4UXHA

Leishmania major thymidine kinase in complex with ap5dt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
173
Chain Sequence
b'RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVALMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 49
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxhA01
1XMVA 3IUYA 4F38A 1BYIA 2O0HA 1HT1E 4D81A 1G3MA 1E1QA 1NP6A 5A0FA 4DB2A 4UXJA 2Q3FA 2ZE6A 1NLZA 4A8JA 1GDDA 4O2LA 2O5VA 4DLXA 1HT2E 2GJKA 1P9WA 1VCNA 4OHXA 4E5UA 4YXWD 1W49A 5JEDA 2XXAB 1QHIA 1TUIA 4FMCF 1QHHB 4KFTA 5AR1A 2ZUBA 3VQTA 4DZZA 3HR8A 4PO8A 3RRMA 2GXAA 3L2OB 4HUQA 2DWQA 4AWXA 4B47A 4OI4A 1R7RA 5BQ5A 1LF0A 1NL3A 2BOVA 1ZRHA 2XZLA 1ANKA 4FINA 4M1KA 2C78A 2W0SA 1OSNA 2VIIA 2O8FB 1RJ9B 1ZUNB 1NN1A 4HLDA 2QRZA 2VLIA 4PHHA 1PJRA 2R6GA 5K8TA 3NBZC 1DELA 3QBVA 4PHFA 2QP9X 4GL2A 3KFXA 2CCJA 2A5FA 5DN6A 3DVLA 5JJIA 5JZVA 1T4GA 3CBQA 3QIAA 5K8LA 4MRVA 1Z28A 3GEHA 4GOXA 4Q03A 4A0GA 1F2TA 4CEJB 3ADDA 4V0ME 4ZCIA 4Q00A 4LYJA 2I1QA 2QE7A 2V7QD 2P6UA 3CR8A 1FZQA 3B13B 1E2FA 1W36C 1TMKA 2CEAA 3ZGXA 1N6HA 1TL7C 1ZUIA 2NZ8A 1SGWA 1P75A 4IEIA 2Z4RA 3KKPA 3K0CA 2XX3A 2CE2X 4B71A 3KXIA 2XGJA 5BN3A 3B1WA 3P4XA 1MRNA 4IFBA 4HB2A 2LKDA 4AKGA 1R6BX 3C8UA 4ERNA 3FE2A 5CLQA 2QM8A 2IS4A 1FMLA 3U44A 4F4CA 3PIRA 4US1R 4L16A 3GLFE 1UBEA 5E4FA 4PPGA 5IHPA 1HTWA 4LI0A 1R8QA 3QENA 4PPFA 2EWWA 3I5YA 5F9HA 1QF9A 1AS2A 2IYVA 2OCPA 3BBPA 4IXNA 1VYVA 2H57A 4CF7A 1RPZA 1E2QA 4QGFA 1NVVQ 1RE0A 1L2TA 3IHLA 2ZE8A 3DEFA 4Q4AA 4QM7A 1E9FA 1PUJA 1A7JA 5C4GB 5KTYA 3SZRA 1E9RA 2GCOA 1FW6A 5CDFE 4TQAA 3GJ8A 1GVNB 3M6AA 2WSSD 3C15C 4I81A 3K0SA 4GOKA 2WJYA 4N0EA 4CZ2A 121PA 3BC1A 3CRVA 3EZFA 3L0SA 3ZIAA 2C99A 3D3QA 2Q9AA 3OEED 1NMZA 3LXXA 4NU0A 2W6IA 2ZSFA 4TYQA 4DSNA 1VCOA 1PVOA 4BZPA 1KDOA 1Q1BA 4Q21A 3ND9A 2RGGA 3A4NA 3EZ2A 5JBQA 2WKQA 2IWHA 1XCMA 3BORA 1RRFA 1MRSA 3I8SA 1JQJC 2IF2A 2YWHA 2GZHA 1XD2B 2D62A 4DCNA 3THXA 1UEIA 2ZQ5A 1G16A 3UEJA 3Q9LA 1H8HA 5CM9C 3P1JA 1DAHA 5A4JA 1HQCA 2YWFA 2YKGA 2R6CA 2AXPA 2XNDA 3QXJA 4A2PA 2QP3A 1W46A 3D31A 4DEYA 3PJRA 1JI0A 2W2VA 4BZQA 4BGDA 1II8A 1W4AA 3O8DA 1S9HA 3M0EA 1CBUA 1EG7A 1Z0DA 5AK0A 2J87A 4KSBA 4X8OA 1WBDA 1FX0B 1XNJA 1KK3A 1M74A 1Z6XA 2CXXA 1N6LA 1Q1ZA 1UKYA 1E9SA 3C4JA 1KK1A 5JCPA 2IL1A 1D8TA 1K5DA 1WA5A 4Q18A 4YMTA 2WMNB 1T3SA 5KOYA 4LHWA 3U2QA 1Z6TA 4JLPA 2ECKA 3KB1A 4QJ5A 3ADBA 4RKEA 3CH5A 2R65A 1BMFD 4UNQA 1JB1A 2F1HA 1Q1EA 4GI7A 5KU1A 1GZSA 4LV8B 1R4AA 2PCLA 4TLEA 4JL6A 2ASEA 1Z5ZA 4MKHA 4QBHA 4RD3A 4WXPA 1IM2A 1QVRA 1Z8FA 4NYMR 5J4HA 3FHTA 2PMKA 1U81A 3GLIB 3OESA 2BKUA 2XSZA 4LZZA 5C18A 3QSYA 2CDNA 1G18A 5FBWB 2F1IA 1P3JA 4WBSA 4B2PA 4B33A 5EJEA 5FTKA 3UATA 3SHFA 3FFBA 3OE7D 2B8WA 2BMFA 4HLQB 2OBLA 4S35A 2P67A 1S3SA 5KDDA 3LXRA 1P4SA 1KO7A 1W48A 2EFGA 1I4LD 4CEIA 5L3VA 4Q7MB 3IO5A 3H4MA 3F3YA 5FL3A 4TN1A 4DIEA 2GKSA 2VSFA 5KDOA 3FB4A 4RY2A 3LLUA 3JZMA 3CPHA 1II9A 4XJXA 2JLSA 1R10A 2NTYC 1G291 1G17A 3WBKA 4UNRA 2F9LA 2PJRA 1CJTC 4LUCA 2A3RA 4BLOA 4V0MA 1GSIA 3F0TA 3AF3A 4FMCB 2OUKA 1ESMA 5EE9A 5EZ5A 1A2KC 2CL6X 2QAJA 4O3MA 4W9MC 2AX4A 2EYUA 4NCKA 1XZQA 2BBOA 4EQ6B 5LPNA 1E9EA 2H5EA 1XTQA 4LJ4A 3BXZA 4GPTA 3RHFA 1AS0A 4HZUA 2BBTA 5TXGA 3A4MA 5G40A 2V55B 1T0HB 2OCAA 4QXAA 2ZR9A 3U7GA 4HEJA 1T8TA 2C8VA 2KSQA 5HE8A 1ZUHA 1VHTA 2YINC 3Q72A 3SBDA 4R9UC 2EFEB 3CM0A 2VEDA 3RNLA 1FMJA 1KI1A 2PBRA 3OIVA 1RZ3A 1VMAA 1J70A 5FR2A 4DCSA 4U7DA 5FPHA 1E2DA 3GLFA 3HU2A 4G0NA 3CNNA 3PITA 2HCBA 2GK6A 1T9HA 2WWWA 2ZI9A 4Q7JB 2QPAA 3O8CA 2EQBA 3GJ0A 3ZVRA 1I2DA 1G4AE 1UJ2A 1P62B 1XCGB 3BGWA 1KSFX 1E4YA 2XXAA 4KU4A 2RGEA 4LYFA 4OI1A 3ZS9A 1QHHA 1VPLA 3GLIE 3GEIA 3F8TA 3NH6A 4Q1CA 4JYCA 5CDFA 2ENZA 1GIAA 2B21A 4LYHA 4TQ9A 1XMIA 3WHKA 2YVUA 4DDUA 4M9QA 5BYKA 5JSZB 1EESA 4HB4A 4F4IA 4JS0A 4WXRA 1E99A 4FD2A 3MD0A 5L3SB 4L9MA 4IOLA 2D7CA 5B30A 2JJ8A 3CZQA 5EP2A 3TW4A 2H17A 1KDPA 5JFGA 5HCNA 1SULA 4ITRC 2OILA 2O8FA 2PH1A 3T1QA 1N5JA 1RJ9A 2ONKA 1ZJ6A 4L8GA 1MKYA 1XEWX 2Z4SA 4NP6A 4DLWA 2G88A 4M4SA 1DG1G 3L0IB 4PPQA 3P4YA 2WWHA 2IUTA 1GOTA 1EFUA 3VR5A 2HT6A 4GMDA 4DDWA 4ARZA 3BOSA 1ZBDA 3QBTA 4CEJA 5EXTA 1D9XA 5DIFA 4Q19A 2WWXA 2I4IA 1P9NA 3C41J 4QGHA 4B32A 3OEEA 5BXQC 2W2TA 3UMRA 3IBGA 2ZRFA 2RGNA 2ZI3A 3KJEA 3QJYA 2F1JA 1FARA 2FA9A 2P5TB 3WYFA 1EFRD 4M8NE 1ZM4A 1E0KA 2JDIA 2CE7A 5DE3A 4BEBA 3DO6A 1AZTA 2QT0A 4H1VA 4ZO4A 1IXSB 3AKCA 3CNLA 2JAQA 1E2PA 1E94E 4C2TA 1CP2A 3GJ4A 1MT0A 4ESVA 4TTPA 3AF4A 3GJ6A 621PA 5GADl 1RVDA 1T0JB 3SYLA 3AV0B 2NO6A 2J7PD 4FMDB 1IHUA 2OAQ1 3AEZA 3GFOA 1Q20A 5AJWA 4M21A 1EWQA 1U9IC 1VIYA 4CRWB 2WVJA 4JMPA 2G3YA 1M8PA 3NG1A 1AGRA 2RH5A 3DKPA 3O8RA 3GLGB 3NH9A 4GDFA 1UEJA 1HH4A 1U0JA 1YZLA 1W0KD 5GJVC 4JLOA 2VA8A 3OFND 5J40A 1G5PA 2JJ2D 4V0KA 4P32A 3CW2A 1XB2A 2WKPA 4BFXA 4KI0A 1F60A 2R62A 3H1TA 4EAQA 2RCNA 5K8IA 2DR3A 2F55A 5AUOB 2QBYA 4OJKA 4D4KA 3TUZC 2MMGA 4TL6A 3FKSA 3NC1C 1DE0A 4JL8A 1CIPA 1XD2A 3FKQA 4MGIR 4M53A 4AY2A 1VG9B 3VAAA 2A30A 4DUGD 1P7CA 3QPUA 1S1MA 1YZGA 4KXFB 1IN5A 1Z0KA 3FGNA 1AZSC 2FPKA 4EPRA 2GDJA 3LVRE 4M2LA 1VKJA 1XWIA 3W8RA 2GBLA 4YLGA 4TQUS 1AJEA 2KWIA 