4UXHA

Leishmania major thymidine kinase in complex with ap5dt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
173
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVALMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
molecule keywords THYMIDINE KINASE
source organism Leishmania major
molecule tags Transferase
total genus 49
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxhA01
2ZSAA 3HYRA 3WHKA 1NN5A 1KBEA 1Z8FA 1KSGA 2IYZA 3P4XA 2GCOA 1QHGA 3IHWA 4Q19A 1C9KA 3T12A 4XTCS 2BOVA 2KSQA 2VRWB 3BIFA 3SYNA 1R0YA 4QKQA 4DUGD 1IOZA 1VCOA 1OIWA 4Q7JB 2EFHB 4DLWA 5EP3A 1Q1BA 2QZ4A 1OXXK 1OXTA 3UGIA 4IEEA 4P4UA 4CEJA 3U4QB 4PXAA 5F9HA 2OILA 4F4JA 4BZQA 1DAKA 1HEIA 3LH5A 1NSTA 3Q8XB 5H68A 1P62B 3Q3JB 4Q47A 1JR3D 1EXMA 3WNDA 1NN3A 2FSHA 2Z4SA 1WBDA 1M1YE 2VP5A 2HEIA 2HXSA 4MGKR 3WMEA 5EE3A 3ZH9B 4JLVA 3KFVA 4F4IA 621PA 3MFYA 2WWYA 2ZXUA 4DB4A 2X2FA 1T0JB 5JECA 4A82A 4PTLA 3ZZUA 2QROA 2BKEA 1X86B 1E2MA 3EA5A 5TY0A 4DC9A 4A0RA 4ZPXA 3ZVLA 2Q21A 1DAHA 5FBLB 4CYMA 3DZ8A 4JIMA 4KVAA 2CJWA 3H0KA 3QKUA 3EAQA 3ZGXA 1FTNA 5BQ5A 1QVAA 3WNBA 3RANA 4BEBA 1G20E 2AX4A 3TW4A 3K70C 3B6EA 5F98A 2CK3A 2RB4A 3SBEA 3PG5A 1CR0A 5H70A 1JB1A 4RKEA 2F1JA 3BK7A 4GI7A 1C1YA 5BN3A 4NE2A 4Q9KA 1X1SA 4YMWA 3J81k 3EIHA 4JLDA 2O8FA 3TH5A 3NIBA 2WZQA 3GJ0A 3CPJB 3QPWA 3HJNA 4B3GA 1F2TA 1P9RA 2Z5FA 2JLRA 4RY2A 1KI8A 2VIIA 4GFDA 2G3YA 2OFXA 2O0JA 1J90A 1QHSA 2YWEA 3I4LA 1OW3B 3KKPA 4Z8YA 1E96A 5TDHA 3WXMA 1Z47A 2CBZA 5FPTA 1IXRC 3O8BA 1MO5A 3QIAA 3IEUA 4PPGA 1E1RA 4MKGA 2QQEA 4LV8B 1IONA 2CL0X 1E32A 5IRCD 2IS2A 1HURA 2FPKA 1G64A 4RFSA 1CR2A 1HY3A 2YWFA 1KO1A 5FPYA 1G18A 5SZKB 4DKXA 1NL3A 1JPJA 2DR3A 2ANBA 4PX9A 2J87A 5KSPA 5CDFA 5DI9A 1XA6A 3RS7A 4IVPA 4A1FA 3GJ6A 4S2EA 3A8TA 2WKPA 3T1OA 1KKMA 3MGCA 4P4TA 4MUAA 1EFHA 3OE7A 3LBHA 3ND9A 1OFTA 3A1WA 1ZC3A 2J0QA 4M22A 5D3QA 3JZMA 3L0SA 1T3HA 3GLFB 4MDEA 1AKYA 4HUQA 4IXMA 1KDTA 1SVIA 4URYR 3T1VA 1R6BX 3BB3A 1MABB 2QSZA 2D7DA 3B13B 4ABYA 1S3GA 3NEJA 1S1CA 3JVVA 5CITA 5HZHA 3AKCA 2JJ1A 2Y8EA 3Q5DA 4OQXA 4QRHA 4BRWA 2IHYA 4NU0A 4RSGA 3T35A 2IWRA 2BKUA 4B2LA 2OFWA 3CRVA 1QHNA 2JIZA 2O52A 4DRZA 3DZDA 1ANKA 4TSFA 1UBFA 1XEFA 4HAVA 3X1WA 5DNYB 4D0GA 4HZUB 4C30A 4AC9A 4Q48A 3GLHA 2OXCA 4BFTA 3K9NA 4TMVA 4TYPA 3KKQA 3EPHA 2OLKA 1NNEA 1KY3A 1TF7A 1YQTA 1YZGA 1R10A 2WPDD 3SQXA 2FPMA 1KSJA 2HLDD 3CKLA 3ZZTA 4JMPA 4CIDA 1BYUA 4RZUA 1I2DA 5KSOA 2OESA 3GEHA 1OE0A 2E73A 3MSXA 4I1VA 1X6VA 1W36B 4QJ5A 2DY1A 2FX3A 1W5SA 3BERA 4LHWA 1FQKA 1T5LA 2GZHA 4Q1AA 1G21E 2A5GA 2WWWA 4EJSB 3S1AB 4NYJQ 5DYGA 4V0LA 1NG1A 1X8JA 3TSOA 2XNDA 3R9WA 4WXPA 4EFLA 2WJHA 2ZVQX 2OCYC 1HQCA 1BKDR 3RABA 2ZRNA 1Z63A 1YHNA 3FGNA 4MYUA 1GRNA 2ZR9A 2QI9C 4PC2A 4KBFA 3WYAA 5FTLA 2O8BB 2XJ9A 1NMZA 4PZYA 2BMFA 2IXEA 4A2WA 2NOAA 2W2XA 1E0JA 2JCSA 1CULC 4DHEA 5BN4A 1N0WA 1P72A 3GJXC 3P26A 5F3WB 1U99A 4QG7A 3VR1A 1OB2A 3TJZA 2Z43A 1EWQA 1G8FA 1F48A 1XTRA 4MGYR 3DVLA 1TF5A 1AQUA 1P3JA 3BS4A 2VHUA 3KXIA 3PUXA 5FOUA 4D0LB 5EQTA 4LY6A 2JLWA 1KMHB 2GJKA 1FL9A 4B71A 1CLUA 4B6EA 2D2FA 3QXSA 821PA 2NO7A 2CDNA 2AWNA 3OFND 3SNHA 3CF2A 4B35A 1Z0DA 3K9HA 2IYTA 3K53A 1SXJA 1YRBA 4CEJB 5L3VA 4URWR 4E22A 2F1HA 2V8OA 1E9DA 3W34A 3NH9A 4FMBB 5JEEA 2G77B 1MV5A 3AEZA 2G83A 2R65A 4Q1FA 4JZKA 5KDLA 4TT3D 1DEKA 1FFHA 3B85A 4OHWA 4HI0E 4D0NA 3PEYA 1JR3E 4QOSA 1FUKA 1Z0JA 3K09A 2QP4A 3VU9A 1NJGA 3PEUA 5EP2A 2BBOA 3U6KA 2RHMA 3U3KA 4D4MA 1DAFA 3TRFA 1QHHA 4B6FA 1AKEA 4DLYA 2VP0A 2F1RA 1B23P 2QQ0A 1U0HC 3UEJA 1XJQA 3FMIA 5C46F 2X1VA 2XZOA 5K8UA 2CJWB 1P2UA 2ORVA 2BEKA 4V0MA 3QPVA 3UMRA 2QY9A 1CBUA 2EYQA 2XXAA 1MR3F 2QGZA 2V6IA 3FDIA 4HDQB 3P1JA 2HJGA 3THWA 3TVTA 4HB2A 2QMOA 3LO5A 4NYJR 3WBJA 1BMFD 1G19A 5DYIA 3NVAA 2I1QA 3IHLA 2V3CC 4MH0R 2O8FB 2UKDA 1XJCA 2VPPA 3KKMA 4JLBA 2V7QA 1GFIA 1P6XA 5KUTA 1XU4A 1GILA 2PJRA 