA 3TQKA 5J5RA 1GG1A 4O1AA 4FX8A 3IIZA 1SFLA 3DFNA 1F76A 1JCJA 4JTIA 3M43A 1R2RA 4RR4A 1VC4A 1TPC1 3GXPA 3FLUA 1K7FA 2QCCA 1FWNA 2IQTA 4PH6A 1F05A 3W7RA 1FCUA 1F6KA 1FXPA 3LOTA 4UTJA 4Z1DA 3QMSA 2NXIA 1ZCOA 3DGRA 2H8ZA 3GX9A 2QEZA 4HHPA 1NSJA 1H50A 2YGYA 2QF7A 4WZHA 3LHWA 4MUZA 4R34A 1YPFA 1LRTA 2YYTA 1I2NA 2JKPA 4I7UA 5HMSA 1G4SA 1TTJA 3W1RA 2GJLA 2O7QA 5U7SA 1V5XA 4DQWA 2CLFA 2FJKA 2PURA 3MI2A 3W7OA 2TYSA 1OABA 1T96A 1P4CA 5AHIA 4JTFA 1R47A 1L6YA 2Z6JA 3WK1A 5MHBA 3W3OA 1BWLA 1DVJA 3FFSA 5I3KA 4NX0A 1LLZA 4HNNA 3R5EA 2BXVA 4LS0A 1B3OA 4MYXA 3CQ0A 1OX4B 1A5SA 4LNYA 3FYPA 4XTDA 3HPSA 3I6RA 4P61A 3PSVA 1F7BA 1YXCA 3B03A 3HGOA 1JCMP 4FEZA 1DOSA 1XFBA 3NVTA 5CSRA 5D2XA 2VFGA 4K38A 2BZNA 5F4WA 2W79A 5DY3A 1LTDA 4LUIA 1F2JA 3FIGA 5AC8A 2WNNA 3UY7A 3N3MA 4UTTA 2VFIA 3GK0A 1RV8A 3O16A 2OCZA 2E6FA 4QNEA 3BG3A 1TPWA 2ZRXA 1TJRA 2J9YA 5BNKA 3M16A 4FF7A 4ADUA 3NQGA 3CT7A 3W88A 3EWXA 3NNTA 2QCNA 3W74A 2E5DA 1UCWA 2HTMA 4JYFA 4N4QA 4BI6A 2WV8A 4WXYA 2ISVA 4DEFA 4MY8A 2ZA1A 4WJEA 4KKXA 5DLCA 4HN4A 2G5WA 4S1FA 3TCEA 1H7WA 3FOKA 2OZ0A 4XKYB 1DHPA 3I7RA 3WK3A 4HNTA 4CCEA 4DF1A 1GVFA 4X9SA 4RZ6A 2PC4A 3CEPA 3TMQA 2I14A 3NQ6A 2QDGA 1TPH1 3EWUA 3P74A 1SSDA 3NAVA 4Q33A 3ZFHA 5E1QA 3RLUA 3ZWSA 3SY5A 3W7PA 4POCA 4Z1AA 1YTEA 3BGGA 4IGHA 3N19B 4RZ4A 2QDHA 4Q32A 3CU2A 3GIYA 4JTJA 4ICNA 3R89A 2XFWA 1ZY9A 4JEQA 2V82A 1I4NA 1U5JA 3TXVA 1B57A 4FNSA 2RDUA 4RXGA 4K37A 4UFJA 4DO6A 3LLDA 3TFXA 3EXTA 3LDVA 3NQEA 4IX2A 4ZZ9A 3W7QA 1IF2A 4DBEA 2WSRA 3M5YA 4AAJA 5G2IA 5G5IA 4GJ1A 4CLMA 2YPIA 4ML9A 5DCEA 3W2UA 5I3IA 2UV8G 4UC5A 4JTHA 4Y96A 5AYYA 1EWDA 2AQWA 2Y6ZA 4JX6A 1Q6QA 2DZSA 2XN2A 2GOUA 3R13A 1EEPA 5EKYA 2QCFA 1DJNA 3L2IA 2FPTA 4JY8A 2LLEA 3SR7A 3M1ZA 4Z0JA 1GYNA 5CZTA 1KTNA 3P8IA 4LW7A 4GUGA 4GRSA 3LCFA 4XWUA 3G8RA 3SIZA 3SI9A 3V1PA 4ADTA 1Q45A 1KM0A 4O12A 1SO3A 3LHYA 3TSBA 3CEUA 4JTKA 1FBAA 5KZEA 2Y7DA 3KXQA 3NO5A 3S9YA 3NOEA 3C6CA 4CQ8A 5K4ZA 3GDRA 1LRNA 4IMGA 2ZRYA 3G8EA 4O1DA 1WBJA 3BLEA 2A6LA 2V9DA 5F1UA 3H55A 2J88A 2E5CA 5K3VA 1CI1A 3LV6A 1JCYA 4O18A 4JICA 4NNBA 4AHOA 3MBDA 3MYOA 4JNMA 1YDVA 1IXOA 4DPPA 3NPXA 2CLEA 2QCLA 2ZZ5A 4PC8A 4TX9A 4MY9A 3QSTA 5AC7A 2QCMA 3PULA 1TPEA 5L6UA 4GBUA 3G1YA 3WJWA 1E51A 2Y62A 4MZ1A 2TRSA 2F7FA 3EXSA 4Z08A 3W86A 2QJIA 1LM1A 3CLMA 3IRDA 5EA9A 1JRCA 3EX3A 4JTGA 3S1VA 3CHVA 3W75A 1TMHA 4HKPA 1QPRA 3LCHA 2ZZ3A 4FNQA 3C2VA 1TTIA 3STEA 2VOMA 2VEKA 3W7EA 4CCCA 1KBIA 4KFPA 3FKKA 1TPUA 1LLWA 2YX0A 4BWLA 4R53A 1TJPA 2ALDA 2GQAA 1XM3A 4WD0A 5LGZA 1H7NA 5K9CA 1KFEA 3KAOA 1ONRA 1UASA 4MJMA 3EX2A 1UBSA 2R94A 5FF7A 2VENA 1H1YA 3V75A 1VYRA 3LLFA 1OG0A 3OBKA 3GZ3A 4IOTA 2O7SA 2X1RA 1JCLA 4FB7A 2VEMA 1FX6A 3W76A 3N73A 1WOAA 4UUIA 5KINA 1L6SA 4K6AA 3W23A 3G22A 3A5FA 2G97A 5CPLA 3HJZA 2E6AA 4N9EA 5CG7A 1KFKA 1JRBA 4LVAA 3THQA 5KITA 1C29A 3UWUA 4HT3A 2TSYA 1SZGA 4N4PA 1NEYA 3OIXA 1G6CA 1PHWA 4NJHA 4O53A 2CLOA 2WQPA 2P10A 3WJSA 1KM3A 3NQ8A 4M7SA 3M6YA 4AF0A 1OJXA 3RLVA 2CLIA 3NL3A 3NQCA 4IPJA 2A85A 5FEZA 1TYGA 3NA8A 4JIPA 2ZCGA 1XL9A 1W8SA 4MOZA 1KM4A 1Y0EA 2KZHA 1GVQA 3DU0A 5AHNA 1A50A 5F1VA 5HQEA 1K03A 4BF9A 5KMYA 5I3FA 1SU5A 4O1BA 5DXXA 5EBUA 1W5PA 1TV7A 1YTKA 3T78A 4Z1BA 4IJBA 3DENA 3O8AA 2DZVA 2RH9A 2CZDA 3C2RA 3N34A 1UB3A 1W3TA 1KTCA 1QO2A 3K30A 4OGZA 4YL2A 3OA3A 1WX0A 1AW5A 3HGJA 1A5BA 4NT0A 1I2RA 1OFOA 3P84A 4O15A 4Q4KA 3T7VA 3NZ1A 5H2ZA 3DI1A 5C2XA 5EYWA 1EIXA 1JULA 2C14A 3BGJA 3UXAA 3KVLA 3E12A 2E5BA 2P0OA 3IVUA 1RZMA 2CLLA 3F03K 3L0NA 5LSMA 4N9CA 3DHDA 3LGEA 2RDTA 1DJQA 3TA6A 1KV8A 1TV8A 1SW7A 3E0IA 4ZQPA 1SR9A 2A7NA 2XN1A 3G3MA 5AFDA 3WJYA 5F2IA 3T40A 4L4MA 4RK8A 3TE9A 4M6PA 3HO8A 3JS3A 2A0NA 3RFAA 1QCWA 4AXKA 5D32A 4Y9AA 3M47A 2CLHA 3C3NA 1SFJA 1OK4A 4IPIA 4MY1A 1OYCA 3S1WA 1W54A 4X22A 4LUJA 2R91A 3PB2A 3TAOA 2RHGA 2X1SA 2BLEA 2JK2A 1ZALA 2FIQA 2PRMA 2BWGA 2Y61A 5LNSA 5EY5A 4O28A 1FCQA 4GUJA 3B05A 5C6MA 1THFD 1TRIA 5G2WA 4FXSA 1VPXA 3W1XA 4OWGA 4JN6A 5FF2A 5E93A 4AEOA 1KLZA 1W5NA 3PUOA 1GVRA 2E6DA 1VCVA 1SUXA 5K4XA 3FEMA 4QISA 2J9XA 4AHPA 3NQVA 5BMXA 2JGYA 3G1XA 4JD4A 3M41A 3W1NA 5LNVA 4FIQA 3NR0A 3STCA 5CZSA 4NZFA 4UFHA 1HG3A 2QUTA 3UPWA 2J27A 3Q94A 3MMTA 1VHNA 1WYIA 4E2DA 2EPHA 1RR2A 4ZQCA 5AB3A 4RXFA 4HSNA 2X1TA 3F1QA 4EF8A 4N9DA 3IIPA 5BW6A 3QFEA 4I7WA 1F6PA 1H5YA 3IIOA 1WA3A 2YW4A 3G0SA 1VYPX 4NZJA 3SGUA 4FNTA 3G1HA 3B0UX 1ZAHA 3M9YA 5KSWA 2NUXA 4QM1A 1LDCA 4LU0A 3W7JA 1OFQA 3NL5A 1PL9A 1TV5A 3KX6A 1QPNA 4UTKA 2C15A 5FF4A 2ZZ1A 3BLIA 3HG5A 3W2NA 4UTWC 3VFLA 3N9SA 4P2VA 1XCFA 1XBVA 3B0PA 2CU0A 4UMAA 1VS1A 2QUVA 3W1QA 4M5PA 1B4EA 4FIRA 4AWUA 1IXPA 1OF6A 4H4IA 3W2KA 2Q3RA 4E38A 1QWGA 2ZYFA 4UTIA 3G0XA 3W1AA 4K8EA 3C2EA 3JR2A 4UFIA 3W2LA 1GEQA 3SECA 3UNDA 3M7WA 1ADOA 5HINA 1MEWA 3G1AA 3GXNA 4S2CA 1VR6A 4AMAA 3HOJA 3KRZA 3MHUA 5G1TA 3UXDA 5AOUA 3DI0A 1XDLA 1N55A 1AG1O 2VEIA 4DELA 