4UXHA

Leishmania major thymidine kinase in complex with ap5dt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
173
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVALMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 49
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxhA01
3H84A 2XTMA 4GP7A 4W5WA 1KSFX 4D2IA 2ZUCA 1W4RA 1Q3TA 1E0AA 2OCYC 3UG6A 4NCHA 1QVRA 2DWPA 5D3QA 1ZRHA 3LBNA 2IYYA 4D0GA 2D2EA 3UMRA 3WHKA 4Z1MD 2JLUA 1TMKA 1NMZA 1FX0B 1ZUHA 121PA 2J0UB 421PA 3B1YA 4EFNA 1T3HA 2WWFA 2PZFA 4XWOA 2QBYA 4PTLA 3ZIAD 4CDGA 4EQ6B 4EUNA 4MRVA 1AS2A 4Q9JA 2ZSAA 3F3YA 3FKQA 3EPKA 4RY2A 2RB4A 2ZTSA 1W5SA 3I4LA 4ESHA 4LI0A 1D9XA 2ONJA 3T15A 2V6IA 3GJXC 2C99A 3IIJA 4I1SA 4IEIA 2JLXA 1NL3A 4TLEA 1M6NA 2REBA 4ABYA 3QPWA 3U7EB 2D3WA 1XWIA 4F4IA 2OAQ1 3FDIA 2WZQA 3L0PA 4U02A 4XVUA 2ZVPX 3LW8A 1Z5ZA 4KXFB 4Q1CA 3S1AB 3GLFB 2FG5A 3U7HB 4LOAA 1DOAA 5A5GA 2W6JA 2ZR0A 4POAA 2GCOA 1LFDB 3KXIA 3LD9A 4EPTA 1KAOA 3CBQA 1G8GA 1VYTA 1GRNA 3OFNA 3GLIE 3LV8A 1AZSC 2ZJBA 5IRCD 1FUUA 1G3QA 2BC9A 2QUZA 2I4IA 1CS4C 1RKBA 2FSFA 2RGBA 1DS6A 1LY1A 1M74A 1TF7A 2MSEB 3Q85A 1DVRA 4GDFA 4M9XA 3UFFA 5E7JA 3SFZA 1TU3A 1W44A 3EW9A 4G5QA 3Q9LA 4A0RA 2EW1A 2G0NA 3TGPA 4D6PA 5JFGA 2FGJA 1L4YA 4Q7JB 1EESA 2ZM5A 3QE0A 3QEJA 2WOJA 2Z43A 2PBRA 1CP2A 2J59A 1UBGA 2BKEA 1N6LA 5GJCA 4YMSA 3PIRA 4FD2A 1QF9A 5KDDA 1KI1A 4NMMA 4FMDB 3AVPA 4C7OB 2QTFA 4D26A 3C5CA 3F8TA 3CXLA 4LWZA 3AF4A 4XOIA 3KY9A 2CE2X 2V4ZA 2ZSFA 3CF6R 4JSTA 4Q1BA 1G4UR 5FBVB 3AKCA 4MITA 4BPBA 3AVTA 2VP6A 2EWWA 4A2WA 1CRPA 3W90A 1DEKA 1UEIA 2R65A 3KJHA 1A82A 3CO5A 3UIEA 1SKYB 2F9LA 2QPOA 4BFTA 1AKEA 1FARA 2RGDA 4S2EA 2ANCA 2WV9A 3NBXX 5IK2A 5BYJA 5AK0A 2IUSA 4MUBA 4Q03A 1JR3E 1FNNA 1IXSB 2FSIA 3CUEF 3FKSD 3PENA 4JYBA 3LDAA 2H18A 1XX6A 1KZGB 3IPXA 4GFDA 4XTCS 2IYQA 2VYFA 3B1WA 5G3YA 3DDCA 3KKQA 2ODWA 1VMAA 2CCJA 5K8TA 4O2RA 5EE0A 2FX3A 3CRQA 4B73A 2AK3A 2IUUA 4TMVA 4IXNA 3VR3A 3NTUA 4MYUA 1K5DA 2F1RA 2C9OA 3KXLA 2ROWA 2QU8A 1DTSA 3AV0B 1Z07A 2QGNA 2O8FB 5EE9A 2YC4C 5EP1A 4TQUS 2BWJA 1A5TA 1KMHA 3CW2A 3R7WA 4B43A 1PVOA 5EXPA 1GNQA 2ZE8A 4C0AC 1DG1G 1H8EA 2CHQA 4TYNA 2O8DB 3W9YA 2DHRA 1K8RA 2ASEA 2IK8A 2EFCB 4H1VA 4IVPA 4LZZA 1OIXA 2ZRMA 1AZTA 1F60A 1M8PA 1RE0A 1VG9B 3TBKA 1YRAA 4XTRA 2WWWA 1F6BA 4XSGA 3MWKA 1KBEA 1NSTA 5F9FA 4MRSA 3GLGE 1T5IA 2Q3MA 4LHWA 4M1YA 2G1KA 2CHVA 1IOZA 1HTWA 4BECA 4US1R 2CL6X 1OV4A 4DSOA 4LHXA 3CZPA 1JR6A 2X1VA 2OSBA 3CRMA 3EAQA 5CK5A 5DGXA 3OF5A 1ZYUA 4QG7A 2GJSA 5L8VA 2DFTA 4K8OA 1HA3A 2ZE6A 1TUIA 4HAXA 1SVLA 1XD2B 4YXWD 1IXZA 2GCNA 1JALA 1NN1A 3SEAA 5K8IA 1XU4A 1LB1B 2E1RA 1BKDR 1Z6YA 4TMXA 3MSXA 5JJKA 2H1LA 5DI9A 5CDFA 2IF2A 4CEHB 1E2IA 4Q4JA 2JJ8A 3RS5A 1RJ9B 3KTAB 4DIEA 1W36C 2XTZA 2ZS8A 5AUOB 5SZKB 5JJLA 4JMPA 5EJEA 2R62A 1ZUIA 4E5UA 2ZYTX 5ANRB 1U0JA 1GOTA 1NLFA 1DAMA 1KI3A 2OCPA 1EFUA 2WSSA 1R8QA 4LBWA 4PQRA 2F9MA 2GAAA 2HXYA 4A0FA 3AUYA 3K0FA 2YWHA 4ON9A 3R8FA 3C16C 3OIUA 3HP1A 4HLDA 1FAQA 3TH5A 2XZOA 1KY3A 5JJIA 2E87A 1ESMA 1OYYA 4HAWA 2XGJA 1YVDA 1E9AA 4Q9IA 2PJZA 2IXGA 2XNDD 5AWFC 1P9NA 4RFVA 1UKEA 1JR3D 1W0KD 4BLQA 3QNUA 3Q7QA 4PSAA 2P6NA 1E2DA 4DLZA 3B60A 2QMEA 1Z28A 4CZ2A 1TQ2A 3TSZA 4ZKDA 3U7GA 2B8TA 3KQNA 1OXVA 3AVUA 1KO7A 1N2CE 1RRGA 1RRPA 3IO3A 1R5OA 4PQYA 4AYTA 4F4JA 1Q3HA 3SBEA 5L3VA 3VNUA 2BEKA 3K0CA 4LJ7A 4UXIA 3HDTA 4URUR 4MYCA 1G3MA 3W6OA 4P4SA 2AR7A 1NMYA 2YOHA 1GG2A 4G5GA 3TAUA 1G20E 5JCPA 5FOSA 3TVDA 3WNCA 2W6ID 1L8QA 3W6PA 4JJZA 2GKSA 3IHWA 3M1IA 1GL9B 3ASZA 2VSXA 4NHOA 1XEWX 1KI2A 3BORA 1XTKA 2ERYA 3AM1A 1YU9A 2GESA 1SULA 4PC1A 2O0KA 1KO4A 3BE4A 3UWOA 3CR7A 1ZP6A 4LDJA 3RC3A 4HAVA 4NKRA 3AUXA 5CDFE 2BOVA 1GIAA 1JQJC 1T91A 1ZM4A 5DI3B 4A2PA 5FTNA 5LD2C 3KX2A 2QI9C 5B30A 3HU3A 1LF5A 2YHSA 1E0SA 4X8MA 1YQTA 1W48A 1UAAA 1N25A 5FUXA 3D8BA 1U9IC 5E95A 5G3ZA 2ODBA 1IJFA 2RGNC 1IY1A 1A7JA 1KDPA 3VR1A 2IYZA 3B1VA 4B44A 1XEWY 4IDPA 2IS1A 1X3SA 2RGAA 3FB4A 3WY9A 1S1MA 2NIPA 2VA8A 4R98A 2H16A 1E9SA 4JS0A 1GVNB 1T5LA 4B3FX 1M1YE 3GLHB 2XX3A 3PEUA 1W36B 3VU9A 3QKRA 1HQYE 5HR5A 2HCBA 2H8KA 4A2QA 4JLVA 5KU1A 2XTNA 4EIWA 4B32A 2GBLC 1EFCA 2R8RA 4HB0A 4HDOB 4NP6A 3R9IA 3ZH9B 1E9RA 2CVFA 2QE7D 4LK2A 5FTLA 1UF9A 3VNVA 1GRQA 1JB1A 1KGDA 5FTJA 4P32A 4KLNA 4M9QA 4KSCA 4NCKA 1IN7A 2JLSA 4RD4A 4L15A 3IHLA 1P7CA 4AKIA 4MA4A 5DHAA 3Q72A 3RWOA 3UMSA 4G1UC 1CRQA 2FSHA 4MGIR 4URWR 4Q7MB 1KNQA 2P3SA 2WIBA 4FINA 1JPJA 2D06A 2BHRA 4NYMQ 1QVAA 2A3RA 4JLJA 3AKEA 1CR4A 1U99A 5AJVB 2J45A 3EARA 4Q66C 2GF0A 4JVNA 4B33A 2OBMA 4OKSA 4ZCLA 2FJUA 3FE2A 4URZR 5DN6A 2H5EA 4TLDA 5J4HA 3W3ZB 4GMDA 2JGNA 2WSMA 3E5HA 2ZRLA 4QL3A 1F5NA 1R0ZA 1N5IA 3V9PA 2AD1A 2ODEA 5HKKA 4ILEA 1FP7A 1E99A 2F3TA 3P4YA 3ZZUA 4BFXA 2L0XA 3P4XA 5IF9A 1M34E 1JXOA 2QMHA 4TLBA 3SS8A 4Z8XA 2AKYA 1BMFD 1KDRA 4KFTA 3QKSA 2CLDX 4F93B 2FOLA 3JZAA 2R6GA 4QBGB 3THWB 3DMNA 3AVOA 1AQUA 4IOJA 5FL7D 5FOUA 2XXAB 1VYUA 4NYMR 2ZRFA 2HT6A 4BLPA 4Q4AB 1MO4A 1JNYA 3SBDA 4A82A 1VG0B 2WWYA 4OK3A 2KI5A 1Z6GA 2GEVA 4MH0R 4UNQA 5DSZA 2J0QA 3QOFA 1OKKA 4WZBE 5DLQC 5F2EA 2FE4A 5CITA 2E9SA 5LD2B 3OESA 