3PUWA 2A5YB 2HDNB 4QFMA 5DO9A 3T5DA 1M7GA 2FNFX 4FN5A 1ZW6A 5HKKD 3EX7C 3U44A 3NXSA 3LQRA 3HP1A 4C4PA 2R44A 2DWOA 3MCAA 4MKFA 1AA9A 2HCJB 3C41J 3N70A 4O2LA 1OFHA 2EWWA 3DMNA 2BWJA 3TE6A 4EUNA 1GP2A 2WSSA 5HZKA 3BFVA 3DOFA 4A15A 4EPTA 4GOXA 2J0UA 2QL6A 4BUJA 5IT5A 2CL7X 2LCFA 4LYHA 1CEEA 3EWSA 1W4AA 4WW0A 1O3YA 2W6JD 1TNDA 1G8HA 3IIMA 1KAGA 1NY5A 1D2MA 1Z0IA 2W0SA 4LJ8A 3E1SA 2NO1A 2R62A 2GEDA 2JLUA 2KB0A 5L3QA 2AKYA 4QM6A 1BOFA 3REFA 3I73A 3FPAA 1TADA 3FOZA 1P2SA 1G4UR 5KU1A 4GDFA 5AJWA 1D2EA 3VX3A 5GJBA 2GRJA 2PJZA 1FAQA 3CZQA 3AVPA 4GZMA 2ZE7A 3MWYW 3SYKA 5FOSA 3CB4A 4KU4A 5DI3B 4JSYA 3U2QA 4KAXA 1DTSA 1E79D 2DYKA 5EZ6B 4LHZA 4HLUA 1NVXQ 2F3TA 1M8PA 1XTSA 4PO8A 4DIEA 3K9LA 3KL4A 4MYTA 2AFIE 1OKKA 1CTQA 4II7A 1Q0UA 1LNZA 2ZI5A 2BDTA 2O8DA 3AQ4A 1WRBA 4D81A 4Q9IA 2ASEA 4NCNA 1NKSA 1KDOA 5FR1A 4F7WA 5J4HA 2ZJ5A 2EU8A 2H57A 2RMKA 5CK5A 3SE0A 3VHLB 4NP6A 4XTRA 1KI3A 1QBKC 3RHFA 1N0UA 4YMTA 4AIIA 4EPYA 3AKDA 2B6HA 4QXAA 3GLHB 3NBYC 1E4VA 4C2UA 4OHXA 1F60A 2PEYA 5C4GB 3JZAA 3VKWA 1A82A 1Q44A 1NVUQ 3LLMA 3BGWA 1IN4A 1G7RA 1IBRA 3QOFA 2WIAA 4Q1DA 2B7BA 2EFCB 2IUTA 2ZUBA 1OB5A 2P6RA 3I92A 1YZLA 2FFAA 1TBNA 4LJ5A 2AWOA 2EQBA 3ND8A 3X2SA 4M8NE 4DCVA 1EESA 5EXXA 1W2HA 2ZJ8A 4LCBA 4TQ9A 5GVRA 5FUWA 2O8CA 3L8YA 4B6DA 4TMZA 2E87A 3TLXA 1XMJA 4WVFA 2VSFA 4Q9LA 2VF8A 5KTYA 4Q03A 4IDQA 1T0HB 2AFHE 2G1JA 2RGGA 3U3JA 3GD7A 4AURA 2FF7A 4L9MA 2WJIA 3U6BA 1D2NA 2FNAA 3OAAA 1ZD8A 1Q21A 2KWIA 3QQ5A 2WKQA 4EPXA 4PPQA 2HUPA 1AM4D 3CXLA 2PBRA 5EUMA 4OYHA 3LFUA 2RGDA 4X8OA 1NF3A 4CZ2A 2WBLC 4NMMA 5ELXA 5H8WA 4PHFA 3VAAA 4ZDKA 2J41A 1D9XA 1G9XA 2GZDA 2WM9B 2GILA 3AVOA 4M1SA 4DLXA 3I61A 1UBCA 2ZAOA 5DGXA 4A9AA 4DT1A 5CM9C 1RRGA 2A5DA 3ZQJA 2BBSA 1E4YA 2QE7D 3PV0A 4FCTA 2DB6A 1GKUB 2ZIAA 4JKIA 5CYPA 3WYGA 3ZLJA 2Q0HA 3G82C 1ZM3A 1J8YF 4PZLA 1E9CA 3AF4A 2QAGB 3OEED 2BMDA 3BFKA 1JQJC 4W9MC 1S2MA 1T8UA 4EQ6A 5FPHA 2IYSA 1C4OA 2ORIA 4ERNA 3A37A 5AWFC 1GOTA 3IBGA 1OIVA 4IJMA 4EPVA 2H7VA 4B44A 4ASUA 3CWQA 4EPRA 4AI6A 2QBYA 3QPUA 2R6GA 3VR2A 3BJIA 1DG3A 1US8A 2MSCB 1UDXA 2XTZA 2J0SA 4Y0AA 1MT0A 1DAEA 1YR8A 4P3YA 3KQNA 5FFMA 1D5CA 1II0A 1CJUC 4IXNA 4PSAA 2FU5C 2QPOA 1IJFA 2ZSEA 4TL7A 4LZZA 5SZIA 4IOLA 4MGIR 1P61B 4D80A 5JCZA 1ZUHA 3W3ZB 1Z6XA 3R9IA 2AHOA 4E07A 2Z4RA 4F4CA 4FWTA 3QXJA 1TQ4A 2GF9A 2V4ZA 2BJWA 4E09A 2OO7A 2J46A 1U94A 4NCJA 3UANA 5JLJA 3GLGE 1OJLA 4XD7A 2D7CA 4NL4H 3MD0A 1GDDA 3QI2A 4LJ6A 4US1R 1AGPA 2D74A 1SKQA 2ANCA 3ZYCA 5JEDA 4IFEA 2VHQA 2OAP1 2ODWA 1XRJA 4TWZA 5B57C 3X1XA 1E2FA 1P9NA 1OHHD 3DOEA 5J4LA 1M7HA 3EIQA 3R8FA 1COWA 2WWFA 2XXAB 2QMUA 4IDHA 2BMJA 1W0KD 5K8LA 1RVDA 2QEQA 3THWB 4L16A 1SVOA 1MO3A 1Z6GA 1NVVR 4NCHA 1TQDA 1WCV1 5GADl 1H8ED 5FOTA 1GTVA 1XEWX 4JVLA 3FKSA 1A2BA 3P4YA 3WY9A 4XJXA 4EAQA 1G3MA 4E03A 3ZVMA 3PUZA 3KJHA 2VA8A 4KV9A 3Q85A 4AY2A 1XFAA 3SZRA 3BBPA 2EFGA 3BB4A 1NI3A 1WB9A 4B73A 4NCIA 3EZ2A 4HAWA 2ZRJA 1PUIA 4M9QA 3B7GA 4QHTA 1KI4A 3OEHD 1XTJA 3NC0C 3QKSA 2V1XA 4L5BA 4YDSA 2W0MA 5JBQA 2DBYA 3KTAA 4GL2A 1E0AA 2REOA 2TMKA 4A0FA 1I2MA 1Z6TA 4AYXA 4BPBA 4C0KA 1J70A 1OPXA 3BRWD 1T9HA 3HDTA 4JSTA 2R2AA 4R2IA 1Z22A 2AR7A 2YNMA 3HWSA 4HEJA 4BWYA 3CUEF 4HAUA 2PT7A 4Q7LA 2IS1A 4A8JB 3KJIA 2QP9X 4BE7B 5A0FA 2A5JA 1EFRD 2IT1A 3A1TA 1F3OA 2P3SA 3BB1A 3I8XA 4O25A 2FZLA 3QXXA 3W6OA 3P32A 3W9YA 2ZVPX 3RS0A 4EKDA 4QGHA 3FYHA 1A1VA 3LXRA 3W6PA 2C77A 2OT3B 3P20A 2ZANA 5KO2A 1X1RA 2FPLA 1Z3IX 1P2VA 5CJPA 2CLSA 4V0KA 4C2TA 3QKRA 1K5GA 2OAQ1 2QT0A 1E2JA 1QVRA 1LF5A 3W3AA 1W36D 2QA5A 5DHAA 3CNOA 1S9HA 2ZU6A 1XTKA 1N6NA 1P2TA 5JRJA 1E1QA 1WP9A 1VG8A 3BH6A 3MUFA 4LX0A 5HE9A 5BXQC 2QAGC 1DELA 2RAPA 1Y63A 3OESA 1ZUNB 4OBEA 5IHPA 3A58B 2WWXA 2JASA 3GPLA 2PMDA 2EFEB 4A6XA 2H16A 1DOAA 2WWHA 2A3RA 3B1WA 1RKBA 2ATVA 3U7GA 2QGNA 3V4RA 4LC1A 1HYQA 2FWRA 2IS6A 2JDID 2WSMA 1MKYA 1RJ9B 4BGDA 