4LVGA 3B04A 4UFKA 5C5YA 5HJLA 4NJGA 1LBLA 3P62A 1NVMA 2QAFA 4OBTA 3G24A 1MEHA 3GNDA 1BEUA 2BSLA 3UZ5A 5G2HA 3HMJG 3T4CA 1DL3A 5KZDA 1G4EA 3BW3A 3TW7A 3W7HA 1VZWA 1ICSA 4JDBA 3PS7A 3W7CA 2W0UA 1X8FA 1Q6OA 4LV4A 3TQVA 5LHEA 3W7NA 3UWQA 1YYAA 3H54A 4TIMA 2Z0IA 4LS2A 1MZHA 4K7VA 3AO0A 1QO5A 5I3HA 5HWJA 2C16A 5AHLA 3INPA 5IBXA 3CB8A 3KVJA 5FESA 3QZEA 1I45A 3C61A 2VFHA 3SJ3A 3FS2A 3G1VA 2VKZG 1G7VA 1ME8A 5EPDA 2WKJA 3NQFA 1ZJIA 5LHFA 3R12A 1T99A 3QQ1A 1OVDA 3W7LA 3P7YA 3W84A 1RQEA 3JRKA 5K9DA 3W1UA 4UTMA 4JYDA 5K9XA 4NVTA 5DBTA 3S5ZA 4EOUA 1RPXA 3FJLA 3HPXA 5ABTA 3P8JA 2R8WA 1KW1A 1NAL1 1X6UA 4UTLA 3N14A 3NPUA 2RKXA 3CWNA 2DP3A 4O10A 1MO0A 1DKWA 1YPIA 4ONVA 2P1FA 5LNUA 1FXQA 3MI3A 1SO6A 3NQDA 5T26A 4UR7A 4A29A 2OT1A 3TKFA 2WOQA 2VFFA 4IWWA 5TQLA 2E68A 2NUWA 2A7RA 2WPBA 4C1KA 1K7EA 3F4NA 1OK6A 4HNVA 5I3GA 3S8HA 1XI3A 2FLIA 1DQWA 3EWYA 1P0NA 4LTSA 4AF0B 5EL1A 4ZMGA 4LC6A 3W2MA 3BPWA 5D33A 1S3HA 2BX7A 4PTNA 1TSIA 5CPNA 3EWWA 3SSJA 3W7DA 5HWNA 4TU1A 1ALDA 1K8ZA 1XKYA 2F84A 3TSMA 2FQIA 2C3ZA 5FEXA 4H3DA 3SZ8A 2QCEA 3WK2A 2ISSA 1RVGA 1PCKA 3HG3A 4XZ9A 3LERA 2YCEA 3LCGA 4K7YA 3QPZA 3VE9A 2V30A 2NXGA 3PSWA 3QMTA 1ICPA 1LBMA 4JTUA 1TQXA 4XTIA 5HUOA 4ZQOA 3P67A 4A3UA 4MPQA 1KV5A 2ZTKA 3MO7A 2ZBTA 3LHUA 4A2RA 4JY9A 1I2PA 3CIXA 1SZNA 1A5CA 3IGSA 1VCFA 1U83A 3GDKA 2B4GA 3M5VA 4DBDA 3W7GA 1C9DA 3L21A 4WQ6A 3ABQA 1OHLA 1RD5A 3QW4B 1F74A 3MYPA 1KFJA 3TIMA 3KVMA 4RKAA 1W0MA 2W6RA 5CPOA 3LXCA 5DCDA 1O60A 3LHZA 4M7TA 4YLWA 4BFAA 3B0VC 2CW6A 3H53A 3C8FA 1R30A 4WUIA 1HUVA 2A21A 3EEGA 3PY2A 1GTHA 2A4AA 5KZMA 4E2BA 4MLRA 2GVLA 1Z48A 2RFGA 1X7FA 1G7UA 2Y63A 3UZJA 4JDYA 1XUUA 1W5OA 4GE8A 1IXQA 1G4TA 2VC6A 3ABRA 1B9BA 3A24A 3UWZA 3TDFA 4NJKA 4KWVA 5DBUA 5FF0A 4UTHA 1D3HA 3I68A 2VFDA 1PCWA 2NX9A 4LS1A 4OE7A 5KTLA 3GDLA 3WJXA 2QJGA 3S42A 3MHFA 3NQ7A 3BG5A 1GYLA 4NX5A 1G4PA 4UTUA 5CZJA 3LRMA 3W22A 4RX0A 4JS3A 3HB9A 2YW3A 4QITA 4Y90A 2G95A 3PC0A 4CNOA 3QSRA 1PIIA 5DCBA 3RU6A 1L2UA 3G1DA 3QC3A 3IIVA 2ZZ7A 1K8YA 2B7PA 2H3DA 3KOFA 2WO5A 3P5ZA 1W5MA 4UXDA 4JR5A 4LV9A 3TSDA 4Z1CA 3TROA 4XUGA 2Y88A 3HF3A 4O17A 4HNUA 1OX5A 2Z1BA 5EMUA 3MUXA 1JVNA 4A2SA 3NEVA 5CKSA 1B4KA 1JUKA 2XN0A 2VXNA 3NG3A 5DXYA 6ALDA 4WY0A 3Q2DA 2CZFA 2VFEA 1JQXA 1H60A 3TV8A 3P60A 1M7OA 5CGQA 5HULA 3LTYA 1HFBA 1QFEA 4NUWA 3PBVA 3PUDA 4O0ZA 4E0CA 3S1XA 2NX3A 1KFCA 3DFTA 3BARA 1MXSA 2AAMA 4GXMA 2CZ5A 1HTIA 4QNWA 1W5QA 1P1XA 2QCHA 2V2DA 2NUYA 4O4WA 4FHAA 4I7VA 3Q37A 4A21A 3C2FA 2EF9A 5HUPA 4IMDA 1QAPA 1LBFA 1TB3A 3NM3A 3TU9A 1TO3A 3PG9A 1SSGA 3O6DA 3RK8A 1XUZA 1N7KA 3TW6A 4PL2A 2E1DA 1K02A 3MW7A 5AHEA 1EUNA 5D04C 3HBLA 3Q58A 1O5XA 2Q8ZA 3GAYA 4OU1A 2Y7EA 5D2YA 1LOSA 1GVOA 4B5NA 2ZRVA 3PG8A 3S5OA 4UIOA 2ATMA 4LT9A 2NV1A 3CWOX 3UY8A 5HR7A 3PVFA 2EHHA 3ZR4A 3LCLA 4WY0F 4GUIA 1XDMA 3DBPA 5E0KA 1FCVA 1MEIA 1M5WA 2PE4A 1IXNA 2YYUA 3U2OA 4CNPA 4MFDA 2ZRWA 2ZRZA 3G3DA 2ABAA 1P0KA 4AVFA 4UCGA 1I2OA 2WNZA 3QRHA 1KM1A 2QCGA 5C55A 1TPVA 1IIHA 4AH7A 4ORIA 1TREA 2X2GA 2CLMA 3OVRA 2Q8LA 2Q3OA 1H7XA 1I2QA 3A9IA 2PCQA 1Z44A 3TK7A 1PVNA 5G4EA 3QMRA 1W3IA 2YFOA 1I8JA 1EWEA 4O16A 3BW4A 3TJXA 5L9FA 3G0UA 1VCGA 5AYZA 8TIMA 4YCOA 3W7KA 3AJXA 4I9AA 2D73A 1FWTA 3MBFA 4DF0A 3HGRA 4MLJA 3QH2A 3W85A 3G1SA 3TXZA 2ZTJA 1FWSA 4QJ1A 3QQ0A 5AC6A 2VELA 2FPYA 1QPQA 3VI2A 1ZHAA 2ABBA 5LKYA 4CNNA 4FNRA 3W73A 3SGZA 2HMCA 3W2JA 1X1ZA 3TR2A 5D09A 3LRKA 3N2MA 2V81A 4HIBA 3GB6A 3DHFA 5AHFA 4NU7A 1K7XA 2QUUA 1T8XA 4IXHA 3NGJA 2B0MA 3W7IA 2ZDRA 2NZLA 4Y8FA 4H6KA 4Y6GA 1SW0A 5D05A 5BRBA 2QAPA 3ATZA 3NQAA 1VQTA 3TQ0A 3DH7A 4M6VA 3W71A 4NQ1A 5K2ZA 1M7PA 4PA8A 5FEWA 2NWSA 3C0JA 3HIJA 1KA9F 1ZAJA 2ZA2A 3QW3A 1ZFJA 2J9ZA 4CCDA 1BKSA 3QF0A 4GUHA 2X16A 3IIXA 1W37A 3LBCA 2I1OA 1ML1A 4JXCA 2C19A 2H3BA 3ZS4A 3IEBA 2QKFA 3LCIA 5F2GA 3C52A 2GVJA 2ZA3A 1AMKA 1J2WA 1YADA 3UPBA 2CZEA 3B4UA 3L0GA 4N2YA 1AW2A 3TNOA 3WFAA 1KM5A 1NF7A 5AYXA 3EX6A 4DO4A 4UNKA 1QR7A 5F4SA 5A8GA 3W72A 3G1FA 1OFPA 3MP3A 4MIMA 3W1PA 1JQVA 3QPYA 5K7JA 1CX9A 1QPOA 1ZAIA 4ADSA 4JTLA 4EIVA 2GJNA 2C0AA 2Y7FA 3LCXA 4RJEA 4RV8A 1LROA 1ZENA 2EAWA 1O94A 2FPVA 4JIQA 1SZEA 2DZPA 1CW2A 1FQ0A 2EKCA 1UUOA 4NXSA 3NYZA 3MHGA 3PUEA 1JCXA 3DAQA 4O8RA 4AB4A 2DJXA 3LB0A 1NFBA 2Y89A 4MZ8A 3P5YA 5D2VA 4UMCA 3I65A 2OX1A 3BO9A 1J4EA 5HR6A 2I9EA 4GUFA 1VLWA 5A5WA 2DORA 4WOZA 3BG9A 3QYQA 1XBYA 3DXIA 4LWWA 2QCDA 3WJZA 3PR2A 2ZRUA 2ZZ4A 5D2WA 1X1OA 4O54A 4NJJA 3B8DA 2B7OA 3LXAA 3GR7A 3E9AA 2A6NA 1SO5A 4O1CA 3LM7A 4X3ZA 1F73A 3GR8A 2YXGA 2V8ZA 3W7MA 3NQ2A 2V5LA 2V2CA 1SW3A 3DFPA 4EWND 5IBXC 4OT7A 3UYCA 4UTWA 2TPSA 4K36A 1XC4A 4IMEA 1QOPA 3A5VA 4UTTC 3NDOA 4N02A 1VRDA 1OFRA 1DBTA 3N2XA 3THAA 4NJIA 2QJHA 2ISWA 1TPFA 2RDWA 1QOQA 4K8HA 5LGXA 3EWZA 4EF9A 4MVAA 1LYXA 4LVDA 4LRSA 3HG4A 1LRQA 1S5VA 3KFTA 2CLKA 1S5TA 3SW6A 3FKRA 1WOBA 4UMBA 3UD6A 3P80A 1SQ7A 3EXRA 1EUAA 2EGZA 