3ZLJA 4HEJA 3PEWA 1KKMA 2WIAA 4OK6A 4CEIB 4O2LA 2AWNA 4LY6A 3BB1A 4PO1A 3UKDA 1JBKA 4MQBA 1GAJA 3D3QA 1OXXK 1MO3A 1XTQA 2ZRPA 1QRAA 1OFUX 1CULC 2W58A 3I8SA 3SR0A 4DCVA 1KI6B 3RLFA 1W4BA 3CNLA 3QI2A 1WA5A 5DYIA 3K70D 1E2LA 4JBXA 1RFHA 4M1KA 1U81A 2A78A 3BK7A 1YZTA 1E9DA 3I5XA 2JIZD 1ZW6A 2ORVA 4IDHA 4E22A 2FMXA 3KKNA 4A92A 2ZVQX 4I4LA 3P1JA 4JLOA 4ACBA 3M6AA 2AKAB 3DZDA 2P5TB 3L82B 1G7CA 3LLMA 1E6CA 2R6DA 5DIFA 3X1YA 4ZCMA 1P4SA 1SHKA 3P27A 4RFSA 3OE7D 2AN9A 4K81B 2QSYA 5DE3A 1J99A 5AJWA 4HUQB 4URYR 3GLIB 3RRZA 2ZE7A 1R79A 1NNEA 2ZAMA 4ACAA 4JLMA 1UADA 4Z1MA 2ZSBA 3DM5A 2DWQA 2ZRIA 4QGHA 4AIIA 2H7VA 1NVVR 2O0JA 3K0EA 5JHHB 2CLCX 4IFBA 2GZAA 4GI7A 1YZUA 3C7KA 3GQBA 3RABA 5F9HA 1A2KC 5AJXA 2WPDD 4PO9A 3TRFA 1CTQA 4DSNA 1N6KA 4U7DA 3U4QA 3FMFA 2C5LA 3H0KA 3QIAA 3RNLA 2GHIA 2IBMA 2HYDA 3LQQA 2D7CA 4V0LA 2LWIA 1IBRA 2HF9A 2HV8A 4PHTA 1WRBA 3SDZA 2XB4A 1HE1C 1N6NA 5G53C 1YZQA 2QROA 2WVJA 2GTPA 2WBLC 1W0JA 3GFOA 3QBTA 2OFOA 1UKZA 4Q5IA 5IHPA 1TTTA 4US0R 2ERXA 5JCZA 5JRZA 4OQMA 2QBYB 221PA 3DM9B 3ADBA 3UANA 3RYTC 2P65A 2XJ4A 2V3CC 1IONA 2C9YA 5EZ5A 3B85A 3OEHA 4JKIA 4LV6A 2REXB 2ZJ5A 3PG5A 1FZQA 2X2FA 1W5TA 1E79A 1GL7A 5DH9A 4ASUD 2FGKA 2ZJ8A 4IDQA 4P3YA 2B6HA 3WBKA 4C0LA 4FWTA 1KAGA 4JLNA 1NN5A 1SKQA 1VCIA 1E96A 2QMUA 3U3MA 2HYIC 3ZD6A 1T6NA 4KJZA 4TQAA 3FHOA 4CF7A 2C95A 2JASA 4KYUA 1NY5A 3RRYA 721PA 5CLLA 4DUGD 2GCOB 4PC6A 1HYQA 4I1OA 4NYIQ 2GXUA 1ANKA 3IUYA 2QGZA 5FOXA 1OH7A 5E4FA 1E0KA 3AKYA 4ZIRA 1NI3A 1AKYA 2V1XA 1NVWQ 2ZRAA 1YZNA 2HEIA 5JECA 4PC7A 4V0KA 1I4DD 4WIAA 3T5DA 5J40A 5H8WA 4ZDKA 4RCZA 3U3RA 2QTVB 3R20A 4M9ZA 1P9RA 3TUZC 1DBSA 2G77B 4UNPA 4XVRA 2GXQA 4BGDA 4LJ6A 1P61B 1KSGA 1KK1A 2AL7A 3ND8A 1S2MA 1L7VC 3Q7PA 1N3BA 2FEMA 3BIFA 4HLQB 1CJTC 3W5IA 2PL3A 3ZVNA 2PCLA 2Q21A 2YINC 3P32A 3PITA 4J0QA 3PEYA 1E2JA 1E9CA 821PA 3LRPA 2XXAA 4ZV4A 5L3SA 1W49A 4HLUC 3GLGB 1J8YF 3SYNA 1SXJE 3FKSA 1HV8A 4PR0A 3O47A 2F1IA 1UDXA 2ZREA 5DISB 3UGIA 3BBPA 3GMTA 1TQ6A 1AS0A 3MFYA 4TMKA 4B48A 1DAIA 3ZQ6A 4FKDA 3ZDQA 1OW3B 1TNDA 4CEIA 3TAHA 4XD7D 2WM9B 1C9KA 5BN5A 4EAQA 3L8ZA 4CW7A 5DYGA 5JEEA 3MCAA 2GVIA 1Z0FA 3AVYA 1KI6A 2VLIA 2Z0MA 1Z29A 2WKPA 1G6HA 3BH6A 3HPQA 1KJZA 1P9WA 5H70A 3QF7A 2B92A 3OIVA 2YNMA 1B23P 1G8PA 4MRNA 2H57A 1E2MA 2JLRA 4A0HA 2JLWA 5DHFA 2ELIA 3EWAA 1US8A 1EGAA 3QPUA 1XP8A 1G6OA 2JJ2D 3GPLA 1WMSA 1KO1A 2F3RA 5FOTA 2GBLA 1XPRA 2ZI5A 1RRCA 4Q00A 4D80A 4EFMA 1ZNYA 2ZJ2A 2G3YA 3NBYC 1Y8FA 4ZI3A 5FL3A 4EPWA 2DPXA 4HZIA 1ESNA 3MJHA 1NIJA 1XF9A 1NVUQ 1Z47A 1CU1A 2W2TA 2ORWA 4OJQA 3C15C 1M7BA 4XH9B 1KMHB 3R7WB 3SJBA 1GKIA 1AN0A 1ZMXA 2QPAA 1S96A 1QHNA 4LYFA 3NHBA 2GXSA 4FMCF 5FBLB 4QBFA 3JVVA 3HR8A 1KY2A 4RCYA 2K5UA 4YXWA 2W00A 4Q01A 3IGFA 1XJQA 1QBKC 3SC3A 3EX7C 4RKFA 2JLYA 4LYJA 1G41A 1P2UA 1FL9A 1OXUA 2QT1A 1PLKA 2QY9A 4DEXA 5EE5B 5C18A 5J47A 3TR5A 1JI0A 1UKVY 2OEPA 4QGFA 1CJKC 3BH7A 2FFQA 4WW0A 2JJ1A 1XMJA 5JMTA 5B57C 4DHEA 2NQ2C 1ZM3A 3TE6A 4PC3A 5EE1A 1SVWA 5KUTA 1E1QA 4DLTA 1Z8FA 2VIIA 4DCNA 3ZYCA 1JAHA 2WKRA 1XMVA 2VH5R 1KI7A 3VKGA 5EP2A 1M7GA 5J4VA 3RVBA 4DEYA 1QZXA 3QXJA 2A9KA 3D6TB 2ZYWX 3R9WA 2XAUA 3RDPA 4NCJA 2QORA 2V55B 4D4MA 4D0LB 2QP4A 4ZDJA 4Q4JB 4S35A 1Z3IX 2HLDD 5FPHA 2XNDA 1NN3A 1TEVA 4RJLA 1JR3A 1Q22A 1W0KA 3I32A 4B34A 2QA5A 1E32A 1SXJD 4W5HA 1JPNA 2GA8A 2OESA 2I3BA 2ZI7A 3B7GA 4I99A 2ONKA 4FI3C 4R2IA 4PAMA 4B6DA 1GP2A 2WMOB 3CB4A 3K0FB 4HDCA 5FPTA 4BRWA 2C98A 1WE2A 4IRUB 4P0TA 3B13B 3PEVA 3L0SA 1BH2A 4Q9LA 1E2EA 5F3WB 1EX6A 1UBFA 2B8WA 4GOKA 4L5BA 4MGZR 4Q7LA 1RRFA 1MABA 4B2LA 4F4CA 1OB2A 4NZYA 3IPYA 4Q1DA 1Z2AA 4QNRA 3WP0A 1DAGA 2D74A 2ZE5A 4LJ5A 2PX0A 1OFTA 1SVKA 3WXMA 4TTQA 4FCVA 3QKUA 1FQKA 1NG1A 4QGGA 2Q0HA 5FI0B 1W4AA 2GVZC 1Q1QA 4TMWA 2QL6A 5GJVC 2VTKA 4QNMA 4K46A 1G9XA 2QSZA 3QENA 2IWHA 1WBBA 1FW6A 2CL7X 1TADA 1UM8A 4NTZA 4WZ6A 3A6PC 2XSZD 1XMIA 3I8XA 1S9DA 4O25A 4KVAA 3WNDA 2YOGA 3MAAC 1CF4A 4KV9A 4P4SB 3FFAA 5D3MA 2FN4A 5FOVA 1MO5A 3GLGA 1XA6A 2G83A 2VP0A 1KJYA 1IM2A 1KDOA 3AGPA 1II0A 5JI2E 1C1YA 1UJ2A 2ZSEA 1OT3A 3MGCA 3AVVA 3EZ2A 2VSFA 3I73A 4NCNA 3M0EA 4NDZA 3TR0A 2CNWD 4BQSA 2AX4A 1LTQA 5E7IA 1T9HA 1SQ5A 2QN6A 2ZRJA 3WMEA 1K6MA 1KIMA 2VP5A 1H8HD 4TYWA 1KK2A 3O8DA 4F91B 2IL1A 3GEEA 3QXHA 2XEXA 5HZHA 1G5TA 1G291 4CT4B 2QE7A 2NO6A 2IC5A 4PPNA 4PXAA 4TT3D 3CPEA 5FUWA 5GJBA 4NE2A 1A1VA 2ENZA 3D31A 3X2SA 2NOAA 5HZKA 1R6BX 3VKHA 1JAIA 1TU4A 5CIWA 4G5RA 2VP2A 3AF3A 4DSTA 3JVUA 1AGPA 2BCGY 1PUIA 1ZM9A 3FFBA 1Z83A 4Q1EA 1ZM7A 1E1RD 2IT1A 4WA7A 1XCMA 3VU9B 3QKRB 3AVQA 1XXHA 3N2IA 2XJ9A 4L16A 4ITRC 2IYTA 5SZJA 2WJIA 4JSYA 3KQLA 2VSOA 3IEUA 1AJEA 3EZ7A 4FMBB 5EZ6B 4Q1AA 5DO9A 3KJGA 3BXZA 2RCNA 4BZXA 2YWGA 4A9AA 3CPHA 4QKQA 4OL0A 5FI1B 5C4GB 3GJ7A 1ZINA 2ZR9A 3C5HA 3K1JA 2ZRGA 1GTVA 1TF5A 2Q3HA 1BMFA 1YR9A 2QP9X 4V0ME 5C46F 1NMXA 3O8BA 1X8JA 4YMTA 2ZRNA 1SVMA 4G5OA 4GP6A 1LNZA 5GVSA 1TL7C 5K8LA 4XJXA 2EFEB 5FL7A 2O5VA 1D6JA 1UPTA 2OLJA 3IBYA 2FA9A 2VQSA 3WRXC 1P3JA 1J8MF 2P5SA 3VHXA 1G19A 1OFIA 3CONA 1IQPA 1PTRA 4JLPA 4FMCB 4PZZA 1SXJC 4L8GA 1SVIA 1VCOA 3QXSA 4B3DA 4HLUA 1XTRA 