4KFUA 1YZUA 4KHZA 3ZIAD 1YZKA 1Z28A 2KBEA 4B33A 4DCUA 3L0IB 3ONWA 421PA 4OQMA 4X8LA 2CHGA 4JJZA 2ZRHA 2H18A 2R6AA 3X1ZA 4LJ9A 3KX2A 2Z6VA 3PCRB 2ENZA 2QTHA 4K8OA 1E9RA 5KDOA 3QVVA 1ZUIA 3W5JA 1ZNZA 3B5JA 1G3IA 1YKSA 3DMDA 4X8MA 4PC1A 4QC2A 721PA 2GBLA 2VHCA 5JFGA 1FZQA 2ZETA 1GNPA 4TQAA 5FI0B 3RSLA 2FGKA 3SFZA 1GIAA 1XEWY 2HF8A 4BFXA 4CEHB 4UJ5A 2IA5A 1R0ZA 4PC7A 2XTNA 3K0FA 1IQPA 2ZSDA 3KKNA 4C7OB 1KNXA 2PL3A 3R8CA 2VSXA 1IY1A 1VMAA 1II8A 2REBA 2ZRPA 4XOIA 3WYFA 2DHRA 4M1YA 5EXSA 3VHXA 1E98A 3NC1C 4OI0A 3QXCA 4LYAA 2GEVA 3H1TA 3TNFA 1KI6A 1XXHA 2ONKA 5AUNB 3DHWC 5LB2A 1YU9A 2IX3A 2G1KA 4JT4A 1LFDB 2JLSA 1E2LA 3RAPR 1IN5A 1W1WA 3MLEA 1SULA 2F9MA 2ZR7A 2FEMA 2PZEA 1FX0B 3SBDA 4N0DA 2X2EA 4HZIA 1QF9A 1NBMD 1T3SA 1SVKA 3NHBA 3C16C 4QHSA 1OH5A 2QBYB 3E5HA 2JEOA 3UKDA 2YINC 3RRMA 3BOSA 2ZRLA 2WOJA 4WBSA 5KYKA 1VCNA 4ZDWA 1XF9A 2IF2A 1CKEA 4KLZA 3SN6A 4QBFA 4B3FX 2RGNC 4RCYA 4A2PA 2CK3D 1UBGA 4WAUA 3PITA 2WAXA 2I4IA 4TN1A 5G41A 3AGQA 2CLDX 4A4DA 3K0SA 3NBZC 1G6OA 2P65A 1T5IA 4DDWA 3KFXA 1G291 5CLLA 2W58A 4JLAA 4DSUA 5JWOA 3PENA 4R7ZA 5L3SA 4OI2A 2UZIR 4PC3A 3THOA 5AJYA 1XPUA 4B34A 1E94E 2FFBA 121PA 4GP6A 4A8JC 5B58C 1XJ0A 2VP2A 1W0JA 4Y0VA 3PXGA 2CL6X 3EZ6A 1S9DA 4FMDB 3AKYA 3TUZC 1M34E 3LLUA 4LV6A 2IUUA 3KUDA 1G3QA 4K46A 4DCTA 1E1RD 4KJZA 4OI4A 3CH5A 4MUBA 4O2RA 1E2KA 1F5NA 3EC2A 4ZKEA 4JL8A 2ROWA 3A1SA 1QHXA 3R9XA 3Q7PA 2JJ2A 2B92A 2X19A 4ZI3A 3QG5A 4NDZA 1XD9A 4D82A 3EIEA 3T34A 3UWOA 3WHLA 2IW3A 1XPOA 5JS7A 1LB1B 1IXSB 2H5EA 4LYFA 3I62A 2R6FA 1QG4A 4Q9HA 4Z54A 1P7CA 5GJCA 2OHFA 3OE7D 1SVMA 2ODEA 3RC8A 4IW3B 3LRPA 4Q9JA 4NHOA 1TAGA 3AUXA 3T5GA 1YJ5A 1NSFA 2JLVA 2IYRA 3ZQ6A 5KSZA 6Q21A 3TUJC 3GLFE 3AVWA 2ZRBA 4O0MA 4CRWB 3K0AA 2ZJZA 5JCPA 2E1RA 2QMHA 4NPHA 2DPXA 3IKJA 3GEEA 5FUVA 2I3BA 3K9GA 2JJ1D 2WJVA 2ZEJA 4LYJA 3EPKA 4ILEA 3LW7A 1E9AA 1YR9A 1WMSA 2OCBA 5DN6A 2GAAA 2P5TB 2XZPA 3NDPA 4XVRA 2XB2A 2KE5A 2JIZD 4PO9A 5EE5B 2CCGA 1E0SA 4TSFD 3U7FB 3ZVNA 5E7MA 4V0OA 3W8RA 4B3BA 4DDVA 4GOKA 5AR1A 1L4YA 1Z06A 4DCSA 1FTSA 3X1DA 1G6HA 4MITA 3DM9B 4CVNA 3LX5A 5IK2A 1CXZA 4U7DA 3IPXA 4LC0A 4LOAA 4CT4B 4Q01A 1OFIA 5C1BA 2XGJA 1P73A 4GP7A 1EFUA 4B2PA 3DL0A 4K81B 4QGGA 3C4JA 1RFHA 4WZAE 2IBMA 5B2ZA 2ZITA 3E70C 4B76A 2ZRIA 2HXYA 5D3MA 2D2EA 4GNKA 1GM5A 4RKFA 4WOPA 2EW1A 3BE4A 3TQFA 3WBKA 5LBIA 4P4SB 5CM8B 2V6JA 2XNDD 4NONA 4L9SA 1KZ7B 4QBHA 4RJLA 1E2PA 3DKVA 4DZZA 1XCGB 1OT3A 5UKDA 4A2QA 4Q4JA 3ECCA 4MRVA 4TYWA 4G5OA 4HUTA 3BH0A 1TQ2A 4UNSA 5DIFA 4PHTA 3LBNA 5G3YA 1U8YA 3QE0A 1RYFA 2YZ2A 3IQWA 2NPFA 5AK0A 4LBVA 2FA9A 3K0CC 1F2UA 3CLVA 3SR0A 2QPTA 2O0HA 3OF5A 1S0UA 4Q4LA 2G88A 2WICA 2WMNB 4OI1A 3KQKA 2G0NA 4IOKA 4G5GA 4TMWA 1E2DA 5DHFA 2ZUDA 4IRUB 2NO0A 3Q9LA 4US0R 3TUIC 1UKYA 1KAOA 2GCOB 1YZNA 3AP1A 2ZS7A 2HJVA 1SHKA 4BQSA 1AIPA 4QNMA 5FBWB 5JHGB 1PJRA 1J2JA 1GL9B 3L0PA 2F9LA 3SQWA 1R2QA 2BHRA 4A92A 1IXZA 2XB4A 4H1UA 4XH9B 4Z8XA 4BFZA 4AKHA 1II8B 1Z29A 2JATA 4G5RA 4M21A 4DWJA 3KJEA 4EDHA 2RGBA 1F6BA 4FMCB 2QM8A 1TF2A 1KI6B 1XXHB 2CHQA 3CF0A 1N0VC 3C5HA 5BYKA 1D6JA 2ZRKA 1VYUA 4X8HA 1Q1QA 2W2VA 1U9IA 2ZRAA 1RRPA 4JJKA 4Q4HA 5J4VA 2AN9A 4KYIB 1NBME 2IYXA 1CS4C 4ARZA 2FG5A 2VSOA 1MO4A 2C03A 3PFIA 1AGRA 1E2EA 1MH1A 4DSNA 5L8VA 5BN5A 1AS0A 5FOVA 1T91A 3GLGA 3BH7A 4GT1A 4YLGA 5JWHA 2YOHA 1W44A 1YZTA 2XITA 1LF0A 1UBEA 4KSCA 2W2TA 1KBFA 3MJHA 3N5CA 3GFPA 5J40A 3ADKA 1CJKC 2QPAA 1Z07A 1XMSA 1XEXA 4URVR 3QSYA 3SOPA 1KO7A 2RGCA 5K8TA 3HYTA 4AKGA 2GESA 1ZCBA 4DLRA 3QF4A 3ETLA 1LW7A 4PQRA 3AF0A 1ZYUA 2QORA 1F2TB 1N6IA 1UM8A 2J7PA 4BZXA 2V7QD 1ODFA 3RYTC 3NDBB 1CRPA 2F7SA 4KCGA 3GJ4A 3HR8A 4KITB 4B3XA 4PR0A 4US2R 2VQSA 2ZQ5A 1NLYA 1TUEA 2LKDA 3GQBA 3IDQA 1TEVA 5CB8A 4TLDA 1IY0A 1XB2A 2GETA 2PEZA 3D6TB 3UFFA 4Q7KA 1TPZA 5KDDA 2PCJA 4HYYA 4LSGA 1FPMA 1G7TA 2FOLA 3UEYA 1NVWQ 4RD2A 4TTPA 