1DV7A 2JGQA 3MWAA 1KFBA 3EWBX 4ZQNA 1TIMA 1KTBA 1WV2A 3OG3A 1Q3NA 3I7SA 3ABSA 1VLIA 4NXKA 4ALDA 1Q6LA 3NQMA 3CM4A 2GPTA 3TH6A 2WSQA 1W56A 4JGDA 4NNCA 1FCBA 5CSSA 3PM6A 6TIMA 1FWRA 4LRTA 1VYSX 3W9ZA 3UQNA 1GG0A 4HPJA 1O4UA 5FI8A 3PBUA 1FDJA 1YDOA 3YPIA 1OF8A 3ABOA 1H51A 2C6QA 1GQNA 4WY0B 2YSWA 3VCRA 2DU2A 1W31A 3EX4A 3P82A 1D9EA 3GXTA 1F5ZA 5AN7A 1PE1A 3TFCA 4R7JA 3GLCA 5F2MA 3FJ6A 4WOQA 1EB3A 2H6RA 3LBMA 4DXVA 4OQVA 3MP5A 1NF0A 1XBXA 2Y85A 1TTQA 3QM3A 5G1YA 1YDNA 4DPQA 4GC4A 2DZTA 5DN1A 2PRLA 3NM1A 4TMBA 2HS6A 3QJAA 4L4LA 3M44A 1FWWA 4HSOA 1K8XA 2TMDA 2DZXA 1GOXA 1A5AA 1EPXA 1Z41A 4JTSA 1DORA 2FDSA 3NPVA 3ATYA 3W6YA 2HSAA 1VJIA 2ZFAA 1SZFA 2Y7GA 2A2IA 2E77A 1JCNA 2GUUA 3HQ1A 2A5HA 3PBYA 1GWJA 1XXXA 3BV4A 4W9TA 1W1ZA 2X1UA 3IVTA 3O15A 2FTPA 4O11A 1C8VA 2CWNA 4KFNA 1D3GA 3B06A 4FNPA 1R2TA 5U4NA 3LTPA 1GT8A 3S1UA 2ZQ0A 1LOQA 3C2OA 3MI6A 4ZL1A 2JBMA 3C56A 4AWSA 3BLFA 3E02A 4MZYA 5F2LA 3O63A 2OJPA 3O05A 5TBOA 1AL7A 4JX5A 3UWWA 3W1TA 4UR8A 4PODA 3TJLA 3PF3A 4N6EA 4D2JA 5J5DA 4JX4A 3IVSA 4PL1A 5CZ0A 3HG2A 1OYAA 1TRDA 1J5TA 2V5BA 2BTMA 4O14A 2CFFA 3P81A 3KHJA 3EKZA 3OHIA 5D38A 2DZUA 1L9WA 3LV5A 1QDSA 3A23A 5LNRA 4TMCA 3L65A 3S6DA 2G96A 3L5LA 1L6WA 7TIMA 2NWRA 1LP6A 5H91A 4YXGA 4JTTA 2ZZ6A 2WNQA 5FEPA 1PV8A 3PBWA 2A7PA 3R2GA 3IV3A 3GNNA 3CTLA 3KRUA 3UWYA 4YWIA 3LHTA 2NX1A 4BR1A 2E09A 4GFSA 1DQXA 4ZQRA 1GPWA 1QNVA 2YDAA 3VNDA 4LOCA 1JUBA 1LOLA 3O6CA 4BWLC 1KM6A 3GAKA 2YR1A 4JTEA 1OFAA 5G4WA 4U4MA 1VHCA 1JR1A 3MP4A 1K3UA 1R46A 5SWUA 4YCPA 3M0ZA 3M5ZA 3PB0A 1OX4A 3BW2A 1T0OA 2H8XA 3L9CA 3OEXA 3MJYA 3TX9A 4XBSA 1GVSA 3TC7A 4CQAA 2A1YA 1YLVA 3W07A 3GKAA 1UUMA 1VGAA 3KRSA 2X30A 4MKNA 1TTPA 3ANYA 1R2SA 3FYOA 3NPWA 5AHMA 4TO8A 3PWAA 3LCWA 4UFMA 2H90A 1KM2A 3NL2A 3CIWA 1FY6A 2J24A 3W1MA 3LRLA 4LVFA 4AHQA 1IIGA 2V0TA 1MSSA 1ME7A 4XBKA 1TPB1 5IM51 1LORA 2GQ9A 1OFDA 2QR6A 4O0KA 4NNAA 4O52A 4BI7A 2DZWA 1G67A 4KFOA 3GDTA 3U8GA 3O6YX 3DZ1A 3GVGA 2GVGA 2C13A 4IUOA 4C1LA 4FXRA 3L68A 3LI1A 4MJZA 5CPMA 2FFCA 4LVBA 3STFA 4FX7A 4O4VA 3C4UA 4XKYA 2FB3A 3S0CA 1KBJA 3LTSA 4TR9A 3CC1A 3E96A 4M19A 3UWVA 3A21A 3L5MA 1H63A 3LX9A 4IQLA 4X2RA 1G69A 4FX6M 4IXXA 1H61A 4KWWA 1XBZA 4FO4A 4ZVJA 1PS9A
chains in the Genus database with same CATH superfamily
4N9BA 1FWEC 5DMMA 3L66A 5FF3A 1YXYA 3NJ3A 4K68A 5BXTA 4E8CA 1VBRA 2PD9A 1S5WA 1J5SA 2Y24A 3A12A 2UWFA 3VA8A 2HDJA 4AZBA 1BQCA 4AD0A 3R8RA 2DSVA 1V7YA 4EK7A 1E1CA 1ZNNA 4DO5A 3WH7A 3SB0A 5ABFA 2XU2A 3LXBA 1ISWA 1BYCA 5D9NA 2FHFA 3NZRA 4XAZA 1WZLA 1Z42A 1QI0A 4WDTA 1RQBA 3CAQA 1X8CA 3MU7A 1WBHA 3PHAA 2ZWZA 4EXQA 4NZ3A 3C3UA 2ZX5A 1FHDA 3BTNA 4LX4A 3L12A 1GZGA 2GSHA 3WQPA 4HA4A 2C18A 5RUBA 2HS8A 1IGSA 2PCEA 3STPA 1WXJA 4ZQMA 4X61A 4KEVA 4GNKB 4D6DA 1R7OA 3F7JA 3TMLA 2JEPA 2Q71A 3T6CA 3QTGA 2ANUA 3ITXA 5CZKA 3P61A 4HZMA 3WNPA 2BODX 4S2BA 4RZ5A 2UY4A 1F8IA 2J6XA 4RCXA 4MYAA 5CSUA 6REQB 3ARSA 2OPJA 1R0MA 1VPQA 3U7BA 3BSGA 1BG4A 2VNCA 1PHQA 3PJUA 1JDEA 2WC7A 3OVQA 3ABXA 4Q22A 2YXOA 3KVKA 4W8BA 3WQ8A 4J3WA 2V5CA 3CGTA 4XSLA 5FOOA 1Q6FA 5CH9A 1JAKA 3CMGA 1AK5A 3QHOA 3FA5A 3HPZA 5C54A 3O6AA 3EKLA 4R7OA 5D37A 1A3WA 4AYGA 4RLIA 3LI0A 1EXPA 5JH1A 1AD4A 4H7CA 1WZAA 3PTDA 2OOFA 2ZUNA 1LCOA 3A4XA 1YTDA 5M03A 3ID7A 1W1VA 3S9IA 1U33A 1LF1A 3MV01 4LYQA 3CASA 3OODA 5DY2A 4EPKA 3W87A 2FB2A 3DKLA 1R5YA 2QVHA 1OFBA 3DYOA 1PDZA 1YRRA 5LIKX 1KGUA 3PZVA 2HVMA 2YFNA 2E40A 2WKGA 4AWTA 4IMCA 2Z1SA 3UJ2A 3L0KA 2R14A 1F3XA 3UU0A 4AX6A 1LQ0A 4C5ZA 4DIAA 5A8MA 1GJPA 4IJCA 4OBSA 4BI5A 4OV4A 5LZLA 1OSEA 2NT0A 1IWBA 1EP3A 5LNWA 1Q2SA 2VD9A 3GHSA 1SFSA 3ZLGA 2PDWA 2B7QA 4UZSA 3O06A 1ELSA 2VGIA 2CESA 3BK0A 1TQJA 2OLSA 5D03A 1W3NA 3STGA 3DFNA 1F76A 4M8UA 3M43A 1R2RA 1VC4A 3ARQA 1Z32X 3GXPA 4XK2A 1K7FA 4ZO7A 1FWNA 4K3ZA 3DIPA 4PH6A 2ZX7A 1VPYA 3MMUA 2NXIA 2H8ZA 4EPDC 2WHMA 4QBXA 1LRTA 2YYTA 2D20A 2JFEX 1TUFA 2JKPA 3ARXA 3CHCA 1TTJA 1QW9A 3FVMA 3GXIA 4AZCA 3T1GA 4GA8A 5TAOA 3WK1A 1UA3A 1BWLA 4DJFA 3FFSA 5I3KA 3MUY1 3R5EA 2WZEA 4LS0A 1V0LA 1OX4B 4LNYA 4XTDA 3FAWA 3HPSA 5A6TC 5MKGA 1Q6CA 3WLQA 3PBMA 2GYIA 4RNHA 5ENLA 5F4WA 1VRXA 4K8GA 2JEQA 1XS2A 3FIGA 2NSXA 1FFRA 4B92A 2GVEA 3MWCA 2WNNA 4AIBA 2AAAA 2VFIA 3R6IA 4U5KA 4C7DA 3VGFA 3BG3A 1GGOA 3LZ3A 2FVMA 4ADUA 3W88A 3NNTA 3W74A 4E6MA 2VR4A 4S3DA 2HTMA 4N4QA 1V3MA 2Z00A 3M0LA 2WV8A 2ISVA 4DEFA 2GSJA 4KKXA 3PN8A 3MCMA 2G5WA 1OY0A 1P1MA 2OZ0A 4XKYB 1QHZA 4HNTA 1GVFA 3VGGA 2PC4A 4LALA 3TMQA 3WQ6A 3GC5A 4PUKA 2YDSA 1TPH1 4M6UA 2UBPC 3AXHA 3W7PA 3GYCA 4RZ4A 4IQDA 4GX9A 4JKKA 3GIYA 3OYXA 4JTJA 4JQ1A 5EB8A 1XH2A 3VX1A 4LBRA 3WD2A 1I4NA 1U5JA 4XAYA 2RDUA 4K37A 4UFJA 5EMYA 4CN1A 1F6YA 1RP8A 4ZEPA 4BA0A 1UWAA 3TYZA 3KOXA 4IX2A 3W7QA 1IF2A 4QG8A 3RCNA 2XUCA 4GJ1A 5DCEA 5I3IA 2NQZA 4UOJA 1L6FA 4UC5A 4JTHA 4KRTA 4CN6A 2FMNA 3TEVA 4ZOEA 3R13A 2QCFA 4BCEA 4WDWA 4JY8A 4Z0JA 5CZTA 