4UXHA

Leishmania major thymidine kinase in complex with ap5dt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
173
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVALMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 49
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxhA01
1A5TA 1Z0DA 1W36C 2YJTD 4Y0AA 3VU9B 4A0FA 4WA7A 1X6VA 3TGPA 4PR0A 4KU4A 2EWWA 2YOHA 1A82A 2ZRJA 4AD8A 4C9BA 5JI2E 3CRRA 4MUAA 3KY9A 2BV3A 4CF7A 4F92B 1HURA 1GAJA 3BOSA 3EZ7A 4I99A 3O8RA 1OXXK 4KV9A 3VX3A 4IKEA 3EAQA 4V0LA 5JFGA 1Z5ZA 3KB2A 5JI3E 1TQ2A 1DS6A 2QP3A 4EPVA 4RD0A 4YQFA 4P32A 4LC1A 3KUDA 1QHYA 4OQLA 3MD0A 2ROWA 5DI9A 3SOPA 3GJ6A 4FMBB 1TF7A 2BJWA 2X1VA 3K9HA 1KAGA 2JLXA 3A58B 2BJVA 3P20A 1UKZA 2J0UA 3WHKA 4GL2A 2OFWA 3NHAA 4Q01A 3TAUA 3GLHB 4B3XA 1E9RA 2V55B 1U98A 3EIQA 4PSAA 2V3CC 3K70C 2VF7A 3H84A 1UBFA 4IJMA 3HYRA 1O87A 2OXRA 1FP7A 1T0HB 1OH7A 4CEJA 1KBEA 5A0FA 421PA 3E2IA 2WZQA 4KFTA 1YKSA 3CF2A 1G4UR 5C46F 4LHVA 1R7RA 4IOKA 1CLUA 4Q4HB 3GLGA 3MG9A 2RGNA 3QPUA 2ZS9A 5IK2A 1XEFA 1VCNA 4PC3A 5AR1A 2PJRA 4DT1A 1EX6A 2W0MA 2ZRCA 2VTKA 3OAAA 4MRSA 3LVQE 5EE9A 3LQQA 4URVR 4B3BA 4B2LA 4OQXA 4C3ZA 4FWTA 1QBKC 4OKSA 1D2EA 4FCTA 5FL3A 2R2AA 3PEUA 3FHOA 4OI2A 1YZKA 4IHQA 4M1MA 1W5TA 1XD9A 4TQUS 3U7GA 3ZLJA 3WYGA 2J7PA 4KO8A 4LYJA 3UG6A 2QU8A 4PAMA 4BFZA 2ZE7A 2OCBA 2NO7A 1KI7A 3DL0A 3VR4A 3LW7A 3X1DA 3IKJA 1OT3A 5BWMA 1T3LA 1E96A 2VQSA 1TQ6A 2X2EA 4LC0A 2V7QA 1UKYA 2R62A 5FTKA 2ZE6A 4PC6A 3RWMB 1TQDA 2YWEA 2D3WA 1ZJ6A 3NBYC 4MYTA 3AB3A 4YMSA 2RGBA 4EPXA 2IXEA 4S2EA 4ARZA 2ZR0A 1TPZA 1ZNWA 5FH9A 4GI7A 5HR5A 1MABB 2N1BA 4AKIA 4DSOA 2EWVA 3TH5A 4P31A 5EJEA 3A1VA 2Q0HA 1IOZA 4JT4A 5BQ5A 2P0EA 3VKWA 1X8KA 4F38A 3BERA 4IEIA 4IXNA 2OILA 5EUQB 5EUMA 1BMFA 3VX4A 3E70C 2BEKA 2WOOA 4V0OA 4IDHA 4JS0A 3IPYA 2X8AA 1TEXA 3IIKA 4Q7KA 1EG7A 3TAHA 4HSEA 3U3OA 2XTZA 3A4LA 1EESA 4QRHA 3DHWC 1HY3A 1Z22A 1OHHD 1AJEA 4BEBA 3RS2A 2AKYA 521PA 2VL7A 1VIYA 2ECKA 2ZRPA 1J8YF 4GZMA 2MMGA 4C0HA 4IVRA 2VPPA 3C4JA 1E2KA 2ENZA 1DVRA 3IQWA 5HE8A 1GG2A 4LV5B 3D7MA 1X86B 3CR7A 1E9AA 5CYPA 2VBCA 5AUOB 3ECCA 1DBSA 3NC0C 4JIMA 5GADl 2BVNA 2W6IA 3FE2A 3OF5A 1Z63A 3VR3A 1MV5A 1YR9A 2QTFA 1KY2A 1NSFA 2ODEA 4TL7A 1KY3A 2CLSA 2KBEA 3QXHA 2OHFA 2C99A 2FFBA 5TV2A 2F43A 4DDUA 2Q3FA 4MKHA 1PTQA 2YC4C 1OKKD 4PSVA 5KNDA 4L9MA 2F6RA 2H8KA 2A30A 3K0FB 5DH9A 1VG9B 1X8LA 4BFVA 1RJ9A 4BFTA 2DPXA 1G8GA 1ZU4A 1LV7A 2D4HA 3C15C 4ZCLA 3Q85A 3TJZA 3ADCA 3EPJA 2N46A 2CCGA 3SEAA 3X1XA 3TNFA 4JLJA 1LB1B 1E1QD 1J2JA 3VFDA 5LPNA 2IEZA 2ZYTX 2D7DA 2YYZA 1G8HA 1ZP6A 2R65A 1F2UB 4NU0A 4NE2A 4RSGA 3THWA 1XMSA 3BS4A 2XZPA 3N2EA 3UEJA 3PUXA 4B3GA 1JR6A 1KYIA 1XP8A 1SVLA 1AGRA 2CEAA 3KX2A 4Z1MA 2ZJZA 2IK8A 4UXIA 3IDQA 1U0LA 3ADKA 1XXHA 3X1YA 4CEIA 1NN5A 1GZSA 2CXXA 2W6JD 5KPDA 4TL8A 3TIFA 2XXAA 2IXFA 3RC3A 3C14C 5KOYA 3EG5A 2AFIE 4V02A 1G7RA 4KI0A 4M9SA 3IO5A 1TX4B 1E9FA 2A5FA 4I1VA 4B34A 2PZFA 3CIOA 2JJ2A 2JJ1D 4RCZA 3KDSE 3H0KA 3NTUA 2BMFA 1U0JA 4F93B 1ZD9A 4ZO4A 2FPMA 1TU3A 4MITA 4LV8B 5FPHA 5SZHB 3ND9A 4HUTA 3VHXA 1FOEB 2QM7A 4B44A 5LB2A 2ZPTX 2ZRDA 3GEHA 1ZRHA 1XMIA 2WWFA 4YXWA 2EFGA 2OUKA 4BZXA 5IK2D 1AZSC 2CDNA 1C9KA 3EPKA 3QVVA 3AVYA 2ZSFA 4NMMA 1WF3A 3LX5A 1RPZA 1NY5A 4ZCIA 4C2UA 4O2RA 3HR8A 2QBYB 1Z6YA 3REGA 1BYIA 5CM8B 3RSOA 3U4QA 3R9XA 4A1FA 4MDEA 4XD7D 1AS2A 2JEOA 3OAAD 5F2EA 4EPTA 1TUIA 2G0TA 2ZQ5A 4Z8XA 4IDQA 1ZNYA 4GP6A 3EC2A 4GT1A 4JKYA 821PA 1GNRA 3SI7A 4K46A 4FN5A 1Q20A 5CIWA 4YMVA 5E7IA 1J70A 3P27A 2BM1A 2YZ2A 2K5UA 4LJ6A 1JJVA 5JEDA 1ANKA 2J7PD 5EXTA 1E32A 2G88A 2YOGA 3CXLA 3GLGB 5FBRB 4B3CA 3KQUA 1RRPA 3U5ZB 2GKSA 5J4KA 2ZRAA 4QGGA 1OXSC 4D4JA 4M4SA 1XEXA 2JCSA 3GJ4A 1Z47A 2CCJA 4FINA 2PL3A 2ZRLA 3OFND 3QKUA 4PPQA 1KO8A 4X8HA 3PCRB 2NIPA 4LPKA 5SZJA 2A5JA 1X8JA 4L16A 1KI1A 1PJRA 1TF5A 1A2KC 3UG7A 3WMEA 4BFWA 1KO5A 3O47A 3Q9LA 2RGDA 4JLNA 1YZQA 2NPIA 3MJHA 5CB6A 4U7DA 1II0A 2PBRA 2NZJA 2X19A 2QPAA 3D8BA 4Y0VA 5GVSA 4A6XA 4ZIRB 2OLKA 1FMJA 1CJVC 4PAOA 4JVMA 4CT5A 3QY0A 1FPMA 1ZUHA 4HAVA 1R5OA 3KJGA 2ZU0C 4TLDA 3L8ZA 4DHEA 3QXJA 2B7CA 4JSTA 1KK3A 1TADA 3LX8A 3GLFA 4TTQA 4RZUA 4ARZB 4OI4A 2YNMA 3WP0A 4AYTA 4ZCMA 4YONB 1H8ED 2YOFA 1NVXQ 3VAAA 4HEJA 2W6ID 5JWRA 2VO1A 2GCOB 4DIDA 1ZM7A 4KFSA 2IYLD 3UFFA 2WJHA 5JHHB 3QXSA 3TUIC 3WXMA 2QSZA 4PZLA 1Z8FA 4R7ZA 1KHTA 2FA9A 3KFXA 3H2YA 3HJNA 4Q4AA 1M1YE 4OHZA 4G5SA 3W6NA 4ZDKA 3I5XA 3U7FB 1Z3IX 1QHIA 4I4LA 4M1YA 1BOFA 1FQJA 4A9AA 4OQNA 5J4HA 2WKPA 4TQAA 1WA5A 1NSTA 2ZE8A 4DDVA 2VHJA 2VA8A 3W6OA 2ZRMA 4ON9A 1COWD 4UNQA 3KKQA 2OAQ1 3CZPA 3LY5A 3AEZA 4BRWA 1PLKA 1OIXA 2BDTA 3ZS8A 3B1XA 4TYNA 3K1JA 2UKDA 4K81B 4QHSA 2HDNB 4BECA 5IHPA 2JATA 2PJZA 2ZRKA 3GFPA 5DO9A 4ZDIA 4OI1A 2HXSA 1YQTA 1N3BA 2IWRA 1W49A 2NGRA 4BFSA 3TMKA 2H17A 5FFMA 3W5IA 4MKIA 3L82B 1R4AA 2F43B 3I32A 3K0EA 4LCBA 4EFMA 3ADDA 4L4UA 5FBQB 5FOUA 1ZCBA 3IHLA 5IF9A 1NKSA 5KPJA 3VR1A 1PLLA 1KZGB 4WBSA 1XBTA 3GMTA 5BYJA 3LVRE 1W1WA 2QPTA 3GLHE 1X1SA 5B2ZA 3FTQA 3FMPB 3UGLA 4IRUB 4Q21A 4TLBA 1Z6XA 1ZM2A 3I92A 4G5OA 4OK6A 2WMNB 3C5CA 4U00A 4Q1CA 5FUWA 5A4JA 