1NKTA 4RFSB 3FKQA 1CJVC 2ODBA 4M2LA 2QM7A 2WHXA 2WSSD 1PLKA 2XTMA 5EXTA 2XZLA 2GJ8A 3T15A 3UG7A 4Q66C 2BCJQ 2Q3HA 1U8AA 4M9XA 5E3HA 3GEIA 1W36C 1CRQA 1HA3A 2FMXA 1UAAA 3LNCA 5AJVB 5C18A 1N3BA 4EJSC 2Z0MA 1I4DD 1L4UA 3RNLA 3I32A 2XSZA 1UF9A 2RHDA 1E99A 4BRUA 1T6NA 4L9WA 4OHYA 3R7WA 1G41A 1HE1C 2REXB 2QRZA 4TQUS 1GNRA 1VYTA 2BC9A 4HUQB 1I4LD 3WMFA 1OSNA 1H8HA 3F3YA 1J7KA 4KBGA 5JS8A 1B0UA 1AZSC 2RGEA 3A1UA 5FR2A 4B74A 4P31A 1OLOA 5P21A 1R5NA 5JJKA 5FI1B 2NTYC 2GNOA 2VH5R 3EZFA 1WXQA 1XZPA 3OHMA 1OKKD 2ZE6A 3IO3A 4LI0A 4PQYA 1HUQA 1CU1A 2QTVB 1L2TA 1KK3A 3ASYA 2OCPA 4URUR 2DB3A 4LBZA 5GVSA 1IJEA 2ZROA 1ZAKA 3OIUA 3VKHA 2HV8A 1YZQA 4HAYA 1VPLA 5CB6A 2IHBA 2YC2C 1UEJA 1G3UA 1GL7A 1PZNA 2J0VA 3AVUA 1TBOA 2ZI6A 1SGWA 4EFNA 4H1VA 4Q4AA 5GJWC 4DLVA 1W4RA 2C04A 5JJLA 3KB2A 3T1QA 3LQQA 2FFQA 4KODA 1E6CA 3SDZA 1XPRA 3EARA 3PVSA 4AYTA 1IN8A 4J0QA 3PR1A 4F38A 3ZD7A 1M74A 4KO8A 4U5XA 5LPNA 4FW9A 4AG5A 1NIPA 4PSKA 1KK2A 4UXJA 2GF0A 1RRFA 4F92B 4L4UA 2PZFA 1SVSA 2C95A 4PSVA 4QJ4A 2CLCX 2F43A 1OYYA 2GVZC 1PTQA 2DFLA 1NVVQ 2NGRA 3K0EA 3VX4A 1A2KC 2A2ZA 5E7IA 3IEVA 3MWLA 4M1TA 3TKLA 3U61B 3AVYA 2XX3A 4IKEA 5GJVC 3GLIA 3NBFA 5E7JA 3KQUA 3UIEA 3GJ7A 2IL1A 3LXXA 5JI3E 3OAAD 2F55A 3LVQE 1R5OA 3BD9A 4RD4A 2GXAA 4ZDJA 3LA6A 1G3RA 2W6IA 1U2RA 4IVRA 2F3RA 2AL7A 4Z1MA 1SZPA 2OV2A 5KNCA 1OH8A 3WRYC 1Z2CA 2J45A 1KMQA 3ADCA 2GCNA 2BM0A 4RVCA 4ZCMA 2IUSA 1E9EA 3CIOA 4JLOA 3SC3A 4OJKA 4BLOA 2ZRFA 1NRJB 4MKIA 2L0XA 3LBIA 1ZM9A 1AZTA 5DSZA 1XD8A 1VG1A 2VLIA 2ZSFA 4POAA 3D7MA 4JVNA 4XVQA 2IYWA 2KJQA 3CPHA 1R8SA 4R2HA 5JI2E 5EZ5A 4TLCA 3E2IA 1KK1A 1KSHA 2R6DA 2NZJA 2VBCA 3AM1A 2GAOA 1MOZA 1SKYB 2A5FA 1Q1EA 3AV0B 3Q5EA 2ZYVX 4BLTA 1SXJB 3PEWA 3A1VA 3QF7A 2AK2A 4NH0A 4U00A 4W5HA 2IYUA 3A6PC 1OF1A 4MA4A 2GA8A 3TIFA 4M4SA 1QRAA 1KI2A 2QU8A 3GFOA 1JALA 2YJTD 2XAUA 3AVVA 8OHMA 1FMLA 1ZJ6A 3EW9A 3QENA 2KI5A 3FWYA 2C9CA 3VU9B 1E9FA 1KZGB 1N6LA 1MO6A 3CNNA 4ZCLA 1ELOA 2VF7A 4AWXA 4PPFA 1E3MA 2WJYA 1QHHB 3KUCA 4AYWA 4XD7D 3FVQA 3RS4A 4I81A 5F9FA 4A36A 2WAYA 2GXUA 1RRCA 1N6RA 2WIBA 3KKOA 5DLQC 1M6NA 5EE9A 4YDHB 2HT6A 3LVRE 4OHVA 3U5ZB 2DWQA 3MRSA 2DFTA 4LBYA 1S96A 3CO5A 4TLAA 4JL5A 4DLZA 1COWD 1KYIA 1BS1A 3SJBA 1XEXB 4IVQA 1LS1A 4KYUA 1A4RA 1UJ2A 4MYHA 5JWRA 1HQYE 3KDSE 5TARA 4EFMA 2J3EA 2OM2A 1G7SA 2ZU0C 3D31A 4QJ3A 1T8TA 3AGPA 3O8CA 2H92A 3FKSD 2MSDB 2QENA 4LJYA 1CF4A 2IYQA 1OHHA 3UWKA 4FKDA 5FL3A 5IDVA 1W7AA 1W4CA 1HTWA 5FBVB 3U44B 2OG2A 4FMDF 2J59A 4BFSA 4RD1A 3R20A 2VHTA 2XOKA 1JPNA 1W48A 1J8MF 2NPIA 2C99A 5KPDA 1RE0A 3A4MA 1JAIA 2VYFA 5J4KA 2YC4C 4CDGA 3QBVA 3ZJYA 1JEDA 2AD1A 2GEUA 2ZYTX 4Q21A 4TZ0A 1JXMA 1P9WA 2CCKA 4RZ3A 2J0UB 4TLEA 4BFVA 4CT5A 5HE8A 3RDPA 4UJ3A 3FFAA 1KIMA 4W5JA 4FWIB 3L82B 2ORWA 3U60B 1X3SA 3UMSA 3KQLA 2JLYA 4MRSA 5L3QB 1GG2A 4HSEA 2WWIA 2N42A 4M9SA 3K70B 1UPTA 5H1YA 1XZQA 4DDUA 3RRYA 3BAFA 1RW4A 2CEAA 2NIPA 1MRNA 3R7WB 4CEIA 1EGAA 2A30A 1UFQA 3UPUA 1G5RA 1ETUA 1RZ3A 4JLMA 3P27A 4OQLA 1XX6A 1T4GA 1W5TA 4OQNA 2JJ8A 4JL6A 4XWKA 5JMTA 1N6PA 5DISB 4DCNA 2ELIA 4GZLA 2HT1A 4BASA 4YXWA 2X77A 5FL7A 4V02A 1KO4A 1UKZA 3LW8A 3TSZA 3UG6A 2YWGA 3KZ1E 3HU1A 2G9NA 2Q9CA 4YQFA 4PZZA 4DXAA 3FHCB 2N1BA 2O8DB 2VP9A 1OFUX 1N6OA 4OK6A 4AG6A 1KTVA 1SVLA 2ERYA 1CJTC 1E1QD 1E9SA 2ZRDA 4OL0A 5AJZA 1QHYA 3SHWA 1ZC4A 3TBKA 3BXZA 3VFDA 3IPYA 1IN6A 4PC6A 2CNWA 1GRQA 2OBMA 1DVRA 3QEOA 3EZ7A 3ZDQA 2EFDB 5FUYA 4MYCA 3RS2A 1DAGA 4NCKA 4EIWA 5HR5A 4AK9A 1FNNA 2PH1A 3S1AA 2QG6A 4ZIRA 5JJIA 2WWGA 4F93B 2XEXA 4NZYA 3SEAA 4PFSA 4P0TA 4XWOA 4C3ZA 3KB1A 1SQ5A 2H8KA 2GVIA 1IHUA 1Z6AA 2F43B 2P6UA 2A7QA 2QRNA 3KXKA 4PAMA 4WIAA 2O8CB 1T3LA 4LJ4A 3TVDA 3DKPA 4W5WA 1K8RA 1W47A 3ICQB 4JT2A 1NY6A 3HU3A 2BCGY 1TL7C 3K09C 1DS6A 4JLJA 2AKAB 3GLIB 2C5LA 2MSEB 3KXLA 2VO1A 4BFWA 1WF3A 3NKVA 2ZE5A 3RVBA 2CMKA 1ZMXA 4IEIA 4I4LA 4MDFA 