1G8YA 3DKVA 3CZQA 1Q0UA 3H1TA 4GBMA 3FYHA 2VHCA 1OH5A 3QKSB 2XITA 2XZLA 1FTNA 4RZUA 1F2UA 2BM1A 4IW3B 1KDTA 2GJ9A 2WICA 3CF2A 4DIDA 5JRJA 3ADCA 1GITA 1J7KA 2QQ0A 2JIZA 4NYJQ 4LBYA 3RS0A 5BN4A 3NHAA 1R0YA 4LBZA 2J0VA 4V03A 4TYQA 5CLQA 4URXR 2N42A 3DMDA 3HJNA 4PPQA 1E0JA 2REOA 3EPHA 1D9ZA 1XXHE 3FTQA 3I3SR 4C0KA 3R8CA 3OE7A 1NJFA 5AUPB 2PJRA 1CEEA 2C04A 2CCKA 4M1MA 1BOFA 4NH0A 1OIVA 1HQCA 1E94E 2C9CA 1ZD1A 1X8KA 1FQJA 4OI2A 3HU2A 4TYPA 1NKTA 1G5RA 3A4LA 3BS4A 4MDEA 2QTHA 4WAUA 3WBJA 4LPKA 4RD1A 1KMQA 1VCMA 3VFDA 2A5DA 3EIEA 2C2HA 3ONWA 4PSVA 4PC2A 5K8UA 1G16A 2QAGA 1D2EA 1NVXQ 2VP9A 3BERA 3REGA 1SVOA 4Z8YA 2WPDA 1FFHA 2D7DA 3H2YA 4PFSA 3V4RA 4IXMA 4C9BA 2WWHA 4RFSB 2W83A 4NYJR 2FZLA 1XPOA 1J2JA 3W34A 3MG9A 4DLYA 1W2HA 2A30A 3L0OA 1BS1A 2RGXA 2WMNB 4JBWA 4D4KA 3ASYA 8OHMA 2V8OA 1DAHA 2B21A 3QBVA 3KQHA 3AF1A 3UPUA 3IO5A 1Z6AA 1E2GA 1NIPA 3SZRA 2JDIA 3AGQA 3A4MA 1BIFA 1EK0A 1B0UA 1ZC4A 2W2VA 3OFND 2I1QA 3EIQA 1Q12A 3RANA 2BDTA 5HE8A 1P5ZB 5JWRA 1Z63A 4DDVA 3AEZA 3B8HA 1S3SA 4GZLA 3U4QB 1CKEA 1NBMD 3AB3A 4DLSA 1ODFA 3G82C 4IDOA 2Q9CA 4BFVA 3CPJB 1D8TA 4ASUA 2MSDB 2ZETA 2ZRHA 4RD6A 4JBYA 4QHTA 3GCGA 2NPIA 4YONB 3EA5A 2FPMA 4YC7A 2OO7A 3KB2A 2GXAA 1KI8A 3K0AB 4IOKA 2EQBA 1G4AE 3MWJA 4I1VA 4TL8A 3PUYA 2ZJYA 3DZ8A 4DUGA 2ORIA 3OIYA 2Q9AA 4RD0A 3LA6A 1JJ7A 2VHUA 1S8FA 2OT3B 2O8EB 4M0LA 3QVVA 4AI6A 2UKDA 1ZBDA 2V6JA 2OXCA 4Q21A 1GFIA 4BUJA 1IN6A 1RW4A 4KAXA 4G5SA 3ETLA 2NMVA 1KSHA 4FXPA 3LXXA 1LS6A 5A0FA 2FPKA 3RC8A 3U2QA 1N0UA 4DCTA 2JA1A 4PPGA 4B3CA 3MLEA 3IQWA 4LHZA 4B76A 2IHYA 5FBWB 4BZPA 4DDWA 3U60B 3DOFA 3AP1A 3KKMA 4DXAA 1U0LA 3IKJA 1VIAA 1YZKA 4UJ5A 4B6EA 4ZIRB 1AS3A 1NY6A 1IHUA 3LBIA 4QJ4A 3LFUA 5KSZA 2O8BA 3SQWA 3ZGXA 3N5CA 2ZITA 4OI1A 1HUQA 1W47A 2ZUBA 1P73A 1SHZA 3P26A 4UQOA 4C0HA 4LX0A 1QHYA 2VL7A 4DCUA 2ZS7A 4IDNA 3LWNA 5EE3A 2IF0A 3BD9A 1WDTA 2ZRBA 4XD7A 4CGZA 2BBTA 2KB0A 1M7HA 3EC2A 1Q44A 1N0VC 4DVGA 1X1SA 3NEJA 5TV2A 1WB9A 1W4CA 3QG1A 1HT1E 1U8AA 1KOFA 3MJRA 5F98A 1G7SA 4BFZA 3AKDA 5L3SB 1Q20A 3O8RA 3CM0A 4PPFA 4PHFA 2OHFA 2WJGA 5J4YA 5E7MA 1AGRA 2GETA 1PLJA 3KQUA 3PV0A 3SYKA 2FNAA 3LXRA 2IYLD 4GMXA 4PSKA 2IWRA 3PUWA 2J87A 1FUKA 1U98A 4CEJA 2V7QD 2GEDA 3G0HA 2C78A 1XBTA 1W1WA 5JS7A 1ZIPA 2EWVA 3PXGA 1YKSA 3T12A 1IXRC 4OHYA 1NVVQ 4BRUA 1BO6A 1P72A 1XDBA 1R7RA 1TQ4A 2WKQA 1WXQA 2FWRA 1AA9A 4MYTA 1DO0A 4OHVA 5G41A 3QXCA 4OI4A 2VP4A 1IY2A 2J7PD 3DEFA 1FNMA 4LRWA 1VPLA 4GRAA 4H9GA 2A7QA 4W5JA 3RS2A 5EQTA 2YWFA 1US8B 1XJ0A 3OAAD 2QM8A 1YRBA 4OQFA 3SE0A 4OI0A 1VECA 3CRVA 5JWHA 2J9RA 4FCWA 4NONA 3WHLA 5JEDA 5KPJA 3NDBB 4WZAE 2OV2A 3DOEA 5FBRB 5LB4A 4TL9A 1Q21A 1ONBA 1NF3A 3IQXA 5EUQB 5B64A 1E9FA 1G1MA 2DFKB 5IDVA 3NXSA 1F3OA 4E07A 1T0HB 1NJGA 1N5JA 3FWYA 3K9LA 3UGLA 5TMPA 3LH5A 4MKGA 4JL5A 3B6EA 1XCGB 1KO5A 2WWIA 3A1VA 3MUFA 2WAYA 5M04A 2CBZA 3W8NA 5TY0A 4BLOA 4FW9A 4CT5A 3ZIAA 3BB4A 1MT0A 2ZJAA 1EFHA 2GNOA 3GEHA 5FOWA 2IEYA 1S4QA 4LUCA 5UKDA 1R10A 1U90A 4LV8B 3THOA 5JZVA 2ZROA 3RHFA 1G7TA 2HJGA 2XOKD 4GPTA 4Q02A 4JT4A 1OLOA 2PEZA 2X19A 3EA0A 3AF2A 1JECA 4OQXA 1I2MA 2BMDA 4AD8A 3IEVA 1Q1BA 1CXZA 3RSOA 2HLDA 1YHNA 5TXGA 2G6BA 3H4MA 4QGAA 5LB2A 5SZIA 2ZUDA 1M2OB 3PQCA 1GSIA 4BWYA 4OQLA 3LX8A 2PZGA 1SXJA 1G17A 1ZM2A 1OXSC 3K0AA 3QPVA 4R7ZA 4B75A 1KSJA 2C77A 4PZLA 1KBFA 1KKLA 2PCJA 4LJYA 4M9SA 4MUAA 2FDCA 2GK7A 1QHSA 1C4OA 3GJ8A 3MMPA 2RHDA 4QFMA 3WYGA 4A1FA 2DB3A 1TBNA 2FPLA 2ZI4A 3ZVMA 3D7MA 3THYA 5KO2A 2G9NA 1Z0AA 4HB2A 2O8EA 4KFRA 1GRRA 1PTQA 4GNKA 3ZS9A 2HT1A 1NLYA 4HUTA 4OBEA 3PCRB 2OM2A 2KBEA 4ZDIA 2IS2A 2FFBA 3DHWC 1FOEB 2P0EA 2R9VA 1L4UA 2Z4RA 1WP9A 2IXEA 2F1JA 2FU5C 1TQDA 2PLRA 3PJRA 4DDTA 4HB4A 2V1UA 2J41A 2AHOA 2XSZA 2ZRCA 4JT2A 4Q48A 2PLFA 3FHTA 2IYWA 2DR3A 5KNCA 4OHWA 2QRZA 4DT1A 4R9UC 2CK3D 2V54A 1WF3A 1MABB 1CR2A 1U8YA 4JYCA 4PAQA 4ZCIA 4TSFD 1N0WA 1R5NA 1JXMA 2GJ8A 5FTMA 3L43A 2ATXA 1NLZA 2HCJB 4RZ2A 1GKYA 3U7FB 3OEED 4PQFA 4IFEA 4M22A 3A1SA 2CJWB 4A15A 1RPZA 1TPZA 1Z06A 2R6FA 2MSCB 3IILA 1NP6A 3ECCA 5CYPA 4HZUA 5KHOC 5LDDC 2A2ZA 3U6KA 3CH4B 4FCTA 3RS3A 2ZI6A 4M1SA 4RZXA 4AC9A 4DC9A 5KSOA 2CL0X 3Q5EA 4LJAA 1H8HA 3EG5A 2RGCA 3KKPA 4KITB 4A0GA 4LYAA 2D2FA 4U5XA 4PO8A 5D3MB 2QNRA 4H1UA 4AK9A 1P6XA 3EWSA 1G3RA 2ZRDA 4TT3A 2WWXA 2W2XA 4C2TA 4DZZA 2JLQA 2GK6A 3AP3A 5AJYA 4DLRA 1IN5A 3GD7A 4MDFA 3LO5A 5CB8A 2GZHA 5L3QA 3K70C 4KBFA 2BMFA 1SGWA 1ZU5A 3K9HA 1H65A 5G40A 2W0MA 1AIPA 2W0SA 2AXNA 3CX6A 5FTKA 3BFKA 2BBOA 3FOZA 3WNBA 5DN6D 5KDOA 2IW3A 4DB2A 4A8JC 4V02A 3VHLB 3PFIA 4YMVA 3X1WA 2PMDA 2VRWA 4ZPXA 4OHZA 3ICEA 4V0NA 5KYKA 4KFSA 2KSQA 4EPVA 1DAFA 3GLHE 2CLSA 2QM7A 1P62B 3LVRE 4TZ0A 3BOSA 3GFTA 5TVKA 4HAZA 2YOFA 2Z6VA 1E98A 5KNDA 3OIWA 1W7AA 4PHHA 2F43A 4TMZA 4QM7A 1CIPA 4C0SA 1N5KA 5EXXA 1N6PA 1S9HA 1BYUA 1RC8A 2ZAOA 4BZQA 2QAGC 1S0UA 4JVLA 1XXHB 2CXXA 3H86A 1R8SA 5EUMA 3T1QA 2OLKA 2IS6A 2GAOA 2Q3FA 2VHQA 1FMLA 4B35A 1OXTA 4QJ3A 5J4LA 1EFTA 2BJWA 2OG2A 1Z22A 2A5JA 4YMUA 4PX9A 3THXA 5ELXA 2IEZA 4Q19A 1OPXA 1E4VA 2ZI3A 3KB1A 2R6CA 4KYIB 4NCIA 2UZIR 3EIHA 3A1WA 1EXMA 5JS8A 1VIYA 1RFLA 2ZPTX 5AUQA 