2VRWA 1KI6B 2HV8A 1PVOA 1DAFA 3UEYA 4TMXA 5JJLA 4DLWA 1T0JB 4IFEA 5KSZA 2BWJA 5JCZA 2WKRA 3SFZA 2A3RA 1F3OA 2D74A 3IQXA 4XVRA 3X2SA 1MO6A 4O2LA 1BMFD 3QKTA 4GSYA 1VYUA 4AC9A 2IS2A 1W0KD 1G291 4RKEA 4CEHB 3BFVA 1VDZA 3TQCA 1QHSA 1OB5A 3CPJB 4AURA 1BS1A 3QKRA 1TMKA 1ZUNB 4Q1EA 3RHFA 2IHBA 2GZDA 5FR1A 3SS8A 4BRUA 5HKKD 3ADBA 1T5LA 1F2TA 4ITRC 2J0VA 1GIAA 3JZAA 1Z0IA 3U3MA 1OXTA 2R9VA 3IUYA 3I61A 2C03A 3K0FA 1SVMA 1U2RA 4MUBA 1OH5A 2Z6VA 1IHUA 5KSOA 4WAUA 3WP1B 1G7SA 2XX3A 2O5VA 2B6HA 1LY1A 5BW8A 4TLAA 3LLMA 5F9HA 2QN6A 1KO7A 1M6NA 4KXFB 2DCUA 4G5QA 1W4RA 4NYIQ 3U60B 4JLDA 4C7OB 1DAMA 4ZIRA 2EFCB 1KAOA 1CJUC 2GAOA 4Q7LA 1P9WA 4FWIB 5AWFC 3W90A 2REBA 3GEEA 3KKMA 2DYKA 4OJKA 1G9XA 2C9OA 1XTRA 2IYXA 1U8YA 3IO3A 2JLRA 4TYPA 2GEVA 3GD7A 3P4YA 3GLFB 1R0XA 4LZZA 1F5NA 1UBGA 4AK9A 1TU4A 1ODFA 5HE9A 4B47A 1Y63A 3F3YA 4LV6A 4O25A 1KDTA 4HUQB 4G5GA 2XB2A 4PSKA 1IM2A 1IQPA 1AGPA 1JEDA 4DEYA 4DCNA 3FMOB 4M9XA 2OFOA 3QEJA 5JZVA 2O0HA 3JVVA 3OE7D 2WMOB 1E79D 3T5GA 1FL9A 1OH6A 1Z0AA 1Z2AA 2RB4A 3KXKA 3QOFA 4QHYA 1S2MA 1SXJA 2IYYA 2ZRIA 1KDRA 1RYHA 3V00A 3TW4A 2GA8A 3EIHA 1G18A 1G3RA 2Z0MA 1MRNA 1OHHA 3K0CC 4JJKA 1NG1A 1NN0A 1IONA 5CYOA 2Q9BA 1XEXB 4C0JA 3VR2A 1MOZA 4EJSA 4WXRA 1EFTA 1E1RA 1WCV1 3DM5A 5DLQC 1P2UA 3AQ4A 2IS1A 1RRCA 1I4DD 2QE7D 1UPTA 3O8CA 4BZPA 2V6JA 3TSWA 3GLGE 2ZJOA 1OIWA 1KIMA 3AF3A 4AG5A 1NLYA 1YU9A 1P7CA 2V6IA 1XZPA 1S4QA 4MGYR 4Q9LA 4D0NA 3MGCA 2IT1A 3KQHA 4LJ5A 4CZ2A 1F2UA 2RAPA 5ANRB 1XZQA 2JLQA 3M0EA 4DLYA 4DWJA 2XZLA 4QL3A 3B6EA 5JSZA 4CIDA 3EZ6A 2HJVA 1E4YA 2EQBA 2P65A 5E3HA 4PPFA 3AKCA 4DVGA 2YWGA 1XU4A 1U94A 4BLSA 4JYCA 4KHZA 1VIAA 3QIAA 1S1CA 2QP4A 4NYMQ 3CNOA 1KNQA 3L0IB 2J1LA 2JLZA 5P21A 4HAYA 4II7A 2F3RA 1S9DA 1PTRA 3TLXA 2ZITA 3U44A 2NO0A 1R6BX 1E3MA 5KDDA 4XD7A 2PH1A 2RH5A 1CF4A 2YVUA 3S1AB 1T91A 4RD6A 1OH8A 4DSNA 4HATA 4HB3A 2QEQA 4PZYA 1WP9A 3BRWD 3W5JA 4BEJA 1OJLA 4URXR 3T1OA 2CLDX 3T61A 3U61B 1TUEA 2GJ9A 2IUUA 5EE1A 1FUUA 2N42A 1IXRC 1PZNA 2GRJA 1XMJA 2HYDA 3BFKA 2IYRA 1OKKA 3AH8A 2WPDA 3OIYA 1KSFX 1KO4A 4RZ3A 4AYWA 1KK2A 2GK6A 1VG8A 3U2QA 1F48A 3DDCA 4OYHA 4C0AC 1NP6A 2Y8EA 3QXXA 2QT1A 3UKDA 1ZINA 3WHLA 3OE7A 1SVWA 2WICA 3ZIAA 4LJAA 3U4QB 1JB1A 2OSBA 1XRJA 1KJZA 3B7GA 3Q3JB 4LDJA 3PFIA 2JJ2D 1WRBA 2D62A 2JJ1A 2QMHA 1N6PA 1CRQA 2GJSA 5JHGB 3AVTA 2W00A 1P2TA 2PMKA 2AD1A 3Q5EA 1E2IA 4LBWA 3SHWA 4OHVA 2MSEB 5H8WA 3AP2A 3CBQA 5DIFA 3MAAC 4RZXA 1Z06A 1SXJD 5FTMA 3LNCA 2WBLC 3GJ8A 4M9QA 4F7WA 3PENA 2HF9A 4DUGA 2V54A 2ASEA 4QBHA 2IYUA 3HYTA 4LGMA 4D6PA 5JRZA 1U90A 4MH0R 2E1RA 2G1JA 1RC8A 1SVIA 2R6GA 4PC2A 5AUQA 2VF8A 5EXXA 5FPKA 3OEHD 4QM6A 2Z4SA 3OIWA 3DZ8A 4C0SA 3CPHA 2W83A 1SZPA 1G3IA 1Q12A 3BC1A 4A15A 3AUYA 3QUSA 1FQKA 1U99A 1P9RA 3FWYA 5EP2A 3ICQB 1SHKA 2YWHA 3LW8A 4B74A 5KUTA 1Q1BA 5J40A 2ZRNA 5DGXA 3N5CA 4ACBA 2ORIA 4BZQA 1GWNA 4IOJA 4QBIA 3VHLB 1BIFA 1T3SA 1Z0KA 1NMZA 1SXJC 5DISB 2ZJ5A 1GRRA 3SN6A 1CR1A 2WJJA 4JLOA 3LD9A 2Z83A 4RFSB 3NBXX 2P2LA 2WSMA 2CL6X 4U5XA 1E1QA 2G83A 4BPBA 3LLUA 3CWZA 1N6IA 2E87A 1L4YA 5JS8A 3K8YA 3U3KA 3VR5A 5D3QA 5KDOA 5FOXA 3GLIB 4XWKA 1GKYA 4CEJB 1HH4A 4B43A 2EU8A 4JZKA 4C30A 1W47A 1YZUA 4UJ5A 3GFOA 4GMXA 2CE2X 4Q4AB 1TL7C 2R6FA 1E2PA 3LFUA 4G0NA 3RANA 2QTVB 1ZBDA 3LWNA 3PQCA 1D2MA 1FW6A 2YUUA 1MO3A 3AVXA 5DN6A 4IXMA 4TSFD 1NNEA 1NIPA 3DMDA 3WRXC 2BCJQ 4ASUA 2BOVA 4GP7A 1YE8A 1Q0UA 2OFXA 4JLBA 3DVLA 3EX7C 2A78A 5JCPA 3B1WA 4DLRA 2QAGC 3HPQA 2FZ4A 5EP3A 1FX0A 3GJ3A 2QGNA 3H86A 1XCMA 5J5CA 3U3RA 1KJWA 2VSXA 2ZS8A 3UMRA 2QG6A 4BFYA 5UKDA 1ZD8A 1RE0A 1FAQA 2V1XA 1XXHE 2NPFA 4DLUA 1Q21A 1JXOA 2ZYWX 3C16C 4OQMA 2C9CA 3CNLA 4Q18A 1TAGA 1WXQA 2FOLA 1G6HA 1R5NA 1S9HA 2CNWD 2ZRGA 4KVGA 3VKGA 2OCYC 5KO2A 4KBFA 1N5KA 5DI3B 2ZRHA 4PX9A 2JLVA 1DTSA 2GDJA 2FJUA 4B32A 4CT4B 3SZRA 1KTVA 2VP0A 2DHRA 1E2HA 2CJWB 1B23P 3OEHA 5TDHA 3GLIE 5IT5A 4QG7A 3PUVA 2IW3A 4B75A 5CITA 2HLDA 4D4MA 4B6FA 1V43A 3KJIA 2B8WA 3EIEA 4TWZA 4XVUA 5GVRA 2ENNA 4LBYA 1ZYUA 3H1TA 2Z5FA 3B1YA 4IW3B 3R8CA 2FPKA 4JLKA 5EXSA 3KUCA 4Q47A 1KKMA 5JSZB 3RS7A 4WVFA 4FMDB 1DAIA 2VHCA 2Q3MA 2IL1A 1DAHA 4Q1FA 2AX4A 2JLYA 1YRBA 2P5SA 1XA6A 1SXJB 1YRAA 1XFAA 3V9PA 1D9XA 2VIIA 3OEED 2J0SA 3BXZA 2RHDA 2XNSA 3CRVA 3NKVA 3IIJA 4M1KA 2FPLA 3KL4A 4Q1AA 1ZMXA 4TL9A 5JMTA 2BMDA 4QJ3A 3F5FA 4EFLA 1CKEA 1U8ZA 3ZIAD 2C77A 2F3TA 3AP3A 2QQ0A 1FP6A 2WHXA 3T1QA 5JECA 3EA0A 5EE5B 1JEEA 4L15A 1QG2A 1W0JD 2C8VA 3LBNA 4Q5IA 1P61B 1UDWA 4J0QA 2VHUA 1UKVY 3PG5A 4PPGA 3R7WB 3REFA 2ZRBA 1WBDA 3SHFA 4KBGA 4EPYA 1XJ0A 1EWRA 3ZQ6A 1CR4A 3ZYCA 2ZJ8A 3SJBA 2NO6A 4E5UA 1MRSA 4KSBA 2HF8A 4PTLA 2WJYA 4HZUB 1ZCAA 1M8PA 4PO1A 4BLTA 2QA5A 2XOKA 3QNUA 4HAUA 2VSFA 4MGKR 1H65A 4KAXA 4MRRA 4P0TA 3TRFA 2XOKD 1II8B 2E9SA 8OHMA 4OQFA 1G64A 4ZV4A 1JAIA 1R0ZA 1S0UA 2GBLA 1SVKA 1QHHA 2AXNA 2C04A 4DLSA 1G21E 1EFRD 2WKQA 4BGDA 5FL7D 2W0SA 1SQ5A 4G01B 4D4KA 3U44B 4L8GA 4D0GA 2VEDA 4NCKA 4C0LA 2RGGA 2WM9B 3BGWA 2ZROA 4NCJA 4Q4JB 1Z0JA 1MO4A 1NLZA 5HTKA 2ODWA 4KLZA 2J45A 1QG4A 3RLFA 3S1AA 2UVQA 4EQ6B 4F4CA 2V1UA 2FFAA 1IN5A 2L0XA 2GXUA 3MWJA 3X1ZA 4AYXA 