4PPNA 2GZAA 4FIDA 4AKEA 3C15C 3CRQA 1GKYA 1XTIA 2MMCA 4IDPA 3WRXC 4DT1B 4KVGA 1WA5A 2B21A 4LUCA 1ZRHA 2CVFA 2J9RA 3GP8A 1KMHA 1EG7A 5E4FA 2GXSA 2WKRA 3MWKA 2RCNA 3GJ8A 4DUGA 1GZSA 4LV5B 3M4YA 4EQ6B 3V9PA 4V03A 4BFUA 1GL6A 2FH5B 1NG9A 5HCIA 3H86A 4TYQA 1AQYA 2BJVA 2GHIA 4URZR 4DVGA 4TMTA 1NLZA 3VR5A 4DDTA 1TU3A 1D8TA 1US8B 1JR3A 4NTZA 1SHZA 1ZU4A 1Z0KA 3A4NA 3ADBA 1ZIOA 521PA 4DIDA 3JVUA 4JYBA 5LD2B 2IF0A 3UXMA 4B75A 1TQ6A 1GKIA 3B82A 2ZREA 3DDCA 3RS5A 4A0GA 4FMCF 4PAQA 4B2IA 4RD0A 1N5IA 1NBMA 1P75A 1P60A 2ZRCA 4DLUA 4FD2A 2V1UA 1KO5A 4B43A 4GSYA 5ANRB 5LDDC 4NYMQ 4V0NA 3CWZA 3QBTA 2IEYA 4IFBA 3KQHA 3THXA 4FI3C 1GAJA 1V5WA 2FSIA 1Y3AA 2DFKB 4PO1A 3C8UA 3VR6A 3CX6A 2P6NA 4KLNA 1IM2A 5CK4A 4A6PA 4I1SA 2IYVA 4FXPA 2I1VB 5AUQA 5SZJA 2YKGA 4DB2A 1FUUA 3AUYA 2UVQA 4MGZR 2SHKA 2VL7A 3HPRA 3RSOA 3LD9A 3LX8A 2W83A 1TMKA 4MRNA 1DAIA 2XNSA 3PQCA 4BLRA 1ZVQA 2ECKA 1W0JD 2BMEA 4TL8A 2V55B 2N46A 2IS4A 3M6AA 3WP1B 4O3MA 2H1LA 4MKHA 3N2IA 4HLUC 1XMIA 1QHIA 4GMDA 2D06A 3MAAC 2PX3A 4R71A 4N3NA 3H4MA 1LTQA 2GTPA 1PLLA 4CF7A 1KY2A 2Q3FA 4LHXA 2JJ2D 2GJ9A 3CONA 2ZE8A 3MJRA 3AP3A 3Q7QA 3SHFA 4QNRA 1NMXA 1FP6A 4UXHA 1KK0A 1Z5ZA 4L8GA 1XWIA 2AXPA 3EWAA 4U02A 3TR5A 1Z0FA 4FCVA 3QJYA 1A7JA 3IQXA 1W46A 2D3WA 4DEXA 1E2GA 2GK7A 1XMVA 3FE2A 1IY2A 1X8LA 1GVNB 3UGDA 1ZNXA 2O8EA 3QKSB 4FINA 3C14C 1R5BA 1XTQA 3KTAB 1JXOA 1EFTA 1S3SA 4OK3A 5A4JA 3PJRA 4I1OA 2YOFA 1KI7A 1ZCAA 4JVMA 3AVXA 3UGLA 2IWHA 3SJZA 1VHTA 2H17A 1WDTA 2O5VA 4JLNA 3TAUA 4N1AA 2ZM5A 3VNUA 1LS6A 1DARA 5CIQA 1JECA 5DI3A 1AJEA 4IDNA 5M04A 4DSOA 4OHZA 1E2QA 1IAQA 2IC5A 5DN6D 1FQJA 1ZBDA 2XJ4A 4RFVA 4BLPA 1DAMA 2C9YA 4LGMA 4C0LA 4B48A 5EP4A 3L2OB 3WNCA 4TYYA 3QXHA 4CEIB 1AS3A 4JLPA 1KJYA 4OQFA 3SJCA 1VKJA 4DLTA 1N5LA 1AN0A 2VP4A 3IGFA 1RFLA 4FCWA 2G0TA 1VECA 2Q9AA 5IK2D 4BEJA 4Q1BA 1WE2A 4IHQA 3D8BA 4JBXA 2BV3A 3I3SR 1ZM2A 2YWHA 221PA 4JKYA 3T61A 3QKRB 4BLQA 4M1OA 4NYMR 4GMXA 5BW8A 1JEEA 1NP6A 5EP1A 3ZS9A 2ZRGA 2WPDA 1TX4B 2OUKA 3LDAA 3I8SA 3WP0A 1R0XA 4MRPA 3THYA 2HLDA 1U0LA 5FUXA 1KHTA 3AKEA 3B1YA 2GXQA 4JVSB 3B1ZA 1VDZA 3QKTA 1W4BA 1DE0A 4C9BA 1DO0A 3B9PA 3UMFA 1OH7A 3CH4B 4PHHA 2BBTA 4ACBA 1HT1E 4DBLC 1NN0A 1JNYA 2ZI4A 3TGPA 2FE4A 4NBSA 2ZAMA 2WV9A 3BJIC 3WMGA 4ZIRB 3NEYA 4UNRA 2ZYUX 2NG1A 2YOGA 4UXIA 3KY9A 2PT5A 1PUJA 2FFHA 2OBLA 3OIWA 1NN1A 5EE1A 3ZS8A 5LD2C 2JA1A 1GWNA 4S35A 4QGAA 3U3RA 1UEIA 4UNQA 2YHSA 5TXGA 2ONJA 3FTQA 2QN6A 4ZCIA 1Z08A 2C2HA 1ZP6A 3AP2A 2J7KA 2ZJYA 3B78A 1RPZA 2LWIA 2WVJA 4DSTA 2NMVA 5JHHB 1XCPA 3CR7A 4D4JA 4GBMA 2IEZA 3HPQA 2BIFA 1GSIA 1BO6A 3EC1A 1XD2A 3HR7A 3O8DA 3B9QA 1AK2A 4HB4A 4QBGB 2ZPTX 5FTKA 1IN7A 4A0HA 3TAHA 1XCMA 2ENNA 1KJWA 4UQOA 5BWMA 3K0FB 2QNRA 2QAGA 2VEDA 2RGXA 1SXJD 1GITA 4LPSA 3FMOB 3VKGA 1Q20A 2CCJA 2PZGA 1YR6A 2FZ4A 4DEYA 4OK5A 3U3OA 3CRMA 1EK0A 2BEJA 3B8HA 1OH6A 3OFNA 3PIRA 1M7BA 2B7CA 2HYDA 1M2OB 1XP8A 3IIKA 3RS3A 4TTRA 2PCLA 4E5UA 1HT2E 3NH6A 1XXHE 3QVUA 3ICEA 3BC1A 2QT1A 3B60A 4ITRC 2C96A 2RKOA 4Q00A 5HCNA 2Q6TA 5FTNA 2FSGA 4WZBE 4PHGA 1VIAA 1FOEB 3RWOA 3IIJA 4KI0A 4PQFA 4TT3A 1RC8A 2FDCA 1FP7A 1KDPA 2CE2X 3AF3A 4JLKA 3F5FA 4LDJA 2WTUA 1CJMA 1DO2A 3K1JA 2R9VA 5G40A 2C9OA 4LRWA 1Q22A 1EX7A 3IO5A 3NG1A 1BYIA 4NKRA 5FOWA 3CF6R 1JI0A 4RD3A 4JYCA 3THXB 3EG5A 3RLFA 3FMPB 2IXGA 4P33A 1R79A 1E0KA 2QP3A 1W2GA 4TL6A 2C98A 5L3SB 4WZ6A 3T06B 3G0HA 4CW7A 1UDWA 2PX0A 1NMYA 2QSYA 1P5ZB 2J7PD 3G5UA 5CJ2A 1CIPA 1FMJA 4TL9A 4G5QA 1VG9B 1YVDA 1BMFA 4LHYA 3BFXA 4B32A 1U81A 3FHTA 3AF2A 4AKIA 2BM1A 1Q12A 2EYUA 5FPKA 5CLQA 4G5SA 3OIYA 1FNMA 2MMGA 1JJ7A 4B3DA 4ACAA 5HKKA 4UNNA 5DH9A 3MWJA 3QNUA 1O87A 4WXRA 3L8ZA 5G3ZA 1E2IA 3CZPA 3H2YA 4B3CA 3AVTA 2VTKA 2ZUCA 5K8IA 3B2EA 3H84A 1YE8A 5CDFE 1U98A 2ODNA 3K70D 4ZI2A 2RGNA 1YRAA 3FHOA 1UKVY 2XSZD 3IUYA 4Q18A 2JGNA 2GJAA 1KOFA 2AK3A 2ZJ2A 2D62A 2W6JA 