3HZ3A 4GUGA 4GRSA 4XWUA 2DQWA 5E5CA 3AYSA 3V1PA 1EOKA 2XGZA 1KM0A 3GG1A 3ALFA 1SO3A 3LHYA 2XISA 3EDDA 4S3BA 4JTKA 4IPNB 1M7XA 3S9YA 3RGTA 3H22A 3C6CA 2W61A 2PEVA 3G8EA 4O1DA 3BLEA 1ZUAX 2A6LA 3UCQA 3UR7A 3AIWA 1YIXA 2ALRA 2CYGA 1DXFA 3GHUA 4FA3A 4O18A 5JQ9A 4I9TA 1O1ZA 1VFMA 3BSHA 2P8CA 1Y5XA 3IS4A 2CLEA 1XD0A 5GNXA 1RCOB 1PSCA 2BVWA 3K1DA 3QSTA 2QCMA 1V02E 1VFTA 3PULA 1D3CA 3VIPA 3QFWA 5REQB 4LCQA 1E51A 4JIHA 3A47A 4KRZA 3CNYA 4Z08A 3WMLA 2G3IA 1LM1A 4LANA 3S1VA 3W75A 2FVKA 1TMHA 1G94A 3ALGA 3A64A 4R85A 2VEKA 3CXOA 1T6MA 1TPUA 1R38A 1PB0A 2AKMA 3SN0A 4C6FA 2ALDA 1HNYA 4WD0A 1OZQA 5K9CA 1KFEA 1UBSA 5FF7A 1C90A 3AQUA 3KZPA 1CXEA 3LLFA 1MFVA 1F4AA 1Y5WA 2JF6A 2YBTA 3U2ZA 1JCLA 3KL3A 3EPMA 4A3RA 2R1PA 1VD6A 4GACA 5KINA 4C5YA 3W23A 3RAOA 3W6MA 2ZICA 5CPLA 4AY8A 5KITA 1C29A 4QJ4B 2TSYA 1UPMB 3GVRA 1PTAA 4UQAA 1NEYA 1H5VA 4GQQA 4O53A 2HE8A 5CCZA 4PTDA 1UWQA 3ARUA 4L56A 4AF0A 2CLIA 2A85A 1TYGA 4JIPA 3FGCA 4URIA 1W8SA 4MOZA 3B4YA 1TJ2A 2OO0A 1YNYA 1VBUA 4BF9A 1XINA 1UWIA 2C71A 1SU5A 4E5TA 5EBUA 2AKZA 4PMXA 5C70A 1YTKA 2WVTA 3QC0A 4HB7A 3DENA 3SRFA 3C2RA 3OBEA 1W3TA 3BLDA 4NHVA 1J0ZA 3VKDA 4CQCA 3OA3A 4V2XA 4J35A 3P84A 1T8QA 3WSUA 3F4VA 3DI1A 1PTGA 4GJIA 3VD3A 1YE4A 1XG3A 5I7GA 2E5BA 1XJBA 2GFTA 2P0OA 4H9YA 4U2ZA 3UA4A 5T9CE 3L0NA 2VQTA 5AYBA 1T7LA 3URAA 3T2QA 4ICMA 3TA6A 4QG9A 2BOEX 7REQB 4P8UA 5F2IA 5D8WA 2CCRA 3O7UA 4L4MA 2VCBA 3P14A 2FGZA 1MNZA 4HK6A 2WMHA 1JGMA 3WF0A 1GOKA 1QCWA 2WHLA 3WFZA 1ZZMA 4MY1A 2C0HA 4X22A 3SQMA 1J79A 1JI2A 2E9BA 2G3FA 3VZXA 4XAFA 2BXYA 1UKPA 2WMKA 3UCCA 3AHXA 2PGRA 1ZALA 2FIQA 3GU1A 4CEUC 2PZ0A 5LNSA 2PTWA 2C1GA 3AWOA 1QRQA 3VOFA 4OWGA 4AEOA 1KLZA 1GVRA 2OWCA 1JZ2A 3ZLHA 4IL2A 1ECQA 2YL6A 1YW1A 1CT5A 3OLDA 2Z2BA 2VI0A 3FEMA 2J9XA 3FHAA 5HAOA 5BMXA 2JGYA 2EJAA 2QV5A 4JD4A 3Q4DA 1Q63A 3NR0A 4QE5A 3STCA 1IEWA 4UFHA 4CD7A 1O68A 2O9TA 3UPWA 1XRSA 1WYIA 1B30A 1ONXA 2XIOA 1BF6A 2EPHA 4E8GA 4N7QA 2X1TA 4N9DA 5BW6A 5M3WA 2RUSA 4I7WA 1F6PA 1DXEA 3ITGA 4REQA 3WH5A 3W38A 4RW3A 3G0SA 3B0UX 3LBOA 3ZJ7A 1JFXA 5D8ZA 1LDCA 1NFGA 5DRCA 1PL9A 2GGHA 4D8ZA 1TV5A 4JPGA 4W4QA 1PWMA 4UTKA 2C15A 5FF4A 2R6OA 3ZVHA 3N9SA 1W8GA 2VDIA 2HVNA 3OG2A 3MMDA 3FEQA 3ZO9A 4JIIX 1V8EA 1ISZA 3F2BA 3W1QA 3RPDA 3K8MA 1B4EA 4FIRA 2GLKA 3GY1A 1OF6A 1VJZA 4XD5A 1XYCA 4WSJA 3TWBA 4UTIA 4YTUA 1WKDA 3WNMA 1BLIA 4AVOA 3CUJA 1AFSA 3W2LA 3SJNA 3OLIA 2WB5A 3HMCA 1MEWA 3KDOA 1FH7A 3G1AA 4C6PA 1QK0A 3CIVA 1VR6A 3HOJA 4JNYA 3KRZA 3MHUA 2YCKX 2ZKMX 2E25A 4GKLA 3RR4A 2QULA 4KEUA 3BXWA 3B04A 3KZSA 4NJGA 1XIGA 2PA6A 2XJ7A 1MEHA 3UZ5A 1BEUA 4DUXA 3IJIA 3HMJG 3T4CA 3BW3A 1ICSA 3PS7A 2CITA 4DUVA 3CL6A 5LHEA 3W7NA 3LPPA 2DZBA 3H54A 4TIMA 4K7VA 2CBJA 1DWGM 3M46A 4FR1A 3AO0A 5I6SA 2VC9A 5I3HA 3FDGA 5BU9A 5IBXA 5FESA 4LUYA 3QZEA 1K6WA 1I45A 4YU1A 3SJ3A 2WQDA 4ZO9A 4PCTA 1GKRA 2R1NA 1K9FA 4PZVA 2WKJA 3NQFA 3R12A 1T99A 1E5NA 3W7LA 1XYMA 4A6GA 1GJUA 4MB1A 2G3JA 3WUEA 1RQEA 2Z7GA 5K9DA 1UA7A 3ZMRA 4QLKA 4CVUA 3LS9A 4JTRA 5K9XA 2GGIA 3S5ZA 4XBJA 3FJLA 1XICA 1UC5A 3CUIA 4I9MA 3BMXA 3DHUA 1VEOA 4Z2IA 3U5UA 1GHRA 1V02A 3P8JA 4C6OA 1KW1A 1QUMA 4UTLA 3N14A 1JG9A 3MCNA 1MO0A 1DKWA 1JZ4A 5H6HA 4G8TA 5C0QA 2XWDA 3N6JA 2QW5A 5CC3A 7A3HA 1SO6A 4GZIA 1C8XA 1R3WA 2YDRA 4A29A 4PYSA 4C65A 4XKMA 4XSMA 4I5XA 1K7EA 3F4NA 1OT2A 4NRRA 4JZ5A 1XI3A 1M03A 2FLIA 4IM4A 3WNOA 4ZMGA 4CU6A 1PKMA 5A2CA 4ZOCA 3BPWA 2CEQA 5D33A 1S3HA 3EOUA 5HWNA 4TU1A 1ALDA 4H3DA 5H1WA 3WK2A 3K4AA 4B9ZA 2GDVA 4IH3A 2C7FA 3LERA 2ZE0A 1IZKA 2GJRA 3AAMA 3RM9A 1GVIA 3O2LA 1GUVA 4ZQOA 3KHDA 3WQOA 3P67A 1TX0A 4BEQA 3W24A 2ISDA 2ZBTA 1WAWA 4JY9A 1A5CA 2X40A 3IGSA 1U83A 4EANA 3M5VA 3WMBA 2GWNA 1C9DA 1YDYA 1OBAA 3THDA 3QR1A 3ABQA 3MUIA 4JEJA 3K4WA 3BANA 2WNWA 1ZS2A 3KVMA 1XLIA 5JBEA 3I4EA 1UH4A 1O60A 4YLWA 4JOMA 3WD4A 1LL4A 4BZYA 4XV0A 4WUIA 4AWEA 4BQ2A 3M7SA 3FYYA 4QSFA 4E2BA 4CD8A 1E4IA 1UKTA 4I6VA 4H00A 1XIMA 1S2WA 1FWAC 1AUSL 1W5OA 1LQ2A 4Q8VA 3PZIA 1R9XA 1XYLA 4RPPA 5DBUA 4P7NA 1PAMA 1MZRA 1FOBA 2PDIA 2YCIX 1R9YA 3KL0A 1V3KA 1WP6A 3WNLA 1PCWA 3ABZA 4OE7A 4D72A 3OBAA 1ZBWA 3SCNA 3S42A 2E9LA 4NX5A 1G4PA 1MQRA 2EKGA 3URBA 3W22A 4C60A 1W9XA 3F5JA 1TG7A 2HK1A 3WBXA 3A3WA 1MW1A 3QC3A 3L4TA 4UQ9A 2Z26A 2H3DA 1P6WA 4D6JA 1W5MA 4IP4A 3TROA 4AZIA 4XUGA 3HF3A 1XIBA 2WZHA 5IFPA 1QVBA 2QIWA 4L1GA 3B8SA 4DWSD 4QR6A 4AXNA 2ZVIA 1K1DA 1NELA 4F79A 4FR6A 4HYRA 2QHAA 3TV8A 3LTYA 3E1F1 3PP7A 4JBRA 5H8PA 2BGNE 3IJ8A 3CQJA 4PUWA 3MT1A 3PZMA 1XQLA 2V2DA 3IAPA 1XCWA 2PU0A 4O4WA 4FHAA 1B90A 4I7VA 3Q37A 4GY1A 4HQVA 4A8IA 1UUQA 1NQKA 2EF9A 2QNEA 3DEQA 2O9OA 1LBFA 3NM3A 5B7ZA 1Y7VA 3DDMA 5A94A 4ERAA 4US5D 4LYRA 4TXEA 1EUNA 1KCXA 1WUEA 3LSCA 3AMDA 3E0LA 3GWQA 1Q66A 2Y7EA 1EC8A 1UIPA 4Q4MA 2ZRVA 2ATMA 4MKVA 4DX3A 2PP0A 1FWHC 2NV1A 3UY8A 2R1MA 5BXSA 4DWSB 3LCLA 2VEFA 1XDMA 2DIJA 4X60A 1UD3A 1FWCC 2A3AA 1EJUC 