2WPDD 4PO8A 4TTRA 3PJRA 1D5CA 3JZMA 3K9LA 5CLQA 2ZI3A 1UKEA 1UM8A 3KKNA 2BBSA 2FWRA 4NHOA 721PA 3AVVA 2A7QA 1CTQA 2QRZA 4OK3A 3MMPA 2XTMA 4LJ9A 3SYNA 3SNHA 2QMOA 1OE0A 3RC8A 1WMSA 4M1TA 1JXMA 2FSGA 2GVDC 4H9GA 2IXGA 3P4XA 2DY1A 5EP4A 2GVIA 1G7TA 1EX7A 4A0HA 4B2PA 1N0UA 1QRAA 1AIPA 1FTNA 1UADA 1CULC 3I73A 1I2DA 2FMXA 1N6HA 4M9ZA 3AF2A 5EQTA 2ZXUA 2O8CA 1G3UA 4LWZA 5KNCA 3CX8A 4MKGA 2W6JA 4HDCA 4HDOB 4CRWB 2D2EA 2GNOA 3FVQA 1O3YA 2FH5B 2EVWX 2ZI4A 1IY1A 2O8FB 5CJPA 1HQYE 4WZAE 4NYIR 1CR0A 2KE5A 3H4MA 2QQEA 1G4AE 2NZ8A 5AJVB 1P6XA 1D8TA 2B92A 4QM7A 3CR8A 1E9EA 5DSZA 3SR0A 4PPNA 2XB4A 3AVUA 4OHXA 2FSHA 2WVJA 2QM8A 4PHHA 3KKOA 4QGHA 4A0RA 1EFUA 3THWB 2WWXA 4GBMA 1W0JA 2GESA 1G8YA 1GP2A 3A8TA 2H7VA 3GLIA 1NN3A 2DWOA 1T9HA 1GFIA 4B48A 5HPYB 3FPAA 1AS0A 1N5LA 2KB0A 4Q66C 1GNQA 4MDFA 1AQYA 3GJ5A 5BN3A 1FNMA 5KSPA 2WTUA 1LF5A 3C7KA 2AKAB 4BFUA 4RD1A 3KQNA 4DLVA 2G77B 3BFXA 3I62A 3EARA 3QSYA 4M1SA 1F60A 3BIFA 1BKDR 2QNRA 2GVZC 4PC7A 3LDAA 1Q3HA 2VP6A 1QF9A 4A82A 2ZI7A 4JVLA 2G6BA 4BUJA 3L0SA 3KQKA 4DEXA 4Q7MB 1RZ3A 2O8EA 3FKSD 4LJ8A 1LS6A 4PO9A 2GJAA 2XTNA 2ZJ2A 1LFDB 3T5DA 4P4SB 1XF9A 3PEWA 1A1VA 1EK0A 5FR2A 1NBME 2O8DB 5H1YA 3QJYA 1QVAA 5TARA 2GBLC 4O3MA 4IDPA 1KI8A 5KSYA 1XWIA 3LXXA 4E09A 3QG1A 2FN4A 4HAZA 2C9YA 2GXQA 4YDHB 1DELA 1NL3A 1XXHB 1ZC4A 4WZ6A 5DHAA 3U3JA 4A2WA 1AZTA 2XNDA 3MLEA 2XXAB 3K53A 2OE2A 2ZAOA 4TYWA 4LBZA 1KMHB 3VTKA 2PT5A 4DB4A 2GCOA 2GWHA 2ZUBA 4M21A 4HLDA 3TVDA 4BWYA 1ETUA 2FFHA 3IEVA 4FD2A 5HZHA 4U02A 2GJ8A 2J5XA 1WE2A 3NHBA 1ZUIA 2MMCA 1NKTA 1UEJA 3MWKA 4A8JA 3MJRA 1DADA 2IYVA 1W36D 2RHMA 221PA 4XSHA 1AM4D 1E9CA 1NY6A 2B8TA 1YZGA 2PLFA 1YR6A 2DFKB 4MGZR 2P3SA 2A5DA 4G5RA 5E7MA 3DKPA 3M6AA 3ASZA 1N5JA 4PHTA 4LJYA 5SZKB 3TSOA 2BKUA 4YC7A 3MWYW 1YR7A 2O8BA 1XNJA 5M04A 1XTIA 4A4DA 1P9NA 3BAFA 3THXB 5FL7A 1NF3A 2NOAA 4N3NA 3W3ZB 2ONKA 3CWQA 4C4PA 1GOTA 3C41J 5FOSA 3T34A 1UEIA 2FEOA 4Z8YA 4OHWA 2G1KA 4MYHA 2ZI9A 2O8FA 3GJXC 2ZJAA 2PMDA 5FI1B 3VR6A 5IRCD 1YR8A 2IYZA 3TKLA 3OIUA 4B6EA 1Q1EA 3SJAA 1EXMA 4Z51A 3RSLA 3BWDD 4RD2A 1COWA 2MSCB 2OXCA 3X1WA 1ZAKA 1LVGA 2OLJA 5FOTA 2FDCA 2GCPA 4R9UC 1LF0A 4M1WA 4NONA 5ELXA 4JT2A 3VNUA 1U9IA 4LPSA 1P62B 1XEWY 1ZC3A 2ODBA 3BB1A 3CW2A 1KI3A 4MQBA 2QI9C 1N25A 2OBMA 2R6CA 2XAUA 3OZXA 1CR2A 1SKYE 4Q1BA 4Q9HA 2WJIA 3KJHA 4MRPA 4B33A 2LKDA 1G6OA 1WBBA 2ZANA 4LHXA 4Q4JA 2GCNA 2AFHE 3NDPA 1R5BA 1OIVA 3T1VA 4V03A 1V5WA 4HB4A 3QKRB 1Q44A 2KJQA 1XD8A 1ZD1A 2ZSEA 3CRW1 4I1SA 4IDOA 3VMFA 3RRNA 4DB2A 2QMEA 2WIBA 1KDPA 5FPSA 3B82A 2DBYA 3SE0A 1NVUQ 2V8OA 4JKIA 2YC2C 4HZUA 4XWOA 4RKFA 4JL6A 4NL4H 1E94E 3HR7A 2DWQA 3FFAA 4RZ2A 2VP9A 3AKDA 3F0TA 3EASA 5DI3A 2HYIC 4MYCA 1Z28A 1SKQA 3WYFA 2LKCA 2HEIA 1ZM9A 1LNZA 1MO5A 2GXSA 4OL0A 4HAWA 5DE3A 4JL8A 1KOFA 3NBZC 2ZJYA 3OFNA 1Z2CA 2Z4RA 5KDLA 1W5SA 3A1WA 2FEMA 4FMDF 3HPRA 3B60A 1PLJA 1QHHB 2NO1A 3C5HA 1Z29A 1QHGA 2WAYA 5CK4A 1VCIA 4P4SA 5EP1A 2QPOA 2ZSDA 2QY9A 4XTCS 4GOJA 5A5GA 4IOLA 4NKRA 2ERYA 4ERNA 5FUYA 5B57C 1XX6A 2G9NA 3SYKA 4URUR 4DDWA 3UANA 1DE0A 5J4LA 4Z1MD 5L3SA 4EQ6A 4H1UA 2ATXA 4LSGA 3VKHA 2OM2A 2RMKA 1BO6A 3PEVA 1JR3E 2CNWA 4TLCA 3PITA 4OJQA 5JWOA 5FOWA 1ZVQA 2EYQA 5F9FA 1GNPA 1GSIA 1GUAA 4ABYA 4TSFA 4V0KA 3KZ1E 1UAAA 3AVQA 5J47A 4NYJR 2I3BA 1KI2A 3LAWA 4BLRA 1A7JA 3SJZA 2QMUA 1G41A 4F91B 3KTAA 2LCFA 1S3SA 2IHYA 1EFRA 1P3JA 3MCAA 3HP1A 5L3VA 3FB4A 4HI0E 3R7WA 1N5IA 4FI3C 2FG5A 4F4JA 4TYYA 4RVCA 1HE8B 2ZIAA 3LV8A 3CH4B 4Z54A 2QTHA 2FGKA 5TB5A 4KLNA 1ESNA 3ZZTA 1F6BA 1CBUA 1FUKA 3NH6A 1UDXA 4GNKA 4BASA 2H57A 4DKXA 3ZVNA 2C2HA 1QHXA 4R2IA 3PR1A 3UMFA 1CJMA 3FFBA 3K9GA 2WWYA 5E4FA 2F1RA 3WMFA 1RFHA 5CB8A 3G82C 5KU1A 5TY0A 5B64A 3HWSA 1KO1A 2C98A 2J0UB 4JBYA 3WBJA 5KTYA 4V0NA 3B2EA 5BXQC 4TZ6A 3A6PC 1HA3A 4W5WA 4XSGA 2JASA 3OHMA 4WIAA 1NJGA 4CVNA 4EDHA 2ZM5A 1J90A 2R6DA 4QGAA 2PX0A 4LHYA 1IXZA 1VECA 4TMVA 1NMXA 5DNYB 2R6AA 2VP4A 4ACAA 1W46A 2V4ZA 5SZIA 4GRAA 5LBIA 4N0DA 1P60A 4PXAA 1GDDA 4BLOA 2EFDB 4C0QC 3BD9A 1J8MF 1GITA 1TF2A 1XCGB 4TT3D 1WQ1R 4OI0A 1E69A 4M2LA 3D6TB 1OSNA 1EFHA 3AVOA 1XJQA 3HU1A 5JBQA 1G5PA 4US2R 3FHCB 1PUIA 2YV5A 3I3SR 1EGAA 4DT1B 1JQLB 5J4YA 1BH2A 1JAHA 4LHWA 4LYAA 2IS4A 2WWWA 3R9WA 4A2QA 2OESA 2ZREA 5TVKA 4IEEA 4QXAA 1VKJA 1E9DA 5FBVB 3DOEA 1KJYA 2F55A 3B9QA 3CX7A 5AUNB 1GM5A 3CONA 3TK1A 1KSGA 1DPFA 2GXAA 3CRQA 3ZD7A 3EZ9A 2D7CA 5FPTA 2EW1A 4UXHA 2QZ4A 2CMKA 3QEOA 3AKEA 4Q7JB 4ZI3A 1EWQA 5BN4A 3AVPA 2D2FA 1NG9A 3I8XA 3KQLA 2WOJA 3LO5A 1RYFA 2CVHA 1JALA 3QPWA 2O8CB 4AY2A 3W8RA 4AKEA 1IN8A 2LWIA 1PUJA 1VG0B 3NEJA 4DCTA 3G0HA 1DOAA 1G1MA 2OBNA 2WWGA 3BH0A 1E2JA 5FTJA 3WMGA 3FHTA 3A37A 5FI0B 2AK3A 3RS0A 1LS1A 3KFVA 1D9ZA 3LQRA 3T06B 2J41A 4B35A 2J9RA 1JPJA 1VMAA 2ANCA 4G3XA 2ATVA 4AKHA 1E4VA 2ZR9A 2ZS7A 1HYQA 1XPOA 2R44A 2VHQA 1RKBA 3FMFA 2OCAA 2BBTA 3FKQA 1KMHA 1KI6A 2WSSD 3BBPA 4YLGA 2JDID 2HXYA 1S1MA 4FKDA 2E73A 1Z6TA 2F7SA 2ZI5A 3B5JA 4Q9JA 4BQSA 4DJTA 1C4OA 1YHNA 3BK7A 3ZVRA 4PAQA 2ONJA 1E9SA 3AP1A 3CRMA 1E2GA 2VLIA 2ZVQX 5E7JA 1TTTA 1CS4C 3SC3A 4NPHA 4JL5A 2BHRA 2QRNA 4IVPA 4D81A 1AA9A 4EPRA 