1CR1A 3LBHA 3GJ0A 3OZXA 2MMCA 4QHYA 3LQRA 3B78A 4D81A 5FPYA 1G3IA 1II9A 4MYHA 3NH9A 3QF4A 2DYKA 5L3RA 1ZNZA 1Z0IA 5KPDA 4ZO4A 3SN6A 2WJYA 4GT1A 4B3XA 3OHMA 4B2IA 3WYFA 4DRZA 4R71A 1MRSA 1R2QA 2DCUA 1EFRD 2IYUA 4M21A 3VR2A 1ETUA 1QHHA 4XSHA 3NVAA 4LHVA 4M4SA 1Z2CA 1Z6TA 4HLCA 1OB5A 4B47A 2GDJA 1LV7A 2YZ2A 5JSZA 1MH1A 4BLSA 2ZJOA 1KO8A 4D4LA 1F2UB 1KTVA 1YR8A 4JLDA 4LCBA 2H17A 2IUTA 2VHJA 521PA 3FMPB 1FP6A 3NBZC 2YWEA 4GOXA 3CLVA 3VQTA 3SU8A 4B6FA 3L2OB 3K70B 2NO0A 3ZZTA 3SOPA 3UEYA 4AYXA 1L2TA 1T4GA 5J5CA 3TW8B 3QUSA 3U5ZB 4AY2A 2QENA 2VPPA 1XZQA 1AK2A 3A37A 3Q3JB 3FPAA 3B9PA 1CJMA 6Q21A 1ZNWA 2N46A 5JLJA 2O0HA 4M8NE 4A8JB 1VG8A 4JLBA 1HURA 2J3EA 2CCGA 2OUKA 4LC0A 2W6IA 3I72A 4JLAA 4CYMA 4G3XA 2CVHA 2J1LA 3HPRA 3NG1A 3T61A 3KZ1E 3CH5A 1HH4A 1W0JD 4E03A 2CJWA 1NSFA 4A6XA 4C0BA 4IKEA 2P6RA 4TWZA 1P2SA 1UEJA 1W36D 4UNSA 3K09A 3KL4A 4Z51A 1G5PA 2QZ4A 1WCV1 3SI7A 4IEEA 4XVQA 2XB2A 3MWLA 3OEHD 4PANA 5BW8A 3GP8A 2QAGB 1E2NA 3HYRA 1IAQA 3CX7A 1V5WA 2GVDC 5BQ5A 1E79D 4V0MA 1HEIA 1MKYA 1QHIA 2C96A 4QRHA 1NBMA 4Q9HA 5GADl 4MRPA 1DE0A 4B3GA 3BRWD 4Q18A 2O8CA 1MRNA 4ARZA 4YQFA 2EFGA 2CMKA 4OJKA 3CX8A 3E70C 3KFVA 3W3AA 5EXSA 3QQ5A 1GNPA 3ZQJA 4QM6A 1XD8A 1XNJA 4L9SA 4DLWA 2A5FA 1JEDA 3FGNA 3U3KA 4N0EA 3VR4A 5JHGB 3A36A 3NC0C 4QBIA 3A4NA 2ZS9A 2GCPA 4DSUA 2PZEA 1UKYA 2RKOA 4N3NA 1DG3A 2IYVA 4GL2A 4D0NA 4EPYA 3T5GA 4QJ5A 1NKSA 2QP3A 4UNRA 1D5CA 2VEDA 4LPSA 3TJZA 3LLUA 3A58B 4ZDWA 2BIFA 4CVNA 3I62A 1UBEA 4EPXA 4AKHA 3GJ5A 4AURA 1PLLA 4EJSC 1P60A 2FV8A 4KVGA 4P4UA 4XIGS 1ELOA 4GZMA 4PAOA 3MD0A 2HJVA 4F38A 2PMKA 3BH0A 1MV5A 3B82A 3CWQA 3LY5A 3HU1A 4BLTA 1W2GA 3BFVA 2A5GA 3IIMA 1I4LD 1ZCAA 5CYOA 5KSYA 3GJ6A 2JLZA 2NO7A 1II8A 3PVSA 2J0SA 4YMWA 3K53A 2GEUA 5AR1A 3QJYA 4EKDA 1F2TA 3PR1A 4O3MA 1I2DA 4QHSA 4B2PA 3B2EA 1G3UA 2ZQ5A 4KCGA 5GJWC 1FPMA 1NBME 1ZCBA 2Y8EA 3DKPA 3RRNA 3KFXA 3BFXA 1UFQA 3TLXA 5LPNA 1OHHD 3IIKA 3GJ4A 1E9EA 3L0IB 1COWD 4L9WA 2LKDA 1NRJB 2YVUA 2QT0A 3KJIA 4BASA 1VHLA 2LCFA 3BJIC 1J90A 3DL0A 2O8BB 2IS4A 2IXFA 3QXXA 2RGEA 3EXAA 4Q4HA 5B2ZA 3SFVA 2IHBA 3ADKA 3U44A 4X8HA 3WMFA 4DLXA 1GILA 2QRNA 2CDNA 4L4UA 4URVR 1KI4A 1RYHA 3DVLA 2V7QA 1T3LA 4M1OA 3SJAA 5BN3A 621PA 1YZGA 1KI9A 3U6BA 2KE5A 4TL6A 3I5YA 1E2HA 4F7WA 1Z0JA 2WHXA 3QEOA 4Q7KA 4TLAA 5CIQA 3KDSE 1G21E 2TMKA 3UMFA 3JZMA 3ZVRA 1FX0A 2ZRKA 2J0UA 4LGMA 1X8LA 4UJ3A 2FZ4A 2J7PA 1HY3A 3SYLA 2RGGA 4EQ6A 3N2EA 2DFLA 4PHGA 3RAPR 1UBCA 3AF0A 2B7CA 4NBSA 3OAAA 1MR3F 4A6PA 2GWHA 1JQLB 3B5JA 4OK5A 3ZD7A 1U94A 4W7SA 4A8JA 3VX3A 1PZNA 4OQNA 4KFUA 4KSBA 4CEJB 2JJ1D 3TQFA 2MMGA 3KUCA 1R4AA 5KNBA 4DJTA 3L8YA 1X6VA 4BLRA 2KJQA 1E1QD 1GWNA 2NO9A 1DADA 2DY1A 2IA5A 4JLKA 3S1AA 3TUJC 3GLFA 1EX7A 1IN8A 2N1BA 2VHTA 2ZANA 2ODNA 4JKYA 3X1DA 2P2LA 3B1ZA 5H68A 4O0MA 4DKXA 1QG4A 2EVWX 4JL6A 4Q4LA 4EJSB 2IYRA 3TK1A 3TSOA 4DDUA 3VMFA 1IJEA 3CRW1 4UXHA 3C14C 5HPYB 2BJVA 2FSGA 3HR7A 2F1HA 2OBNA 2XOKA 4L9MA 1GDDA 2Q6TA 3Q8XB 1T8UA 4RD3A 1LF0A 2OCBA 2FF7A 1KK0A 4EDHA 1Z6XA 4HAUA 2UVQA 2ANBA 3T35A 1G7RA 1HE8B 3PUXA 3SQXA 2OBLA 4D25A 1DO2A 2F6RA 1N6RA 1VG1A 2OE2A 4CRWB 1GZSA 3F0TA 4ZI2A 5TDHA 1DPFA 1ZJ6A 2W6JD 4KO8A 2ATVA 3EZ6A 1J70A 1IY0A 2WOOA 3K0SA 2KWIA 2WWGA 3T1OA 5B58C 1ZU4A 2GJKA 3KJEA 5KDLA 4C7OA 4HDQB 3UWKA 4QXAA 1Q1ZA 3CR8A 2ZI9A 2OFXA 4RZ3A 3BC1A 1T3SA 4MGKR 1RYFA 1OJLA 3UG7A 4BFSA 3LAWA 2F55A 1XFAA 1YR6A 1ZUNB 3TKLA 4XWKA 3PUVA 1CLUA 3BWDD 1I4TD 1XTJA 4M1TA 1SXJB 1QG2A 5FUVA 4Q1FA 3QSYA 2ZYUX 4P31A 2GJAA 1O87A 1FMJA 1KNXA 2YV5A 3NEYA 4D82A 4HYYA 1U2RA 2PT5A 5AUNB 2I1VB 4US2R 1X1RA 4TLCA 2CK3A 3THYB 4F92B 1A2BA 4TSFA 1XJCA 3GLFE 1N6HA 4JIMA 4KODA 1CJUC 2IYSA 4G0NA 1E69A 4RVCA 3EC1A 4B74A 3LX5A 2AD5A 3OEEA 1PV4A 1MOZA 5A4JA 3UGDA 1G18A 2GILA 2FFAA 2QMOA 5TARA 2VBCA 4C3ZA 1GM5A 1HT2E 1KZ7B 5EXTA 4BE7B 4BEBA 5C2JB 5IK2D 2BMJA 3IDQA 2O8FA 2ECKA 1YR7A 4FIDA 1X86B 5FR1A 1E2PA 1XD9A 2OAP1 3NIBA 1Z08A 1VHTA 2J5XA 2AXPA 3UATA 1F48A 5FPSA 4DT1B 2OILA 3FHCB 5DNYB 2O8DA 2BCJQ 4M53A 1DAKA 5GVRA 1OFHA 1GKUB 2ZU0C 3GEIA 3T1VA 1Z0KA 3TW4A 2H92A 3CNNA 4IJMA 3ZZ0A 1V43A 3W8RA 3LW7A 3WP1B 1TF2A 1W46A 3B9QA 4C2UA 2R6AA 4B71A 2X8AA 2YKGA 3TSWA 1OIWA 4RKEA 5CJ2A 1VYVA 2V9PA 4LHYA 3T1TA 4HZUB 3ADDA 4WXPA 3K8YA 3NWJA 3ICQB 4TN1A 4II7A 2CHGA 3KUDA 1ZD9A 3GFPA 4U00A 4EPRA 2ZR7A 1CJVC 2YYZA 3DO6A 1H8ED 3KKOA 1FTSA 2NTYC 3RS7A 4KU4A 1T8TA 1XD2A 2D4HA 2PH1A 1SKYE 5FUYA 2X77A 5C4MA 4JL8A 3RSLA 3EPLA 2YUUA 1XRJA 3E1SA 3CF0A 3NKVA 2JJ2A 4DLUA 5IT5A 2G88A 5L3QB 4D4JA 4TTPA 4CEHA 4JZKA 2QG6A 1RJ9A 1XCPA 3KTAA 5CK4A 5E3HA 3RRMA 1TX4B 3GJ3A 3AVWA 5KOYA 2Z83A 3DPUA 2E73A 1E4YA 2Z4SA 1WQ1R 4C0QC 1YZLA 4IOLA 2EYUA 1K5GA 1GUAA 3SHFA 2BVNA 2NGRA 3K9GA 4OYHA 4WOPA 4N0DA 2VRWB 3I1FA 4YLGA 4WVFA 1JJVA 4EJSA 1E3MA 2WJJA 2DFNA 1LVGA 3A8TA 1XEXB 4FWIB 1VCNA 4TMTA 1TUEA 1KJWA 1D2MA 1TBOA 4B3BA 5BXQC 1U0HC 2F43B 4BFWA 4ERNA 3K09C 2Q9BA 2HF8A 2JEOA 2P67A 4YDHB 5KSPA 3SHWA 4DWJA 2QQEA 2QEQA 4NPHA 4M2LA 2BBSA 2X2EA 5C1BA 2WSSD 4N1AA 4R2HA 1XTIA 3ND9A 5CJPA 4AKEA 3VR5A 4BFUA 1E9BA 5CM9C 1GNRA 1VDZA 1TEXA 3NC1C 4RSGA 3THXB 