1MRQA 1IXNA 2YYUA 3U2OA 4RDYA 2HBVA 2ZRWA 2ZRZA 2PDQA 5I79A 3RX3A 1CGTA 1P0KA 4AVFA 1HJVA 2WNZA 3QRHA 1KM1A 1P7TB 3B40A 4FLQA 4MSSA 5GQBA 4JN7A 1H7XA 4LAOA 3QV8A 1PVNA 4ACZA 4LF2A 2PMQA 3BZGA 1E0TA 1EWEA 4O16A 3PWGA 1IT0A 3ARTA 2PB1A 4YCOA 4QEEA 4LBSA 3ORWA 2D73A 1NDVA 3MBFA 4L9YA 4H01A 3AXMA 3G1SA 2XZ7A 5EMMA 1UKQA 5CQ1A 2D2OA 5AC6A 3VI2A 3RRAA 3SGZA 2HMCA 4J2MA 3QGVA 1V93A 3R0DA 1DJXA 1MQQA 1UJQA 3URNA 3MKVA 1N82A 5HNNA 1R3QA 1K7XA 3G2GA 1V4YA 1HKKA 4PFHA 3NGJA 1NY1A 1Q4NX 2GSEA 2R9RA 3CQKA 3VOGA 1SW0A 4WK9A 2ZUUA 2HV5A 1VQTA 3W71A 3LN3A 2A3LA 2XVNA 3EKGA 1UZHA 4ZFMA 2PWFA 1QXLA 1Q7QA 1M7PA 1XD1A 4X0VA 3FV9A 2GUBA 1YX1A 3MVIA 3WLTA 1UD2A 1QK2A 2IKIA 2J9ZA 4CCDA 4GUHA 3EAUA 4PRWA 3UXKA 3R8GA 1CGWA 3EMCA 3CZKA 3IEBA 4XVDA 2GVJA 1IGWA 4ATWA 2VMFA 1YADA 3ARYA 3SCSA 3T0CA 1AW2A 3MSDA 4IJRA 1NF7A 5AYXA 2V67A 3EX6A 4DO4A 1ODZA 5F4SA 1XIDA 3G1FA 3H7UA 3AYVA 1LLOA 4M24A 2XVLA 1S2TA 4AD4A 1B3YA 3ITCA 1CX9A 2DW7A 4F3HA 1PZ0A 2C0AA 4MMWA 2Y7FA 3VCCA 1V6UA 1LROA 3RYSA 3FA3A 1IZJA 4JIQA 4DWSC 2EKCA 2EPKX 3NYZA 3N18A 3PK7A 4DO7A 3VD5A 3L23A 4AB4A 1V3IA 3S2MA 3LB0A 1C93A 2Y89A 3I65A 1HX0A 3WQVA 5CJMA 2QYGA 1CDGA 2I9EA 5FSEC 5KEZA 1XGZA 3UEQA 1EJRC 3H21A 3NZGA 5A5WA 4CNTA 4WOZA 1HIZA 4MJ2A 2YLAA 4MJ4A 3PR2A 2ZZ4A 3WL1A 1KXHA 1E15A 4O54A 3T08A 4NJJA 4ICCX 3B8DA 4ES4A 3GR7A 1MQPA 2VUNA 4O1CA 4X3ZA 2V63A 1UP0A 3PNUA 4LEFA 9RUBA 2MANA 4H2HA 1AQMA 3ONCA 4Q8PA 5E0FA 4QS5A 3FNDA 3AUJA 2J8GA 1VRDA 1DBTA 3SCQA 2ISWA 1TPFA 2RDWA 4ACYA 3OGRA 2OSXA 3HFYA 1EFZA 3EWZA 1LYXA 4LVDA 1S5VA 1M1BA 4UMBA 1WOBA 3UD6A 4GXWA 3QQWA 1DV7A 1KFBA 1US2A 1TJ1A 3OGVA 3T8LA 3R43A 2GZXA 3OG3A 1EZ2A 1UR4A 5CEWA 3ABSA 3OPSA 1B3VA 3CUGA 4DJDD 5FJIA 3H12A 3K5XA 2GPTA 1W56A 4JGDA 1FCBA 5CSSA 4J3UA 2HISA 2PC8A 1NDWA 4LRTA 2CXGA 4I8DA 3W9ZA 1GG0A 3UQNA 1PKYA 4OUEA 2F6XA 1YBQA 1OF8A 4FZIA 4ZXLA 1H51A 2C6QA 4Z17A 1XYZA 3VCRA 4DHGA 4DVOA 1W31A 1REQB 3BOLA 2PP1A 3EMQA 3ZT7A 4K1GA 3RM4A 4HCDA 4FMVA 6TAAA 4MB4A 1PTDA 4GIAA 4RW5A 3FJ6A 2PDGA 1C9WA 4KQNA 1DJZA 1NF0A 2SFPA 2Y85A 1TTQA 5G1YA 3K8LA 1BQGA 2PRLA 3NM1A 4GO9A 3F2DA 2HS6A 3N4FA 3M44A 4HSOA 1EJVC 4PULA 1K8XA 2TMDA 1HVQA 4BF5A 5AZ0A 1FWBC 4RPQA 4JTSA 3M0MA 3SN1A 2XH0A 4V15A 4WCJA 6CGTA 3B8TA 5G1MA 1NWRA 1SZFA 4GOAA 2A2IA 3RO6A 1JCNA 3N6QA 2FYMA 2PDLA 4DUOA 2WVVA 4WF7A 2HPMA 2X1UA 3IVTA 4O11A 3RLHA 2IS7A 3CZEA 5A6BA 2PGEA 3WH9A 2DFAA 2INFA 1L6GA 1GT8A 3NDZA 4KIRA 3BMVA 4Q8TA 1UD5A 5FAGA 4AWSA 5F2LA 4QDMA 3O05A 2X05A 4KWOA 2GOKA 3W1TA 4UR8A 3BLLA 3PF3A 4NP7A 1UR9A 3IVSA 2VL4A 2WBGA 4GQGA 2EPLX 2CFFA 3EKZA 5D38A 4W86A 4DNMA 2NVCA 4NL1A 1DTUA 4TMCA 2BVDA 3T9PA 5BU6A 2G96A 1L6WA 3TTYA 1UZDA 1SJDA 3AALA 4PUEA 1PV8A 2A7PA 2WHJA 3ZR5A 1F61A 3UWYA 3OJGA 3V4BA 3E2VA 4YWIA 2PAJA 3MDWA 3LHTA 2NX1A 1UZ1A 1XP3A 1J0JA 3PPHA 1RJQA 3ARWA 4GFSA 3UA3A 4FLRA 1BVZA 4ZQRA 2O56A 3VNDA 3GS6A 1MUWA 1P0BA 4BWLC 1W1YA 4MG4A 2PODA 4JTEA 1JR1A 1EGMA 3MP4A 4J3SA 3RXZA 1ZLPA 1IT7A 1EYEA 1VB9A 3VTRA 4YCPA 1VFFA 1LUCB 2VZUA 3M0ZA 3M5ZA 3L9CA 3AU6A 3IACA 1EGZA 2QVNA 2VURA 4I5RA 1FH8A 4W89A 1UUMA 2BNJA 1POJA 2EJ1A 2E28A 2AMGA 3GUGA 3KRSA 2X30A 1HZYA 4UZUA 3UBPC 1ONEA 5AHMA 4TO8A 3GTNA 4DYKA 1F4HA 2FMOA 4W84A 3PFRA 3KS5A 4G5DA 4Y2WA 4F2BA 3NL2A 1FY6A 5JXQA 2YL9A 1A5KC 3GTXA 3LRLA 3BMWA 2IPGA 1IIGA 2CKSA 1ME7A 3J7HA 3H24A 9XIAA 3P3BA 1LORA 3RPTA 3IV8A 1BVNP 4DJDC 4KH2A 2FZDA 3EA1A 5D4YA 3V0UA 2DZWA 1G67A 4IGSA 1W2PA 2CZVA 3TJIA 4W5UA 3RILA 5LIUX 1PEZA 1QNPA 2FFCA 4FOUA 4F8XA 3S0CA 1TFVA 2BGQA 4FLSA 2D0FA 4TR9A 1PZ1A 3N13A 4EXBA 1UC4A 3TYUA 1H61A 2YDQA 1TMQA 1X39A 1K9DA 5BOOA 2PTYA 1EX1A 4JFVA 2J8FA 1GONA 1O95A 1GQIA 1XH1A 3OZPA 4JN8A 2JKAA 2JKEA 3VIFA 5DMNA 4PEKA 3GDBA 2DJLA 3ZLFA 1PUDA 1Q6DA 5BXRA 2XH4A 4IHCA 3OA5A 5M17A 1MNSA 3BVJA 3RNDA 3T55A 1ZJHA 2Y5EA 5I3JA 1JPIA 4AZ7A 4E8DA 4YVVA 4LF1A 4Q7NA 2YJQA 6ENLA 1KBKA 3SCRA 1SGJA 4RNIA 2O4QA 5HNUA 4R33A 4PBEA 4IMFA 3TOYA 1HP4A 1PXGA 1N8FA 4EVZA 3QEZA 2BY2A 2Z25A 3E49A 3EWDA 3TTOA 1X97A 2IKHA 4EE9A 1EA0A 3S5YA 3EB2A 1WQ5A 1S38A 1V3LA 5DELA 3V36A 5C9RA 1A53A 1HGYA 2OT0A 2PRHA 5D02A 3E2QA 3F4WA 2GQ3A 1VBHA 1RD6A 5D2TA 4GNJA 2X42A 4ZB5A 3WD3A 4MNMA 4M6QA 1GK8A 1E72M 1EX5A 5BZAA 2PDUA 4RL3A 5EMLA 4L9ZA 2PDXA 4HYWA 1E4LA 3MANA 4MB5A 1KD0A 2VX5A 3NO1A 4HPGA 3RG6A 2GQ8A 3NXFA 4DWDA 2NVDA 3SRKA 3W83A 5ECVA 4MFEA 4UQDA 4KWUA 4J27A 2FZ9A 4O0QA 1CGVA 2BY0A 3L5AA 1AQ0A 4H7ZA 1H7RA 4J9JA 1UKSA 2RAGA 1PJ9A 2QDDA 4LCRA 3DHPA 3CPRA 1KFLA 3EX1A 1FHUA 3OVPA 1M01A 1OX6A 1J0IA 3AMCA 4YHEA 2Z2UA 3DERA 2GJXA 2Y70A 3SFWA 1FVPA 4QAIA 2ATSA 1R86A 4AD1A 1GZJA 3MDUA 3O0KA 3U3HA 5I24A 1GCYA 4Q6JA 4GQRA 4JQ3A 1ITQA 4BK9A 1NM9A 4OHQA 2ZX6A 4A3HA 3WBEA 4KCVA 3WELA 3MJMA 3WLLA 3T44A 2Q09A 3GNPA 4IFOA 1IT8A 3LHVA 3GTHA 2X7WA 4O57A 3WLIA 2P53A 3DFOA 1ICQA 3RCMA 5TF0A 1JI1A 3JW7A 2DUAA 3W1LA 3TLQA 1EP1A 