3GJ3A 2QAJA 1P4SA 4G3XA 2O8EB 2YUUA 1H8HD 3K0AB 3W90A 4D4LA 4BECA 1N6HA 3AB3A 3I1FA 1YR7A 5TV2A 4QM7A 2R8RA 4DLSA 4RZ2A 1ESNA 1TUIA 3PUYA 2FV8A 2GJSA 4A8JA 5KNBA 4YONB 2Q9BA 3QUSA 4NYIQ 3EPJA 5FTJA 3VR3A 5B30A 1JJVA 1OIXA 1E79A 2P67A 3M1IA 5FPSA 4DJTA 1G4AE 4M1KA 4HAXA 4HDOB 3SFVA 4R98A 1R4AA 1L7VC 3ASZA 1BH2A 4B47A 1KNQA 2ERXA 1OYWA 4LWZA 1K5DA 1X8KA 2OEPA 3NTUA 5KNDA 1HH4A 2GBLC 3LAWA 4GOJA 3GLHE 2OBNA 4I1UA 4JBWA 4G1UC 3VNVA 2DWPA 3GJ5A 2W00A 3K8YA 2R6CA 2V9PA 1Q3HA 2IXFA 2IYLD 3O47A 4MRRA 1I4TD 1LV7A 4URXR 2OCAA 4KFTA 2EWVA 3VR4A 3NHAA 4RCZA 1RYHA 2GVDC 3NWJA 5D3MB 3ZVRA 2CE7A 1LY1A 2ZS8A 2ZJAA 3OZXA 1HV8A 3HU2A 3Q72A 1RJ9A 3O8RA 3THYB 1DADA 3QY0A 4KFSA 1NJFA 3C7KA 2ZS9A 5KPJA 1Q1ZA 1OXSC 1N5JA 1ZNWA 2QUZA 4LBWA 5JSZA 4Q4JB 2OLJA 3L43A 3LV8A 4TTQA 3GMTA 5AUPB 4Q1EA 2ZJOA 2W6ID 3W6NA 2DCUA 3T1TA 4QBIA 4Z1MD 2NZ8A 4F91B 1OV4A 1F2UB 4XWAA 3C5CA 4D26A 2OFOA 3AVQA 2FSFA 3RC3A 3CM0A 3OIVA 5E95A 1OXVA 1Q57A 3MMPA 2VRWA 4XSHA 4Q7MB 2A9KA 4OKSA 2ZI3A 1L8QA 1PTRA 4M1MA 1ESMA 4PAOA 4D2IA 2OSBA 4QGFA 4CEHA 4ZKDA 1E2HA 3N2EA 1QDEA 5SZHB 4C7OA 4C0SA 3FFBA 4HLQB 4PANA 3TR0A 1K6MA 1II9A 3QEJA 3U4QA 1TU4A 2QE7A 1DG1G 4I99A 2FEOA 1XD2B 4KXFB 3IILA 3LY5A 4KSBA 4WA7A 2ZYWX 2X8AA 3TK1A 1S8FA 2P5SA 1J99A 4ASUD 4Q1CA 3CNLA 3OEEA 4C0BA 1S1MA 2IYYA 2KBFA 4P32A 2PMKA 3CR8A 1ZD1A 1SKYE 1HE8B 1KGDA 4HDCA 1Z6YA 2ZJBA 5TB5A 2YV5A 1H65A 2E9SA 3DPUA 3AF1A 4ON9A 5A5GA 1FX0A 1SXJE 1NIJA 4NYIR 1KKLA 4YMSA 5B64A 1WQ1R 4QHYA 1SVWA 1U8ZA 5KOYA 1ZIPA 1CR1A 1VCIA 5J4YA 1XNJA 3F0TA 3PEVA 4CGZA 2CVHA 3KJGA 4D25A 1E9BA 3AH8A 3EXAA 1EX6A 1XBTA 5FBRB 4H9GA 4BFYA 2D4HA 5IF9A 2GK6A 3K0CA 3TMKA 2Q3MA 4BLSA 3TSWA 3CRRA 4Q4HB 1KI9A 2P2LA 2Z83A 1LVGA 1R0WA 1V43A 5EXPA 1R8QA 4ARZB 5J47A 3RRZA 2FGJA 2B8TA 4TYNA 1U0JA 3SI7A 2CXXA 1VTKA 3IBYA 5F2EA 4JS0A 1KI1A 3GLGB 1QZXA 3X1YA 4C0AC 4HLCA 1PLJA 1KDRA 1N6KA 3RWMB 3U7EB 5LB4A 4V0ME 1ZINA 2HF9A 4YC7A 4LHVA 1N25A 2ZR0A 1G8PA 3REGA 1PV4A 3EPLA 1VYVA 2LKCA 1UADA 2NO9A 1CR4A 4IOMA 3QF4B 5HPYB 1U90A 2WOOA 3UATA 1NLFA 5KSYA 1JAHA 4AD8A 5CYOA 3SJAA 5FH9A 4XVUA 3SYLA 5BYJA 4TLBA 3TW8B 1VIYA 2JLZA 5FOXA 3SU8A 4C0QC 1JQLB 4C0HA 3I72A 2B8WA 4MQBA 5J5CA 5TMPA 4ESVA 4LPKA 3W8NA 1QG2A 1W0KA 2YVUA 3DEFA 2AXNA 3GFTA 2JLQA 4N0EA 1KSFX 2K5UA 4GPTA 4ZO4A 4M53A 2BVNA 1EFCA 1DBSA 1H8EA 1ZNYA 2XOKD 4L15A 2NO6A 3I5YA 2GCPA 4TMKA 3I5XA 4C0JA 1D9ZA 1Z2AA 2OZEA 2VP6A 4M9ZA 2V54A 4HB3A 2JLXA 1E2NA 1Q3TA 4D4KA 2A78A 3A36A 1TEXA 2BBWA 3BWDD 4HLDA 3FB4A 5DE3A 2HYIC 3EASA 4IOJA 3A4LA 3CX8A 4YMVA 1DPFA 4ESHA 2OXRA 3GLFA 1TTTA 3OEHA 4RZXA 2WMOB 4G01B 1VG0B 4LJ7A 2O0KA 4Q5IA 4XSGA 1RIFA 2F6RA 2OE2A 3L0OA 2GKSA 2ZSBA 2ZRMA 1MABA 1Y8FA 2WJGA 1G5TA 1Z83A 2DFNA 3VTKA 3RRNA 5AJXA 4OJQA 3V00A 1KO8A 2HCBA 2YYZA 5TVKA 1ONBA 1R7RA 4KFRA 4M0LA 2PLRA 2ZI7A 3CPEA 1CP2A 5FTMA 3U3MA 4M1WA 4UKDA 4ZV4A 2GDJA 3CW2A 5KHOC 3D3QA 4UNPA 3UK6A 4YXWD 1G1MA 1VCMA 1ZM7A 2G6BA 2QMEA 5FL7D 1GNQA 1EFRA 2P0EA 4HZUA 1ZD9A 4RD6A 4JBYA 1G8YA 1G5PA 3NBXX 5CIWA 5FBQB 1JR6A 5EE0A 3DM5A 5HTKA 4G0NA 5AUOB 3EZ9A 1GUAA 2IK8A 2JAQA 4LJAA 3U7HB 3BORA 3F8TA 1BIFA 3V4FA 1OXUA 2RGAA 2ZI9A 3B1XA 2C78A 2GWHA 3QG1A 1FW6A 4XIGS 2C8VA 2J5XA 3PUVA 3ZZ0A 2J1LA 4HAZA 1S4QA 3LWNA 4Q4AB 1UKEA 4TZ6A 4R9UC 4W7SA 3W5IA 4HB0A 2CNWD 3CX7A 5C2JB 2UZ3A 1MRSA 4EJSA 4Z51A 2RH5A 1G17A 3VQTA 1SXJC 4EPWA 1N2CE 4P4SA 4BZPA 1AS2A 5C4MA 2ATXA 3CBQA 4YMUA 2QTFA 1VHLA 1FARA 2F1IA 1WBBA 2EVWX 2FJUA 1XDBA 4HATA 5G53C 3B1VA 3EA0A 2CHVA 1EWRA 2JDIA 5JZVA 4D6PA 1W49A 2AD5A 3SS8A 3GCGA 2O8BA 5EJEA 1N5KA 2FN4A 1Z0AA 2VHJA 3FMFA 1G8GA 3CRW1 1GRRA 3ZIAA 1U9IC 2ZTSA 4LK2A 3DO6A 5EUQB 4QL3A 1G7CA 4TMXA 1ZU5A 1E69A 3ADDA 5JSZB 3M0EA 4ZDIA 3GLIE 1A5TA 3VMFA 1JBKA 3MG9A 4Q02A 2PLFA 3TQCA 4IDOA 1ZM4A 1G16A 2NQ2C 2WJJA 3ZD6A 4GRAA 5JRZA 5L3RA 1PVOA 1KJZA