1FARA 4B6DA 3CB4A 1GILA 1GL9B 1UF9A 1P75A 3U7HB 4LI0A 4GPTA 1YJ5A 2HJGA 3LBHA 3SYLA 2EFEB 4EJSB 3L43A 3ZD6A 1T4GA 3K0AA 5F98A 2W2XA 3NVAA 1N0VC 2GEUA 5GJCA 1QZXA 1E99A 3ZVLA 1OXUA 5F3WB 3VQTA 3EZ2A 3CNNA 4I1OA 4V0ME 4DLXA 3OIVA 1JECA 4URYR 2OCPA 3QENA 2VP2A 4DCUA 2FSFA 2IUSA 3A4MA 4A0GA 2GF9A 1Z07A 2R8RA 2GILA 1DG3A 1SKYB 4KJZA 5C4MA 3AGQA 3PEYA 1R0YA 2H92A 2GAAA 1JNYA 4ZDWA 2XSZD 5HCIA 3QXCA 4BFXA 4CDGA 1CXZA 2QE7A 2AHOA 4GOXA 4Q4HA 4AI6A 3VNVA 1IJEA 1X1RA 1S3GA 2J46A 2OT3B 4GFDA 1M7BA 3ZVMA 3QBTA 5EZ6B 3GEIA 2JJ8A 2I1VB 4KVAA 5C1BA 2PCLA 3F8TA 4ILEA 3UGIA 1R0WA 4HDQB 1SVOA 3SJCA 2B21A 1E0AA 2IF0A 2OEPA 1LTQA 4Q48A 4NCHA 3I1FA 4NYMR 5HZKA 4FXPA 4ESVA 2JA1A 1Z0FA 1I4LD 5L3SB 2P5TB 4PQYA 3GPLA 1ZIPA 5LD2B 3NC1C 1CJTC 3EPLA 2FGJA 1TNDA 2DR3A 5AK0A 5GJWC 2ORWA 4C2TA 2WWHA 3WNBA 4JSYA 3RRZA 1HQCA 3C8UA 1Q22A 4K8OA 5EZ5A 1VCMA 1N0WA 4ESHA 1W48A 1N6KA 1Y8FA 1X3SA 3DPUA 4IDNA 2RCNA 4M8NE 3ETLA 1ONBA 2Q9CA 3GJ0A 2PZGA 4CW7A 4FCWA 1T5IA 1PV4A 4JLPA 2J59A 2GF0A 5D3MA 2YKGA 2Q21A 1JI0A 4A92A 2OG2A 1KI9A 2ZU6A 4HB2A 4JLMA 2XGJA 3GLHA 3P1JA 5CLLA 3IPXA 1ZIOA 4W5JA 5AJWA 4DIEA 3THXA 2DB3A 3QPVA 2IA5A 2BC9A 3ZJYA 4DRZA 1HTWA 1FNNA 1XTKA 1KGDA 3A1UA 4QHTA 4B3FX 3HDTA 3BB4A 1R2QA 2AN9A 3LH5A 3WNDA 1IAQA 2H18A 3MWLA 4OK5A 2QENA 3DMNA 4XVQA 2CLCX 1NIJA 2IEYA 4P4TA 3I5YA 3A36A 2JLWA 4OHYA 3AVWA 3QE0A 4B3DA 1RVDA 5FPYA 2XJ4A 4EJSC 5FUVA 3SBDA 1OYYA 3UWOA 1HT2E 3IGFA 4FMCB 1KSHA 1ZM3A 4TMKA 5G3ZA 5J4VA 4FIDA 1OF1A 4UQOA 2FNFX 2REXB 4D2IA 1U81A 2RKOA 1IY0A 1TBNA 3SDZA 3SU8A 4P3YA 1W2HA 1K8RA 4UXJA 2ZE5A 4D82A 3SQWA 3QVUA 1E0KA 3QF4A 5FTNA 2C78A 1RRGA 4ZPXA 3T35A 1D6JA 2ELIA 2J7KA 1L8QA 1H8EA 2ZR7A 3K0AB 1Q1ZA 2VHTA 3DM9B 3IIMA 4EKDA 2OV2A 1OFIA 1DG1G 1JR3A 5AJXA 3PIRA 2ODNA 1MKYA 1IN4A 3MUFA 4US1R 3Q7PA 4LOAA 2CL7X 3GLFE 2CHVA 1MABA 2FX3A 3U6KA 1T6NA 2TMKA 3FGNA 3E1SA 4AKGA 1T3HA 2O0KA 1AK2A 1W36B 1E6CA 2YHSA 3WBKA 1GTVA 5JJIA 5G3YA 2PLRA 4TL6A 3AGPA 4W7SA 1KBFA 3CLVA 4FCVA 4YMWA 1Z6AA 4RCYA 4YMTA 2J87A 3V4RA 3ZH9B 4ZI2A 4A6PA 2QBYA 2ZRFA 2IC5A 4QBGB 3T15A 2CK3A 1U0HC 3O8BA 4DZZA 2CK3D 1E2QA 2WV9A 4DLZA 1M7GA 5CK5A 3RS4A 1RW4A 1VYTA 2BBWA 1YZNA 3A1SA 4MRVA 1E2NA 1NVVR 1U9IC 1CIPA 4FW9A 4RFVA 2F9LA 3CUEF 4OBEA 5DYGA 5HCNA 4XIGS 2FSIA 2CHQA 3NEYA 3Q5DA 3RRMA 1IN7A 4LUCA 1HE1C 3CZQA 1OV4A 1CU1A 3L0PA 2IYWA 2W58A 3FMIA 3QF7A 3DOFA 4NH0A 1RIFA 3SQXA 1B0UA 4G1UC 1FMLA 3ZZUA 3L0OA 3TUZC 2ZUCA 4P4UA 4KCGA 4PANA 3Q8XB 4JBWA 2YWFA 4QJ4A 2FE4A 1YVDA 3MRSA 4DXAA 3EPHA 2NTYC 3IHWA 2QSYA 1E1RD 1JJ7A 2OBLA 5G53C 2XITA 1ZM4A 3IBGA 2EFHB 1JBKA 3O8DA 2DFLA 2C96A 4V0MA 4XTRA 1AS3A 1M34E 3BE4A 2Q9AA 5B58C 2CJWA 1ZU5A 1NRJB 4LHZA 5D3MB 3ICEA 1DAEA 1CP2A 5C4GB 3ZDQA 3ONWA 2ZETA 4QNMA 3PUZA 1HV8A 3FKSA 3K09A 2UZ3A 4DSUA 3QBVA 3B9PA 2AXPA 3QI2A 4UNRA 1U8AA 4PZZA 2WJGA 4DCSA 4JVNA 3KKPA 3GCGA 2IYTA 1IY2A 4X8LA 3K0CA 1HEIA 1XMVA 1KK1A 4TQ9A 1M74A 5HKKA 1AKYA 1II8A 1G5RA 3B8HA 4IVQA 4Q1DA 2ORVA 2A2ZA 3SFVA 1DARA 3NXSA 2XZOA 1G7CA 3LBIA 3WNCA 4D4LA 4QGFA 2KSQA 1P72A 2PT7A 1Y3AA 3KB1A 1VG1A 4S35A 2VRWB 1SGWA 5L3QB 2AL7A 2RGEA 3AUXA 1SVSA 1XPRA 2FU5C 4L5BA 4AIIA 1W4CA 2EYUA 4PHFA 2SHKA 1XD2A 2PX3A 4F4IA 1FTSA 1TQ4A 2ZYUX 4HLCA 1TBOA 5JWHA 3U7EB 4B71A 1FX0B 5H68A 4TMWA 1OXVA 3THOA 3TQFA 3B78A 3CM0A 4NTZA 1KNXA 2D06A 3A4NA 1G5TA 1VTKA 1XDBA 5B30A 1ELOA 2PZEA 2Z43A 1W2GA 1P2VA 2CVFA 3BH7A 1ZNZA 3TW8B 1F2TB 3GP8A 2XNDD 2VP5A 1DAGA 3BJIC 1OYWA 4KFRA 1Z83A 4I1UA 5GJBA 3G5UA 2JAQA 3GFTA 1M7HA 4LBVA 4XOIA 2NG1A 3SBEA 5TMPA 2MSDB 4TMTA 5K8IA 1XJCA 1LW7A 3WYAA 4LYHA 1OFHA 4NYJQ 1AKEA 1H8HA 4IOMA 2ERXA 3W9YA 4QJ5A 1A4RA 3UATA 4LJ4A 3L8YA 4I81A 3UIEA 2I1QA 2VYFA 2Q6TA 1XTQA 2ZSBA 2G3YA 3W3AA 4H1VA 2F1IA 5LB4A 2O8DA 2OAP1 3NWJA 1N6NA 3QKSA 5LDDC 2VH5R 3N70A 4UNSA 3Q72A 4EAQA 2RGNC 1NJFA 5G41A 2JLUA 1NVWQ 2X2FA 3Q7QA 4Q03A 4X8MA 1T8UA 1KDOA 4P33A 4E22A 3ZQJA 2BM0A 1IXSB 1KKLA 5FBWB 2HT6A 1P4SA 4QC2A 2P6UA 2CHGA 2HCBA 2DB6A 2ZEJA 4POAA 1Q57A 3R9IA 3W34A 4E03A 2P6NA 4E07A 1EFCA 2QP9X 3EW9A 3UPUA 5TXGA 4B73A 4M1OA 1C1YA 1NN1A 4GMDA 4PQRA 1GKUB 1US8A 3D31A 3LXRA 2A5GA 3K9NA 3RVBA 3IBYA 2CE7A 3QQ5A 1AN0A 4RJLA 1YZTA 3CF6R 1QHNA 3OEEA 1KI4A 4Q9KA 4EIWA 5G40A 4AWXA 4DDTA 2IYQA 2O52A 3BB3A 4JVSB 3TVTA 2B7BA 5BN5A 4B2IA 3K0SA 4Q00A 1CEEA 4ZDJA 1N6OA 1NI3A 5FTLA 1NBMD 4DBLC 2O8BB 3RNLA 2IF2A 4D26A 4Q9IA 2DWPA 1H8HD 2OZEA 2KI5A 4A2PA 3FDIA 3OESA 3AKYA 1E98A 5DHFA 3NIBA 3FOZA 2HLDD 1N6LA 4Q02A 3QG5A 2IS6A 5H70A 4W5HA 4RD4A 2JGNA 1K5DA 1XCPA 3CPEA 2F1JA 1L4UA 4TMZA 5CJ2A 2AWNA 2GJKA 4PQFA 4US0R 4N0EA 3B1VA 2H5EA 3ASYA 3R20A 5EE0A 1DO2A 1E79A 4KSCA 1OFUX 4UNPA 2QORA 3N2IA 3CX6A 4MKFA 1UBEA 1ESMA 3TE6A 1CRPA 1QDEA 2CBZA 4M22A 2BBOA 4CEHA 2GETA 3RS3A 3EA5A 4CGZA 4A36A 3B13B 1OFTA 2QL6A 5DN6D 2QAGA 1OB2A 2P6RA 4HAXA 4Q19A 4WZBE 1W4BA 5L3QA 4FMCF 1UJ2A 1T8TA 4C0BA 4EFNA 2AR7A 3UWKA 1A2BA 3K70D 1M2OB 4TZ0A 2GK7A 2H1LA 1WDTA 4M53A 2NMVA 3TR0A 3RDPA 1HT1E 3CH5A 1ZW6A 4JYBA 3I8SA 1UFQA 3NH9A 4A8JC 2XEXA 5FBLB 3PUWA 4A8JB 3B85A 1W4AA 5FUXA 4RD3A 5L8VA 1GVNB 5FOVA 4GDFA 4YDSA 5KHOC 