5GVJA 4UNLA 1ZTVA 3PAJA 3U6WA 2B7NA 3IWPA 3TC6A 2QGHA 1P0EA 4FX8A 4NZ1A 3V5FA 2Z29A 4HU0A 1AQFA 2PWUA 3SUTA 1WE5A 1JCJA 1EXBA 4EKJA 1IR2A 1JZ5A 4L6DA 3S1GA 1XRTA 4DJED 4L7ZA 3EDEA 2IPFA 1JF6A 1FCUA 1F6KA 3LOTA 4UTJA 4Z1DA 3DGRA 1CEOA 4Q3MA 3GX9A 1NSJA 2YGYA 4R34A 1I2NA 4H9MA 4ZE5A 3W1RA 2DSZA 2PURA 3LQGA 5AHIA 1KWKA 2OLAA 2Z6JA 3CYJA 4TVUA 4PN2A 4H8NA 3WENA 4MADA 1OADA 4NX0A 1LLZA 3G1RA 4MYXA 1RUSA 3UG5A 3GNRA 3B03A 4GY0A 1KKOA 1H1NA 4FEZA 1XFBA 5CC5A 3VIGA 3WLPA 5D2XA 4K38A 3IJ6A 4IICA 5DY3A 3BICA 1CGXA 1F2JA 4JTDA 2CBVA 2OU4A 3ENLA 2OCZA 1YE6A 2E6FA 4QNEA 4GI6A 3G6LA 1TJRA 3B97A 3RX4A 4GFIA 1R3SA 2DT0A 3CT7A 2QCNA 4LAZA 4ERGA 2OR2A 4NAEB 1UCWA 1E9ZB 4BI6A 3S2CA 2OOGA 4MY8A 5DX7A 1JXKA 4HN4A 3BL3A 4XO7A 3CUZA 2DIKA 4QG6A 3I7RA 2DPEA 4CCEA 4QLLA 3WQWA 4MWAB 2I14A 3NQ6A 3Q65A 2QDGA 3P74A 4PMNA 1UWUA 3GHRA 4C90A 4POCA 2YBUA 3WUGA 5CPTA 4Q32A 3ZT6A 3S9ZA 1HKMA 2C79A 3R89A 6XIAA 1B57A 3T42A 4RXGA 4I5UA 1O6IA 1EF3A 4GGBA 3LDVA 1E1CB 3PZTA 4QE1A 3FW6A 3ZVIA 4DBEA 5ABFB 5A1AA 1UBPC 5G5IA 3BUVA 4ML9A 5EMKA 3W2UA 2UV8G 3D3FA 5XIMA 2VD8A 5AYYA 2ZXQA 1FTXA 3H7RA 1JYXA 4JX6A 1HGWA 5EKYA 1KB3A 4LW7A 1DXIA 3LCFA 4C1NA 1WKYA 2WZTA 3G8RA 3SIZA 1TMLA 3VAVA 1Q45A 2G37A 4O12A 4CU8A 3KRBA 3GXDA 2VRJA 3GH7A 2GGEA 5G4HC 3E5BA 3VOJA 4PE8A 3NO5A 3NOEA 4CQ8A 1TVPA 2Z7KA 2BVYA 2DSWA 3GDRA 4H83A 1JZ3A 1MW0A 4F9JA 4L61A 1IYXA 1W6TA 1XLMA 4O1EA 5HMFA 4ZOBA 3E6EA 4XZMX 2D0GA 4JICA 4NNBA 3MBDA 4CVWA 3VM7A 1YDVA 1IXOA 4Q4OA 3CB3A 1EC7A 4CQBA 2ZADA 4HU8A 1EC9A 2QCLA 3PZUA 4MY9A 4PBGA 1TPEA 5L6UA 2E0PA 1X7IA 2WM1A 2O4MA 2F7FA 2WCAA 3HQOA 3REQA 2E1WA 3M07A 4MWAC 1XLHA 3QV9A 5EA9A 3CHVA 2ZZ3A 3AIRA 3AIVA 4GKTA 4PB4A 2VOMA 2BOGX 2J79A 3W7EA 3FKKA 3VGHA 1WO2A 3R0UA 5BWFA 1BPLB 3CQHA 4BWLA 4DLFA 4IFKA 5LGZA 1H7NA 1ONRA 4MJMA 2HZGA 4YVXA 4FOKA 2VENA 4Y9MA 1H1YA 2BY1A 1E6NA 3V75A 1VYRA 1KWGA 2D69A 3GZ3A 1DWHM 1PDYA 3POCA 4A3YA 4IOTA 1J0HA 2O7SA 2WMIA 2VEMA 2I7GA 5FJPA 1L6SA 3ONBA 4K6AA 1KGXA 3G22A 3WLSA 2G97A 3N9KA 4PSRA 3HJZA 4AVNA 1A5LC 4LBUA 4N9EA 5CG7A 4DJFD 4HT3A 1AJ0A 4GQ0A 1G6CA 1T40A 4NJHA 3K4DA 3WJSA 3NQ8A 4JTAA 4M7SA 1BTCA 3M6YA 4AY1A 2UY5A 1OJXA 4W8AA 1VIZA 2WWCA 4KERA 3MCOA 4DI9A 1XL9A 1KM4A 1Y0EA 3DU0A 3L4WA 5AHNA 5FJOA 1K03A 2R1LA 5E9AA 4U5IA 5I3FA 2ASHA 3ANVA 4M56A 1TV7A 3AXXA 1HL9A 4MUPA 3O8AA 2RH9A 2VUYA 1D8CA 2CZDA 1UB3A 1KTCA 3JUGA 3G77A 4OGZA 4YL2A 1WX0A 1AW5A 1J6OA 1A5BA 1OFOA 4O15A 1RCQA 2PFHA 2VDGA 3NZ1A 3R4IA 5H2ZA 5C2XA 1CXKA 1JULA 1O7AA 1V79A 4AZCB 4PCNA 2V38A 3IVUA 4GH1A 3F03K 2F2HA 3MUCA 3DHDA 3LGEA 4V1YA 2RDTA 1PPIA 2W62A 1A0DA 4JFTA 1QTWA 1OCNA 1PWLA 3T40A 1XLGA 4RE2A 4M3PA 2E8YA 3LD5A 5C2CA 5MKGB 3TE9A 1QBBA 1L0PA 3FXYA 4M6PA 3HV9A 3RFAA 1GQKA 4AXKA 5D32A 2V5JA 3M47A 1HKJA 1FHLA 1O5QA 1SFJA 2HK0A 3F4CA 3KOWA 1OK4A 2WAGA 4L80A 1EBHA 1OYCA 2Z4GA 3QY6A 4QGCA 1JZ8A 2R91A 2ISFA 4ASTA 2GJPA 2EQDA 3PB2A 3TAOA 4YIWA 2BLEA 5XINA 3UG3A 2DSUA 1WCGA 3M0VA 1FCQA 5AVHA 1NDZA 1THFD 3HTWA 2FJUB 1W5NA 2VCCA 2E6DA 3SCPA 1SUXA 1A47A 1N2VA 3U0HA 2BBFA 4AHPA 3NQVA 4RDVA 1XLJA 2XSBA 4G1NA 3M41A 3W1NA 4FIQA 5B7YA 5DEZA 1MDLA 1ZGDA 4EPEC 5FJJA 2WJEA 2QUTA 2IKGA 1QASA 3JU2A 1D7KA 4AD2A 1A4LA 3TZFA 1RR2A 1TV4A 5AB3A 4W93A 1S1PA 4EF8A 4E4UA 1A5NC 1UR1A 1H0GA 5EMJA 2NQHA 4B5XA 2W3ZA 2YW4A 1DJHA 5C71A 1EL3A 4NZJA 2IMRA 3SGUA 3G1HA 1EQCA 2YA1A 3IUDA 1EIBA 3QBUA 2NUXA 1EHAA 3W7JA 4XISA 3NL5A 1G5AA 1AH4A 3KX6A 2XHYA 1QPNA 2XTKA 4PCSA 2ZZ1A 3BLIA 1K4HA 1RAKA 1QW7A 3BAKA 4L1XA 3VFLA 4KGJA 1JXJA 2NQ5A 2VRQA 4XX6A 1Q85A 1IXPA 4L9XA 5BCAA 4HYVA 3W2KA 4LUTA 3CV6A 2DUXA 3KTSA 1VENA 3PZGA 3MSGA 1GEQA 2EG8A 1KGWA 4DJFC 1MYRA 3R8HA 2GDUA 4UOQA 4A05A 4LY4A 3MC5A 3N2TA 4AMAA 3CAKA 3WBWA 4GIEA 4XIMA 2XM1A 3F5LA 4QS6A 1OIFA 2CERA 4NSBA 4S3GA 1N55A 4WSKA 3EBVA 1AG1O 2VEIA 5C5YA 3K1GA 5HJLA 1NOWA 1M68A 2QAFA 4TTGA 2BSLA 5I09A 4RDZA 4E2VA 5G2HA 3M0YA 3TW7A 4JDBA 2GUYA 2ACUA 3TTQA 4LV4A 1Q6OA 2IXUA 1CTNA 4J3XA 3RRXA 2PDKA 2VJXA 2PBGA 1VKFA 3CMJA 2Z0IA 2XZ9A 1EH9A 3JZEA 1KCZA 3AHYA 2PI6A 2FZBA 5HWJA 5AHLA 3BZJA 4CEXC 4QEHA 2RDXA 2REQA 4K2SA 4HNOA 2Y4SA 2VFHA 3QVQA 4H19A 2VKZG 4H6RA 4NRSA 3SGGA 5EPDA 2PLCA 4J7RA 2E3ZA 4OOZA 3VM5A 2PF8A 3UYIA 3VPLA 3W1UA 1E71M 1UZ4A 1NOUA 2MNRA 3F4DA 3TW9A 4NVTA 3TP4A 4EOUA 1B3WA 1RPXA 3MQTA 4JFUA 7ENLA 3FSTA 3G5EA 2PWGA 2R8WA 1X6UA 2RKXA 3CWNA 3WNKA 1LL7A 2DP3A 4F0RA 4PUMA 3KLKA 4HK5A 4ZSUA 3OTRA 2Y0FA 2VGGA 2OT1A 3CUXA 2VFFA 4IWWA 5TQLA 3CHFA 2NUWA 2A7RA 1E5JA 4C1KA 1KNWA 1MRAA 4HNVA 3S8HA 2YOCA 4GD0A 1TE1A 4AF0B 1H49A 4LC6A 1IHIA 3WEOA 1Z9AA 1DYSA 3ZIZA 4C6BA 4PTNA 1TSIA 3SSJA 3EWWA 3FGCB 3R10A 2CHOA 1K8ZA 1XKYA 3TSMA 2C3ZA 2ADAA 2ISSA 2PD5A 5BXPA 4XZ9A 3VDHA 2FGBA 3ZJ8A 4K7YA 3QPZA 3R7MA 3VE9A 2V30A 2G3MA 5LIXX 4Q4SA 4JTUA 1TQXA 4AFYA 5HUOA 1LL6A 1OC7A 4B4HA 2ZTKA 3SEPA 2ZX9A 3HM7A 1XYAA 3LHUA 3RCYA 1NOFA 