chains in the Genus database with same CATH superfamily
3R74A 3LUKA 3HYRA 5LL6P 3P4XA 4F6CA 5KQGA 2NWQA 2V7XA 2ZT6A 1H6CA 3NT5A 5E0OA 3IHWA 4Q19A 3PQ6A 3T12A 2QJWA 2VRWB 3DL4A 1FSSA 1YVEI 4RESA 5ISMA 3CEJA 2JFVA 3T3OA 1B8VA 1KVSA 1TM2A 4JVOA 3AFGA 4QKQA 4DUGD 3MTIA 3IQFA 1OIWA 1K75A 1ZNQO 2YXLA 1VJGA 2EFHB 5EP3A 2X0NA 1OXTA 4IEEA 4P4UA 3W5HA 2RONA 3BD8A 3HJTA 4ZVUA 1G5QA 4RULA 4DLNA 2OILA 1NV9A 2G08A 2NZWA 3V8NA 2XMQA 1DAKA 1L4MA 2IDKA 1NSTA 4B7XA 4EUSA 5C81A 4JLSA 1HYEA 3ACDA 4YRSA 3PXBA 4PYKA 5LOVA 1JIJA 5DTJA 4E88A 1NN3A 2FSHA 2Z4SA 1DKNA 1PS0A 4RQTA 4HRYA 1DG9A 4MVJF 4JITA 4JLVA 1V1IA 5AKIA 1R88A 4JN6B 1C8VB 3IAM1 3M4NA 5JECA 1G0OA 4N7JA 5IG2A 1JMKC 3ACCA 2CNDA 5TY0A 1DC7A 3BIOA 3QFSA 1K89A 4ND6A 4B8ZA 1QE0A 2I29A 4EBBA 2HHLA 1N8TA 4CMJA 3OFJA 3F46A 1L5KA 4AECA 1XTTA 4BGIA 1EX9A 3MB8A 3ZGXA 1QVAA 1UDRA 2X9VA 4L27A 1M9NA 2VQ3A 2QMQA 1KY5A 3B6EA 3AKZA 5F98A 1AUVA 1K6XA 3LBYA 3PG5A 3KB6A 3KS9A 4RKEA 4G85A 5K01A 2X14A 2H85A 1WU8A 2AUNA 2NVUA 3OMLA 5B3LA 3ZXSA 1VDMA 3P2OA 5C31A 5TQJA 5BN3A 4WD3A 3DLBA 4C5BA 4Q9KA 5EUBA 3IVRA 3O92A 1U2EA 2CYCA 2HH9A 5EIWA 4LXIA 1XDUA 4XA8A 2IX9A 3GJ0A 2R1UA 2RJNA 3HJNA 1M6YA 2BHSA 4MR9B 4Q3CA 5EEHA 5KI6A 4D8VA 1P9RA 1ZMRA 1KJJA 4GC5A 3WLAA 1OBFO 4U7FA 1S8OA 2ZDGA 3O03A 1SVNA 2L19A 2O0JA 4FFMA 4XRRA 3T9AA 3TD9A 2ODQA 3I4LA 2HDWA 3KKPA 4QUAA 1E96A 1WOMA 4MUJA 1JJFA 4B81A 4FFSA 1A9QA 3BEOA 4CFZA 1BJTA 4UULA 5FPTA 4CTMA 5ALVA 3QIAA 2OO5A 3IEUA 2CWDA 4LRYA 1RWXA 2DVMA 4EGSA 3S1SA 1E32A 3U5TA 2VP3A 4RCVA 3QBDA 4JQYA 2JAXA 3QU2A 1G64A 5JYEA 2KS6A 3RTAA 1E6MA 2YWFA 1G18A 3E8XA 1OC2A 4DKXA 4E21A 1NL3A 5LQMA 2CXOA 1AA6A 1JPJA 2DR3A 1M75A 4HQRA 2O2JA 5CB4A 3MRVA 1ZHFA 3JZFA 1XA6A 5DI9A 1U0FA 2B4RO 2B8JA 5JCXA 1M8BA 1KEVA 3FNEA 2JGLA 3GJ6A 2CVPA 4A1FA 3CX3A 4RM2A 3L6BA 4M60A 1KKMA 2QLFA 3DHNA 3IV9A 3MGCA 1VE7A 1U2PA 3WGGA 1WD5A 4BNKA 1JWLA 4LA4A 3KIPA 2P9YA 2X15A 3A1WA 4PLGA 4WL0A 5BWOA 4XGKA 4M22A 2GPYA 3JZMA 5HHTA 2UV8A 4EG5A 4MDEA 2BL4A 1AKYA 2B3TA 4G36A 5GIOE 4MLPA 4HUQA 3U09A 1E3SA 4I7EA 3SE7A 1PYOA 4EBFA 2DG2A 3LHKA 3MWEA 3GRAA 4HC4A 1K7VA 4FOPA 1JLHA 4MUYA 1XZDA 2RHBA 2QN8A 3MQFA 4FGUA 4I5DA 5KYYB 3OLWA 1XMQB 4G0QA 1NUQA 5IXYA 2O7SA 4LCEA 3L7LA 1U3TA 1P4RA 2BGMA 3DZBA 1YKFA 2Y8EA 4MWBA 5HK9A 4QRHA 3HDVA 2DHEA 3EISA 4ASUD 4CCYB 1NXVA 4NK4A 4RSGA 1Q0QA 2P5YA 4GR5A 2XCOA 3W79A 2IWRA 3K9BA 5JJBA 4B2LA 3ANTA 3CRVA 2QRVA 3A7EA 3OECA 4LXHA 3LT1A 4PV7A 3WGMA 1V6SA 2BAGA 4TSFA 3RF7A 1FJHA 1DFIA 2FPIB 4Q48A 4QELA 3IT2A 2NZ2A 5HG0A 3E2MA 4XX0B 3BREA 2RHCA 4ECEA 1YZGA 1S6YA 3DZKA 2WPDD 4LFBB 2RC5A 3GEPA 1QDUA 1SIUA 4L8YA 1W88B 3USZA 1XTBA 1KSJA 3DTTA 3QMVA 4ZU1X 2YY7A 3CKLA 1UKCA 2GK4A 3EW7A 1V11A 1BYUA 1ISGA 3ETEA 1UPCA 3H9QA 4RZUA 1JDTA 1PF7E 2OESA 1OE0A 3GEHA 2E73A 4TXLA 3BGVA 4BNXA 3JQ6A 4IZ6A 1NXSA 3CWCA 4QEDA 4QYIA 3BERA 5AOCA 2XWBF 3R75A 4CFSA 5EJ6A 5KTPA 2JH3A 4AUKA 3IJRA 2A5GA 2I5PO 3GGGA 4EJSB 1RYDA 1VGQA 3OUUA 5IKXA 2XDQA 3PC8A 3VU1A 4V0LA 1C3OB 1NG1A 1X8JA 4L5YA 5DPMA 3TSOA 1XIVA 2YWCA 2R25B 1SPBS 3JQ8A 2Y6UA 4F1KA 4EFLA 3IVXA 2WJHA 2PVPA 2WCYA 3EXEA 2ZVQX 4DDHA 1FDIA 2YICA 1MNAA 4EO7A 1BKDR 3OTIA 5I8PA 3N05A 5AJTA 3NALA 5B1IA 1YBVA 2E4XA 3EUEA 3CZRA 3QLEA 2PE5A 2YXNA 3D4LA 4MUGA 3AEQB 1XCJA 4MYUA 4PC2A 3WYAA 5FTLA 1PGPA 4EUEA 1NMZA 3Q7EA 4R8KA 1QO0A 3E7XA 5DN9A 4AJHA 4YCCA 4A2WA 1TZCA 2ZDQA 1YL7A 4OCZA 4DANA 3HL0A 1ULTA 3E1KA 3FR7A 1EDDA 3OA2A 5KTMA 4YAWA 1QQ6A 4Z2YA 5F3WB 3PUIA 3SX0A 3VR1A 3U4CA 3SKVA 3WV5A 3G02A 4PWZA 1Y7LA 2GKVA 1CEQA 1TJ4A 2N1AB 1K7SN 3NP9A 5I9BA 1H1LA 5CNJA 4LRUA 3NNSA 4UHEA 2SGPI 3V97A 5CH5A 3WADA 2QUKA 3L18A 3VKUA 2YTZA 3VDUA 4IJ5A 1YXMA 1V5IA 1KYTA 4U5QA 5EQTA 5C8ZA 4XEUA 4LXTA 3IEMA 4AIRA 4KJXA 2GJKA 1USIA 4D98A 5KQLA 1FL9A 2R1ZA 4WLOA 4B71A 4B6EA 2OD2A 3JWJA 3QK7A 2NO7A 3B2QA 1VIMA 4IIVA 2I3ZA 1PR0A 3U7IA 4BOYA 4IYRA 3SNHA 