1LB1B 1UADA 5DSZA 3RS4A 1D2EA 1M1YE 1PLKA 3LX5A 3CXLA 4KCGA 4CDGA 1E6CA 2ZTSA 4KITB 1G8FA 4MDEA 4NYJQ 4EPTA 4HDOB 1FX0A 4CYMA 2MSEB 5UKDA 1AM4D 2FSGA 2REOA 4W5JA 2H18A 3TE6A 3PENA 4RSGA 5BWMA 1WE2A 2GJAA 2RGAA 3KX2A 1PZNA 1YZUA 3FMIA 1GILA 4RZXA 1X8KA 2ZRNA 2IA5A 3C16C 1D6JA 4LY6A 2IYWA 4KBGA 4DLRA 5HR5A 1XPUA 5JCZA 5AWFC 1OB2A 2FE4A 1CS4C 3KXKA 4BFZA 1NVWQ 4JSYA 3NVAA 4IDNA 4A36A 1HQYE 5CK4A 1S0UA 3N70A 4PC7A 3T35A 3GLIA 2D2EA 3GLGE 3DOFA 4URWR 5CIWA 3UEYA 2I1VB 2OHFA 4NMMA 2O8DB 4Q1DA 4O2RA 3IPXA 3HDTA 2JLQA 3Q85A 1SHKA 2F1RA 2ENNA 4LHZA 4ZDJA 2KI5A 3THYB 1S3GA 2GRJA 4PANA 4V0NA 3L82B 4IOJA 2P5SA 1IN4A 3AP1A 5SZKB 2BVNA 3A1SA 3K53A 3AM1A 3VTKA 3PCRB 5SZJA 2O8BB 2CHQA 2VRWB 3KZ1E 2FFQA 2GXSA 3B1ZA 1GKIA 3A6PC 4Q47A 1VDZA 3EPKA 2ODBA 5SZHB 2ZETA 4A4DA 3K9NA 3U7HB 2IEYA 4DIDA 4FI3C 4TL8A 3GP8A 1A4RA 5JWRA 2F3TA 5JI2E 2IT1A 1QBKC 4EQ6A 5IK2A 1S2MA 3LBHA 4D4LA 3C7KA 3QF4B 3SJAA 2DBYA 2FN4A 2ZR0A 2PX0A 2X2EA 2OE2A 5TDHA 2VP2A 4G5RA 1BIFA 2QM7A 1US8B 3VMFA 1BOFA 2ZIAA 2KBEA 4IDQA 4IDOA 1E3MA 4URZR 1KSJA 1J7KA 4BE7B 2EFDB 3U3KA 4BFTA 2IYSA 3UXMA 4PHGA 1DG3A 5C1BA 1YZTA 4BLPA 3W34A 2VP9A 2QSYA 4PSVA 2D4HA 1RFHA 1L8QA 1Q57A 4XWOA 1EFRA 5CJ2A 2BC9A 4B6EA 4BRWA 5DN6D 2FMXA 2ERXA 3EIEA 5SZIA 1L4YA 1ZNZA 2GVDC 3ZQ6A 1X86B 3P32A 1RIFA 4NH0A 4PAMA 1ZD1A 2HXSA 3IDQA 4BLRA 5JHGB 4QBGB 5JSZA 2GILA 2QE7D 2ZRDA 4BPBA 4DLYA 1NN3A 3KL4A 5E7MA 1IN8A 1UKZA 4IVPA 2CLSA 4AYXA 1Z6GA 5L3SA 3CX8A 1U0LA 4OBEA 5FTLA 1JJVA 1W2HA 4UNNA 1WDTA 4IW3B 2IXFA 1OXSC 4JJZA 2VHTA 4A15A 4ESHA 1GM5A 5TV2A 4RJLA 2QQEA 2N42A 4IKEA 4Q02A 1K5GA 5BYJA 2FGJA 3BERA 4M1SA 4C3ZA 5B58C 5CB6A 3AF0A 2ZRLA 5J4KA 4NHOA 2O0KA 4OHVA 5IF9A 4D25A 2WWGA 4KVGA 2QU8A 3BIFA 1KK2A 1GRRA 2QPTA 4XH9B 5DYIA 1TAGA 5JECA 4OQNA 1E98A 2VHUA 3TGPA 4LHXA 2AWOA 2BMEA 3KJGA 1KMQA 2C95A 2ZJ2A 3JZAA 3DMDA 3QF7A 4P3YA 3BFKA 3PUZA 2ZJYA 2V4ZA 3L43A 1JR6A 3AP3A 1Z2AA 1OFHA 4URYR 2VYFA 4BLQA 2FZ4A 4D4MA 4N3NA 2NG1A 1ZU5A 4HZIA 4KAXA 5DI9A 4AKHA 1CXZA 3OIUA 3RRZA 5KPJA 2ZRIA 4PX9A 4G5QA 4B35A 4ZIRA 1KZGB 4PO9A 3TVTA 4PO1A 4EJSA 2W6ID 1Q1QA 5GJWC 3V00A 4DHEA 3DPUA 3EC2A 1G8HA 4UKDA 2JLXA 2QMUA 2OO7A 5ANRB 3LO5A 1P72A 4BFSA 1N5IA 4GOJA 4NKRA 4MKIA 1JPNA 4X8HA 2GWHA 1OT3A 4OI2A 1R0ZA 4I4LA 4R98A 2IUSA 4Q4JA 4OYHA 2ZRBA 4TTQA 1H8HD 1LNZA 1DTSA 4XVUA 2QTVB 4DC9A 2ZSEA 2LKCA 3EAQA 1XTRA 2G9NA 5EQTA 3ONWA 3OZXA 4PHTA 3BB4A 3TSOA 5JLJA 1XMSA 3QXHA 3ZZTA 3UMSA 1ZIPA 4LJ8A 2R44A 1Q22A 4PQFA 2DB3A 1P61B 2G6BA 2G83A 3TAHA 4KVAA 3UGDA 4A6PA 3ZVMA 4XVQA 2ERYA 3NWJA 3SI7A 3MWJA 2AWNA 4J0QA 2DYKA 4U02A 4NZYA 3TRFA 4US0R 3A36A 1R0YA 2YWEA 2QMHA 5KDLA 3BE4A 4AG6A 3E2IA 1UBCA 2X77A 3GCGA 3I4LA 5FBVB 2WJIA 4CEHB 2YYZA 1TBNA 4IDPA 4I99A 2C9YA 3U3JA 2CNWA 3GJ5A 1KI6B 3T34A 1P2SA 4Q9KA 3KKQA 1B23P 2VP0A 2V9PA 2XAUA 1OIXA 3ASYA 4NCJA 4RFVA 4AKEA 2HXYA 2IS1A 1W4BA 1NG9A 4D2IA 2H16A 1NVXQ 3TLXA 1Z08A 2ZSBA 3VKHA 1G8GA 1N6PA 4X8MA 1SVSA 4YMSA 3SBEA 4B2LA 3SYKA 2LWIA 4DBLC 4JBXA 4IJMA 3KUDA 1VCIA 2ZUDA 4M9SA 1GWNA 1CJMA 2FEOA 1RFLA 3I72A 4UNSA 1XCPA 2HLDD 1G41A 3RS0A 3UIEA 2C96A 2WAYA 3HPQA 4CIDA 3LD9A 1OJLA 2FEMA 1J8MF 3RS5A 2R8RA 2RKOA 2WPDA 1Q21A 4BZXA 1VG1A 4TTRA 4QJ4A 1RRGA 1X8LA 1MOZA 3AKEA 2NMVA 3VKGA 1ODFA 1CU1A 2VP6A 3U3MA 1NKTA 1G3UA 1WF3A 2ZRCA 3THYA 3SFZA 2OBNA 1RRPA 4X8LA 3T1TA 1TPZA 2J41A 3R7WA 1FNMA 4JKIA 5FH9A 4XOIA 2DFNA 4L5BA 3NIBA 2WMOB 2FGKA 4PQYA 2R6AA 4EFLA 3U4QB 3TUJC 2O8BA 5IRCD 3CPEA 1W44A 2VRWA 2QAGC 2ZPTX 4IVQA 5E95A 3RYTC 3NEJA 1JQLB 2IYYA 4C0AC 4DWJA 1NLYA 1XD9A 1G7CA 2ZVPX 5KNCA 4QBIA 3TSZA 2G0TA 4UXIA 3TBKA 2QT1A 2IF0A 4JBYA 5BN5A 2AD5A 2FG5A 1L7VC 1NLFA 3QOFA 2A78A 3I32A 5GVRA 1Z29A 1IQPA 1DPFA 4PZLA 1LS1A 2VHQA 3U60B 2B92A 2GXQA 3CONA 2NZJA 1US8A 3AVPA 3T15A 3R8FA 1KNXA 1XTKA 4B44A 2BEKA 2ZU0C 2OLJA 4UJ5A 2AL7A 3AGPA 4EPWA 4MITA 1V5WA 3UWOA 4ZKDA 2OT3B 3PEVA 1X1SA 4KO8A 3DKVA 1KO8A 4W5HA 2IYRA 1SQ5A 1CRPA 4A0FA 3AVXA 2DY1A 3LBIA 4Z51A 3K09C 1TTTA 3SJBA 1W47A 2CVHA 4ASUA 1TU3A 2WJHA 3CUEF 1TNDA 2RHDA 1E2GA 4TT3D 1N6RA 4LK2A 1HY3A 1KDRA 1NSTA 2ZRHA 2ZRGA 4GMXA 3ZZUA 3LWNA 3H84A 1U94A 1XZPA 1DAEA 2ELIA 1X8JA 2XITA 4LRWA 3RS2A 2YWGA 3BK7A 3EIHA 3VKWA 3R9IA 3QKSB 5FFMA 3X1WA 1QDEA 4TMKA 3SHWA 3KY9A 5FOXA 3G0HA 1KTVA 1X1RA 2GESA 4OKSA 1LV7A 2WBLC 4NYIR 3TIFA 1IJEA 2JDID 4EFMA 1EFTA 4JT4A 2MSDB 1E2KA 2Q6TA 4JZKA 1KK0A 1G5TA 1QHXA 3PUVA 2NO1A 1Q12A 2A7QA 5G3ZA 4Q5IA 1I4TD 2AFIE 3H86A 3P26A 2O8CA 2EU8A 3Q8XB 1G8PA 2IHYA 4TYYA 1VECA 2EFHB 4HAWA 5M04A 1E0SA 1QHGA 4PTLA 3WNDA 2GAOA 2FU5C 3SN6A 1Z0AA 4A0RA 4D0NA 221PA 1DAMA 4V02A 3EZ9A 4ZCMA 1AQYA 3DMNA 1ZCAA 3T12A 1UAAA 1LY1A 4AURA 3HWSA 2JIZD 3F5FA 2JGNA 1S9DA 4JSTA 3FMFA 4OHYA 3KTAB 1Z83A 1UBGA 3K70C 4XSHA 3U61B 1E96A 4QFMA 1WBBA 3K9HA 4PQRA 3QXSA 4OK3A 5C4MA 2YOHA 1HE1C 5BN4A 3QKRB 3CB4A 1DBSA 1R0XA 4LPKA 1L4UA 5DHAA 1G20E 3KKOA 2BHRA 1N6NA 1OV4A 4B3BA 3FKSD 3EPHA 3IIJA 2ZRJA 3E70C 3KJHA 1JBKA 1ONBA 2XTNA 3CF0A 4M1WA 1UKVY 2J0VA 3LV8A 4KSCA 1QG2A 1YJ5A 4Q4LA 4TMWA 2YV5A 4DXAA 1ZP6A 4RCYA 2J46A 1N6OA 3RWMB 1AGPA 3RC8A 2ODEA 3EA0A 