2GZHA 1XTJA 1KMQA 1L2TA 5E95A 3T1TA 2C5LA 1W0KA 2QGZA 3CKLA 1KZ7B 4TYQA 5K8UA 4JLVA 4HYYA 3RRYA 4M0LA 3MSXA 4DUGD 2J3EA 2XSZA 2AWOA 1MH1A 2ZUDA 3TBKA 1G19A 4BE7B 3THYA 4W9MC 3GJ7A 2V9PA 3CO5A 2HUPA 1DO0A 1JQJC 1SULA 4PFSA 2OO7A 1XPUA 4WOPA 5CDFE 2NQ2C 4UNNA 3UMSA 4HUQA 4X8OA 1E2EA 3VU9A 3A1TA 3KXLA 5C2JB 5EE3A 3TSZA 4UJ3A 2HT1A 4L9WA 2RGAA 1VCOA 2ZVPX 1OW3B 2ZSAA 6Q21A 2WWIA 4HLUC 3UGDA 5JLJA 1R8QA 3K09C 4QNRA 4LY6A 3D3QA 1KK0A 4DCVA 5GJVC 2ZYVX 3I4LA 4HLUA 1G3QA 2RGXA 2FNAA 4GZLA 1VPLA 2GTPA 2AK2A 3RABA 2CCKA 3QF4B 4TLEA 3LRPA 4QKQA 2GHIA 4KITB 3BJIA 1Q3TA 1GKIA 1G16A 1G20E 1FZQA 4MGIR 1VHTA 3M4YA 1N2CE 1S8FA 3AF4A 3DEFA 4MYUA 5BYKA 2BIFA 1NVVQ 5LD2C 5JEEA 1US8B 1I2MA 1TEVA 3AF1A 4QOSA 3KJEA 4JJZA 4ZKDA 2O0JA 2WAXA 1E2LA 3CF0A 4URWR 5DYIA 2O8EB 1G8FA 4QFMA 3I72A 4C7OA 1OLOA 1VHLA 1Z08A 2BEJA 1E2DA 1GRNA 2AD5A 2ZJBA 1GRQA 4RY2A 4DSTA 5AUPB 2IYSA 3R8FA 4LK2A 1RJ9B 2ZI6A 1R10A 1NMYA 2RGCA 1II9A 2VSOA 3B1ZA 2Q3HA 3TUJC 2WIAA 2QAJA 5K8TA 3T12A 2JIZD 4MRNA 3ND8A 3ZGXA 2WJVA 1P73A 2JDIA 3BORA 1W7AA 3WY9A 1MR3F 2NO9A 5KNBA 3UK6A 1JR3D 1RFLA 4KODA 2BMJA 3JVUA 4KFUA 4NZYA 4XWAA 1E0SA 1JPNA 4PC1A 1XD2B 2YINC 3DO6A 2ZTSA 1HUQA 3DZDA 2I4IA 2ZAMA 3P32A 2HCJB 1ZNXA 3PV0A 3NG1A 4LRWA 3V4FA 4LX0A 1XB2A 4TN1A 3IILA 4KYIB 1NBMA 4O0MA 2BKEA 4YMUA 3RS5A 3K70B 1E2MA 1GL6A 4JBXA 2PEZA 3KTAB 5AJYA 5KYKA 4ZKEA 4BLQA 3EXAA 5L3RA 4JLAA 4B76A 3NBFA 4GOKA 4R98A 3UXMA 1MT0A 1G17A 2UZIR 5CM9C 4UKDA 2F1HA 2IWHA 2FZLA 2A5YB 1IN6A 4NP6A 2W2VA 4XJXA 4DC9A 2J0QA 1UBCA 3MFYA 3AF0A 2PEYA 4WXPA 1P2SA 3WRYC 5JJKA 2XJ9A 2QROA 1W44A 3P26A 1FFHA 4HLQB 3TR5A 2V7QD 3U6BA 3HU3A 1N6RA 1DEKA 1E2FA 2W2TA 2FF7A 2BCGY 2IX3A 2CL0X 1BYUA 1DAKA 1I4TD 4TTPA 3AM1A 1S96A 4ASUD 3DKVA 5CIQA 3AV0B 4C0KA 4EPWA 4EUNA 3M1IA 4R71A 1IBRA 1D2NA 4URZR 2ANBA 3RYTC 2G0NA 4NBSA 5C18A 4JMPA 1KSJA 5K8LA 3RAPR 4BLPA 1QVRA 1SXJE 1WB9A 3EWSA 1IJFA 4NCNA 3L2OB 3W8NA 4Q4LA 4IFBA 4AG6A 2BMEA 4QBFA 4YXWD 1XTSA 2C95A 2X77A 5JRJA 2H16A 2FV8A 4L9SA 4TT3A 621PA 3EC1A 3J81k 3EZFA 3PVSA 4HZIA 3ZZ0A 4LJ7A 4CYMA 2KBFA 3KXIA 1K6MA 2JLSA 3EWAA 4DLTA 2JIZA 5IDVA 2IUTA 5EXPA 2GZAA 3NDBB 2KWIA 5AJZA 1Q1QA 1AQUA 3IEUA 4R2HA 1RRFA 2WSSA 2F9MA 3RWOA 1Z6GA 1GL7A 1XEWX 2PCJA 1R8SA 4D25A 1VYVA 2GEDA 2IBMA 4RFSA 3GQBA 1G3MA 2DFNA 3W6PA 1P5ZB 2DFTA 2FFQA 4WW0A 4D0LB 4LYFA 1J7KA 3PUYA 2REOA 1L7VC 4D80A 4KYUA 5JS7A 1CJKC 1E0JA 2QUZA 3LA6A 3HU2A 2P67A 4HB0A 3QKSB 1SHZA 3BH6A 1E9BA 1R79A 1K5GA 3PXGA 5CDFA 3FYHA 4N1AA 1NLFA 2QT0A 4NCIA 1G8PA 121PA 1YZLA 4MA4A 1OPXA 3THYB 4XH9B 4CEIB 4PHGA 2QAGB 3ZS9A 3E5HA 4NDZA 1J99A 2A9KA
chains in the Genus database with same CATH superfamily
2VCYA 3QLUC 3SYTA 3GFRA 4NDNE 3SQNA 1E4EB 3VU9B 1FRVA 5F5NA 4BJ1A 4BO0A 4EY7A 5MFPA 4WA7A 1X6VA 1YD7A 1UUCA 1A9RA 1HYHA 3RJ9A 2P90A 2CXHA 4HL6A 2YOHA 4AD8A 2OB2A 4WY2A 1XFDA 1PT9A 3ET5A 2FPXA 1OA1A 2QX4A 4CF7A 4F92B 2F3UA 1HURA 3QKIA 1GAJA 3EZ7A 1ODKA 1WZUA 4EHFA 1YB6A 1RLTA 3KELA 2AN4A 4GX1A 3VX3A 2HY7A 5CFQA 3MCZA 3KB2A 4YWHA 4QOGA 2IXDA 3CU5A 3QJ5A 4WNCA 5EIWA 1M54A 4CFSA 4F6LA 4CIBA 3IKTA 2QP3A 3VHXB 4EZBA 1X7GA 1MCZA 2WTAA 2IUEA 4EPVA 4YQFA 2UUOA 2EDCA 1RACA 1H0ZA 4TZTA 1M6EX 1CHOI 1WV0A 3O7WA 4EKGA 3FNHA 1F8GA 2Y99A 3NHKA 3I9LA 3P2KA 2CLLB 3UAOA 1W9HA 3CPSA 4ZO8A 3A58B 1FLAA 4EG0A 4B8ZA 1UKZA 4BTEA 2GZ3A 1NHGA 3EIXA 4BKMA 1ST3A 2OFWA 4TSKA 5J23A 3NHAA 1HRKA 2EJVA 4IG4A 3CLKA 1SQGA 3RBAA 4Q01A 1RJGA 1FRFS 5CDGA 2QNIA 4OUKX 4YAKA 1U98A 4F8EA 2GFQA 1T8RA 2DJ5A 2K2WA 3KB6A 2B8NA 4PSAA 3G8BA 2OFPA 2AX3A 1D2CA 4OREX 4UVDA 3T3DA 3TPZA 4IDAA 3JRNA 1O87A 4HYTA 2B1GA 2OXRA 1JU3A 3A14A 4LISA 1XQ9A 4RHFA 1OH7A 4CEJA 5DU2A 1CUFA 3HV2A 4RACA 2WZQA 1Z2OX 5EHIA 1S4MA 4TWAA 3LPLA 2IRWA 4FE7A 3TDNA 3LC0A 5C46F 3CUSA 1R7RA 1GADO 1CLUA 1QP4A 3NRCA 3T3OA 1GPBA 2RGNA 4QXPA 4WECA 4YCNA 1CHNA 5T57A 4RU1A 4YJGA 5JU6A 5IYZB 4PC3A 5G02A 2HH9A 3T9EA 3O8NA 5EMNA 4DT1A 3MINA 5DDIP 4R2JA 3NX4A 1FDUA 1KJJA 3FCSB 1KAHA 4MRSA 1FFCA 4IZOA 4B3BA 5JS2A 4M9UA 4URVR 1QBKC 4FWTA 5GMOA 1W96A 1B8UA 4UASA 4CM7A 1RNLA 2FLVA 3D2LA 1U0SY 3OLQA 1UMDA 4M98A 2FTKE 5KOHB 1VHDA 4M1MA 4TQUS 1XD9A 2JFQA 1S01A 5BVGB 3M6VA 4YREA 2IYNA 2J7PA 3IAS6 3IKMB 1BHO1 4LYJA 4PAMA 2GMWA 5GV7A 5H83A 2ZE7A 4AICA 4FC6A 3DE7X 3WGUA 1XK7A 1M9NA 3N2YA 4FE4A 1XPJA 3QNWA 4UE3S 3HBNA 3IKJA 1RWMA 1UM9A 2AMJA 5BWMA 2ECPA 2AZXA 3MQ2A 2BGUA 5CP8A 4ZVVA 1UKYA 3M5PA 4EHBA 1DFIA 2ZE6A 4P4GA 1QTRA 5FTKA 1TQDA 3NBYC 5A4KA 4YV1A 4CCYA 1QFJA 3P5SA 5B3KA 2BEVA 2QLNA 1HE4A 3D8SA 1OA0A 4YMSA 2RK3A 4CJXA 3JARB 5CEFA 5JQGF 2FUNB 5F3RA 4GI7A 4RV9A 1CZUA 2OBXA 3Q12A 4JCOA 3TSCA 4NCBA 4DSOA 2EWVA 4IJKA 1G60A 4CMAA 4P31A 2C7RA 5HRCA 4EHLA 1DWUA 1L8AA 3OA0A 4G1VA 4TV9B 4DDMA 2RD2A 5JVDB 2FWJA 4Y2PA 4WXMA 1JH9A 2O4UX 1P0FA 2N47A 1FNBA 1X8KA 2KM1A 3HVIA 3KVRA 3EYWA 5GONF 5EUQB 3KPJA 4LXHA 3MZ0A 3ORHA 1RI3A 3PDIB 3S5UA 2JAOA 4O4IA 5IEJA 1KMIY 3B52X 4IDHA 1QX4A 3IPYA 3PKZA 1TEXA 3EVAA 3T7RA 4L5AA 4D45A 3BXOA 4ND2A 3E8XA 2O3RA 1MJGM 2C3UA 3A4LA 3DHWC 2FMTA 3O4RA 1TB4A 5EJ6A 1SQFA 4ONEA 3RS2A 2AKYA 4KQWA 1CE8A 