5H1YA 5FH9A 4JVMA 3AVXA 1NN0A 1EFRA 2UZ3A 2AFHE 2BV3A 4LYHA 3TVTA 5P21A 3SJCA 4DLVA 5EP3A 3P20A 3BJIA 4BEJA 4E09A 2XZPA 1R5BA 1AM4D 2JCSA 2PT7A 4AKGA 2FEOA 3VAAA 1CBUA 1BYIA 2R2AA 4W9MC 3RWMB 3WRYC 2F7SA 2OXRA 1OH6A 3NH6A 3UXMA 4TYYA 2R44A 4I81A 3AH8A 4NU0A 4PZYA 2GRJA 2QAJA 3G5UA 2WJVA 1A4RA 2DBYA 2YC2C 3QF4B 4Z54A 3R9XA 2C03A 4AG6A 5HE9A 4KHZA 5HCIA 1TAGA 4BFYA 1QDEA 2NG1A 5DI3A 1OF1A 3I92A 3C4JA 2PEYA 2RAPA 5BWMA 2ZXUA 1QHHB 4QBHA 2DB6A 3KQKA 1N5LA 3EZFA 4UKDA 4AG5A 1S3GA 2EU8A 2NZJA 4UXJA 1U8ZA 4LBVA 1KYIA 1XB2A 3F5FA 5JSZB 4MKIA 5CM8B 1P2TA 1Z0DA 3U61B 2XNSA 2FFHA 2NZ8A 2O52A 3QY0A 3MRSA 2ZSDA 4MGYR 3K9NA 4ZKEA 2JDID 2FNFX 1SZPA 5JWOA 3GLHA 4QOSA 1N6OA 1RZ3A 4HI0E 4Y0AA 3QKTA 1RIFA 1KHTA 4TL7A 4LV5B 2BEJA 1XPUA 4LSGA 4CIDA 1O3YA 5BYKA 2ENNA 4ESVA 1E2QA 1YJ5A 3CNOA 2CE7A 2NPFA 3J81k 2HUPA 4TQ9A 2BKUA 3BGWA 2OCAA 3ZJYA 4IVQA 2G0TA 5FFMA 4EFLA 2NO1A 1ZD8A 5J4KA 4MRRA 2ZIAA 1OH8A 4IVRA 1UDWA 2C8VA 4GOJA 4DCSA 4FN5A 4AWXA 1EG7A 1DARA 3CKLA 2JLVA 3REFA 2JATA 4NL4H 1OSNA 3C41J 2CNWA 2G1JA 5LBIA 1WBDA 3SNHA 4P4TA 1NG9A 4FMDF 4KI0A 2RHMA 3VKWA 3WMGA 3I61A 1OYWA 3W6NA 2EYQA 2QPTA 1ZNXA 4XWAA 1AQYA 1E2KA 5AJZA 3VR6A 1KK3A 4Q47A 4G01B 1Y3AA 4HAYA 4DBLC 1DAEA 3U3JA 1XTSA 2HXSA 2DWOA 4HSEA 3V4FA 2EFHB 5TB5A 3N70A 2BM0A 1Y63A 2O8CB 4ARZB 3FMIA 3EASA 2GZDA 3E2IA 5FR2A 4HB3A 2RH5A 3TQCA 4MKHA 4IHQA 2BMEA 2ZEJA 4WXRA 3FMOB 3V00A 1Q57A 2J46A 1PJRA 2JAQA 4LJ9A 4V0OA 5CB6A 3THWA 4X8LA 1ZVQA 3KXKA 1XEFA 2A5YB 1E2FA 1E1RA 3TIFA 3W5JA 4DB4A 2B7BA 1G64A 2ZYVX 3TNFA 4TTRA 1DELA 4A36A 3X1ZA 2VF8A 4Q4AA 1XMSA 4TZ6A 3PUZA 3QG5A 5SZHB 2J7KA 1JEEA 3Q5DA 4NYIR 1G8FA 2SHKA 4P33A 1OE0A 1P75A 4Q9KA 3RS4A 4IOMA 5JBQA 1EWQA 5HKKD 2BBWA 5HCNA 4A4DA 3CRRA 5FBQB 3IBGA 4RD2A 1LS1A 3O8CA 3A1UA 2D62A 2WAXA 1CR0A 1LW7A 3BB3A 3TMKA 4C0JA 1XEXA 4KLZA 1U9IA 1Q1EA 4Y0VA 2RGNA 4YDSA 3B1XA 4JJKA 3CIOA 1XZPA 2VO1A 4I1UA 3X1XA 1G8HA 3FVQA 1OHHA 1T0JB 2AFIE 3VX4A 1COWA 2ZU6A 3LVQE 1VKJA 2EFDB 1MO6A 1P2VA 1GL6A 4GSYA 3EZ9A 3HWSA 4M1WA 5FPKA 3AQ4A 2GF9A 2HDNB 1ZIOA 1OKKD 3MWYW 4C4PA 1RVDA 2WJHA 3UEJA 3EPJA 1SVSA 1II8B 3ZS8A 4MKFA 4C30A 5JI3E 2AWOA 3LNCA 5EP4A 1F2TB 1ZC3A 4WBSA 3WYAA 4JVSB 4LC1A 2Z5FA 3C8UA 2OZEA 3VTKA 3QVUA 2VF7A 3T06B 2IYXA 3NBFA 4HATA 4HUQA 4UNNA 3HYTA 3GLIA 1QHGA 2CEAA 3K0CC 3NDPA 4OHXA 2OFWA 4AYWA 2IX3A 2YJTD 1VTKA 3BAFA 3ZVLA 4X8OA 2FH5B 1PUJA 4LJ4A 3UK6A 3A1TA 1YE8A 2AK2A 1IN4A 4KBGA 2P6UA 3U3OA 4LJ8A 1QHXA 1N6IA 1R0XA 1EWRA 1ZAKA 5HTKA 3TUIC 3CWZA 3SJZA 2ZJZA 4Q4HB 2PX3A 3AP2A 4QC2A 2RMKA 2KBFA 1D2NA 3U44B 3T34A 1S1CA 2LKCA 2WTUA 1R0WA 5KTYA 3M4YA
chains in the Genus database with same CATH superfamily
4I2VA 4OQQA 2HHLA 1GLVA 4W5WA 1AO0A 4GI2A 4PG4A 3ENQA 4MXDA 3CJTA 2OCYC 3VU0A 1WTCA 1NXUA 5K8VA 1ADFA 1QVRA 2DWPA 2CDAA 4KB5A 1ZRHA 2ZDHA 2KX7A 5G2OA 1T9CA 3HEBA 4TTIA 3WHKA 2X5KO 4Z1MD 2JLUA 1LDMA 1NMZA 3OOWA 1FX0B 1QOZA 5EIFA 4TQGA 1CUHA 2C9BA 2J0UB 1AA6A 4M0PA 4GSLA 2QW0X 1T3HA 1PG5A 2QBYA 3M7IA 2PG3A 3ZIAD 1VJRA 4DLNA 3GMDA 3V32A 4EQ6B 2W11A 5EMMA 3ANTA 3OJWA 5HJ2A 2P2SA 3F3YA 3FKQA 1YHYA 2DU8A 3F6SA 3H5WA 3FIJA 3DDHA 1DIRA 2LE0A 1QLHA 2Q6IA 3FDFA 1W5SA 4I50A 4RY2A 1X7ZB 2H9AA 4B83A 4ESHA 1Z7EA 2V6IA 2C99A 1NBOA 1ACLA 3GJXC 1NVMB 3AR5A 3IIJA 2C4MA 3LS2A 5T4BA 1NL3A 2VJDA 2XNKA 3SX2A 5HGJA 1Z2OX 1T1RA 4YUWA 4FB4A 1NV8A 1C5KA 4CIXA 4LI3X 4U02A 4XVUA 5TMDA 3NAZA 3NHLA 1YKGA 5CDGA 3E8MA 3S1AB 2IJGX 2ZUTA 4AJEA 1OYOA 2X5NA 4TS3A 2DHQA 4LOAA 5A5GA 1MB2A 1P2GA 3BCUA 3IULA 4YPVA 2PAFA 4POAA 2HJHA 3ZDFA 1B42A 3IODA 1F4PA 2X3YA 1SAYA 3M6VA 1V3UA 4AO8A 3D6HA 1O4WA 1J9GA 1VE6A 3DAGA 1JEQA 2P7IA 4YMLA 3G8DA 5AVQA 1PGPA 5ENZA 3L02A 2VTBA 1BA2A 4PZDA 3GY0A 4JX9A 4OIMA 2I2BA 1GEEA 3A0UA 4RELA 4A7PA 3UY4A 2VJQA 1LY1A 2YWJA 1TF7A 2G36A 2AQHA 1N2JA 3Q85A 4GDFA 2HJWA 2QTVA 2J6BA 1OYVA 1W44A 4GOOD 3EW9A 1UUCA 2GYYA 3Q9LA 2G0NA 4MX8A 3T94A 1TGVA 3TGPA 4QQNA 4DREA 2IIPA 5JFGA 4YO7A 1P0CA 3LNTA 4AJ9A 1EESA 1KYQA 4WFKA 3IDAA 4UM9B 5A06A 5ESRA 4BUCA 2WOJA 5AVXA 1Z4PX 1CP2A 4TS4A 3R1IA 2BKEA 4HNAA 1FDUA 3GP5A 3PIRA 4YMSA 3WL5A 4FD2A 4CLOA 4R9SA 1QF9A 4YRLA 4NK4A 5JNLA 5JYDA 4EATA 1KQNA 5KDDA 5KU7A 4C7OB 1GUZA 4P5EA 4BMYA 3A10A 3GIDA 5AHRA 1DQPA 3AF4A 4IWXA 4XOIA 1TA0A 3GLUA 3I53A 1ESZA 4G8CA 5AKEA 1RWVA 2ZSFA 4JSTA 3X44A 2X5OA 4MO9A 3A9RA 5JAZA 4YYZA 5FBVB 1FYDA 1IWPB 3BD6A 1QYIA 4MITA 1M66A 3Q3IA 4RLHA 3TRDA 4FR0A 4KGVA 1G5FA 4LRSB 4FOTA 2VP6A 2D5BA 2EWWA 3ESQA 3AVTA 1DEKA 1VSUA 1A82A 2EJBA 3CO5A 1V71A 4N3BA 1CEXA 1EHYA 2F9LA 3UIEA 5C9ZA 4BFTA 3PHHA 3KG2A 2E0IA 1SZDA 2XZTA 4RM3A 2WV9A 2AI3A 5BYJA 1FP4B 4EGCB 2Q5LA 5CLJA 1YFJA 3IE1A 1OX4B 3QU4A 5FB3A 3ZU5A 2ZOSA 3EH2A 1JR3E 4N9QA 2A7XA 4D4GA 4CQLA 1IULA 3BSYA 3CUEF 3PENA 4PR3A 4GFDA 3IPXA 4XTCS 2ORYA 3T3MB 1GA6A 1JSZA 1D1TA 3BQNB 2O2GA 4F1JA 2YHIA 4DBZA 4D0RA 3L6BA 3G88A 3LBYA 2JH9A 1O77A 1ZD4A 1Z8DA 3KAQA 3IR5A 2ODWA 2W4IA 3KHSA 3AU9A 1XZHA 3EQ2A 3BEOA 1D7OA 1RRMA 2NP7A 1SNYA 3NTUA 4MYUA 5DW3A 3UK2A 4KVZA 2Q1SA 4D5EA 3EOAI 2G0AA 2WJ3A 4H6VA 2X9QA 4IH9A 2QGNA 4CTNA 2IOFK 1JWBB 2WD8A 2YNMD 