2ANBA 2IYTA 2YC4C 4CVNA 1KY2A 1DS6A 4MGZR 2GEDA 2ZRPA 4UNPA 4AIIA 1GUAA 3H2YA 1HUQA 1ZD9A 3WP1B 2CVFA 4TMZA 4Y0VA 3AKDA 2HLDA 3B82A 4WAUA 4E07A 3W3ZB 1KDTA 5FTNA 1JECA 2UKDA 3B7GA 4BECA 3PV0A 4LJ6A 3IEVA 3LFUA 2PLFA 2OM2A 2RHMA 1A82A 3LQRA 3FMPB 4YMWA 2UZIR 1JEEA 3AGQA 4LBZA 4HAYA 4TWZA 4Z8YA 3BAFA 4KLNA 4A8JC 3CRMA 1NMXA 2ZJOA 5H68A 1T3HA 4JLVA 2FSFA 1G1MA 2HJVA 1KGDA 3MWKA 3X1DA 3W5JA 1QG4A 1Z6YA 4LX0A 1IBRA 2BMDA 1G64A 4HB0A 1EXMA 1HURA 4JLKA 1KI6A 2FF7A 1YQTA 1Y8FA 4L9WA 4WA7A 2AXNA 2X1VA 1NBME 1OXVA 1KO4A 3SS8A 2A5DA 1E0JA 1W4RA 4EUNA 1SVOA 1YR8A 1O87A 2NQ2C 2VSOA 5EUQB 1SVIA 2GJ8A 1OXUA 1HV8A 5LD2C 1KBEA 4G5OA 4NPHA 2QMEA 2YJTD 4LBWA 3W6NA 1CJKC 2WHXA 3QQ5A 1ZVQA 3B9PA 3THWB 1N2CE 3M1IA 1JJ7A 2F43B 6Q21A 2QAGB 4EKDA 3I92A 1W36B 1R5OA 4KYUA 2FWRA 1G5RA 2G0NA 3D8BA 2QA5A 3K0CC 3L0OA 4TYNA 3FHCB 5IK2D 4LCBA 2GVIA 1RW4A 3NBFA 2F7SA 1T5IA 2ATVA 1AK2A 2PCJA 3B5JA 3KB2A 5EP3A 2F6RA 4R2IA 4QHYA 3X1YA 4N0DA 1SXJC 1WP9A 1SHZA 4C2UA 2ZI5A 5JEEA 1AIPA 3SNHA 4TT3A 1R2QA 4Q4HB 4U5XA 2XB2A 5KO2A 3RRNA 5TVKA 4TYPA 3U4QA 1NMYA 1OPXA 2GAAA 2VO1A 1XXHB 4P31A 4MDFA 2HUPA 2QRNA 1G9XA 3L0PA 4RFSB 2IYXA 4B48A 4HLUA 4M1MA 2FH5B 2V1UA 5F9FA 4ZDKA 1QHYA 1UBFA 3A37A 1XP8A 2IYZA 4BFYA 1N0UA 4B34A 4KFSA 1IN6A 5FI0B 4Q66C 4NTZA 3UKDA 1JAIA 4Z1MD 1F6BA 3VNUA 2OLKA 3GEEA 2FSHA 2RAPA 3CKLA 2YZ2A 3BB1A 1KMHB 2ZRMA 5JRJA 1LW7A 1XEXB 1KJWA 2IC5A 2PX3A 4EFNA 5AUPB 1KO5A 1DAKA 3U5ZB 4URUR 1R79A 1TADA 2HDNB 5GVSA 2FFBA 4XTCS 5FBLB 4B3FX 1FNNA 4OI0A 2DWPA 1Z6AA 2JEOA 4GT1A 1JXOA 1YR6A 4V03A 2JASA 3MJHA 4AYWA 4P4TA 2QGNA 3TAUA 4M1OA 3TQFA 1SVLA 2JIZA 3HP1A 4PZZA 1PTQA 4O0MA 4AC9A 2JLVA 1CRQA 3BJIA 1W1WA 1SVKA 3ZS8A 3LQQA 1DEKA 5D3MB 2AKYA 2HJGA 2GETA 4FMBB 3A1WA 3CWZA 4HLCA 4ZCLA 4B74A 2JLRA 4E09A 3DM9B 5DNYB 4FKDA 1KBFA 2J0SA 1YKSA 4NYMQ 3KQNA 2NGRA 4LC1A 2FZLA 3R20A 3FFAA 2ZJZA 2A2ZA 5FPSA 4IEEA 1FTNA 4ZDIA 2D74A 4QNRA 4Q9HA 4AKIA 5CITA 1SVWA 2C2HA 2QP4A 2C04A 3K70B 1XXHE 3QEOA 3SU8A 2CK3A 1ELOA 3KUCA 1TF5A 4OK6A 3IQXA 3KFVA 5TY0A 3FYHA 4TL7A 2MMCA 1IY2A 4Q1EA 3O47A 1CLUA 4LJYA 2D2FA 3AUXA 3LBNA 2QTHA 1TQDA 1T6NA 4NL4H 4HAVA 4JKYA 2V54A 4UQOA 4M1TA 4ZKEA 2QN6A 4M9ZA 2XTMA 3R9XA 3OAAD 4FCVA 4RCZA 5FPTA 1WRBA 3TK1A 1NBMA 3VU9B 3WYAA 4POAA 4XD7D 4DKXA 1G6OA 3EARA 2BDTA 4LDJA 1P2UA 2GK7A 2HEIA 2XNSA 3KTAA 3MG9A 4KODA 3Q5DA 1JXMA 2C77A 4A9AA 2JLUA 3AH8A 3CO5A 2ONJA 2FX3A 1E9BA 2JATA 5KHOC 1ZAKA 3K0FB 3CF2A 4GRAA 1DAGA 1N0WA 4OQLA 5KYKA 3MWLA 2IWRA 4RD1A 3UGIA 5IDVA 4P4SB 4LPSA 2IW3A 2VSXA 3BRWD 1KNQA 3EWSA 1IY0A 5B2ZA 3MWYW 5FOWA 4XSGA 3ZJYA 4B3CA 4A8JB 2ZM5A 1KI8A 3T06B 3I5XA 3L8ZA 2JLWA 3QVUA 1GL9B 2WIAA 1P9RA 4OHZA 3TR5A 3CWQA 3KJIA 2FJUA 3RABA 1FFHA 3LVQE 4YMUA 2EFCB 4EPXA 3BS4A 2DWOA 1XPRA 3IGFA 1YVDA 3OIYA 2CNWD 3MLEA 4KJZA 4URXR 3TUIC 1AN0A 4AI6A 1CR1A 3ZZ0A 2AHOA 2FPLA 1CEEA 2CLDX 5HKKA 2CCGA 2ZJ8A 1RRCA 4FIDA 4XTRA 3QI2A 1TQ4A 4PSAA 4BRUA 1U0HC 5FL7D 3TNFA 3BFXA 4PR0A 4YQFA 3RVBA 2QI9C 2JLYA 2OXCA 1P60A 1XBTA 1TEXA 3AVWA 3RS7A 1OHHD 1XTIA 4JVSB 1KZ7B 1II0A 3VFDA 5AJVB 1YHNA 1G21E 2VL7A 3AVVA 2R6FA 2F9MA 5KNBA 1TQ2A 3WXMA 4R2HA 1JR3E 2WPDD 1R5NA 1XJCA 4QG7A 2RGBA 1LS6A 2P3SA 3VHLB 5C2JB 4CW7A 2GEUA 1EGAA 2PJZA 4BUJA 4OL0A 3RAPR 2OEPA 4JLMA 4QNMA 1R0WA 5EE1A 5JJLA 3N2EA 1RYFA 4Q1BA 1XU4A 1SXJB 5JRZA 5H70A 3CIOA 4NONA 2RGXA 3HYRA 1RKBA 3FMOB 4R7ZA 4ON9A 3THWA 3LNCA 2F43A 1AS3A 4Z1MA 5CM8B 4RZUA 2RMKA 1JEDA 1MR3F 2RGNC 4JLAA 2ORWA 2D3WA 4MRRA 3NKVA 1CULC 2QSZA 1G6HA 1E1RA 3R8CA 4MKGA 1Z3IX 5JJKA 2OAP1 4G1UC 4TMVA 2OFWA 3I62A 3SJCA 3CRQA 1E69A 1YR7A 3ZD6A 1SKYB 4EPYA 1UPTA 521PA 4HAUA 4DT1B 1M6NA 3THOA 2J45A 3BFVA 1Z0JA 3TR0A 2REXB 2WV9A 2FOLA 3DL0A 4TLCA 1JALA 3B6EA 3Q3JB 2ORVA 1NY5A 1OKKA 2GF0A 2ZYTX 4HUTA 4Q4HA 2IK8A 2OCYC 3W6OA 4ZI3A 5J4YA 1WB9A 3LW7A 4LSGA 2OESA 3DHWC 2BM1A 3S1AB 1A1VA 1XXHA 5GJBA 4IFEA 5KSZA 1IXRC 1I2MA 1FTSA 1ZIOA 4RFSA 2ZS9A 4CT5A 1XA6A 2WKRA 5ELXA 1NN5A 2W58A 1KY3A 4BFWA 1QVAA 3TH5A 2ATXA 4ASUD 4JLBA 1D9ZA 1DOAA 3HU3A 4MYHA 2V8OA 4LV5B 2ZEJA 4M9XA 2G1KA 2BKEA 3GFTA 1N5LA 2C5LA 1XEFA 1X3SA 1B0UA 1GNQA 2X8AA 5KPDA 2WWFA 1NVVR 4D4JA 1KMHA 1OF1A 1XEXA 2ZE5A 5K8UA 1Z0FA 1KYIA 1XMJA 2VTKA 3E1SA 2HYIC 3GLHB 3OHMA 1SXJE 3JVVA 2H7VA 1AQUA 3DZDA 4N1AA 3C5CA 4F91B 3OAAA 4MYTA 3RSLA 3GLGA 4XD7A 2G1JA 1NNEA 2N46A 5EXSA 1T91A 3CF6R 1DAIA 1G4UR 4NCHA 2GBLC 4C7OB 3ASZA 721PA 3LA6A 3NHBA 2WOJA 2VPPA 2AN9A 1G8YA 2PT7A 2VF7A 2X2FA 2J1LA 2WWIA 5D3MA 1KI9A 5EP4A 2B7CA 4MH0R 1UDXA 5FTJA 2AFHE 4TLAA 1SKYE 1F3OA 2QZ4A 3W5IA 1NKSA 2A5GA 4BEJA 1Q44A 2JJ1A 5B57C 4XWAA 4L4UA 1IY1A 3KKNA 4TYWA 2DB6A 4OQXA 3I8XA 4JLJA 4MA4A 3ZVLA 4AK9A 2OXRA 5HPYB 1MO4A 1Z06A 1K8RA 5HE9A 3EG5A 3VNVA 4A6XA 3VX4A 2KBFA 2BCJQ 4CEIB 4PAQA 3QNUA 2Q3MA 4GZLA 4IVRA 2D7DA 5JWHA 2ZAMA 2ZRKA 3BB3A 3GD7A 4JT2A 2VP4A 1OH7A 2EW1A 4FN5A 4F4JA 3NDBB 1GTVA 4DSTA 2IXGA 1S96A 4MRPA 4R71A 3VR4A 1KAGA 2AD1A 2W6JD 3DZ8A 3FHOA 4QGGA 5DLQC 5AUQA 3ZYCA 3T5DA 1EWRA 1D2NA 2GA8A 1Y3AA 1YZKA 4KHZA 4GBMA 3SQXA 1XFAA 1ZM9A 3VU9A 4QOSA 2BMJA 1YRBA 1FP6A 5FL7A 2B7BA 5LDDC 3TQCA 1OE0A 