521PA 1SU6A 3PPYA 4GL4A 4UCWA 2GO7A 2JJMA 4PX2A 3QVLA 5J1TB 5LZ8A 4HAIA 1J8YF 4DZRA 2VRNA 3O90A 4FC7A 4XIJA 2FE1A 2QMZA 2VPPA 3C4JA 3IQWA 2ENZA 3OIGA 3IBTA 1MC5A 5EFOA 1GG2A 4WBNA 2A3NA 5IKPA 3ZJ5A 1P45A 1X86B 3CR7A 3HUUA 4LSMA 4DWVA 3TM5A 3EDOA 1WHTA 3DDHA 3AFGA 1EUDA 2JXDA 2X5JO 3VR3A 5DNDA 3ICVA 4OHCA 3ZIDA 1YR9A 4E4TA 4IDEA 5I9BA 3KG2A 4RESA 1GT6A 3DEZA 3JQGA 3QV2A 5TR9A 2C99A 5TV2A 2FFBA 2R4QA 2PD6A 1SHJA 1L5FA 3ZXIA 4L4XA 3QH4A 4FD3A 2AG8A 4QXRA 1NW8A 4TV8B 2H2GA 2YC4C 3G5MA 5THXA 2ZUFA 3UTDA 1Z17A 2D1TA 1N34B 4BO6A 5DH9A 5KJFA 4ZQBA 3LUFA 1I2AA 2DPXA 5AK6A 4LFAB 3EPJA 1DCTA 2PUTA 2ST1A 3Q85A 2HMWA 4UBLA 4XE5A 3T5BA 5BSGA 4KPYA 2VRBA 4BQNA 3SEAA 2HSZA 3GDWA 3X1XA 4EO7A 4ZA2A 5JYBA 2LRHA 2CUTA 1LB1B 3RU2A 1J2JA 2DH5A 2ZXFA 3VDQA 1Y6QA 1G8HA 3DVAB 3RSQA 1E3QA 1H9CA 1KY4A 2FXVA 2I7CA 4E3ZA 3U40A 4WLVA 3UT6A 1PCEA 2BCEA 1I51A 3BS4A 3P2OA 1FDWA 2XZPA 3PD1A 1J9EA 3PUXA 4NDAA 5SYAA 4KQKA 3EPRA 1SIBE 4F04A 1K6JA 1Z5OA 1ZQ9A 1KYIA 1XP8A 1SVLA 1AGRA 3WMXA 4QDJA 3IUJA 3THRA 2D1FA 3KX2A 4BMSA 1G2QA 3CEHA 3SR3A 3EQ7A 4UXIA 5D7BA 1YS4A 1F8UA 4TKMA 2J5BA 1T0BA 1YSCA 2AFHA 3PHGA 4HH3C 4JNCA 1GZSA 4ENPA 1H3EA 4JJAA 4TL8A 3V6MA 4RELA 5BRJA 3TIFA 1UBSB 4ANFA 3I1JA 1L5YA 3G9UA 4YRLA 3PD7A 2YDXA 4QA9A 3RC3A 3E2PA 1SEPA 1VA4A 1X7XB 2GPNA 2W5UA 3AETA 3O0DA 3GP3A 1G7RA 3O84A 5EIBC 1U0FA 2H29A 2DG2A 1JQDA 1TX4B 2IKSA 4X7BA 1FRNA 6REQA 1K7TA 1CUVA 3KOMA 1H4VB 1T3GA 2JJ2A 2JJ1D 2ZM6B 3PTAA 1E1CA 4IM7A 4O63O 2ZTUA 5BSEA 3V2IA 2BMFA 2Q8QA 2NTEA 3LC7O 4F93B 1L5LA 1ZD9A 2OVOA 2SGDI 1T9KA 4IJ5A 4INPA 5JSKA 3CN9A 3P7MA 5SZHB 1Q0SA 3W3AD 2QM7A 2ZPTX 5AOBA 3IVXA 1JHVA 1ZVMA 3LDUA 3GWGA 1ONNA 1XMIA 1PPFI 4BZXA 4X54A 1FP4A 5CDHA 5AW1A 2CDNA 1C9KA 1DB3A 1JDUA 4C2AA 1TM7E 2E6KA 2O2JA 2VHEA 2QVZX 3OM9A 5BSRA 5JSUA 3EPKA 2C7BA 1WF3A 4WOBA 5EQDA 1KQPA 1TK2A 4RIEA 1EDZA 1AURA 3ITKA 1PT5A 1U0TA 3M9XA 3SLRA 3HR8A 2WT9A 5TJ9A 3BREA 1TRHA 4RDHA 2Y05A 3DC7A 1VLVA 1DJPA 4A1FA 1RQGA 1HDIA 1M8GA 4XD7D 4IFTA 2CXTA 3CV3A 3ROZA 3OAAD 2I4RA 4IDDA 3WZMA 2ZQ5A 5I9TA 2AG6A 4Q9JA 3PR3A 4JKYA 3M4XA 1GNRA 3F6SA 4K46A 5HKLA 1BEZA 4ZAGA 1BAPA 4F12A 3KTOA 1NRXA 4YMVA 2IY8A 5E7IA 2HIAA 2Z2ZA 3BMNA 4YR7A 1BHQ1 4TXMA 1VI5A 2P7IA 2BM1A 5LA6F 2JS7A 2OCIA 2J7PD 4EZIA 2AR9A 2R8BA 3IE2A 3AWIA 5B55A 1X0VA 4X6XA 2PXHA 2YOGA 3DTNA 3NCTA 5HFJA 4B3CA 2YBEA 4Y2XA 3F3MA 4H7JA 4YRRA 4FSDA 2P4EA 4BKPA 1YVPA 1V1RB 2ZRAA 3OLYA 4EJFA 3X1JA 2ETVA 1W75A 4XCXA 2BR5A 5A7GA 1N2BA 3STTA 3LWBA 1D8AA 3H8JA 2C92A 2Y2VA 3OICA 7GPBA 4X8HA 3WLJA 2A5JA 4WNAB 4EJMA 1KI1A 2ZULA 5D3ZA 2F17A 2I7VA 2YS6A 3IB3A 2ZYDA 2D8AA 3UG7A 4BFWA 3RGGA 1SUAA 3Q9LA 2RGDA 4UARA 4HPJB 1X1BA 2J32A 4LX8A 4P54A 2Z6QA 4C4SA 4U7DA 4GE0A 3JD1A 1UR5A 5FKJA 3STHA 4BV2A 5I8PA 2DXIA 5JS1A 2ZZMA 2BZGA 3DTTA 4Y0VA 3LVFO 1EI9A 4A6XA 1TA4A 5CA1A 5E9AA 2XF8A 2Y71A 2RC4A 1JTVA 1CJVC 4JENA 5F7JA 4ZIRB 3PX7A 4E12A 1X0XA 3Q6MA 4A6EA 2VPWA 2CN1A 3OTOB 3KJGA 5C53B 1OZ0A 4RC9A 4RYDA 2A88A 2RBGA 1TADA 3LX8A 4RVHA 4BN4A 1SMKA 4E6PA 2AEFA 4JJ8A 5H82A 4DPLA 4DV7B 4OI4A 4II2A 3ESXA 1JQKA 1TZBA 1V26A 4YONB 3TM4A 4CMIA 4Y0NA 3VAAA 1ICEA 2B5VA 3FH0A 3KYCB 4JB0A 5AI0A 3WGLA 4ZMRA 3HCBA 4BS9A 2VO1A 1THTA 1O54A 4DIDA 1PZMA 1NXVA 4BNJA 1EDBA 2IYLD 4QGSA 5KYYA 1JPUA 2G82A 2WJHA 4OA8A 5ETJA 5SYNA 1NW6A 1DBVO 1Z8FA 3I39X 1YJBA 4G0ZA 4R7ZA 3VR0A 2KS6A 1L9KA 1XZEA 4OQ4A 2N9UA 1T1RA 4WFQA 4ZDKA 3H2KA 1B8VA 4XZ3A 5A9SA 1F4LA 1QHIA 5JXHA 4DADA 1FQJA 4AJHA 1P0PA 4A9AA 1R88A 5F2KA 1P7YA 1UBJS 5J4HA 3PNOA 4TQAA 3TNDA 1TECE 1XUOA 2R8ZA 4HQNA 1R5JA 2Q0QA 2OOSA 4Y7DA 4AP5A 4D57A 5CCLA 1ZHHA 4EVQA 3BD8A 4DDVA 1YF3A 4ON9A 1COWD 4TKVA 1NVEA 4UNQA 3ZNNA 3QBDA 3OVOA 2OAQ1 4D97A 5BV1A 3IXQA 4GR9A 3E9RA 4TTVA 3LY5A 2A1TR 4HDSA 1PLKA 3GJQA 3I5MA 2C5HA 3GIWA 4K81B 1IQUA 1LLQA 2HDNB 2VYCA 3I9V6 4KIJA 3ACCA 3EHEA 2ZRKA 3SP1A 4DJ5X 5ALYA 4EB6B 5DYWA 4N7RA 2CFTA 4ZDIA 4ABTA 2A7XA 4OI1A 1J6UA 1QWOA 3HGMA 1QTIA 4O4LB 4MTLA 1W93A 2WA1A 4E21A 1N5RA 4KMOA 4BIIA 2WJZB 2GBCA 3QOYA 2IP1A 4K03A 3KEOA 4DHWA 2F43B 4LCBA 4NE9A 2JGDA 3K0EA 3PHLA 4MAMA 1N2CA 1ISRA 4R31A 4WNYA 3IHLA 1IVYA 5FBKA 4FNMA 1JXAA 3GYBA 4Y67A 5KOIA 3VR1A 4DV1B 1A98A 4I19A 3PNBA 5BYJA 1XBTA 3GMTA 1R6VA 3GLHE 3LFTA 2BFBA 3M70A 3LE8A 4C76A 4D8VA 3LRTA 1P3Y1 2Q4BA 3EDRA 4TLBA 4HH0A 1ZM2A 2CYCA 3TB6A 3WS7A 2E4UA 3T54A 1GCOA 1YHYA 5K0NA 5TGTA 2W8BA 3HACA 3PLNA 3FPSA 3E9ZA 1Y6JA 3BKWA 2VRWA 3D6FA 2OAEA 1KI6B 4H7IA 4V2IA 5A4JA 2ZPAA 2XVYA 5HQ3A 2NUPA 5J2TA 2VXYA 4DLWA 2BW0A 1JJFA 4OB7A 1FZTA 2GSWA 4P38A 2DETA 4IFEA 5KSZA 4HK4A 3RF6A 2WKRA 2WSLA 3RSFA 1VLZA 3IQXA 4XVRA 2PVCA 3V48A 1TGYA 1P5FA 4P93A 1OB5A 3R8XA 2WW8A 4RH3A 5LR6A 1BS1A 3IH5A 3QKRA 1Y4UA 2E85A 2CJYA 2OD7A 1QRTA 3LHKA 4M1ZA 4FFDA 1GXSA 2QDKA 3JQGB 1B42A 2I9PA 4XASA 4LQDA 3ZDCA 4M37A 1H5UA 2Q29A 1QONA 3WYCA 3JQ9C 3QPCA 4ZP1A 2SKDA 5E1BA 3HXLA 1ZESA 3A6HA 1IOVA 3U3MA 4IWYA 3RVSA 1DEOA 2C03A 2RHTA 2NM0A 1SVMA 1U2RA 3D6HA 3SXUA 4BCDA 1IHUA 2W2MA 1NUUA 3MT7A 4RUKA 1HR0B 2O5VA 1T6ZA 1JDBC 1ZRMA 4L2IB 2HSWA 4LKRA 4G0YA 3PNKA 4IAOA 2X1HA 4KXFB 5GP1A 3WGOA 5ED0A 