4AEEA 1VCFA 3NSNA 3E2SA 5FD0A 4DBDA 3W7GA 3L21A 3ZR6A 3QW4B 2C8NA 2VX4A 3MYPA 1Z3NA 3TIMA 1S2CA 4YVPA 3II1A 3N2BA 3RR1A 1FH9A 4BFAA 3B0VC 2CW6A 3C8FA 1HUVA 3N29A 4QFUA 1GHSA 4JFSA 1SJBA 2A4AA 4MLRA 3ZQ9A 1Z48A 7TAAA 4HP5A 2Y63A 3XIMA 5HK4A 3WO8A 1X6NA 1QOXA 1S2VA 3KBSA 1G4TA 4AUBA 2VC6A 2OZ8A 3TWAA 1O1HA 4ATDA 3F5KA 3TVAA 2J13A 2OQLA 3I68A 1W3HA 3TYDA 4LS1A 2VP8A 5KTLA 1AZ1A 3ECQA 1XF0A 3MHFA 4R27A 1XLCA 3BG5A 4A8NA 3KOZA 4UTUA 3LRMA 2Y5SA 1FA2A 3HB9A 4PR4A 3QZAA 3RU6A 1L2UA 3G1DA 3N12A 3IIVA 2QGYA 1AD1A 4JNZA 2B7PA 4F0LA 3P5ZA 4PMQA 5CJNA 3AMGA 2YLLA 3TSDA 4O17A 5EMUA 3E74A 3NEVA 5CKSA 1B4KA 4I9JA 4AY7A 2ZXAA 5DXYA 3TQPA 1US0A 6ALDA 3VKAA 2I9UA 5M1TA 4EXAA 2ZUTA 4REQB 2ZIDA 1H60A 3WMSA 3BAJA 5KZ6A 1TWWA 1QFEA 1XIEA 1OC5A 3FCPA 1Z7AA 3PBVA 2OB3A 3PUDA 4E0CA 3S1XA 2NX3A 1MXSA 1HTIA 5HMDA 1QI5A 2W9MA 1E43A 2DT1A 3ZVHB 5T91A 1QAPA 2OTDA 1MWOA 4YTSA 3QV6A 3O6DA 3RK8A 4GIRA 1N7KA 3WF3A 4PL2A 2VT0A 3S6TA 1K02A 1K9EA 1Y65A 2Y8UA 5D04C 4CD5A 3HBLA 1O5XA 1EBGA 1U22A 2XG9A 4OU1A 4B5NA 3PG8A 4UIOA 4AZ6A 3CWOX 3PVFA 2EHHA 3H6OA 2BDQA 3KOYA 3E0FA 1PYFA 3VINA 1O66A 1JNEA 1W9DM 1FCVA 1I0DA 4H9XA 3LEPA 1M5WA 1Y5VA 1C92A 4CNPA 3EZ4A 4MFDA 1JDFA 3G3DA 1A5UA 5A2AA 2ABAA 1TZ9A 4IGMA 3WX7A 3CH0A 3EDFA 4YTQA 2KAUC 2XIIA 2XFYA 2CLMA 3OVRA 2Q8LA 2Q3OA 1I2QA 5JUVA 1W3IA 3K8KA 2Z1VA 4WGXA 1I8JA 1AH3A 1B5TA 3H2MA 3BW4A 2J6VA 1VCGA 4K1WA 3VOCA 1G1YA 3W7KA 3AJXA 4I9AA 4YYFA 2QXWA 1AZ2A 1U2YA 4MLJA 3W85A 3UZWA 1ZHAA 2ABBA 3NGFA 4CNNA 1KBBA 1XLBA 5TNVA 3FHQA 2QV4A 2PLJA 3HA1A 5D09A 1XLLA 5A8OA 4UNIA 3O3RA 4X0NA 4HIBA 5AHFA 4B5WA 1AMYA 1DWFM 2EG6A 3U57A 2QUUA 2DUZA 2B0MA 2ZDRA 1TZZA 1ZB5A 1FWFC 4AZ5A 5IFTA 5BRBA 2UY3A 3NQAA 3TQ0A 4M6VA 3SCWA 4CGTA 1YNPA 5K2ZA 1XFCA 4PA8A 4UQEA 1CCWB 2HVOA 4XAGA 4OKDA 1PKNA 5EFDA 3LUTA 1ZAJA 3CUHA 2O0TA 3SCOA 4NASA 3QW3A 2X16A 1YPXA 3IIXA 4R3UA 1W37A 2I1OA 2OVLA 1BVWA 4JXCA 2C19A 2H3BA 4W8LA 3LCIA 3LM3A 3C52A 3RO8A 1HKVA 1IEIA 2ZA3A 2D0HA 2DZAA 3WDQA 3BCDA 4GYKA 3L0GA 2UY2A 2QDEA 4UOZA 1HN1A 1G9HA 4H8UA 3T0AA 1ADDA 2WZIA 5A8GA 4WKHA 3H2FA 1XGEA 3QPYA 3GH4A 3TONA 3OZYA 3WLKX 2GJNA 2JE8A 2EAWA 1DE5A 2FPVA 1FQ0A 3FVDA 4GZEA 4J4KA 1SJCA 4D1IA 3IARA 1LG1A 1PX4A 1NFBA 3P5YA 1DQUA 1XPYA 4AISA 3BO9A 4S3AA 1J4EA 3V1HA 5HR6A 4GUFA 2DORA 1TA3A 1XPGA 4LWWA 3ZM8A 3NZQA 5I5RA 2QCDA 1E56A 3WJZA 2OGYA 3V5CA 2ZRUA 1F3WA 3BDKA 1X1OA 1X6LA 4UTFA 2QT3A 2NQJA 3VNKA 2FGLA 3E9AA 4AD5A 5F7UA 2A6NA 1SO5A 2XFFA 4M1RA 1DPMA 3NQ2A 3PZ9A 2V2CA 1QI3A 3GVWA 5IBXC 4OT7A 3UYCA 1E0XA 1E6PA 2ON3A 1A0EA 4S3FA 1XC4A 4IMEA 1ITCA 3NDOA 3V5OA 3S2JA 4K8HA 2PUZA 5LGXA 4ATLA 3WQFA 3UR8A 3HG4A 1BG9A 3W4RA 2HE5A 5GJMA 2V68A 4US5A 3P80A 1SQ7A 3EXRA 3QLDA 4M29A 1DWIM 4E2OA 3EWBX 4PMUA 4W85A 1WV2A 1TIWA 1Q3NA 2RGLA 2PPGA 3IANA 4IP7A 3RX2A 3H4GA 4NXKA 3SCTA 4ZO6A 2Z1WA 1KXVA 4ALDA 3T4WA 3TH6A 4WKFA 5H8UA 2WSQA 4KPLA 5CGTA 4HOWA 3PM6A 6TIMA 2OG9A 3I3EA 4GYFA 1FWRA 3OU8A 4KGLA 3GD6A 8CGTA 1VYSX 4HPJA 5FI8A 2H9AA 1EO7A 4XZIA 3ABOA 3NDYA 2PP3A 1DWJM 4DB7A 1UH2A 4IIBA 1ZJAA 1D9EA 4MAVA 4H9ZA 5AN7A 2DT2A 3TFCA 3GLCA 4B3ZA 2DGAA 4DXVA 2PWVA 5AC5A 4HZ7A 1XBXA 1YDNA 4DPQA 5A6AA 3KLLA 4L4LA 4PBFA 5C2GA 1UMLA 4G56A 1CXIA 1J0KA 1A5AA 4J2PA 1EPXA 2FDSA 3ATYA 1WDPA 3W6YA 3SN4A 1JDCA 3HFTA 3WDPP 1WKFA 3CHEA 3GG7A 2Y7GA 4KCTA 1E1EA 3UT0A 2A5HA 3ZSTA 3WEZA 4EPBC 1JZ7A 4I8YA 4L6HA 5LIWX 4L65A 1S5NA 1W1ZA 1ZSXA 4J40A 1LWHA 5JH2A 4PB3A 3B06A 5DMLA 4GVHA 1R2TA 1RK6A 3LTPA 4BEUA 3WKZA 2ZQ0A 5I78A 3C2OA 3WLJA 3C56A 3BLFA 4MZYA 3O63A 3U2CA 3C86A 2TAAA 4MM1A 4GINA 1CIUA 2QIIA 4N6EA 4D2JA 4PL1A 1US3A 1OYAA 1I6NA 3S46A 4O14A 2WVSA 3C2YA 4ACZB 2DZUA 1QDSA 3L5LA 1CXLA 4S23A 5H91A 4YXGA 3VNJA 4M1BA 3R2GA 3SUUA 3GNNA 1OT1A 2CC0A 3KRUA 4DLMA 4JL1A 5AKQA 3IUIA 3BAWA 2VC7A 1C7TA 3L4ZA 4BR1A 2E09A 2YDAA 3BAIA 4LOCA 1CPUA 4B5SA 3WL0A 2Z24A 2F61A 1KQYA 4YHGA 1VHCA 1XIHA 3N1AA 3N15A 3BOFA 1R46A 1H2JA 5HJYA 4IQJA 2H8XA 4XBSA 1GVSA 2X0YA 2BHUA 4CQAA 2XM2A 1UD6A 3K46A 1YLVA 1VGAA 3MV11 3DYMA 3VO0A 1FP9A 3FYOA 4DBUA 4UCFA 1NFPA 3PWAA 8XIAA 4IMAA 2QS8A 3WF2A 2HCVA 4FXJA 3TR9A 2YCLA 3GVVA 1KM2A 3CIWA 2F8QA 2EO7A 2J24A 3W1MA 1IEVA 2CBIA 3KWSA 2P3ZA 1PO9A 2V0TA 1MSSA 5AZ1A 1TPB1 2WK2A 3VNYA 2ZUVA 4L5ZA 2POZA 4O0KA 4ZODA 1EJ7L 3P2VA 1CLVA 4WDXA 3U2EA 3XINA 3GDTA 3O6YX 4IUOA 2C13A 4FXRA 3LI1A 2D23A 3STFA 3I6EA 3AHZA 3C4UA 4F9DA 3GFYA 3E96A 2XWEA 1XX1A 3L5MA 1DWAM 2AL2A 4WJ8A 4IQLA 1FRBA 4KWWA 1PS9A 3U4AA 4M51A 2HRWA 1EP2A 2VEPA 1HO1A 1IWAA 2IKJA 2WJZA 2NLYA 3GDMA 1HKIA 2E67A 3GH5A 3O1NA 3QTPA 1RLDA 4HTYA 4LQ1A 3GG0A 5AYIA 3RMJA 3VIKA 2AGKA 1TJ0A 2G4JA 5HATA 2WW5A 4LC8A 2QQ6A 2E7FA 4B2DA 3OB8A 2OODA 4HJWA 2YZRA 1QMLA 2P8BA 5FA5A 3WK0A 5FJUA 4O19A 1EOMA 4KRUA 3BCFA 2NV2A 2P3EA 3B9AA 1KKRA 1CXHA 4NAFA 3AJ7A 4QSHA 2ZUWA 1VH7A 1RBLA 3S2LA 1GTEA 1F3TA 2PLKA 4H8HA 3AIUA 2A3CA 