1A5TA 4RKFA 4LV6A 3J81k 4C9BA 4OQMA 1IAQA 3KQHA 2QUZA 4HDQB 5HZHA 2BCGY 4IRUB 3UWKA 3IEUA 3VR1A 4BASA 1OHHA 5KNDA 3GLHE 4DCTA 2YUUA 2HF8A 3NDPA 5FR1A 1ESNA 3G82C 3UG6A 4UXHA 2ZI4A 3GLFB 2IS6A 2XEXA 4P4SA 3K9GA 2WZQA 5EUMA 4LHYA 2ZREA 4Q1FA 4LJAA 2VF8A 5DI3B 4C0KA 2O8DA 3OF5A 1E2IA 4ACBA 4C0QC 2XZPA 2ZS7A 4LJ5A 3X1XA 4MYCA 4GZMA 2W0MA 3NBYC 2OFXA 3PG5A 1C4OA 1T3LA 3WYGA 2I3BA 2IEZA 1KSHA 4TMXA 2O8EB 4C30A 2P6RA 2AK3A 3NHAA 1N25A 1O3YA 2MSCB 3QE0A 4PSKA 4CT4B 4MGKR 5KSYA 3FWYA 1E4VA 3EIQA 2QY9A 5B64A 1MH1A 2BIFA 1CR2A 3VX3A 5G41A 2Z5FA 5F2EA 2GXUA 1W4CA 2QPOA 4MYUA 3MUFA 3AVTA 4A2QA 3U7FB 5J5CA 4TMTA 4ZDWA 5L3QB 2OV2A 2J0QA 4OJQA 3QF4A 4QGAA 1VG8A 3X1ZA 2CL7X 4G5GA 3AB3A 2ZROA 4FWIB 4US2R 4ARZB 3T1OA 4D0LB 2O0JA 1UFQA 3AVQA 5A5GA 5DH9A 4Y0AA 2IYUA 1XPOA 4M1YA 4WZBE 1NJGA 1LFDB 1E2EA 1J8YF 3KQUA 4PC2A 4Q48A 4S2EA 1X6VA 2RB4A 4RZ3A 2G77B 2R9VA 1ZYUA 4A2WA 1ZNWA 2IYLD 1M34E 5KSPA 3SC3A 3SFVA 3HPRA 2HT1A 4LBYA 4GNKA 2PMDA 5AJZA 3GJXC 4HAZA 2H8KA 2BEJA 1U99A 1Q0UA 4XVRA 4FCWA 3GJ3A 3KDSE 4A0HA 2DHRA 2HF9A 3WBJA 4DSUA 2QTFA 1SXJA 1KJZA 3RLFA 5EXPA 2OFOA 4PXAA 3MSXA 1P6XA 5LB4A 4EIWA 3U3OA 2YOFA 5LBIA 5J4LA 1P73A 2OG2A 1VTKA 3G5UA 1COWA 3ICQB 5P21A 4PPNA 2GNOA 3GJ7A 2E1RA 1XD8A 4I1OA 3D6TB 1XDBA 4HB3A 1SZPA 2SHKA 3QY0A 3C14C 5F3WB 5E7IA 3AUYA 2PZEA 3AQ4A 1OXTA 2DFLA 2BM0A 3CX6A 4LYAA 2ZI6A 4M0LA 4G5SA 1E79A 1VYUA 3GMTA 4GP7A 3BH7A 3MMPA 3GQBA 3NTUA 3QKTA 1SVMA 2CMKA 1U8ZA 5DHFA 4DT1A 2CLCX 2QGZA 2E73A 3MAAC 4FXPA 5DYGA 3WMFA 2Z43A 5CLLA 2GCPA 3TKLA 5H8WA 3K1JA 4YMVA 2CHGA 4P33A 4EJSC 2FNFX 5KUTA 2OSBA 3EPJA 3KQLA 2ZS8A 1TUEA 1HA3A 2QBYB 4GP6A 2FNAA 2P0EA 4C0SA 3S1AA 3A1VA 3SOPA 3K9LA 3HU1A 4V0OA 5JHHB 1N3BA 2AK2A 3BH0A 3IO3A 3A58B 5FUVA 5JWOA 4ZPXA 2Z83A 1U9IA 3O8BA 2ODNA 4FMDF 1OLOA 4B6DA 3B9QA 3WY9A 1G3QA 4Q1AA 4ACAA 8OHMA 5FTMA 2IX3A 2ZYUX 2V3CC 1P2TA 1W5SA 1GFIA 1OB5A 1GITA 1PLJA 2E87A 1D5CA 2QROA 3WMEA 1E2JA 5DGXA 1TQ6A 1OIVA 4F7WA 1GG2A 1Z2CA 1KKLA 3GPLA 1S4QA 1E2MA 1OXXK 3ND8A 1TEVA 4RZ2A 4Z8XA 3HYTA 2FSIA 4M22A 4KV9A 5TARA 1TX4B 5FUYA 3UANA 1OYYA 4EDHA 5E7JA 2W6JA 2JA1A 2V6IA 3GLHA 5CK5A 1DO2A 1TF2A 2HCJB 2RGDA 4CGZA 3RDPA 3QEJA 4QRHA 3B1YA 3MGCA 4DLSA 1KI2A 2ZXUA 3CPJB 3C5HA 2QG6A 1VYTA 3AKYA 2CK3D 4E03A 4IDHA 4URVR 4C7OA 1GNRA 4G01B 4F93B 4JBWA 1F5NA 1DO0A 2XOKA 3QG1A 1PUIA 3AP2A 5FI1B 2L0XA 1E9AA 2RGCA 2YNMA 1IOZA 2VQSA 3ETLA 2FFAA 1ZM7A 3ADCA 4XIGS 2CHVA 2FPMA 4U00A 4C0JA 4JVMA 4LC0A 1QHSA 1WXQA 1E2LA 1NBMD 1GRQA 4JVLA 2QMOA 3TW8B 1FL9A 4L9SA 1RYHA 2O52A 4QKQA 3PEYA 3NC0C 4YC7A 2CJWB 4LGMA 4DSOA 1BKDR 2C98A 4B3GA 2QQ0A 2DFKB 4YXWA 4II7A 3JVUA 2A9KA 1J2JA 2PEYA 3B1VA 3A8TA 5AJXA 4CEHA 2XB4A 4NYJR 5FUWA 2P2LA 1U8AA 1NVUQ 1XRJA 4QHSA 4P4UA 3CZPA 3V4RA 3WMGA 3I3SR 4RVCA 3RS3A 2UZ3A 5JI3E 2V6JA 3B8HA 4JIMA 1KSGA 5L8VA 1EFCA 1OH8A 3PXGA 1M7BA 3QVVA 4HYYA 4Q01A 4W7SA 5AJYA 3NBXX 2Z0MA 4NBSA 4GFDA 1WCV1 1EK0A 2ZI7A 4MRSA 4G3XA 5TB5A 1ZCBA 5J4VA 1G7TA 1QRAA 2JCSA 1GKUB 3KKMA 4MKFA 1J99A 1ETUA 5G53C 2QORA 3QPWA 1GKYA 1E2HA 2Y8EA 4LBVA 2J5XA 2F3RA 1ZINA 1Z63A 2YC2C 3T1VA 1FOEB 2VHJA 2V7QA 1Y63A 4FW9A 4L15A 5HKKD 1HEIA 2WOOA 1V43A 4NCIA 2V1XA 3W3AA 2ZITA 5LB2A 3LLMA 5DI3A 3W9YA 1U90A 1LTQA 2J59A 5JS7A 3VR3A 2XZOA 4Q7KA 5L3RA 1F48A 4BFUA 1U8YA 3I1FA 2NPFA 3IIMA 2ZANA 1W7AA 2CBZA 2J0UB 3VR6A 2WSMA 5EZ6B 1RC8A 3FOZA 3ZH9B 3B78A 1XF9A 4BLSA 2FFHA 4MUAA 4I1SA 4JJKA 4QBFA 2O8EA 1IONA 3UK6A 4YDSA 1H8ED 2BBWA 2GJSA 4V0LA 3QG5A 3QXXA 3PQCA 1N0VC 1ZM2A 3T61A 1Z0IA 1DARA 3IHWA 1JNYA 4DLTA 4E22A 2B8TA 1E9CA 1DAFA 4JVNA 2UVQA 1MV5A 2YOGA 1WQ1R 4KBFA 4ZI2A 1AKEA 3REGA 1FUKA 4HATA 4LJ9A 2CCKA 3OIWA 4JL5A 5L3QA 1MABB 3WRYC 4NYIQ 3W90A 4I1UA 2J3EA 1JAHA 1M7GA 1QHNA 3E5HA 2EWVA 5EXXA 2C9CA 5FOSA 2WSSA 3V4FA 1Z47A 1D2MA 1ZW6A 4NDZA 1XEWY 421PA 5EP1A 3WRXC 1FQJA 3LH5A 3K8YA 2PT5A 3PR1A 4UJ3A 1W36D 1YZNA 3WHLA 3CNOA 2J7KA 1E1RD 3IKJA 3SQWA 4ILEA 3U6KA 4F92B 1G7SA 1PLLA 4NE2A 4K46A 5TMPA 4D6PA 4I1VA 1PTRA 2Q3HA 1LF5A 4C0LA 3PVSA 2A5JA 2WM9B 4Q9LA 5CYOA 4D26A 2GF9A 2ZJAA 3Q7PA 5J47A 3AVYA 1OFIA 4ZIRB 3HJNA 1OKKD 3K0AB 1GNPA 4EJSB 2VBCA 4LWZA 3LAWA 4KLZA 3BWDD 1N6IA 4DCUA 1EFHA 4LHVA 2NO0A 2ODWA 4RD4A 1ZC3A 5DO9A 3QKUA 4PC1A 1QZXA 3QPVA 5FBQB 3QKSA 2GJ9A 2VP5A 4O25A 4Q4JB 4BWYA 2IXEA 4TSFD 2B6HA 4C4PA 4A1FA 4JYBA 1LVGA 1N6KA 1GRNA 4RD0A 3RWOA 1Z07A 1NSFA 3UMFA 1EX6A 4D80A 1KI7A 4FWTA 2R6DA 2XJ9A 2KJQA 4TLBA 1NIPA 4NCNA 2Z6VA 5HTKA 5CB8A 1BMFA 2H1LA 3UGLA 2AR7A 3OEHD 2ZJ5A 5D3QA 5EE3A 4TZ0A 3ZQJA 4WZ6A 4IXMA 1NI3A 1HE8B 3M4YA 3RC3A 1C1YA 3ECCA 3EWAA 4IOMA 3IBYA 2TMKA 4HAXA 2BJVA 2ZYVX 1ZNXA 3IQWA 1YRAA 1F2UB 2WAXA 3EXAA 4ABYA 4Z54A 3CRRA 1E32A 3OE7A 3EX7C 2W00A 2EYQA 2PZFA 4JLDA 5EE5B 2C03A 3U6BA 2PLRA 4LOAA 1E9DA 1W5TA 4PAOA 2WIBA 3CRW1 4C0BA 2WICA 1JPJA 1T8UA 2AKAB 3V9PA 3QKRA 4B73A 1AA9A 2DFTA 2BWJA 1NY6A 2JJ1D 2Q9BA 3EPLA 1UM8A 3H0KA 1YR9A 4DJTA 2A5YB 4JLNA 2BBSA 2WJGA 3PUYA 2P65A 2FDCA 3LY5A 3RSOA 3ZD7A 3ZDQA 3P27A 1C9KA 2W83A 4MRNA 3T5GA 3RANA 2BV3A 3TMKA 1W0JD 3BD9A 3EZ6A 4A92A 1EX7A 2D06A 1P5ZB 3ADKA 3EW9A 3PEUA 3AVOA 