3BCSA 5AVXA 2CB9A 1L7NA 1PNOA 2DTXA 2R6R1 1E6WA 4NYIQ 5EERA 3R7LA 1T9BA 3K4PA 3LFHA 4JLDA 4C7OB 1VMKA 1LFAA 1X7ZA 2GS9A 3KR2A 3FF1A 1CJUC 4FGZA 1XHLA 4MV7A 1GT91 4MQUA 2RG7A 2XE7A 5AWFC 3GEEA 1J2TA 2PWYA 4OJKA 3WAGA 2IH2A 2C9OA 3C5EA 4UOZA 4FHFA 1Z68A 4KPGA 3ZE0B 2QF7A 1Y34E 1ILWA 1Z0UA 4Q16A 3DE2X 2GEVA 1PCXA 3CCBA 1JIJA 3L05A 1P6QA 1W88A 2HCTA 4DBLE 3Q7SA 1TM5E 3ZDZB 4C5AA 3RC2A 3ZUPA 4DJAA 1YR2A 3QEBZ 4OHKA 2VOJA 2VCEA 3U1TA 1Y63A 2P9EA 3M3DA 2AUNA 1V39A 3H1AA 5C7IO 5J3JA 4FYHA 3T7EA 3AEKA 4DEYA 3WTBA 3JQAB 3H4TA 1H4QA 2NP7A 2XVAA 3QEJA 4MW4A 2YJ4A 3JVVA 4HNSA 4DYDA 2GEBA 3C7CB 3EGVA 4I4IA 1Z15A 1UBNA 1Q7TA 2WMOB 1QIGA 4MQFA 3VPGA 4DRXA 4ZHQF 1UWLA 2SCUA 5A5FA 5B7GA 5CNMA 1KH2A 1C9JA 1KRHA 3KXKA 4S2UA 4UTPA 3LKVA 2IYYA 1SXJA 2ZRIA 4WKOA 2A6PA 4EA7A 5MDHA 3V00A 4N03A 3CJRA 1LLUA 2P9TA 4U8HA 1TMGE 1EVEA 1G18A 5CYOA 4IH1A 1NG1A 3WKBA 4C0JA 5H9WA 1MOZA 1N77A 4ZQFA 1Q9BA 3N8KA 1XAGA 2YICA 3HG7A 4IMPA 2O8VA 3DCIA 3OEYA 3OQIA 3R7SA 4E5NA 2IY7A 3M5WA 4TX1A 3DM5A 4QDTA 3THSA 4RTSA 4WOCA 1UPTA 5A2QA 2ID4A 3IEKA 4XFJA 1P1RA 5HA5A 4BZPA 1JVSA 4E7OA 5L40A 3DL7A 1OIWA 5DTQA 3EH2A 3H6KA 1MJAA 1OVMA 3GHHA 1NLYA 2VJKA 4AG5A 4PIVA 4CGYA 1ADCA 1P7CA 1S4QA 1XL0A 3MJDA 4MOWA 2HN9A 1RQLA 1N7HA 1RWPA 2VSNA 3PFCA 4Q7QA 3NJ8A 1QE5A 2EJTA 4LJ5A 4CZ2A 1F2UA 3H2HA 1XZQA 1D04A 4F5ZA 1EXWA 2XZLA 3KSZO 2ZP1A 5EJAA 1IG3A 3B6EA 3BMNB 3HI4A 1MOSA 4AAYA 5IVHA 3AM5A 1E4YA 3K6SA 2GBIA 1NXSA 2Z2JA 5U1PA 4ZJZA 3DMTC 3ZQKA 1ND6A 1DC6A 4U0KA 3FPGA 3AY7A 2WJ3A 4X1KA 1XU4A 1U94A 4I50A 3ZN2A 3TXXA 4BLSA 5JSHA 1TUSA 5E9JA 1T4MA 3A9VA 4E2YA 3K16A 4RADA 2QP4A 2VUSA 1KNQA 5BWLA 2J1LA 4WT7A 1C0PA 3ROXA 3HZZA 4HAYA 1HDLA 3STWA 1YGPA 1MQAA 1PTRA 1S9DA 2ZITA 3VZQA 3EVGA 3EZLA 5JDCA 1R6BX 4BJHB 1JSCA 1RMQA 3PNSA 4XD7A 1JZTA 1Y5NA 3HEAA 1CF4A 3H2SA 3KVNA 4GD3Q 3VNQA 1OH8A 4LF6B 2BFFA 2XE6A 2ZUTA 3DXFA 1CCWA 4M8IA 2C0QA 3AEQB 4AMGA 2F1KA 2R2GA 4PZYA 4I1YA 5BUSA 5JYEA 4URXR 7YASA 2AOWA 2Y1KA 2OENG 4D3FA 1BJKA 2GJ9A 3CF4A 1QH0A 1TJ5A 4R4JA 1IXRC 2GRJA 2R5FA 4MEAA 4OFZA 4ZEMA 5DLYA 3C97A 4R0MA 1A72A 2RIJA 2F8TA 2PGNA 4A16A 1E2UA 1KSFX 2GN6A 1KO4A 2AYZA 1NFQA 3OIDA 1KK2A 4AYWA 1JLSA 3DDCA 4OYHA 5LC1A 3QXXA 4L8LA 1J8VA 3AIKA 1BMDA 8MHTA 4GU5A 3IVRA 4PYNA 3ZIAA 5ER6A 1RAAA 1H6DA 1WXDA 1QG0A 1SG6A 3C98A 4UAUA 1KJZA 3B7GA 2JJ2D 2JJ1A 3EOZA 4OCZA 2GJSA 3AVTA 2AYXA 2Q6VA 3ZWBA 1SBIA 3D2AA 1O95C 1U5AA 3QE3A 1E2IA 1JMYA 3B48A 3FPFA 3KLNA 1DJOA 3CXRA 4MUGA 4OHVA 5KCZA 4TMFA 3DZCA 4FFWA 3AJRA 3UUEA 1I33A 1KJNA 3CBQA 1J07A 5DIFA 2ZW9A 5FTMA 4OJNA 4M9QA 2PD3A 4QZVA 3QMVA 2GQ0A 3PENA 4I3HA 2HF9A 2ASEA 3E5RA 3UJ7A 1K3FA 1RMYA 3S6JA 1E59A 3I12A 2TSYB 1Z35A 3HGQA 3LKBA 4C4OA 1ABBA 2KCXA 2R3SA 4NMWA 1NW9B 2VQ6A 5EAIA 1K3UB 2Q99A 5AUQA 1SCUB 3GPCA 5A4DA 5BPHA 4R0VA 1OJ7A 1XTZA 3PTLA 5EXXA 3RUIA 3T3HA 5KREA 3OEHD 4YHBA 1ZUD1 1R6TA 4NXMB 2Z4SA 5JH7F 3OIWA 3U9TA 2DJIA 2VJLA 3CPHA 4B31A 4DWWA 2B9EA 4G4SP 4G89A 4JU8A 4ROSA 3UAXA 2FN8A 3OU6A 1Y0BA 1EAMA 3LPAA 3AUYA 2XZTA 2XUOA 3R0VA 1U0RA 1U99A 3FWYA 3ICQB 1GEGA 4ZOEA 2BFEB 4B74A 1NPYA 2WHRA 4QGBA 4DG9A 4K9QA 1XC7A 3RYHA 4KO3S 3N5CA 2YCLA 1GWNA 5IH7A 1ST2A 2YN0A 4QBIA 3RSGA 3DW3X 5JYCA 3FKJA 1BIFA 1T3SA 1Z0KA 1KC3A 1OLUB 3IQZA 4P53A 1SXJC 1SXGA 1KZ9A 2BR4A 2C9MA 5EVJA 3WKCA 4R3WA 1DUVG 1Z26A 1RJEA 3UK1A 1RM4A 2Q5HA 4L22A 3DD5A 2Z83A 3JSXA 2XVZA 2EW8A 2Q1XA 5IS2A 1H4SA 2VJBA 4U5XA 3GCZA 5HK8A 1DL5A 1H6AA 4DV2B 4CETA 2NACA 2WDPA 3QOWA 2CD7A 3K8YA 3EEQA 4L8YA 3F71A 1QOPB 3U3KA 3UA4A 3VR5A 3Q8KA 5FOXA 1WTCA 2O1WA 3DZFA 4RL6A 4WFJA 2BISA 4B43A 4CEJB 2XD9A 3O83A 4EFDA 1IHXA 4JZKA 4UJ5A 2CE2X 3M6XA 1TL7C 1E2PA 2XLBA 2LCIA 2W6CX 5CR9A 1XNGA 1ZBDA 1D4FA 5TMBA 3TZCA 4BUZA 3N1UA 1R0RI 2YUUA 1QGAA 3D1VA 5DN6A 1KMNA 3ILSA 4TSFD 2ZBFA 3AVXA 2V59A 1OLSA 3ILXA 2VDPB 4YP5A 5TQ2A 3DMDA 1NSYA 3TRKA 1YOVB 2C4UA 1JI3A 1AX9A 1DXYA 3PUKA 4Z9BA 3GDOA 3NW9A 4JLBA 3WAKA 3H65A 4FT2A 5JCPA 3B1WA 4OQPA 4TQGA 4EA8A 1KR5A 1LTKA 1ZWKA 2QGNA 2YRFA 4JP2A 2VSXA 4J4HA 2NU4I 3PI6A 2QG6A 3KWFA 3PRYA 3UMRA 2V1XA 1RE0A 3L9WA 1F17A 5JQWA 2IOHA 1Q1NA 1XXHE 2COKA 3C3KA 2B36A 3H9JA 4HYQA 2ZGVA 5DM2A 3RUCA 3FPJA 3ZDYB 1JXOA 3C16C 3MD9A 3V7WA 3FM9A 3CNLA 3T4PA 3UFXB 3WL5A 4F8JA 1G6HA 1R5NA 1E60A 1S9HA 5L9AA 4TXLA 3T3NA 1BSVA 4HNGA 1QP8A 1RHQA 5JNWA 4Z7NB 1Y8QB 2FVXA 5DI3B 3U3XA 4TTJA 3T7KA 1YS2X 1JMVA 2OQVA 2GDJA 2JLVA 4R1OA 3I2FA 2DHRA 2PMWB 2R1UA 2ZYIA 4UBJA 5TDHA 2RIPA 1QJCA 1RXVA 3T1NA 1XDUA 4WLNA 2PHZA 2IW3A 3H4VA 5CITA 5IT5A 5ALTA 5IN4A 3MERA 3O4FA 3Q3IA 5T8KA 4H7DA 4N5HX 1PNRA 4JV5B 1PZHA 3UA3A 2JJQA 4XVUA 4ZGWA 1KGSA 5GVRA 2ONCA 1V41E 1R0CA 2NXEA 3O8QA 4LBYA 4QYSA 2Z5FA 1ULHA 3AM4A 1E5DA 4EI8A 2FPKA 4TVSA 4JLKA 1C7EA 1KKMA 1JG2A 4K28A 2EAUA 4U1RA 4WVFA 3RS7A 1I5OA 4MQFB 3TLJA 4DRYA 2UVDA 4ZYVA 5IJ9A 2PTHA 5CX1B 1J1ZA 2AX4A 3QU5A 4BWGA 3N7AA 4YCJA 5D86A 2P5SA 2ZZKA 1GAEO 1D9XA 1Q19A 2VIIA 3GRUA 1PNQA 3DBIA 3IULA 3BXZA 3DT6A 3LSYA 3TB4A 4H1WA 2OAGA 4MIOA 4UD6A 3LQFA 1RXYA 1J5XA 2A9RA 1WUJS 2D1SA 2GPSA 3A1DA 3KL4A 3MT8A 2O07A 4Q1AA 4RXTA 2BMDA 5CVEA 3F5FA 4AJ4A 