2PGFA 4FNUA 1EPVA 3L67A 1NWSA 3GKFA 1HL2A 4GX8A 2QPXA 4DZIA 4LPCA 4F2UA 1ME9A 4PFMA 2WSYA 2OMAA 4ORMA 3M5XA 1LZOA 4FAMA 5HWMA 1M6JA 1DIOA 1QBAA 3L4VA 3AZTA 1JJKA 4IISA 1Q7MA 3KP1A 3AISA 3EOOA 3KBWA 4UWMA 1DHKA 2ACRA 1GZ1A 3PANA 1WAUA 3ARVA 1SO4A 3T81A 3OLGA 4QCFA 4Z2JA 1FP8A 4V1XA 2D2JA 4ZXOA 3CZ8A 3W0KA 1YBQB 3EDJA 3TUUA 4P5UA 4CNSA 4YMZA 3T0BA 5A6BD 2QF8A 3WQ5A 4TOQA 4NYUA 4BQ5A 4EAYA 1OYBA 1OB0A 1RQHA 1E70M 2PZNA 2XDFA 3QOKA 1HVXA 3R94A 4PGLA 3MKKA 4MGGA 1SPQA 3WH6A 3QY8A 4WX2A 1VFUA 3ZWTA 3VKKA 1BRLA 1TWSA 4HD5A 4QIUA 3D0CA 3KCJA 1OGSA 3W70A 4RUBA 3W27A 5I06A 3A3HA 3C8NA 2OSYA 1BWKA 1UJPA 3Q67A 3B9DA 1WKEA 3GFZA 1FDYA 1SVDA 1FDZA 4Z0SA 4HA3A 4NZCA 4KBXA 5KETA 2WVVB 4G1KA 4IIGA 5FL1A 4KIEA 4V27A 5CBBA 3RF9A 4PRRA 3VE7A 5I03A 5E0CA 4UFLA 1TV2A 5LA2A 2DVUA 5D30A 2C91A 3E2RA 1I9CB 3CS2A 1E6SM 2DH2A 4BQ4A 3ELFA 2E6YA 1MUCA 3CPUA 2C1HA 4GWEA 4Y8EA 5FACA 4O13A 4HPXA 3QGKC 4GJJA 3TQKA 5J5RA 3PWIA 1S46A 3IIZA 5FCZA 1KXQA 2J8TA 4JTIA 4B15A 1JYVA 2EBNA 4RR4A 1TPC1 4AMCA 3FLUA 3L4UA 2HXTA 1QNQA 2GK1A 2IQTA 1FKXA 3W7RA 3LPFA 1GW1A 3NOYA 1FXPA 2HWGA 3RJXA 3QMSA 1ZCOA 4LB4A 2QEZA 1F9CA 4G7FA 1H50A 4YTTA 2QF7A 4WZHA 5A8QA 1U1UA 1PZ2A 3CV7A 3CJPA 4I7UA 4WJXA 2O7QA 1UD8A 5U7SA 4DQWA 2CLFA 1GPFA 3MI2A 3W7OA 2Z1KA 2TYSA 1OABA 1T96A 1P4CA 5BRPA 1R47A 3SY1A 1WDDA 3N4AA 3RPMA 1GQJA 5GPRA 1AJ2A 1A4MA 4HNNA 1JPDX 1DP0A 3RMEA 1A5SA 3FYPA 4AZHA 4P61A 3MSRA 3PSVA 4D6FA 1F7BA 3HGOA 1V77A 1JCMP 1ODUA 3SQSA 1DOSA 3UJFA 4Q4RA 4L6OA 2BZNA 2W79A 1LTDA 1N8WA 1QNSA 1ISVA 5AC8A 1V6VA 3BLKA 5HQMA 3GK0A 3O16A 4DBWA 2F2KA 2ZRXA 2J9YA 2E9MA 4FF7A 4EP8C 1KR0A 1GW9A 2E5DA 4JYFA 4DRSA 4WXYA 2NV9A 2D24A 1H3GA 2ZA1A 1XG4A 2P50A 3M6DA 5DLCA 4Q7IA 3BJTA 3KTCA 3NO3A 4XUYA 1OINA 3S2NA 4AX7A 1DHPA 2QMJA 3WK3A 4DF1A 4IP5A 3VK5A 3CEPA 3NAVA 2OFJA 3ZFHA 4A4AA 4HMCA 1E6RA 3MO4A 4TVCA 3RLUA 4Q8NA 2Y5JA 3N19B 4QTGA 2QDHA 3BCJA 1FKWA 3CU2A 2VOTA 3N6HA 4ICNA 1CLXA 1ZY9A 3H2NA 1TVLA 4O8AA 2V82A 1WDSA 3CTTA 4FNSA 1UMYA 3LLDA 4HU4A 3E38A 3WQEA 3TFXA 1SR0A 3IAQA 3PZQA 1Q13A 1Q5MA 3GW3A 3VNZA 4CLMA 2DQXA 3DC8A 5IDZA 3KL5A 1EWDA 3UG4A 2UZ9A 4XD4A 1TV3A 4EAMA 2Y6ZA 4ZOAA 1Q6QA 2GOUA 2FPTA 2J7EA 4GZJA 3SR7A 2LLEA 4MB3A 2FZ8A 3M1ZA 3N4EA 1KTNA 8XIMA 2INEA 4ADTA 3OOQA 1G0CA 2ONEA 2WSKA 3VZZA 4L4OA 3U4FA 3CEUA 1XCXA 3E0WA 3KXQA 4OOUA 3LA4A 3TYAA 4U2YA 1LRNA 4IMGA 2ZRYA 1BYDA 2PGWA 4C6NA 3MSYA 3H55A 2J88A 3OP2A 2W4XA 5K3VA 1J01A 3ZZ1A 4C7GA 3WYZA 2AL1A 3LV6A 1JCYA 4AHOA 4WR3A 3BC9A 4Q8QA 2ODOA 2VGBA 3Q45A 2WYSA 2QUNA 3ZXWA 1ZBKA 4RE0A 2PDJA 4N0RA 4ZA0A 3NPXA 2VCAA 2ZZ5A 4PC8A 3CH9A 4R9XA 4KF1A 3CAWA 5AC7A 3VXGA 2CWXA 3ME3A 3EOEA 4GBUA 3QY7A 4HTBA 1E6QM 3WJWA 4R5EA 1RVKA 2TRSA 3EXSA 3V35A 3FJNA 4DJEA 1ENUA 4C6DA 3W86A 2QJIA 4WGHA 2FVLA 3EX3A 4PTMA 1QPRA 5D9MA 4FNQA 3AS3A 1TTIA 3STEA 2GJXB 3UR5A 4MNKA 2BP1A 4KFPA 1JPMA 3WDJA 2YX0A 4R53A 1TJPA 4NIRA 3KAOA 1UASA 3EX2A 4Q8OA 2R94A 1JCTA 3NFUA 3TTSA 4IIFA 1GNXA 4PRTA 3A3XA 2WXDM 4RDWA 3VC5A 2FTYA 8A3HA 2X1RA 4FB7A 3JZUA 1FX6A 3SY8A 1W3KA 1P6CA 2EXOA 4IFRA 4Z1YA 2QJJA 4LFYA 3A5FA 5LXEA 3QKZA 1U5VA 2E6AA 2XIBA 1SZGA 4N4PA 4BF7A 1PHWA 1VJSA 2WQPA 4G7EA 4IIDA 2WLZA 4ECLA 2FZMA 4F48A 1BXBA 3WF4A 4XO6A 1WB0A 4IPJA 5AY7A 3PPGA 1I1WA 2KZHA 1GVQA 2PTZA 5F1VA 5HQEA 1KXTA 5KMYA 4O1BA 1A3XA 5DXXA 1E4NA 3R79A 3T78A 3QR3A 2NW0A 2HXUA 3N34A 1GQLA 2EPMX 1B0IA 1BWVA 1QO2A 4EACA 4IPPA 1GORA 3HGJA 4NG3A 3T2OA 2ZC1A 2A3EA 3BAXA 4EWJA 4Q4KA 1JIBA 2VVNA 3PAOA 3T7VA 4D8LA 4H2CA 2VZVA 3KP0A 2R1KA 3FDKA 4JQAA 2Y8KA 4XIAA 1OWQA 4MDPA 4BHYA 3BGJA 4QAWA 1HW6A 1W9UA 3WG6A 3E12A 4KESA 5GNZA 1M41A 2CLLA 4N9CA 3PTQA 1XRVA 3NIYA 1DJQA 2E4TA 1ESWA 3VNMA 2EPNA 1KV8A 1UG6A 2GL5A 3E0IA 1W1IE 1SR9A 2BB0A 4GZ7A 2A7NA 2XN1A 1PKLA 5AFDA 3WJYA 4MTVA 3GIPA 4RK8A 2R24A 3VD7A 3DYPA 4YYCA 2AGTA 2VO5A 2JALA 1E1FA 4Y9AA 2CLHA 2OQYA 1IV8A 1R9ZA 4C6IA 3TNBA 3B9NA 1WZMA 1P6BA 3AI0A 3S1WA 3AROA 3N2CA 4G9PA 2NSOA 4LUJA 1R3YA 2HBXA 3VD4A 4OBRA 9XIMA 4AQLA 3EOLA 2PRMA 2BWGA 5EY5A 2IUZA 1TCMA 4O28A 3LGDA 3S6OA 4GUJA 3B05A 2ZUSA 4AIEA 5C6MA 4HZ8A 1V6XA 1TRIA 5G2WA 2O55A 1UPPA 4FXSA 3FK4A 4JN6A 5E93A 2FHCA 3QKEA 3PUOA 4Q8MA 3S5SA 3UCDA 2F9RA 1JGIA 3M0IA 3TZNA 1OD8A 4QISA 4LAUA 5A8PA 4OVXA 1XYFA 4HHLA 5DT5A 1JL8A 2BHYA 5LNVA 2WM0A 3OYZA 1VIWA 4NZFA 1HG3A 1NDYA 3MMTA 1GJWA 1WPCA 4E2DA 1TUXA 4ZQCA 2XVGA 4RXFA 4HSNA 3LYEA 3DG6A 3VZYA 1UHVA 3IIPA 1OIMA 1XIIA 1JYWA 3W29A 2PS2A 1VYPX 1AJZA 4FNTA 1Z69A 1M7JA 2HJPA 3UJRA 3M9YA 4H04A 5KSWA 3WLHA 5JVLA 4QM1A 5DFAA 4MAZA 3DBNA 3QYSA 1BSIA 2V69A 3W2NA 3N11A 4P2VA 5B80A 1XCFA 2FKPA 1XBVA 2CU0A 4UMAA 5HA7A 4WKAA 3H2EA 3KE0A 3ZSSA 4C1NB 3W01A 3OZMA 3LU2A 4E38A 1VF8A 2AOSA 3PZOA 3NYDA 4XZHA 3G0XA 3W1AA 4K8EA 4PUDA 5I77A 3JR2A 1W3LA 2P0IA 4UFIA 3SECA 3UNDA 3M7WA 3CV2A 2YL8A 1E40A 2X1IA 2ZVRA 3UZXA 3GXNA 4RE4A 4S2CA 3CV1A 5G1TA