3GU3A 5AK3A 4B43A 3OY7A 2RAVA 3I1JA 2C3MA 1W9HA 4YH1A 16PKA 1H8EA 3DTVB 2X14A 4QPPA 3W9YA 5JLAA 5CFRA 1FSZA 3AINA 2IK8A 2O3UA 3ML1A 3OCVA 4LZZA 1F60A 5K0BA 1TC2A 1SFRA 1RE0A 1VG9B 1TGYA 2CDRA 4HP8A 4CDNA 1WLSA 4EHLA 2E4ZA 5AXBA 2CEKA 3D7LA 3PI7A 4GKBA 2OL4A 3DLCA 1ZQ1A 4MRSA 3JYLA 3GLGE 2Q3MA 2RGWA 3FDJA 4UCFA 3WQHA 4HDRA 1PX2A 1U9YA 3CX4A 1EJBA 1X9GA 1IZ0A 1Z35A 2PR2A 3NUGA 3QVKA 3C74A 3QMMA 2Q2VA 1P0QA 4LHXA 2TECE 5DGXA 2C3YA 1J23A 3CRMA 4OTZA 4QG7A 1ZYUA 4DPKA 2DFTA 2C54A 3SM9A 1KHHA 3HUEA 2PUAA 1SVLA 1UP7A 3ABSB 2L82A 4FK8A 3L7AA 1XD2B 4P38A 3UGKA 4E11A 3LK6A 4YUXA 3F4KA 3HDGA 3KJXA 2CV0A 1A98A 1JTEA 4K87A 2FSVA 3TTUA 3VC1A 2XMZA 3MSXA 4GYYA 5E4YA 2H1LA 2ZB2A 3T41A 4AUKA 1WUJS 3FWZA 1IK6A 4D74A 4F4DA 2BHLA 3GWZA 4Q4JA 1QIFA 1RJ9B 3KTAB 3GRUA 1Q7RA 5E9WA 2XTZA 1E5DA 3GJZA 1QE5A 3FCEA 3FF1A 4HQRA 2BJHA 2EERA 1VE7A 2GUGA 3M8KA 2VTEA 4X6XA 1Y7IA 1SG9A 2QRLA 2IDZA 1ORWA 5ANRB 2UUCB 1GOTA 1V41E 3U48A 3PXEA 3NT4A 2WSSA 1RR6A 1R8QA 1ZN7A 3DOHA 5K6AA 1JS1X 4KXNA 3V8PA 2AI2A 4A0FA 1I3KA 1Z5NA 2BEUB 4KIGA 3K0FA 1V2GA 4RWZA 5C8YA 4ON9A 4UARA 3TH5A 4B8YA 3DHNA 4H0NA 3ZE1B 3ZLTA 4EX7A 4QGBA 1I1NA 1CV2A 1ESMA 5ADWA 1G38A 4GF5A 2DERA 1OYYA 1E9AA 3ZJUA 4TRNA 4I4CA 4Q9IA 1Y6QA 2PJZA 1L8AA 1ZW1A 3A3OA 3CF4A 1P5RA 4KDEA 1FXWA 4PSAA 3RC7A 3MS7A 4PGMA 2OU2A 2F8MA 3HH8A 1E1LA 3I39X 2H1RA 4DLZA 3L01A 3PXXA 8AT1A 3OM0A 1KBQA 1TQ2A 1ZH4A 3TSZA 2R79A 3LT4A 1ECJA 2GGSA 4EMUA 2JZOA 5G1PA 1NI4B 2WD7A 2PRKA 3LPDA 1R5OA 4AYTA 2ZKLA 4D6XA 2BZ0A 1E8NA 3ZXYA 2YN0A 1TTQB 1JDVA 4COKA 1EXDA 1RNLA 5IC5A 3PQFA 3OZCA 2J3IA 4ZICA 3GN2A 1X70A 3AR8A 4P4SA 2EWMA 3UH0A 4CODB 1H4SA 5CA0B 2H5JA 1L8QA 3DLIA 5CCDA 4JJZA 4Z0HO 3IHWA 4OB7A 2WU3A 1GUYA 1GL9B 3HCNA 4JI5B 1W25A 2GPSA 2QTZA 3ASZA 4HDSA 4NHOA 1XZNA 4OLAA 5DDIP 5EZYA 4U7PB 1GEGA 2WC1A 2ZBVA 2OC4A 4PC1A 1HDZA 1K7XB 3F9RA 1U2QA 3BE4A 2CWHA 4C06A 4J7AA 2PMBA 3RC3A 3RT9A 4HAVA 4XCXA 4NKRA 3USCS 4I50F 3T5AA 1Y4UA 1GIAA 4EYOA 1N1EA 1FP4A 3A9VA 4XJVA 5KEIA 5ISMA 4A2PA 5DI3B 3LGAA 4N7RA 2O2SA 2NYRA 1M0TA 4LXXA 3D8BA 3TSAA 4C6TB 2JHAA 2IZZA 1IJFA 4HS9A 4I8IA 1IY1A 4NBWA 1KDPA 4RW0A 5TLSA 1I9CA 5CNMA 3P94A 3B1VA 4MUGA 4I46A 5C34B 4B44A 3UHAA 3A14A 4XDHA 1S2LA 3ZNOA 1XI2A 4A23A 5A9SB 3AM3A 3NXKA 3FB4A 1IB6A 1O2DA 1C9EA 2D1RA 2R47A 2PMFA 5EQFA 4CPDA 1NYQA 4YV7A 1T5LA 4CDRA 4BCDA 1E3WA 5K3CA 1EBBA 1E3QA 1AKRA 1UJBA 2FETA 1ZLXA 2XX3A 1QAMA 3LF1A 5LA6A 4BNGA 1HQYE 2XF8A 3AFIA 5CVEA 4YIHA 3D7KA 3ZHCA 5KU1A 2YXPX 3I6MA 3Q0IA 4L2IA 4B32A 3DAPA 2R8RA 1WHTA 3PSAA 3O0TA 3R9IA 4N39A 4D8UA 2QE7D 5C7IO 4JN6B 1K06A 1UF9A 5IXJA 2P11A 3AM5A 3ZEIA 3AO0B 3DTVA 4G0ZA 2R8OA 4M9QA 4NCKA 3M81A 1R4MB 2DR0A 4RDIA 1CD5A 1P7CA 4Y1EA 4EG0A 5CFOA 2V45A 5DHAA 1QRRA 4GM0A 3RWOA 3OCXA 4RA9B 4WE3A 3ZBUA 2Q46A 1PJ3A 5BVGB 2FSHA 1MJAA 3LSTA 2IZ1A 3DEAA 4JR0A 1P1CA 1Y3BE 4XUDA 4Y1FA 5J5AA 3X1MA 4BNZA 3CTMA 4NC9A 1U7UA 4ZFNA 5ETJA 1QVAA 3IJRA 4V2UA 4EB3A 3ZLVA 3PLNA 4CXMA 2Y1EA 1CR4A 1U99A 2FHPA 1CGII 1LSUA 4F5DA 1P0MA 1LC0A 4B33A 4QOHA 2PWYA 1NNSA 2OBMA 4D8VA 3DA8A 1N32B 3WWYA 2AFHA 1WHSA 3N0RA 4G0WA 2NV0A 5REQA 3NC4A 3MRVA 4A26A 1VGRA 3JPYA 3K92A 4CLHA 2ZRLA 2ZYGA 3G59A 4NV0A 4F6RB 5LNK1 1K63A 1R0ZA 2JA2A 2JGFA 1ZHOA 1Y9ZA 5HKKA 2H51A 4J1SA 4BFXA 3P4YA 1G59A 1ZXBA 4XAQA 3P4XA 5IF9A 1U2DC 4K9NA 4DW8A 4HNUA 3B51X 1BMFD 4Y9SA 3B70A 2FMFA 3H4IA 2G1UA 3UWSA 4LJRA 1QKIA 1NW8A 4PIVA 4F93B 1RMTA 2FOLA 1CQZA 1OTXA 1Y0BA 4QBGB 3MSCA 3V7FA 3BCRA 3O1HB 4MS1A 2PH5A 2WLTA 3FYUA 4JD5A 3U7QB 3NHPA 5FL7D 1QYRA 4RTJA 4NYMR 1IH8A 1XTPA 3FTCA 4K7JA 4Q4AB 1MO4A 1UPXA 3UFBA 5L51A 1QCCA 2O14A 2X8JA 5HCUA 2NVUB 4A82A 1ULSA 4AY4A 2K2WA 1YDHA 1SIUA 1V3VA 1ENYA 3N6XA 4EMSA 4QJBA 1RQ7A 1GGJA 2ACWA 1YXMA 3GFVA 1OKKA 4WZBE 5DLQC 4XVCA 4S1NA 5J3JA 2FE4A 3HY4A 3COSA 2O1EA 3R7WA 2DEUA 3J7AC 2PGXA 4Y1GA 3TEFA 2F3CI 1KKMA 3A2MA 3PEWA 5GOZA 1IL0A 3FNEA 4LY6A 4PO1A 1JBKA 1XTTA 1NDQA 3Q8WA 4U9HS 3D3QA 2XD9A 5HFNA 1XDSA 2ZRPA 5JS2A 4Z7JA 4DA0A 4QX6A 4DF3A 1CULC 2PLAA 3P4UA 2M1ZA 1KI6B 3RLFA 1ZLYA 4KR6A 2WW8A 3QI2A 1WA5A 4UVEA 4C7VA 5DYIA 2OHXA 3B6KA 1VB3A 4D8TA 2E89A 4EG7A 1M6WA 2FPPB 4LVOA 4WFQA 4K28A 2JHPA 1RP7A 3D6NB 4BMPB 4GVXA 5HFJA 2FMXA 4JEHA 3L9XA 1ZJ4A 3LGXA 1IWBB 2AKAB 5FQOA 2P5TB 2VPQA 2SKCA 4Z2YA 2QZJA 3RVMA 4KWIA 3X1YA 4ZCMA 3GEDA 2FG6C 1P4SA 1SHKA 1O0CA 4RFSA 1OBCA 3OE7D 2AN9A 4IIHA 1IVSA 2O4CA 1M73E 5DE3A 1SBIA 5HA5A 1SQ6A 4J4HA 5DX0A 2OPHA 1GZDA 4BO2A 5TT1A 5DKFA 3UA3A 4EBBA 2FWNA 5FTWA 3Q7EA 3CLUC 4G4GA 1KYZA 2JCGA 1NNEA 3QU5A 1DQNA 2ZKIA 2A9PA 4Z1MA 3AOGA 5K0SA 1JEYA 3WIEA 5SY4A 3SXPA 5K05A 4AIIA 4QGHA 5IN5A 2H7VA 1NVVR 1BHSA 3ZY3A 3ZCUA 1MJHA 3DMFA 5DCWA 1F2DA 2GZAA 2VT6A 3ZW7A 1O03A 3GDWA 4OH1A 5E1MA 2O7SA 4P0QB 4PO9A 1KJNA 4I08A 3AJRA 1N6KA 5EWMA 3FMFA 5L3ZA 4DZRA 2QLFA 2Y0BA 3OJEA 3C8DA 5F12A 3WGVA 5JZ9A 4CM4B 2NUPB 4R1LA 3RNLA 3MINB 1CVIA 3VSCA 1OZGA 2D7CA 4OA8A 1IBRA 2FPXA 3HMKA 4ZMRA 1Y7LA 3NEPX 2HJSA 1HE1C 1RHMA 1IOLA 4DG8A 4OXIA 1GFZA 1K5HA 5A9SA 3H8WA 2AF4C 3IQHX 1NZFA 3PGA1 2EV9A 4I19A 1W0JA 2DIPA 3R24A 4P5PA 1WGTA 3GFOA 1V1IA 2PUJA 4G81A 