1U8ZA 2OGZA 4AF6A 1ADBA 2C77A 2C1EA 3OG9A 2WHXA 2IHKA 5ICMA 1SIWA 1C3OB 1TYCA 1K7CA 1YBVA 4GO1A 4LY3A 3V4SA 3FNEA 1X74A 2PZLA 1X1EA 1QG2A 4HJXA 4KIUA 1B6SA 4LQLA 3HZRA 3G2JA 3IT3A 4KXLA 2C4HA 3BXEA 4XJTA 5EWJA 2PL5A 4EB0A 1JLLB 2OTCA 3W6ZA 3SHFA 2OLEA 5JSQA 4EPYA 1WBDA 1H5QA 1V9SA 2HL6A 1NW4A 2P6OA 3Q15C 3ZQ6A 1XI2A 2D54A 4D6XA 3OXLA 1O95A 4FOTA 4E5UA 4ITVA 4CMBA 2OO5A 3AHCA 4J1TA 1JQAA 4PTLA 4HZUB 4B7ZA 1DJMA 5DM60 4D98A 5BR4A 1SEVA 1H2EA 3OD5A 3QNUA 2PRZA 3KETA 2VSFA 3ML1A 1WAMA 4MGKR 3A6DA 4XCQA 2HU5A 1II8B 1RKVA 4JBLA 5HEKA 7ADHA 4KDRA 4BVBA 1QC5A 2FPOA 5K3FA 3DE3X 4HRYA 1HSOA 1WV1A 3L49A 1SCQA 5IWAB 3DEIA 1WTAA 4C6RA 1ULSA 1PW5A 1QUFA 1S0UA 1LZKA 1QHHA 2MHCA 3DVAA 5GZ1A 5JH7B 3OWOA 1HOXA 1KZYC 1U04A 4R1QA 3L0CA 2W0SA 2W22A 2BKXA 1U3TA 3I01A 4D4KA 5CBKA 3WB0A 3SVLA 1QB7A 1SXHA 2WIJA 4XXHA 1QFSA 1VMEA 5AK5A 5TQJA 4EYOA 2VJOA 1B16A 5IAAA 3BGWA 4UVHA 3DC2A 4Q4JB 1WOMA 4PRYA 4N7MA 2VJMB 1NLZA 2LPMA 2VR1A 3S1AA 1JAZA 2UVQA 1UC4B 4NXNB 4H7HA 4F4CA 4FUQA 2B4RO 2V1UA 3ZWOA 1FTYA 2L0XA 4RNCA 3AY6A 4FPXA 3D6JA 3PQ5A 4B9EA 3X1ZA 2WK1A 3VA7A 1M33A 2E89A 4AUKA 3ZX4A 4NEHB 3NTVA 3K9LA 3KPVA 3KKNA 1UKEA 2XRMA 5TS3A 2OO5C 1CETA 4NHOA 4EVIA 1IAVA 4WACA 3C87A 4M7PA 3MMPA 2RGRA 3MIIA 1NP3A 4JA2A 4I55A 2R84A 2QMOA 4M86A 5AHOA 5NLLA 2OC9A 1WMSA 4KK3A 1JXMA 2GVDC 3LK6A 4GGMX 4AP6A 3H17A 3BE6A 1EX7A 1WZEA 2P11A 3K30A 4ZREA 3O9ZA 2B78A 4WD3A 5FX2A 2IU6A 1QRAA 1AIPA 4KE7A 1CUAA 4WBNF 3O21A 2E49A 3KS9A 1YJAA 2WF8A 4WA8A 4O59O 5EQTA 3WAJA 3A11A 3TZHA 3SGQI 4B4WA 1DV2A 3GRRA 4HQFA 2XW6A 3NTOA 1XCBA 3BA1A 1XKTA 3CX8A 3JAKB 3QAHA 2UAGA 2W6JA 3HHPA 2CZCA 3MAJA 2D2EA 2HSDA 4KOAA 4CRWB 5EJ5A 3TZQA 2O8FB 3S68A 3SYRA 1HQYE 2XRFA 1H0RA 3GROA 4H59A 5CLGA 4KPEC 3C4VA 1E0DA 3H4MA 3AILA 3V8RA 5BMVF 2QQEA 3E3OA 3P96A 3V55A 1FY7A 3GMDA 4LF4B 1G4AE 3HCCA 4H15A 4Q3CA 3U4GA 4ZMSA 2GBFA 3AEXA 4DQXA 5B5SA 1EWTA 3CR8A 4QM7A 2B20A 4WL0A 3SR0A 2ZAIA 4CKYA 4C1NA 3WFJA 1GU0A 2HPAA 3UEOA 4DMFA 4WMLA 1U3UA 3TCKA 2O0LA 3AVUA 2Z58A 3WL8A 3CXUA 4A0RA 2M6RA 4DE5A 2WWXA 1Z2PX 5C0OE 4F4HA 1AY0A 1W0JA 4E2FA 3O4VA 2GESA 1P4AA 1NN3A 3CUKA 3HN2A 4BCCA 1P44A 4DYHA 1GFIA 3W1EA 2IPLA 1PGOA 1O0SA 1QV9A 2KMRA 1AS0A 3JTMA 3VV2A 2CV0A 4Q93A 1WDKA 3KE9A 5TQVA 3TQQA 5BN3A 4OLAA 3GX1A 4DBZA 2L19A 1XCOA 2IEBA 1K7UA 1FNMA 1X3LA 1Y3DE 3BMQA 2AN1A 1QK3A 1WTJA 3BK2A 4R5HA 4RD1A 2O7RA 1I8TA 2G77B 3I8OA 3BFXA 2RCYA 4K2HA 4YEDA 1YMUA 3IDAA 4IWNA 4M1SA 3BIFA 4ZVKA 3QEMA 4YT4A 3QSYA 4JYAB 4G6ZA 4CCAA 4OUDB 5DHSA 4EELA 5F5XA 2VP6A 4MWSA 1QF9A 1SWVA 1NR5A 3OLWA 4JR0A 4D8WA 4E3WA 4QOIA 5JAZA 3RHSA 2YXEA 1Y6RA 4CCYB 1REQA 4J7AA 5HS6A 3BT7A 1FRQA 1JT9A 1SOAA 5JJBA 1CQIB 2I2FA 4GKAA 3FPLA 4Q7MB 2O8EA 1OX6A 3RROA 1U8TA 3TSAA 1WUKS 2GJAA 2XHZA 2CLEB 2WABA 3UHJA 1Q15A 1PS0A 2V7BA 4TV8F 3ZY2A 1A1VA 4YRJA 4NS1A 1KZHA 1SQ6A 3R9KA 1AF7A 3VZBA 1MGOA 2H1CA 3DEHA 4MV8A 3BRWA 1UDCA 1KI8A 1B3BA 3O03A 4A8HA 2XGMA 1KQ3A 4E33A 3U3JA 4XX0B 1XXHB 3N74A 5EIFA 1QIKA 3GC6A 1ORHA 1AZTA 2R4TA 3C6KA 4YIKA 3I45A 4EABA 4RHXA 4RMNA 4HS4A 3SLGA 4YCCA 1JHMA 1VL0A 2OE2A 3EF0A 1PZXA 2PT5A 3OOJA 1M10A 3SGBI 3IDFA 4M21A 4CV0A 2G72A 3LQ4A 3WL3A 2VZLA 2OORC 5BR1A 3L7LA 3C3EA 3H5TA 3ZE9A 4YJ2F 1KU0A 2PX6A 4GEKA 3KQOA 1VJCA 2J5XA 1Y42X 2CDAA 2VBIA 2ZBQA 2MMCA 3FSYA 1NKTA 1FNSA 1UDBA 1UEJA 3MXTA 4ZMBA 1MB2A 4GICA 3RUFA 4BQOA 2EP5A 5JROA 2OU2A 1DADA 1JW9B 2MR5A 4FYMA 1FTWA 2ZB4A 5INTA 3I0MA 2FPRA 4UVGA 3ENNA 1NY6A 4L75A 2B8TA 1Y3CE 5I7UA 3W5HA 1HNXB 4TV9F 3OU2A 2WAAA 3MC1A 4FNGA 4Y2QA 1BS9A 2CZGA 3PXDA 4G5RA 1TVEA 2ERCA 4JR1A 1IMOA 1ORWA 4LY0A 3IV9A 3LYHA 3M6AA 4PHTA 4LJYA 2IY9A 1CS0B 1ULAA 1X80A 1L1RA 1YR7A 2VZEA 1DO8A 3MWYW 4LN1A 4YC7A 5AHWA 3CVVA 2CGEA 2PJUA 1XMXA 3LZCA 5IJAA 1FVOA 3EY4A 3H83A 3ROGA 3OLXA 1NHWA 3CN7A 1V16A 2WB2A 3OOEA 3NJ4A 4FIZA 2HRCA 4DCPA 1Q6YA 3W3ZB 4C4PA 2OCKA 1P39A 1Z6QA 3CWQA 3CUWA 4KDFA 4NBTA 2PUHA 5EGNA 4A5SA 3W5DA 4CCSA 4EITA 4ZV9A 1AV7A 4OHWA 2C3OA 2G76A 2YWJA 2ZI9A 5KBYA 4D9MA 3CR3C 4CM9A 1YFZA 4Y3UA 3GJXC 2DKNA 2PMDA 4Y7CA 5DXJA 4OHUA 1E2BA 3OIUA 4B6EA 1Q1EA 4C21A 4ER5A 2CV2A 2YJ6A 1COWA 1WW2A 2GYUA 5LDGA 3R5SA 1W5EA 4PW0A 3X1WA 1ZAKA 1LVGA 2GCPA 2RHOA 1LF0A 1X9IA 3HCDA 4JT2A 4LPSA 3QM1A 1WR8A 4LF9B 1NOKA 4CNQA 2QI9C 1VSUA 4RHCA 1NW7A 1NTOA 2X6RA 3KEGA 3JVEA 3KJHA 4B33A 4JI1B 3WLNA 1GGFA 4BRSA 2PSSA 2GCNA 3PP8A 5IEBA 2AFHE 2CFSA 3NDPA 3W5VA 2P9GA 4FYWA 3RAGA 2UYOA 3OKAA 2J4FA 4CLOA 1D09A 1V1MB 1CF2O 1V5WA 2O50A 2OZPA 2WJAA 3RAFC 3QKRB 1NVMB 1AXGA 2M5XA 3RW9A 1ZUNA 2R87A 5AVQA 3BWBA 4YWJA 5D6OA 2DBYA 3SE0A 4BMDA 1GZHB 3WK8A 3GFVA 1HFEL 2G63A 2F55A 4JL6A 1P1KA 1RDFA 2JF0A 5TEWA 1X39A 1N3IA 2VP9A 3PC2A 3F0TA 5FNVA 4EHJA 1E1KA 3A4TA 1Z28A 2BKLA 2JBWA 1SKAA 4LMPA 3IPLA 2JVKA 4U4AA 4UU7A 4OL0A 1W581 2GXSA 1CQXA 5DE3A 3AI3A 4MJLA 4B17A 4JL8A 1KOFA 4INJA 4MUIA 1N36B 1AV6A 3LYLA 2QW1A 5JAIA 2E4WA 2Z4RA 4PS0A 4ZHQA 4XR4A 2IH4A 4BJ3A 3ERCA 3HPRA 1MVNA 2PS3A 4FFRA 2I2XB 1N9KA 2HI0A 4NBWA 1N75A 1QH8A 2W2KB 4KBYA 4P4SA 4TS1A 5G1OA 5IJXA 1N3YA 2PH7A 1GA4A 4BNYA 1L7PA 1A9SA 2RGUA 4GOJA 5DYNA 2CKDA