3NEYA 3K70D 1MO6A 3MCAA 2HV8A 4EPVA 1KI4A 1M7HA 1TU4A 4GSYA 2NIPA 4K8OA 1CJUC 4D0GA 4QC2A 4TZ6A 4KFUA 4QL3A 3EASA 2EVWX 4HUQB 4MUBA 2P6NA 1GL7A 2ZR7A 3A1TA 4C0HA 4DDVA 1FP7A 5JS8A 3L8YA 4KYIB 1OFTA 4B3DA 1OW3B 3NXSA 1KO1A 3GFPA 1JR3D 2ZE7A 3PEWA 3LX8A 4P0TA 5CIQA 3WP0A 1G3IA 2YHSA 3TVDA 2C9OA 5FUXA 1IN7A 2W2XA 4W5WA 5LD2B 2E9SA 2CJWA 2QNRA 3UPUA 1MO3A 1S8FA 2GZDA 4DDTA 3X2SA 1M2OB 3LDAA 3R7WB 3AF2A 2IUUA 4B76A 3U7EB 5BW8A 1ZM3A 3TJZA 3EA5A 3VHXA 3ICEA 5FOTA 1F2TB 3SE0A 4DCVA 4WIAA 2J9RA 4WZAE 4RD2A 1H8EA 3I61A 2ZSDA 5E3HA 1XTSA 5KSOA 4RD6A 1E1QD 4ZV4A 3N2IA 4LJ7A 4Q9JA 1NRJB 2GHIA 2ZRAA 3IPYA 4H9GA 2QENA 2Q9CA 1G7RA 3SYNA 3U44B 4DRZA 1Q3TA 4BLTA 1NIJA 2OCBA 2OZEA 1XJ0A 3CLVA 1CKEA 1YZQA 1SKQA 2CL0X 4AG5A 4D82A 1KJYA 2ZSAA 1R8SA 2QAGA 1UF9A 4YDHB 5G3YA 4XWKA 4PZYA 1KAOA 2K5UA 3CX7A 4OK5A 3B60A 4B2IA 4HLUC 1KI3A 2WJVA 4Q4AB 1OH5A 2NOAA 2VH5R 2ZUCA 4OHWA 3MRSA 2GEVA 1ZD8A 3FTQA 2PEZA 2ORIA 2GCOB 3W8NA 1E0AA 1Q3HA 3SEAA 1NG1A 4BQSA 3PUWA 5HZKA 5FPKA 3Q7QA 2WTUA 1CR4A 2XJ4A 2J0UA 3EZ7A 3D7MA 4B6FA 1CR0A 3FDIA 3IILA 1VG0B 1ZNYA 3IIKA 3AF1A 1TF7A 4MGYR 1WMSA 4HDCA 3A1UA 1FPMA 2IHBA 2QEQA 1NJFA 2J7PA 1OYWA 3SDZA 4YONB 1KHTA 2N1BA 4PFSA 3K0EA 4IOKA 4Q9IA 3QXCA 4H1UA 1VHLA 3CR7A 3AVUA 3THXB 4OQFA 3B2EA 5FBRB 4TSFA 3DM5A 5FOVA 2IBMA 3K09A 2H92A 3UFFA 2JLZA 1MABA 5EE0A 3KXLA 3BH6A 3TSWA 1SXJD 4QM6A 1XJQA 1VIAA 1W0KA 4DLUA 2GVZC 3KQKA 1XX6A 3OFNA 1BYUA 3BJIC 2JJ2A 4TLDA 2O8CB 1K6MA 1II8B 4WOPA 1COWD 1GL6A 1W2GA 3B85A 4IHQA 1NF3A 3OEHA 3EC1A 1DVRA 2QL6A 2REBA 2XTZA 2PL3A 2OBMA 4PC6A 821PA 2IYQA 1PV4A 1E79D 3W6PA 3UG7A 3HR7A 1KIMA 4HI0E 4HSEA 2LCFA 1FQKA 3FVQA 4DUGA 4BFVA 1YE8A 2KE5A 2KB0A 4Q7LA 1FUUA 1ZMXA 3WNCA 5DISB 2PZGA 3R9WA 1MO5A 3ZIAD 3K0AA 2ZVQX 3ZLJA 4DLZA 1E2NA 3WNBA 1S1CA 4MQBA 2ANCA 1UKEA 4TL9A 3B1XA 1IJFA 1CTQA 2GZAA 1OFUX 1GAJA 1XTJA 2R2AA 2WJJA 1OH6A 5H1YA 4K81B 3CH4B 4QJ3A 2ZYWX 3MJRA 4DLVA 1FAQA 1A2BA 3DOEA 1DADA 3PUXA 1NN0A 1U98A 4A82A 1OIWA 3MFYA 2XNDD 4PC3A 2ROWA 1BS1A 5F98A 4QHTA 1CF4A 3P20A 1T5LA 1W0JA 2HYDA 2NO9A 3N5CA 3SJZA 1AKYA 1J90A 4AD8A 4B3XA 5JMTA 1I4DD 4WW0A 1CJVC 3QUSA 2WWYA 1GP2A 2GTPA 5AUNB 5GJCA 1H65A 3PFIA 4WVFA 5C46F 3ZVNA 4B75A 1ZU4A 1VCMA 2ZAOA 1Z22A 5FOUA 2NPIA 1KOFA 3DDCA 2IS2A 1YU9A 2ZJBA 3FPAA 3VR2A 3U3RA 4DB4A 1IXZA 3LW8A 3RRYA 4AYTA 1KKMA 4DVGA 1F2UA 4KFRA 2Q0HA 1ZC4A 1U2RA 5IT5A 1JR3A 3A4LA 4DEXA 1G19A 2DCUA 3I73A 5HCIA 1HYQA 2NO7A 4HZUB 1R5BA 2BJWA 5CJPA 1TBOA 1N5KA 1UDWA 1BO6A 3LRPA 1P2VA 2ZU6A 3REFA 2VHCA 1G3RA 5FPYA 2XOKD 3SR0A 3Q5EA 2DPXA 2Q21A 2XSZD 4B43A 3K0FA 4FCTA 2X19A 5CYPA 2GCNA 1BH2A 2FV8A
chains in the Genus database with same CATH superfamily
2XT6A 4HNHA 3ER8A 3IUYA 2JG3A 3ESCA 3RU3A 1EFVB 1VE1A 4D81A 2QNBA 1G3MA 1NP6A 5CPBA 2YXPX 1V2GA 5A0FA 5THQA 4DB2A 1RHQA 2I33A 1LR8A 4UXJA 2W6CX 2YYAA 1R4NB 2HJHA 4UUPA 3UJDA 4A8JA 2O5VA 5MDHA 1BMDA 2BSAA 1HT2E 1XDWA 2D1YA 1VCNA 3IQGX 4OHXA 4YREA 2YDYA 3LKDA 4E5UA 2WG0A 1QHIA 3O5AA 2NV2B 1SY7A 3M83A 5AR1A 1O6BA 5GAJA 3HR8A 3RRMA 3OEWA 4XAQA 2XQFA 1UPBA 4R2LA 2YS6A 1DKRA 3SEKC 4AWXA 4B47A 5LYJA 2KLHA 4BU1A 5ADWA 1JEJA 3KSAC 1B8PA 3UJ9A 1FDIA 2EJCA 2W6ZA 1ZRHA 2PIAA 2XZLA 3EVBA 1ANKA 1YMQA 5AJTA 5E8JA 2BGWA 4S05A 5FEUA 4G07A 1QLWA 2IPLA 4CIYA 1JEYB 1NI4A 3P71T 3GGPA 3HCBA 3V8MA 4C2BA 2X4DA 1RJ9B 1R6AA 1XU7A 4HDAA 3MMSA 4XB6B 1FFXA 1Y89A 2HCRA 5LC1A 3E7PA 4YQYA 2QRZA 2VLIA 5KYYA 1OAOA 3NBZC 1DELA 3QBVA 4PHFA 2I2BA 2QP9X 4FM9A 2EX4A 3HUUA 3KFXA 1RU3A 3N0WA 5G4LA 5EMHA 5JJIA 5FNVF 2EKDA 3WGTA 4W1PA 3WLLA 5K8LA 5IHXA 4MRVA 3P0RA 4RA6A 4A0GA 1AF7A 1FNCA 4CEJB 3ADDA 4V0ME 1AH2A 1CE8A 1DBPA 5M3BA 1PW5A 4Q1VA 1FZQA 1XLTC 5EQDA 4BNXA 4IKPA 2CEAA 3NKFA 4ZZ3A 5AI4A 3ZGXA 1RAIA 1DFGA 2RBGA 3M5PA 3W1WA 5MFZA 1GGNA 2ST1A 2RHBA 3M4JA 4HEHA 4X61A 5ALPA 1DIOB 5CLGA 4L0MA 1SGWA 1BTOA 1TA9A 2XX3A 3K0CA 3KXIA 5K2MA 5BN3A 3B1WA 3ZE2B 3AUUA 2IZ0A 1J1ZA 2IS4A 2GM3A 4F4CA 1TD1A 3IP8A 3IURA 3P5BA 3PIRA 3O8NA 3H17A 3I9FA 3CX3A 4US1R 4EF6A 3VR4H 1QGZA 2GPJA 4PPGA 1EZ1A 4ND4A 1CT4I 5CCLA 1ISPA 3D3WA 4D6YA 5C7OO 2O4CA 1ABBA 5KC9A 1VGVA 3HO6A 3QENA 9WGAA 2O3SA 3OXGA 3LXUX 1AS2A 2E5FA 1VLVA 3FLEA 4TPKA 3DBLA 3ZD8A 5BQXA 2OUIA 4X62B 2H57A 4CF7A 1RPZA 2BTQA 1TM1E 2XWJI 4CN8A 3A27A 3IHLA 1L2TA 3U3ZA 2ZE8A 1QBGA 3HCDA 2O3TA 4XFJA 1E9FA 1PUJA 1W73A 5K0LA 1R16A 1VHDA 2DGDA 4GICA 5C4GB 1AD2A 4DCMA 3GI1A 3BIJA 3SZRA 2EJWA 2PGJA 1Z5PA 2HF2A 2YV2A 5CDFE 2X40A 4TQAA 3VR5D 5G1OA 1JDPA 5TS3A 5TF4A 4Y6RA 1Y1BA 3C15C 3CB2A 4GBJA 4QOEA 4KKXB 2I9KA 4WHMA 4GOKA 1Q0RA 4CZ2A 1RLIA 3Q1KA 2VPIA 3GRPA 2EQAA 1DV1A 1C9JA 1BXRA 3EZFA 3ISVA 5DP2A 1PQPA 3D3QA 1PVOA 3MTGA 8LDHA 1DHRA 3TG8A 1JHYA 1NX9A 2XY4A 3D0OA 1CY8A 3O91A 3LA8A 2FMKA 4G9BA 4BZPA 1FDTA 4K5QA 4HNTA 2RGGA 3A4NA 5M34A 3D7KA 3E82A 3A11A 3HNPA 2Y05A 3ESYA 2IWHA 2QX8A 2WTMA 2IYEA 1MRSA 5BXYA 4EZIA 2YWHA 1ZHOA 2E49A 4B3RB 1Q0SA 1UEIA 2WPNA 1G16A 3Q9LA 3LQYA 4RLQA 1HWYA 2C9DA 3TO5A 1AXRA 4RPKA 1DAHA 1F8YA 3RADC 4BMSA 5CCXA 1L5VA 2R6CA 2H1FA 3EGEA 3ESRA 3NUQA 3QXJA 2QP3A 1MJBA 1W46A 3AY3A 3R44A 1OLUA 2MSWA 4RHUA 