5C8YF 5IUNC 2PVSA 3CUSA 4Q5IA 3UJAA 4EHAA 4MIYA 4Y18A 4EHHA 5LQDA 5HOEA 1O6ZA 2Y27A 5I9LA 3RYTC 1UIRA 4I2NA 1I10A 1ZX1A 2XJ4A 3HFJA 2YQ5A 2C9YA 1RYBA 3VV3A 1FZQA 2X2FA 1Z74A 4MW4A 2DH6A 2PANA 1GL7A 2XCRB 4NZ9A 1UQTA 4ASUD 2WK1A 2ZJ8A 4UHDA 3FSXA 1FSSA 5F52A 2OCKA 5ALHA 3UT5B 4FB5A 4XYGA 5TQVA 3WBKA 2YYAA 4FWTA 4ENUA 3ZE7A 2QMUA 3JQAB 1DKQA 3U3MA 4PBRA 5KYXB 3OJCA 4RA9A 2HYIC 4KJZA 3ZD6A 1T1GA 2Q29A 3NZEA 4R8VA 4XGNA 2VHWA 1AUXA 5ALDA 3R6TA 1XSEA 3UAOA 2LUOA 1UMBB 3D64A 2YCBA 2ZT7A 3NJ4A 721PA 1GGFA 1VIVA 2GCOB 3RYFB 4JIGA 1F6DA 3ZHQA 5EZQA 2IV7A 1XQ9A 2DWUA 2GQ0A 1ANKA 2H1WA 5FOXA 1N5MA 2XADA 3ETHA 1XWFA 4BN5A 2UUAB 4W8HA 1E0KA 3QYFA 1E3DA 3AKYA 4P35A 4RIEA 5F64A 1WPRA 1P7VA 2V1XA 4ZIRA 3EG9A 2NP6A 3GCZA 2GHTA 5JECA 4PC7A 4V0KA 1IWOA 1I4DD 4O1IA 5KKCA 1O8CA 2QVCA 2WTXA 3ICOA 5EZYF 4WIAA 2ZXFA 5FP0A 4RCZA 5TSDA 2XA9A 3LUDA 8GPBA 1CHNA 3O2NA 3R20A 1EU1A 1WCWA 3TUZC 2XA1A 3MN1A 1ZKDA 1TO1E 5AJUA 3K71B 4XVRA 1L5YA 1W19A 3ELDA 3F96A 3FDZA 4LJ6A 4MVJD 4ZANA 1KK1A 3V6MA 4ARIA 2FUCA 2G6TA 1YMQA 3R5XA 3DDOA 4LTDA 1CIVA 1N3BA 3BIFA 2XKAA 1E61A 3NM5A 4RZIA 2PL3A 5EVJA 4ALKA 3ZVNA 3S27A 3H5IA 4RHFA 1GTZA 1W94A 3FLMA 1E2JA 2G4LA 3LRPA 3KV1A 2IV2X 2C8JA 4ZV4A 3WE7A 4Q4DA 4HLUC 1S2DA 5BO5A 2EX1A 2NVUA 4F0JA 4U2EA 3LSYA 1J1ZA 1HYEA 3KQWA 3O21A 4YIKA 3O47A 2F1IA 3L6DA 5EIOA 1WVGA 1OX5A 1UDXA 2ZREA 4BMCA 3GMTA 3I6IA 4QU0A 3MFYA 4QYIB 4ZQHA 2X13A 1MGPA 3O7MA 5EY5B 2JGLA 5K0ZA 1TNDA 4L8YA 2B9EA 5KC8A 5LA6F 5P8WA 5DIZA 4EAQA 5DEIA 1KOLA 4QQKA 5DYGA 2F62A 4CW7A 3RTEA 4JUAA 4FYKA 4JROA 1KI6A 2Z0MA 3BH6A 1Z29A 3DE0X 3IQGX 5H70A 3HPQA 2R7AA 2B92A 5B1SA 4DMUB 2YNMA 3WLPA 4R5MA 4MRNA 3AHJA 4B6JA 2H57A 2ZULA 3DE6X 4RLQA 1JKFA 2RIPA 2YVKA 4L5AA 3EGWA 5DBOA 1PNVA 5JSFA 2IGBA 1US8A 1EGAA 1QQ7A 1J1IA 3HKBB 2HM7A 1DBVO 5LBUA 3UHPA 4ZYVA 5CFZA 1A0OA 1FYEA 3G79A 1MB9A 1J09A 1KO1A 3UK0A 1IB0A 3M4ZA 2DUWA 2ZWVA 3HHPA 5FOTA 4AP9A 2IEGA 5B55A 1RQRA 4JR1A 1RPJA 4EFMA 4C4RA 5FL3A 4OAOA 3RVPA 4HZIA 5MGBA 1E5TA 2B4KA 2C7PA 3AI3A 3HCDA 4RETA 2VXCA 1VZ3A 2QVYX 4KAFA 1LC3A 3SEKC 4KQ6A 1QDUA 2ORWA 1E60A 2PS9A 3R7WB 2HJ9A 1U4NA 1CT0I 1BCRA 3H8VA 5BNTA 1U3DA 2DQYA 3G2LA 4ND1A 4J4TA 2I8LA 2X41A 3R2JA 5FOQA 1ZCJA 2FSSA 1UJ4A 4D4IA 1KY2A 2IPMA 1SY7A 3RFVA 2B2CA 1H66A 2OQRA 1PDWA 2ZJ7A 1YZYA 3G85A 4MB6A 4P3NA 3SC3A 5JDIC 4WKNA 2DLDA 2HMTA 2ZIUB 3T7RA 1G41A 3O1LA 1C7IA 2E48A 2ZIXA 2X0IA 5EX0A 4J0KA 3OU2A 4DEXA 1Y5RA 2BTEA 2OEPA 3HDHA 2FTKE 4KQ1A 4QGFA 1CJKC 1H0SA 1XMJA 4R0VA 3JSAA 4Z4CA 2WJZB 4PC3A 1U2PA 5KQLA 1SVWA 1ADYA 4Y3UA 1TVEA 4ND8A 5ALIA 3CRNA 2WKRA 5IS2A 5JXIA 1TAHA 3RRBA 1EUDA 3T7KA 4RMHA 1AF7A 1IRXA 3GRPA 2YJGA 5EP2A 5BWNA 4ZYWA 2VHZA 4RAOA 1JFRA 2QXTA 2WSBA 4GW3A 2JW5A 3RUPA 4DMGA 4P1ZA 3PB3A 1AURA 2JHGA 3PR3A 5JAOA 2JFWA 4BNWA 4YREA 4GAEA 3V4VB 3R9WA 2WR8A 4L5IA 1IHYA 4OYLA 5CGQB 4ZO9A 3T0IA 3H2SA 3C8MA 3JQ7B 4DZTA 3VH4A 2QZPA 4ZDJA 5HDQA 2V7UA 4AZWA 3MFQA 4V0RA 3ROZA 3GDOA 3CEHA 1Z0UA 1U31A 2AC7A 2MIIA 2W8BA 4KQ2A 2QR2A 5E1BA 3TQIA 5L4LA 4GXRA 1GL3A 3IQIX 1RKUA 3OBBA 2QA5A 1E32A 2I0FA 4YRDA 3GNLA 5T6BA 4DDKA 4W5HA 2I6QA 3A2NA 2J07A 3WKCA 2XQJA 3NM4A 3ERCA 3G2NA 3KZMA 1MC1A 1XF1A 4I99A 3I05A 3RUCA 3U4DA 4JOSA 3I45A 3N7UA 4PAMA 4RIIA 3TG8A 4B3IA 3B4VC 2C1EA 2JGEA 5FPTA 1WE2A 3F47A 4U5QA 1TB4A 3DJFA 3L0SA 2X3FA 2R66A 3PGKA 4Q7LA 4DNFA 4F4CA 2JFNA 4TTVA 1RRFA 3L4EA 1OB2A 3IP9A 4QNRA 2WMDA 1UWCA 4R31A 4ZVTA 2D74A 2JKVA 3H1BA 1SZCA 3AR4A 1L4EA 4FYIA 3DS8A 3QKUA 4WNAB 1NG1A 3DBRA 2GVZC 1S02A 3X2EA 1LX6A 2QL6A 4ZTUB 3GXBA 5JCJD 5A05A 4CJXA 1G9XA 1K92A 1X19A 3AC0A 1FW6A 2I1LA 4QPNA 1UM8A 1RYZA 2O5RA 2UXDB 1W9MA 4G4JA 4WZ6A 3E58A 2WUFA 3I8XA 4PSCA 1KR5A 3RVNA 1BD4A 1U3VA 1GXSA 1V45E 3EWIA 3MAAC 4WLUA 5DSTA 3U26A 3N2GA 3BMNB 2QW1A 5FOVA 1MO5A 1ZVMA 2QJOA 3N2ZB 3V42A 3WNQA 3LZDA 2VP0A 2Q3EA 1IM2A 1KDOA 4RK6A 3V8VA 3AGPA 3BDAA 4TV9B 1DGQA 3OKAA 4V3BA 4RA6B 4IJKA 1DIOB 1C1YA 1JEJA 5G4KA 1SC3A 1YB1A 3GNTA 2XCTB 4AUNA 1YFLA 1FY2A 3JQRA 1U0FA 1XCLA 3GAAA 4MSUA 3I73A 2VSFA 2NU2I 2W2LD 5E9QA 3QNWA 4NFSA 4KIFA 2FHSA 1JDPA 2WDPA 1V5GA 4JUBA 1LTQA 5A7GA 3TTYA 3VNQA 1DC5A 2PUEA 3WGTA 3GMSA 4Y2QA 2YDXA 4G07A 2PD3A 4LCEA 4YJ2B 2BGWA 3H5TA 1XPJA 1K6MA 1TUBA 2ACEA 2PL9A 4ZVLA 1X42A 4TYWA 1K8ZB 3O8DA 4F91B 1JPUA 3VDUA 3R7FA 4NU5A 2XEXA 5HZHA 3Q87B 2XMDA 4L07A 5IFLA 4XJSA 1EFVA 2Y4NA 4IINA 2QE7A 4X62B 1YQXA 2QGFA 3O8QB 4TT3D 2EFYA 1OBVA 4PPNA 3UBTA 4NBTA 3OZBA 3E7PA 3S7ZA 4NE2A 4AJLA 3BZUA 5A03A 2ENZA 1DUSA 3D31A 3HKBA 3X2SA 3GDHA 3ZWBA 5HZKA 2XUGA 3FPJA 3MBOA 4DKJA 3U4MA 4G5RA 4NFLA 3M2PA 3W8DA 4CMCA 1I5RA 2YXBA 1ZM9A 4M0KA 2FWMX 5D84A 1C41A 2P4HX 4MMYB 5KAPA 1EDBA 4Q1EA 1EIZA 1ZM7A 3IPRA 3S8EA 3THSA 4QRIA 3RHZA 4JNCA 4NJMA 5KTTA 2XCUA 3G2IA 3F71A 3T5TA 1DTWB 3JAMA 3FUWA 4WESA 3NOQA 2Q4TA 2DXIA 5BQXA 4L16A 4BJ6A 2QTGA 1GDTA 1D2GA 2VYCA 3SC2B 4F6CA 4ZK2A 1U2EA 3KT6A 4TXHA 4RKWA 1T2VA 4FMBB 1E89A 4IQ8A 5A1TA 1B41A 4UOEA 1SBNE 1BE8A 1V9SA 3KJGA 4KO2S 4WH0A 3TLYA 3BXZA 1SXPA 1SBYA 2OXTA 2HMWA 3V8BA 5K0CA 3HACA 3PIIA 1ZH0A 4AMVA 3ZKWA 1ICEA 1ZINA 2B34A 2DGDA 2JC3A 3C5HA 1Q16A 2OOKA 3K1JA 1N2CA 3Q9UA 4EGJA 4GLBA 1U7XA 2Q3HA 1BMFA 2QP9X 1SXQA 3ZE8A 4IGIA 5C46F 1YC5A 3GEBA 1DG9A 4FLEA 4WADA 4YCDA 4MKRA 3WK8A 1RXIA 2ZRNA 1SVMA 4KOEC 1E66A 5GVSA 3RVKA 1ORRA 4GEKA 4ALIA 2PD4A 3JTMA 3D4IA 3NMUF 1NQ5A 2MSNA 3WFJA 4OGFA 1M8CA 5FL7A 5DNAA 4MTCA 5JYBA 3I6BA 2ZVDA 4YT8A 2GHRA 1IEQA 3RT1A 4U7FA 1I7NA 1OPRA 3IBYA 2FA9A 1CC1S 3WRXC 3B9BA 1T8YA 4JXJA 1V4BA 1OFIA 4D9KA 5LJLA 1CUYA 4B45A 4FMCB 3H7AA 1OWNA 4E6EA 1J8QA 2F90A 4DR2B 1H1DA 2GTIA 3AIKA 1SXJC 1Z4MA 4PZZA 3LY9A 1A5ZA 3L8FA 3OTGA 3PRHA 3T3GA 2H85A 5E8JA 2AT1A 2CXSA 5IDWA 3O4VA 2JIPA 1XTRA 2D2XA 3IR6A 3CZQA 1Q0UA 1P1KA 3CZRA 2VHCA 5E3IA 5KYVA 1M83A 3LKBA 2FVXA 3AR9A 2XITA 1G4HA 1KMCA 1SCNE 3Q41A 1LGYA 4MWEA 4P2GA 2BM1A 4NV1A 4O4JB 4X63A 3FGOA 2R85A 1KZ6A 1V37A 1A2OA 4IW3B 1WZCA 3DNMA 5FWXA 4CN8A 1P7YA 3FR7A 1JN0A 1UBMS 3NBAA 5JRJA 1GITA 3ZD8A 1C3XA 1T4MA 1KPGA 2L2QA 3TZQA 2ZDGA 1H1LA 4A0SA 1JDZA 4IS3A 1BDHA 1R0YA 4N3GA 2QWXA 4JJIA 5CLIA 1VFPA 2N42A 2W2PA 3DMDA 5C0OE 1E0JA 3ESAA 4DY4A 2FLVA 3NGMA 3ZDBA 1MHPA 3I3SR 2CFOA 4HQLA 2F3PA 3ZU4A 3OE7A 4IDGA 1RXUA 3DO8A 5AUPB 2PJRA 4C2AA 1CEEA 1X7HA 2C04A 4G8JA 4LRUA 1OIVA 1HQCA 3LQ4A 1ZD1A 2COUA 5DULA 1X8KA 1KDYA 4C08A 3KWLA 3NDRA 1JRLA 4NXNB 3HU2A 3LDUA 4P5DA 3UB3A 2A9OA 5KNCH 5LKRA 4NSNA 2I7XA 3IEIA 3FCUB 1RWKA 4PLHA 4LZWA 1XC7A 4NG4A 4OHOA 1GNLA 5CYGA 4V3CA 4KDCA 3S2ZA 3T7SA 2WE8A 1RDFA 5DM70 5A9RA 3ZOKA 2EXXA 3H4VA 5HKOA 1EVEA 4PC2A 2VUHB 5K8UA 1VKHA 1SIOA 1D2EA 2PV0A 2AMYA 1K9VF 1S2OA 2BR5A 2QAGA 2VP9A 3BERA 3C3CA 3REGA 3DNFA 3TSYA 4LXTA 3E1GA 2W6ZA 2HZBA 4CFSA 4IXMA 4F5YA 3S1SA 4BC0A 1XPOA 2LGJA 5HK9A 4L74A 2KM1A 3DH0A 5AW6A 1HEUA 1LSJA 3L0OA 1L5RA 1Y48E 2G63A 3REQA 4CWAA 4O5OA 4D4KA 2RGXA 3KBOA 4LOKA 1Z4NA 3DL2A 3O6VA 2ZQZA 3UTDA 3ZCRA 1B8PA 4EY4A 4HWOA 4RTQA 2B21A 1M1UA 4GYKA 3UUFA 4BU0A 1E6UA 4E08A 1PDOA 5AKJA 1ZJWA 1MGOA 1JDSA 2JD2A 1NKVA 5C8VA 1NE7A 1GPKA 3PCTA 4GZ5A 4PIMA 5KWJA 1QPGA 2Z9DA 3KKEA 3SZRA 4ICIA 4AKSA 4C07A 1VCHA 5HMMA 3EGDB 5CCEA 5IJZA 3UHJA 1GA4A 3HCBA 1HDLA 3GQBB 3OFND 1Z63A 1MC4A 4FKZA 3GL9A 4Q05A 3VNAA 5GINE 3QYPA 4DDVA 4X95A 1S3SA 4AP6A 3QWAA 2CLKB 4PX5A 5EYPA 4OU4A 2C5FA 2Q9CA 1SU7A 4BFVA 3DMYA 5HQ8A 4ASUA 4XXHA 4D98A 4JBYA 3AI2A 1JEAA 3WGHA 1SEVA 2K2QB 4FGUA 2Y3IA 1U5BB 3AZPA 3UQYS 4DGSA 5CW1A 2I91A 2ODTX 2V0NA 3FSGD 2FPMA 1XR3A 1Z5GA 2GBPA 3QLEA 3NO4A 4WNIA 4EG3A 4I1VA 1FMTA 3DTNA 3AW9A 1WXIA 3RO7A 4HQNA 3OI7A 2Q9AA 2PUGA 4KYTA 3NHKA 2ODDA 2Q49A 4PGGA 4ZI7A 5H4GA 2VHUA 1UMDA 1UK6A 1LBIA 3GB9A 2MINB 4M0LA 1DJNA 4C7JA 1WB4A 1WPQA 2VSQA 4QLOA 3PPYA 3VR5D 2W4QA 4CTOA 1UVFA 2OXCA 3FSRA 3OIGA 1T0UA 4IXWA 2QN2A 3I37X 1YCGA 2IPNA 1UBSB 4R3UC 3VNBA 2HK8A 5DX8A 4O4IA 1OI3A 1DDIA 1XDUA 1PFKA 4MVJA 1YL6A 2Q4OA 3K15A 1MAWA 2L17A 4J1TA 1O5OA 2IYAA 3RC8A 2FZVA 4AP5A 3L0YA 1JJAA 1SCDA 3MLEA 4B3CA 4BQQA 4TYMA 4B76A 3EBPA 1I13A 2IEBA 1HK7A 4K3UA 5KVAA 5CX4A 3AP1A 1PR4A 1OZ0A 4DXAA 1JG3A 1EE9A 1OLUA 1QIMA 1VIAA 4HDMB 4H4CA 5E2BA 2Q2OA 1IHUA 4QJ4A 4Q3OA 4WDRA 2H2AA 3A4TA 2HFKA 3FCSB 3G2JA 3MIIA 4BJ3A 2NUBA 3N5CA 2ZITA 4PYNA 4OI1A 1W47A 4NENA 1MOQA 5DJ5A 1YCFA 2AH5A 3IAM1 3P26A 4IHJA 4UQOA 4C0HA 5JALA 1QHYA 4FN4A 2VL7A 3WQRA 4CL3A 1EI9A 2OAEA 3WWPA 2AJTA 5EE3A 3BD9A 4YRZA 2ZRBA 4CIAA 1N0VC 2V5AA 3NFRA 1X1SA 1YBMA 5LP1A 5TV2A 1IPFA 5L9AA 4ZN6A 2OD7A 4PO3X 1HT1E 4CKEB 1ODIA 2AR9A 1COZA 1DKUA 3U4AA 1CUJA 1EX1A 1LVHA 1NA5A 2NSLA 2PJDA 3JR7A 4MMZB 2CJXA 3CG4A 3UVEA 1Z2EA 2BEVA 2IEIA 3C48A 3QRWA 4RWEA 5HJ5A 3HQ4O 3VPBA 3O92A 4J6EA 3GFBA 1SGPI 5E7MA 3TLAA 2GTHA 3ESBA 2I2FA 1PLJA 2Y71A 2WAMA 1ZQ9A 3D7SA 3E7DA 5CM2Z 2OMEA 5JADA 2OMKA 2H5LA 1W581 1WOMA 1JYEA 2PHZA 3BF8A 3LXRA 4GMXA 3PUWA 4PSKA 1UXOA 2FWBA 2V7QD 2HMYB 1M33A 3R5DA 3M5PA 4NZZA 3RADC 4KDFA 2C78A 4IDDA 5JS7A 1Z75A 2NO5A 3ZWNA 5C51B 1CHDA 1X14A 3E7WA 3PXGA 3T12A 2J8ZA 3NHWA 4MB2A 2H2IA 4KNYA 4N6NA 1P72A 1R7RA 2WKQA 3H3JA 3ZV6A 1NYRA 3ZWAA 2YICA 4GI1A 3QXCA 2Q5CA 4O5AA 3AHDA 1VGQA 4LRWA 1VPLA 3BZWA 4GRAA 1IZ8A 4OI4A 4NDAA 3KZOA 5EUCA 2A7QA 1E5LA 4W5JA 3K8ZA 4C5AA 3KAKA 2F59A 4PYJA 1EH5A 4L72A 4MVJE 4PGHA 1P1FA 3PXAA 4L50A 4RQUA 1MOPA 5JWHA 4DPLA 5D85A 2GKGA 4FCWA 3AZQA 4NONA 3NDBB 2H7CA 1YL7A 2BZSA 1ISRA 2FXVA 3L7NA 1OJ7A 4WZAE 4ZJZA 5BNWA 3DAOA 4MPRA 2HSJA 4FHCA 2VOJA 3TKYA 2PD6A 1NF3A 3IQXA 4DFDA 5KNBD 1E9FA 3TQTA 4BZWA 4DV3B 2GM5A 3C97A 3DTYA 2GPTA 1P7ZA 5IDVA 5GZ1A 4EYEA 2GCIA 1JHAA 3KSDO 1A8IA 3I1YA 3K9LA 5AVWA 1UBOS 2GRAA 4ER6A 5TMPA 1LK5A 1RJWA 1CF9A 3B6EA 1KO5A 3NPAA 3E82A 3KKLA 3PK0A 3A1VA 3AONB 3FPEA 1BMQA 2P9JA 1VBNA 4HQ0A 3FBWA 2CBZA 3OPQA 2CLOB 2F00A 1VJDA 2IHZA 2DP4E 3BRSA 5JJ5A 5KYYB 4FW9A 2GNOA 1H42A 3IDZA 3RVDA 2NPOA 4LUCA 1S4QA 4LZPA 5CDSA 3KIPA 1TYZA 4LV8B 4Q39A 1USKA 4RE5A 5DF1A 2JFYA 2OQ2A 2XOKD 1FMCA 5IT0A 1MLDA 1UBRS 2JW6A 4M99A 1R88A 3M3HA 6AT1A 2XYPA 4OQXA 2H2HA 4TWJA 1Q1BA 5BY2A 5TXGA 1YHNA 4AQDA 4EQZA 2A1IA 2EQ5A 4GKKB 3NTXA 2PZGA 3LOUA 1LTHR 1K6XA 5K6TA 2PLNA 5FHRA 1T2CA 4NRDA 2D59A 4O2BF 5DTEA 3H9UA 2OYSA 1KBFA 1IUNA 4MUAA 2J3MA 4IV8A 1O0BA 1DRJA 2GK7A 1C4OA 1DCKA 3MMPA 1IOVA 4OQZA