4X84A 2OD1A 3UUWA 3K05A 1II8A 4BBZA 2F2TA 2IIVA 1ESDA 4KPUA 1O08A 3LGAA 1ATZA 1U4NA 3M0EA 4KWCA 3S8YA 3LF1A 3KYJB 4I2NA 2J87A 2ILTA 2JGAA 4KSBA 2ZYSA 4GPIB 4JUFA 1VPDA 2NU8B 6NULA 1XNJA 3G9ZA 1KK3A 1Z6XA 3K35A 4QAJA 4YAJA 1WBDA 1UC9A 1Y1RA 3C4JA 1E9SA 4P7FA 1KK1A 3EUEA 5CX1B 3O2JA 2WW8A 4EBFA 3VAZA 1ECBA 3T54A 2DUWA 1IWBB 1CY6A 1YJQA 4K1XA 1FS4A 2WG1A 3KQTA 1GGFA 2LW7A 2BLNA 3AINA 4JLPA 2WFLA 3EGIA 3VZCA 4LG1A 4DN6A 3ADBA 2C7PA 1H23A 1U3FA 5JJ5A 3CMMA 4MJLA 1ODKA 1I6LA 1ICEA 4J4HA 4KRYA 5JG7A 3EUAA 1CJSA 1R4AA 2B1IA 4LV8B 2WT8A 4OGGA 4CM7A 4W5OA 4C78A 1J56A 4TLEA 2HTFA 1JRLA 1UDBA 4WXPA 1QVRA 1Z8FA 4NYMR 3AR9A 3ORYA 4O59O 2VUIB 3JTEA 2AOUB 4JZYA 3QSYA 2QLTA 4EY3A 1G18A 4CETA 5DNVA 2XRZA 1XXLA 4RMGA 4LF9B 5TGZA 3OTOB 4B2PA 4OHRA 4L7QA 4H3SA 3UATA 1MJGM 1UAYA 1Y7HA 3UMYA 2OBLA 3DDHA 2P67A 2IZ1A 5CB4F 1WCIB 4PVDA 5BQFA 1I4LD 2CF6A 4Q7MB 1XELA 1P18A 2IOQA 4FDUA 2NSHA 3F3YA 4XJTA 2GBPA 3Q10A 4TN1A 4GS5A 1CS0A 1EDOA 5TT0A 2C20A 1MD9A 3TEFA 2NT4A 1D7AA 3K30A 3SK0A 1C2YA 4JELA 4K40A 3LLUA 3S4YA 3JAWB 1II9A 2XGSA 4XJXA 4DREA 1R10A 3ORQA 1G291 4FOLA 2PJRA 1O89A 2A3RA 3N3AC 2P68A 4FYWA 4RABA 4FMCB 3ZOKA 3T4UA 1A2KC 2CL6X 4WNYA 3ICCA 4FDVA 4O3MA 2VCYA 3DHVA 3BHNA 3RFCA 2EYUA 4EQ6B 2C3PA 1E9EA 2H5EA 2JIOA 3BMNA 1H2WA 4CIVA 2DFVA 1AS0A 4HZUA 4KL8S 5BV8A 1XDZA 3SKYA 3J80A 4CLDA 4K7JA 1U31A 2OCAA 4OXNA 1UBLS 4QXAA 5BWNA 1MJFA 4N3CA 2GZ1A 1JHRA 1TBQR 2VWQA 4KK3A 2IPNA 4O6VA 4OXIA 1B6SA 1HT3A 5HE8A 1D04A 4AS2A 5KIAA 3L6UA 1H9CA 2VEDA 3EVDA 1DIAA 4C05A 1KI1A 3E23A 3OIVA 1RZ3A 1VMAA 1J70A 3ZZNA 2VPYA 4CU2A 4DCSA 1S6YA 3RJTA 5FPHA 1E2DA 4QNNA 3V9AA 3CVUA 3SZ3A 4CL8A 3EY4A 3GLFA 1J39A 4ML3A 1HDEA 4G0NA 2Q29A 3DFFA 3KU4A 2ISQA 4DC0A 5HYVA 2J4FA 3LQ4A 1IUNA 2E7ZA 2XBUA 4CLRB 4GR9A 1EFVA 1JLMA 3A6HA 4OHOA 4Q7JB 3ZN2A 4AB1A 1BJTA 3RC7A 4GEKA 3FDXA 2PWBA 3O8CA 1AN1I 4BCBA 2EQBA 3GJYA 2BI4A 1R4NA 4YTEA 5E1MA 3ZVRA 1NUBA 3OH8A 3PP8A 2NVUB 1G4AE 1UJ2A 4LE2A 1XCGB 2V96A 3S2YA 2P1DA 4F9TA 3T7DA 4KU4A 4F85A 2IE0A 1Z5WA 4LYFA 4QTZA 4OI1A 1VPLA 4EK9A 1U3WA 3F8TA 1B41A 5LLSA 2ENZA 3DBVO 4HQKA 4LYHA 3WI7A 4G1MB 3E3MA 4JI7B 2HH9A 2YVUA 5BYKA 1YS2X 4YIHA 1L7DA 3ZY4A 2GEBA 4IZOA 4HB4A 5BUCA 3LCJA 2GHQA 1E99A 2G9VA 4KV7A 4WXRA 3MD0A 3PPWA 1X42A 2D7CA 4OBXA 3TW4A 5JFGA 4K2AA 4LKOA 5AIAA 2AFVA 5LBUA 2JGJA 4WDRA 3T1QA 1RJ9A 2NUTA 1RRVA 2W0TA 4AMZA 5L6LB 4L8GA 1MKYA 2C5GA 4NP6A 3OT4A 4PM4A 2ZCJA 4M4SA 1C1XA 1E3IA 2I6SA 1IQRA 1SVUA 2D1FA 4I2VA 5D2CA 3WG9A 2Q41A 1AVTA 3MJEA 1EFUA 6LDHA 5FEMA 5TX7A 3NXKA 4YB8A 5EX3A 3GJTA 4JB2A 2OWEA 4MV9A 4FYKA 2PXAA 3EQ8A 1YBAA 4CEJA 5C7LO 5DIFA 5IASA 4PHCA 1GR0A 4FP9A 2F3CI 3OEEA 4AAYA 2W2TA 4A0QA 1T26A 3IBGA 3JWJA 1CVRA 1P2FA 2A0KA 2FPRA 2ID4A 3PLAE 1L1EA 3KJEA 1PZMA 2YY5A 1SBZA 5CTAA 2F1JA 5JVDF 1FARA 2OORC 4B7XA 2QL7A 1UXIA 2FA9A 5F23A 1M1YB 2WAOA 1NBEA 3A3KA 2VSQA 4S0XA 4BVEA 4CMCA 4M8NE 2IZZA 2VNKA 2JDIA 3HN7A 2CE7A 3WLTA 4BJ5A 1MVNA 1KS9A 3GW8A 5DE3A 2PBFA 1MBZA 2ZB3A 5ALSA 5HGXA 1B1CA 2IP4A 4H1VA 5AM1A 2Y76A 1IXSB 5ER9A 4PX3A 1B76A 1RCUA 2OPBA 4ICIA 1TA4A 2YZNA 4B40A 3TFWA 2MCFA 4M0CA 5HNKA 3GJ4A 4MQ6A 3G79A 2PYZA 4ESVA 1E1KA 3L9XA 1QIFA 3S0JA 2GZSA 1KU0A 3CA8A 3GJ6A 621PA 3SYLA 4JJIA 1H2BA 1L4KA 3YASA 3TLMA 4U2EA 2Y1DA 3C3CA 1IHUA 1BHQ1 1N3YA 2OAQ1 2YN0A 3PF9A 1LVHA 5AJWA 5A4DA 3DLIA 2V0CA 1EWQA 1FRVA 4CRWB 3PI7A 2FQYA 3O2NA 2A9RA 2G3YA 1AUPA 3NG1A 4JMPA 3SE7A 3PC4A 3WIEA 3GLGB 3D02A 2KM1A 1UJBA 1LTKA 2AUNA 5EUCA 1HH4A 3MK31 2YHIA 3CLUC 1JTFA 4F2DA 5AVYA 3L8CA 2QT9A 2AGVA 2VA8A 1WU8A 5A02A 2JJ2D 3L5KA 3MILA 3CW2A 3LCVB 1KC3A 3OJ0A 5AW7A 1W4ZA 2NU4I 1F60A 1XL1A 3H1TA 1U4OA 1SZCA 4IR7A 1EUZA 4ZVOA 3SX0A 2RCNA 3AIMA 2DR3A 5L51A 4KR2A 3W3AH 2RB5A 2BFOA 4HXFB 4GI1A 2A4KA 2Y0BA 5C5IA 2X6TA 4J3FA 3RO7A 4YECA 1EGHA 1SEPA 4YV1A 3HVUA 1JPUA 4YNBA 4AWAA 1VQ1A 4O33A 4DR1B 4OHPA 4HCJA 2ABWA 4M87A 3ZK7A 1S1MA 5DF1A 1VJ5A 2JAUA 3PRYA 3ZWXA 1YZGA 2CV0A 5K6RA 5AHWA 1KIFA 2H8GA 1R3DA 1ZICA 4H6WA 3Q3IA 4UU1A 4EPRA 4M2LA 4E5VA 1P33A 1X1QA 4CODB 4L3OA 1UADA 2Y0PA 3HLTA 4R40A 4WL0A 3RS4A 2VTDA 5J2TB 1I2AA 3P2YA 2AOTB 3PXCX 3C87A 3LX5A 3CXLA 1OUMA 2HFKA 1ZBQA 2PAAA 2PKQO 2ZTSA 4MR8B 5CW1A 1WR8A 4NYJQ 1VB5A 3REOA 4CUKA 1I7DA 1QV7A 4J0FA 4D9HA 5CNMA 5THXA 4AJKA 4CYMA 3E27A 4N5IX 1CK4A 2QHXA 1BN6A 5LLTA 3W5DA 4IMRA 3PIDA 2N75A 1KA9H 3FD8A 4J4BA 1ODTC 4CGYA 4UE6A 2AG8A 3KDPA 4RSGA 2WA2A 4CMBA 5I6DA 3IX7A 4ESOA 1NULA 2PZAA 4IGEA 3BWVA 1YZUA 1Y5MA 1GILA 5FAXA 1CWUA 1WQ3A 1N2JA 3OWOA 2I66A 2EC5A 4MARA 4QUJA 4RGVA 5HQTA 2IYWA 3KTFA 1YQGA 2XUJA 4HEA6 5HF9A 4B6RA 5HR5A 4W1RA 2AMFA 1QYIA 5EHIA 5E7QA 5AWFC 1CS4C 1INLA 4JSYA 4RHYA 4IDNA 1QH8A 1HQYE 2YN4A 4AP9A 3OJLA 1YO6A 4J1TA 2H4FA 2R7MA 3TJMA 5K99A 5BORA 1M6YA 9MHTA 4LN1A 2OHHA 4D5GA 3JR3A 3DOFA 4GPBA 1Y0BA 1F0NA 2AOUA 3GFQA 1HKUA 1QIGA 3K5IA 4AJJA 4EENA 4RM3A 5ABPA 4NMMA 1YJAA 4HNAA 3VZSA 2VJCA 1AO3A 4B84A 5JYBA 1KPIA 3IPXA 1IYZA 2A9FA 2JLQA 4L50A 1SHKA 2UYQA 1DXOA 2PX4A 2PUGA 3VDXA 2JANA 2KI5A 3E9EA 1WCIA 5BSEA 4V0NA 1W76A 3LDFA 4PANA 4JV5B 3L82B 4P2BA 5DWVA 4P5EA 4DM3A 5JUWA 2X5NA 2CYBA 1N75A 3NHKA 1Y1LA 4YR9A 1W581 3MERA 3VTKA 4HNUA 2Q46A 4JQZA 4KVZA 2O8BB 4BNMA 1GL3A 2GAIA 1PR3A 3KZ1E 3QNMA 3TLGB 2OOSA 1UMCB 4B17A 4E5YA 1PWYE 3EPKA 3G8AA 3A6PC 4HXGA 2ZWIA 2O14A 1TECE 4PYMA 1FYDA 4PX5A 1V1JA 2N52A 2WJ4A 4FI3C 1XJWA 3ZK9A 1A4RA 2DHCA 5JWRA 1L4LA 4L0DA 4EQ6A 5IK2A 1RJEA 3LBHA 5KKAA 3DDSA 1QK5A 3C7KA 4PR3A 3WOVA 3QF4B 3SJAA 3O21A 2FN4A 3FOCA 3HP4A 5E2AA 2X2EA 4LMPA 1H05A 4YAWA 3WQHA 2B78A 2J08A 5IM4A 2VP2A 4YXFA 3OOHA 4CI9A 2FUKA 1MIOB 4DJFC 4IDQA 2EZ8A 2XBMA 3B5IA 2PXHA 3K4HA 1KSJA 3KJXA 2K7ZA 3L0BA 4MQMA 5JDCA 4YV7A 4BFTA 2X8JB 2DLDA 5I8WA 3EDCA 3UXMA 1OA0A 1DG3A 1NF8A 5C1BA 2G82A 4BLPA 1MHTA 4BMPB 4CLRA 3UKJA 2J8ZA 2O5CA 1RAGA 2INGX 3S29A 4PN7A 1EIZA 1OWPA 2JXDA 2IRWA 1EFRA 5AXAA 1DRUA 1Y1TA 2NVUA 2Q07A 3R5XA 1Y5IA 3LCRA 3QYJA 4I6EA 5LMNB 2KCXA 5SZIA 4E31A 1O1YA 3MB8A 3O4IA 1Q50A 3P32A 4IHJB 4KWEA 3U4CA 4NH0A 4YRFA 4PAMA 3V6LA 1JWBB 4YAFA 4QBKA 4BLRA 3IDQA 4U9HS 3ZG6A 4BPBA 1JXQA 2GILA 1DWQA 1XCBA 2G9UA 4AJ4A 5CJJA 3EPJA 1KVSA 5E7MA 1IN8A 3GY0A 3TTSA 2CC2A 2CLSA 1DC5A 2QTAA 1Z6GA 4JT8A 3GGSA 1U2ZA 4PFKA 5IAGA 3ORFA 1W2HA 2F8LA 4KXLA 2ZUSA 2I2XB 4DDKA 4IW3B 1Y3BE 3K6JA 4BNVA 4ETMA 1WPQA 3AHFA 1GN8A 1FF9A 2Q0QA 1F38A 4MW9A 1PIWA 3OT1B 3IEIA 1AZWA 1D2HA 3A28A 1KQ3A 5BYJA 3PGKA 2FGJA 3BERA 1TZJA 4D3DA 1FQOA 2ES4A 3AF0A 5CU7A 1FC0A 4YRRA 1FYVA 3RV3A 2O0KA 2DBVO 4QYIB 4FFNA 4EB0A 4IDCA 5HG0A 3IMFA 4C21A 3MQ2A 3FPCA 3HA2A 1QWOA 1WEHA 2WM2A 3KTOA 4XFDA 3RTCA 3K16A 5ETJA 3ER9A 2C95A 1BAPA 3DMDA 1M8FA 3QF7A 3DC2A 5FYDA 3BFKA 4K8RB 5BRAA 3A2KA 4QU8A 2KMLA 2ZJYA 5TEWA 1M1YA 2WT9A 4TM8A 3FRJA 2CWGA 1JR6A 4OAOA 2XWPA 1EFDN 3NIWA 3C98A 3QOXA 3A70A 2XRFA 3KHKA 2GWRA 2VYFA 5ALIA 2B1QA 3BBLA 3VE5A 4YAEA 1B43A 4YCDA 4HFRA 5DI9A 4CJXA 4FB4A 5I4CA 3AX6A 3KP1A 3RRZA 1ZGGA 1G9TA 1PG0A 1XTUA 4PX9A 5DSXA 1E89A 4X3OA 2NZUG 3LIIA 1YB2A 4OXXA 3U5TA 4N4AA 4PFJA 4RVGA 5IU6A 4DHEA 2JLXA 5BSWA 2XMPA 1U5KA 2UZ0A 4XJVA 1N5IA 5MN5A 4MKIA 1JPNA 4X8HA 4UU0A 2GWHA 4OI2A 2OY0A 4E2WA 4X5OA 4Q93A 2Z30A 4HS9A 4OYHA 2ZRBA 5LP6B 1H8HD 2NVWA 4KE7A 4GLBA 2LVBA 1J97A 3GGCA 4FOPA 3IOYA 4JUAA 1Z75A 3PL5A 5HIAA 5IT9A 3NR2A 4UFNA 1Q16A 2G9NA 1YB6A 3ONWA 3KQMA 4I50F 3W5CA 5ALLA 1XMSA 3O2SB 3F3KA 3UF0A 1ZIPA 4INPA 4XWYA 2X8BA 2SKEA 5I51A 3HO1A 1QPBA 1ZA1A 4J49A 4PYIA 5JJCA 1C4XA 3EGXB 3O38A 5KTNA 4CMGA 3BTOA 5T64A 3MCZA 2DB3A 1SUEA 2B0UC 1NFFA 3VO2A 4EO9A 1YASA 4KVAA 4BCCA 1OREA 4QDTA 3RR2A 5HVNA 3F71A 1NXQA 3GBSA 5EKUA 1BWPA 4KNVA 1V9LA 4XVQA 3I64A 4UUNA 5JNWA 1X7ZB 2FZWA 3RTAA 1A4XA 3NWJA 1X74A 1RZRD 3H5TA 2L42A 4U02A 1ENZA 2ZXFA 1GSOA 2QMHA 2FZEA 2ZWPA 3C6KA 2P30A 3E2IA 3G59A 1BRTA 2BGIA 1SOMA 3GCGA 4U0JA 2G1AA 2GFIA 3KQVA 2WJIA 4MW2A 3O3MB 4DIFA 2NU9B 1YDHA 3WNVA 4CEHB 3SEFA 1ZI6A 4I99A 3LFHA 5DX8A 2E4UA 5BYAA 1ZHHA 3GJ5A 5DYYA 1KI6B 3HVJA 5E9JA 4RS4A 3KKQA 3PGXA 4MR8A 5B1IA 1B23P 2HPHA 2OHIA 3A4VA 1QKKA 2VT7A 3UV3A 1RAFA 2HXYA 2K2WA 1M2GA 1DDGA 1L5ZA 3FCEA 1OWNA 3HJGA 4R68A 4Y1RB 3N7UA 1NG9A 4S1TA 2BFDB 3TOVA 1Z08A 3M6UA 3A0RB 4B6QA 4UUBA 2Y99A 2YW2A 3G02A 2GYYA 5GGYA 1N6PA 1Z25A 1SVSA 3SBEA 4E46A 1NOIA 5CFQA 2XMSA 3BKWA 3CX4A 1BGVA 5DEIA 1SCDA 4N47A 4DBLC 3IUQA 4R54A 3TEMA 3RVPA 4EELA 3IAAA 3CR3C 2FPIA 4RIGA 4ATNA 3ND7A 1IQUA 3I72A 4EY6A 2GB4A 1HDLA 1LPOA 2B2NA 2HLDD 5DP1A 3DBIA 3OJEA 1XLVA 3SDBA 5F7XA 4CCYA 3WBFA 2OK7A 4JODA 3D8RA 1UWCA 1E5DA 2ODAA 5ALEA 3RS5A 2PUJA 4GW3A 1T0IA 2R8RA 3JQAD 4QO8A 4HFJA 5DBEX 1WMFA 3E8SA 1FVXA 4RV5A 2ZKIA 1T4MA 4TTRA 3VDNB 4DLPA 4EG1A 1Y81A 4DMUB 2JI8A 3MHPA 4QATA 1L7OA 3AKEA 3FKJA 3P2OA 4FOSA 4EI8A 5IUNC 2NMVA 4J3JA 1CU1A 1HLFA 3KKLA 2H08A 4K9LA 4MVWA 2XB6A 4KYVA 5TGTA 4F4FA 3LUBA 5A62A 5GQSA 4LISA 3SFZA 4ZHQB 2EWMA 1VJDA 3H2KA 2AVDA 3T7TA 4BZWA 2I4MA 4OFXA 3P2KA 2WVGA 3H99A 5FH9A 4JKIA 4AO6A 4E0BA 3ZDYB 1UC5B 2WMOB 1WHSB 4Q05A 4RZQA 2O8BA 5IRCD 3CPEA 1W44A 4G36A 5LZ7A 5E95A 3NEJA 3TLGA 1P45A 3WC4A 1UIMA 4C0AC 2ZVPX 1XD9A 2IYNA 5CGZA 1V2HE 2H7XA 4QBIA 3M5WA 3TSZA 3GELA 3TBKA 2VNJA 2E4YA 4EP1A 3HCFA 1UBSB 3DMYA 3HBFA 2IY7A 3R7NA 1ID1A 4NPAA 3A1DA 3W2TA 1CY7A 2QLBA 1ORHA 4QDJA 1DPFA 1EUDB 1LS1A 3OU6A 2ZULA 2NN3C 1NVGA 4K05A 4LF5B 4C43A 3T15A 5K0FA 1O5IA 5LR6A 1U6KA 4XB2A 4X1IA 3TZBA 3LOQA 4KGVA 4B44A 1IE3A 2OLJA 1M2EA 3Q7RA 2IHZA 3K32A 4B4VA 5CG2A 2X8JA 5DGIA 5TQVA 3OOSA 1T1SA 1V5WA 3AIKA 4MITA 3UWOA 2OKGA 3NMUF 3HH8A 1DP4A 1HTBA 3OBIA 1OT5A 2IYRA 3PJEA 4BB6A 1ZH4A 1SQ5A 5DLDA 2DY1A 4JJ8A 1KH2A 3KOOA 3SGQI 1NVAA 3MJSA 4D46A 2CVHA 3HXQA 3WL8A 4R9RA 3AOEA 4PG5A 4Y1FA 4ASUA 3GRYA 4UDYX 2VDUE 4ZV7A 4Y2SA 1XZFA 4FLFA 1U5AA 1Z36A 3RC1A 5AKEA 1SHTX 3G7SA 3BF8A 3R24A 2DIPA 3IP6A 3R0ZA 3WQBA 1XZPA 2SKDA 3EXG1 3RTDA 2WD9A 3WRXA 2ELIA 2WM8A 3RS2A 1P1FA 3G9UA 4J0DA 1KC1A 3IQZA 4HOYA 3UCEA 2X0DA 1MN6A 4KR0A 1W9MA 3CINA 4TMKA 1DEOA 1L9XA 4F84A 3KY9A 2Z9DA 3ZU4A 3NFRA 3PDCA 3R5TA 4QU5A 1LV7A 3WGYA 4KQ2A 4EFMA 1LBEA 4QYSA 4PGFA 2VPZA 1WUIS 3VVMA 4IKOA 4Z7NB 3OT1A 1E2KA 4CNBA 1ABFA 3DUFB 1L5RA 4JZKA 1KK0A 1SUDA 5IS2A 1G5TA 2JAXA 2NO1A 4IV5A 4FS3A 4Q6WA 3HA7A 1D03A 4Y2GA 2XOXA 3DG9A 3FSRA 5C32A 4Q5IA 2DH5A 1EE2A 2DTXA 3ZI4A 1M2VB 2EU8A 3C2QA 4QLOA 2O8CA 3Q8XB 5BR7A 4TYYA 1ZIYA 1VECA 3BGIA 4MCAA 1E1YA 1U0EA 2EBWA 4PTLA 3QAHA 2C4MA 1RWNA 2ZM6B 1Z0AA 2ZBQA 4QWWA 3EMVA 4W9NA 3HV2A 1AZLA 1DAMA 4PRLA 2BGNA 2Q6OA 3I83A 4WE3A 3ZNPA 4TGLA 5F5NA 4E15A 2F3QA 2HM7A 1N3IA 5EZYF 4YRKA 1TK3A 2H5JA 3S6JA 5L95A 2RSLA 2DOKA 1ZCAA 3WGUA 4DG9A 3ITNA 4AURA 3ZUPA 4JR1A 2JGNA 4RMHA 1S9DA 5CW2A 4FS8A 4QSHA 3SAJA 2XA9A 1HFEL 1Z83A 1UBGA 4CM8B 4DV5B 4G23A 1FEZA 3AI2A 2O2HA 3G68A 4QFMA 4BP9A 5AQ1A 3K9HA 4DMKA 2O06A 3QXSA 4K03A 1XSEA 4HWKA 3QKRB 3CB4A 2QMZA 1XNHA 4BAGA 1ONPA 1JQEA 1L4UA 5DHAA 3UT5B 3F74A 3ZCTA 2POQX 5B4UA 1N6NA 1N2CB 3IIJA 3QEMB 2V5UA 3REFA 4IWYA 4KSCA 1XDDA 3CF0A 1UKVY 2J0VA 4KN9S 3VPSA 5IDQA 4N6OA 2GN6A 1E1CB 3GGJA 3MMNA 3V46A 5EJ8A 3HB5X 1IVYA 2P8JA 5DNWA 4DXHA 2J46A 3OP4A 2VT3A 4IS2A 3RWMB 4JI4B 1AGPA 1PJCA 3DZIA 3GT3A 2ODEA 4XM1A 3AHHA 4ZAXA 1UXJA 1RNLA 2QJOA 5T3UA 4ZTBA 2GEDA 2ZRPA 3AO0B 2KMOA 4DV4B 1GUAA 3D7RA 3H2YA 2AC4A 1ZD9A 2C7VA 3WP1B 4BP3A 5LKAA 5M2QA 4Y2JA 4Y0VA 4GLOA 2Z3VA 3AKDA 4PBSA 4OJMX 1RLMA 1W30A 4M8IA 1OWOA 3EGXA 1G6KA 2I4LA 4TXJA 3W3ZB 5JQGB 5B5SA 3RSZA 3VBCA 3B7GA 2UKDA 4QO7A 3BVPA 4JIGA 3PV0A 3LFUA 1RXYA 2WF6A 3NNDA 2IY9A 1F8FA 1B15A 2G80A 3FMPB 4YMWA 3HJHA 2GFQA 1Z16A 1X7ZA 4QXPA 4TWZA 4ZQHA 3TTWA 1F06A 1IMJA 3EHEA 1N5MA 2QLMA 3KPYA 3L4BA 3NUZA 4ZALA 4ZVTA 5H68A 2BFAA 3LYLA 5CH3A 3TXYA 2IZOA 2FSFA 3EEBA 1G1MA 2R6R1 3EGWA 3N2KB 5C7YA 3MWKA 5FV4A 5I4KA 1SZJG 2HRCA 3PTLA 2XCSB 2BMDA 4OLFA 1GPH1 3VJLA 3QVMA 4G2TA 1PGQA 2J30A 3RJ9A 1N0IA 1D1QA 1EXMA 3BTSA 3FZEA 4HB0A 1KI6A 2FF7A 1O96A 4JLKA 1EDBA 2O0MA 2ZUTA 3W2EA 4DV0B 4IJVA 4GPZA 5F9MA 3QFRA 3EXFB 3UCXA 3TJRA 4CM3A 3CVYA 3ELWA 4GI5A 3EF1A 4WINA 4UHFA 1EH5A 4RULA 2VHWA 2QW0X 4RKRA 4EUSA 3UB3A 4QPDA 3E9RA 4YJGB 5D3KA 2EX0A 4FVTA 1SXHA 3UENA 4ARUA 5EUQB 3RW9A 2X5OA 4GDMA 1HV8A 3GPIA 1FXUA 3QH4A 1YHZA 3V32A 3N28A 1ZGAA 1SCKA 3G2PA 4G5OA 4HMPA 4NPHA 2IHVA 1CQZA 4LBWA 5IZ4A 1W2WB 3QMVA 2WHXA 4Q3OA 2PMEA 1YCDA 3NP7A 4XYBA 4IUBS 5AHOA 3M1IA 1QORA 2OC4A 5EHZA 2GTIA 1FBTA 2F43B 4FYHA 4TVBA 4G0MA 6Q21A 1XVTA 1GNLA 3DE1X 2Y1FA 3OMWA 5EHNA 4XE5A 3TRIA 3WGMA 4ZAFA 3I9NA 3UN1A 2IXDA 1JQAA 2FWRA 4BVLA 2XDYA 3D8BA 5JDIA 1DEXA 4ZVMA 3Q8LA 2BLLA 4KREA 2NAPA 1GUBA 1BX1A 1Y5LA 3MJDA 3B6IA 1QIIA 1U2SA 3WTBA 4XYLA 5EFZA 2TSYB 4N03A 3NBFA 1T5IA 1ZUNA 3I6ZA 3O1IC 3CEPB 2WGCA 1L1FA 3WGNA 4QHYA 4J16A 1K4YA 2DP4E 4ZHQA 1WP9A 2H9IA 3COJA 2O3QA 2ZI5A 4HXYA 4DVJA 5JEEA 1AIPA 3MJ4A 1R15A 3SNHA 1XZNA 1O6ZA 3DNFA 4TT3A 4Q4HB 1JNXX 1C7EA 1WUTA 3UV7A 1UAGA 4Y2XA 3RRNA 1A95A 2HSDA 4TYPA 4WUTA 2HIGA 2FZKA 2H5IA 3MMZA 4MUKA 4WCFB 2G76A 2LCQA 4CWAA 5IYZA 2TYSB 4KRGA 4N6GA 3VVBA 2X42A 2PKCA 4Q0MA 4UU7A 1GA1A 4G97A 4G25A 1ST3A 4HLUA 3R3UA 1NU8A 1PR4A 2RGRA 2REQB 1BVUA 1NYQA 1WF6A 5F9FA 4ZDKA 2HMVA 1RWQA 1JSLA 4WNAB 5EIXA 1BWQA 1Y1QA 3BTVA 2IYZA 5EJGA 3WB0A 5CYGA 3AL0C 1IL0A 1EUDA 5KMGB 4B34A 3R0VA 1EXDA 2YXDA 1K3UB 3TQSA 4Q66C 3UKDA 1TUSA 2FP3A 2FSHA 3DAYA 1V9CA 4KDCA 1YS7A 2IOHA 4KDRA 2L7XA 4Q16A 4A6EA 2OV3A 1P6UA 1R74A 3Q3HA 4IO1A 2IGTA 1LW7A 3HU5A 2EQ5A 2XWSA 2PX3A 1IHYA 3NJ8A 2AIRA 1SU8A 5ISMA 1KO5A 4EB3A 1QRUA 1SELA 2ON6A 1AV7A 3OO1A 2C2BA 1R79A 2HDNB 3D6UA 3CRNA 1U1DA 3DMGA 4D44A 4XTCS 2Q4DA 5KB3A 1TK2A 4OI0A 1Z6AA 1XTBA 2JEOA 3RAJA 1JXOA 3WYDA 3ESXA 4EG6A 4RAOA 2JJMA 1U9YA 3E3OA 3MJHA 1V95A 2AG6A 4KQIA 2QGNA 3TAUA 5BPFA 3AU8A 4M1OA 4N65A 1J06A 2JIZA 1KH1A 3VPGA 1XAHA 1NGSA 3HP1A 3EUFA 5ALFA 3ZHVA 4ZGGA 4PFQA 3DYIA 1F20A 3PA6A 4CHTA 2WIDA 2I6TA 3G2KA 3LQQA 3OM8A 4NF2A 2GRAA 1V96A 2E2WA 1IHXA 4JOQA 4B8YA 5SY4A 2DECA 1B8UA 5EESA 2HJGA 4EG0A 2GETA 1R6DA 3CWZA 4C06A 5KVQA 1J25A 4KWTA 2JZMA 2WE8A 2WNIA 3L7JA 3DM9B 3GLRA 4R2MA 4E09A 5L7YA 1J23A 1NQWA 2IUEA 1YKSA 3GJRA 4NYMQ 1RQNA 1WB5A 2FOIA 3UAXA 3KQNA 3KVRA 3H9BA 4JD5A 3FFAA 1PHPA 4BB0A 2ZJZA 2HBRA 2VYND 3LPAA 1SO8A 4JR0A 4C4RA 1SOUA 5IVPA 1FTNA 4ZDIA 3QBEA 4AKIA 3H6HA 4QNRA 5CITA 2HWXA 1TYEB 1RPTA 2QP4A 4YJ2B 3W8FA 5A6SA 1XXHE 4L6AA 3KYDB 3JQEA 1ELOA 2BUAA 3KUCA 4U6NA 2YRFA 3IQXA 3MCTA 4G24A 4TL7A 1M2VA 2JCVA 2YTZA 5J2UF 1TPYA 1WHTA 1AKRA 1C7IA 1N9ZA 1OBVA 3NHLA 4WCVA 3LXMA 1QYRA 1GPLA 5AKKA 5AW2A 2HY7A 3BHIA 1T6NA 2JJYA 2NTEA 1MZPA 2UXDB 2V54A 1Q7TA 4M1TA 2I2DA 1ISIA 3DLPX 1EAYA 4QEZA 4DIBA 2AZXA 1LPPA 2QN6A 1GKKA 4WZAB 2BFBB 1S89A 3A26A 3RCBA 4ZJUA 5HK9A 4U7JA 3SWWA 4YT8A 3OAAD 4RCZA 4RHEA 4Y2RA 4YA6A 3TK1A 4P86A 1JFTA 3HGMA 3ONNA 4XD7D 2WA1A 2FMHA 2RJ3A 2BDTA 2WYUA 4LDJA 1NP3A 4F3YA 4PG8A 2PKWA 4MQEA 2XNSA 1XDGA 4CM8A 4YMGA 4KODA 3BGOS 5B7NA 3S2ZA 1JXMA 3IFSA 3AH8A 4G37A 2DM6A 5AM5A 1L4BA 3PGA1 1VRWA 4OQDA 1PK7A 3U31A 1E9BA 5E3QA 5F21A 2DUMA 5KHOC 4PIVA 4GRAA 3GXBA 3COSA 1WB6A 1N0WA 1EWVA 2WUGA 3MWLA 2PRJA 1FSZA 2J3DA 3UGIA 1W9HA 3OZRA 2DRIA 3QEMA 3QGMA 2HNBA 2UZ1B 3PQ4A 4X41A 3G7UA 3E1GA 3TQQA 4HEA1 4LGVA 3EWSA 2EZTA 3FY4A 3KELA 1E1CA 4J07A 4KC0A 4DADA 1Y6ZA 1C41A 3QEKA 3GUHA 3ZJYA 5BYBA 5EWLA 1M8JA 3T06B 2JLWA 4EM6A 1NXUA 2YWBA 1IFXA 1VL0A 2WIAA 3Q3GE 4GI3A 4F5WA 4DLKA 1QE0A 3KJIA 2P6MA 1X70A 2FJUA 3I76A 3IMCA 2IKSA