5F2KA 4D46A 3U62A 3MAGA 2A0WA 3SBXA 2RHLA 3K53A 2J5RA 1U0EA 4Z0PA 3P52A 4CEJB 2AUTA 1H0SA 3BTOA 4N9WA 5L3VA 1GR1A 3KKKA 2Q0SA 5AKYA 3LGSA 3N0WA 4FYWA 3UMYA 3OZVA 5AVOA 1A5AB 1HKHA 2EXXA 2G4VA 4FMBB 1IIRA 1A04A 3DFFA 4Q1FA 4JZKA 4YRNA 2B98A 3LY7A 1FFHA 3Q3EA 4IG4A 2AC7A 3SQOA 3HEBA 2P11A 3JD0A 4WKBA 1FUKA 3K09A 1P4JA 2QP4A 2XB9A 4HXFB 2PLNA 3PEUA 2MT9A 3TLCA 5BWLA 2BBOA 4GX5A 3U6KA 5D6NA 3FDJA 3STYA 1XP5A 3T54A 4WN9B 1T2VA 1X1EA 3UYKA 4B6FA 2GZ1A 1QHHA 1VBKA 3BKXA 3GWZA 3SZ3A 2NZUG 2FTKE 4ZVRA 3RAFC 4CV1A 1NYRA 1CQIB 2HDHA 1NYTA 3FD8A 3WRXA 3UEJA 1W34A 1TCBA 2X1VA 1BQEA 1M6EX 3QUTA 1WSBA 3NBKA 3R0JA 1P2UA 2TMGA 4KKXB 1QU3A 1TU0A 2PPLA 2O5EA 1JTFA 3OXFA 3IQHX 4HO1X 3QPVA 1CBUA 4RTMA 5SY4A 3ZHTA 1X8XA 4TTVA 3WC4A 4DRXB 3L4BC 1UFVA 2A1TR 4MV0A 2XKAA 5G02A 1W4ZA 1SBCA 2RBKA 3KR0A 3COPA 4NYJR 4AO7A 4BV3A 4E14A 3C7CB 5ENZA 3VNSA 5FFNA 5FFFA 1KH3A 2PT9A 4MW4A 2FN3A 2NXWA 1SA0A 2UKDA 1R0RE 3HUEA 3KKMA 4JLBA 1TC2A 3TNJA 3O3CA 2V7QA 1GFIA 2PKQO 3SG0A 3WIOA 5KUTA 1U2SA 4BX9A 1XU4A 2PJRA 3L0ZA 1O96A 1CQJB 2B1QA 3OT5A 3T7EA 5ADWA 3T5DA 5HKKD 1NRIA 1PRYA 3BWMA 4RDCA 4ENPA 3B51X 4C4PA 3F3MA 4HOYA 3IVGA 2QTGA 2RI6A 3JAWB 4IZIA 4UM5A 1ZXBA 4HJXA 2PRIA 4ECAA 4Y2SA 3N39C 1AA9A 2XCSB 2H2IA 3BQMB 2O59A 1FP4A 2OM6A 3PEEA 1R12A 3DMNA 1DQZA 4G6ZA 2W43A 4UVGA 1I3LA 4NFLA 4B0PA 4ETIA 4R2LA 2Z1NA 3HEAA 1RMTA 2DQYA 1VL5A 2EKQA 3WHPA 3BX1A 5HSGA 4A15A 4I55A 4MB2A 4H6VA 1P33A 1JLKA 2QL6A 4BUJA 4F5WA 1GCAA 1TM3E 1WHTB 4GSLA 3D4BA 4LYHA 3GX1A 2IXTA 3QNWA 4QQNA 4WW0A 2W6JD 3FYSA 3MFQA 3UT5A 3AHFA 1MJGA 1KAGA 2O14A 2W0SA 3IIMA 3WQQA 3E1SA 4J6FA 4LWQA 2JLUA 2GEDA 4UUNA 2WJAA 3H6GA 1UPUA 3TZQA 1NP7A 3UAYA 3I73A 1YZVA 3FOZA 3KOZA 1G4UR 5KU1A 1MPXA 1D2EA 5TQVA 1Z4QA 5GJBA 1A8HA 1FUYB 3IVAA 4LZOA 3DB2A 4UPVA 3WKCA 2GD6A 2ZBQA 3AVPA 2QN2A 5IU6A 1H9AA 2PGLA 4CF3A 2ZE7A 3MWYW 5FOSA 3G2QA 3ZCXA 1PJZA 4KAJA 3EBOA 4CLHA 1DV1A 1USKA 4AO8A 4R9NA 4HLUA 4Q7QA 2J6IA 2ZBRA 3EBPA 3OSZA 4FWBA 2GVNA 2JL1A 4KDCA 3KSZO 4PO8A 3PRYA 2VNIA 1TCUA 1QIDA 4WK0B 3TOVA 4MYTA 3D0KA 3GCWA 1AUXA 1JWAB 1JZTA 4TRNA 4UE2A 3W2FA 5ITSA 4GPZA 2HW8A 1DC5A 4LVNA 1CY7A 2QZ9A 3FCXA 4DQUA 4UDXX 3NDIA 4CKBA 4NCNA 1NKSA 3KQVA 5J4HA 4Z4GA 1S7CA 4XLZA 5DTQA 2BFBA 3WGKA 1P5FA 1E9VA 2HMVA 4NP6A 4KQKA 3HKCA 5EWMB 5IARA 4HNGA 1ZUNA 1NQWA 5KNLA 2IBTA 1T0IA 4WWHA 4E13A 4EPYA 2HIGA 3AKDA 2HMYB 2B6HA 2ZYIA 3O74A 4RSMA 4XEHA 5SYNA 3WX0A 4CIDA 1YRWA 4WHMA 1ECPA 1EWKA 4AZSA 4JIGA 4OHXA 3AHCA 3DAOA 3VR4D 3SM3A 4ZQIA 4NAUA 2CNBA 4L8WB 4LXYA 4Y18A 4B5KA 2BUAA 2IYPA 5FD8A 2WINI 3LLMA 4L73A 3SX2A 3T9BA 3LLCA 1FFXB 1G7RA 3NBQA 4J7AA 3HTXA 1IBRA 3QOFA 4F6LA 1U7PA 5JZ9A 1BS2A 2PXCA 2WIAA 2B7BA 2TMDA 2IUTA 3L9XA 2ZUBA 5HF5A 3L49A 2QTCA 1YZLA 1Y5LA 4RZQA 2FFAA 4NZOA 5JMWA 2XE6A 2Z3ZA 1SGPI 1TJ3A 4M8NE 3G0IA 4RLQA 2VOJA 5ALYA 4LCBA 5JO0A 1QR6A 3JALA 3MQ4A 2FLKA 4MV3A 4I4TB 4LTDA 5L7YA 4B6DA 4FR5A 1P8JA 4TMZA 4I4CA 2BRUA 2G9QA 3HJAA 1E7MA 1U2ZA 3IUQA 4P35A 2VF8A 4WVFA 3VO2A 4YV0A 2BCEA 2H48A 1P1JA 2C2WA 4AURA 4B5LA 4L9MA 2ZTVA 1D2NA 3H5AA 4D3SA 2HA6A 1UAGA 1PR1A 1LRLA 1P5RA 3NTXA 2GHQA 4PPQA 8ADHA 5EUMA 2VPTA 4OYHA 4X8OA 2RGDA 2C1ZA 4EELA 2IEDA 1WXIA 2WBLC 4NMMA 5H8WA 4PHFA 3VAAA 2J41A 2RC4A 3BT7A 3I61A 1UBCA 1X7GA 4OOFA 4FU0A 3QIVA 1P0QA 4PM4A 2CY0A 1R18A 3QMMA 5ALNA 5FLYA 3FPHA 1RVV1 1A7UA 2A5DA 4FCTA 5EQDA 4H60A 2DB6A 2ZIAA 4BTEA 1HDLA 1Y7IA 5AKJA 1PCEA 1DX9A 1K8QA 1TM4E 2A7XA 2L7XA 1CDZA 2D5IA 3AF4A 3C1TA 4ARVA 1EG2A 3I28A 3LZCA 5AW8A 4KLCA 5IWCA 1Q84A 3DE2X 4KMSA 2R00C 1P5JA 4EQ6A 2Q41A 3H9BA 3K6SA 1XZJA 5KYXB 1NNLA 1TOTA 5CW2A 4ERNA 1KVUA 5AWFC 2ZT7A 3JZDA 4GI1A 4EPVA 4EUHA 2R68A 3COYA 4MO9A 3AXTA 4EPRA 3C8MA 4X44A 3OQ6A 4JJ8A 1TE2A 3LECA 3BJIA 3GLQA 2MSCB 2QX6A 3VV2A 4B1FA 2M2IA 1TLFA 3DOHA 4DFDA 4EW2A 4HGOA 1E64A 5KTRA 1DAEA 2X8JB 3IDZA 4P3YA 5TQ2B 1PCXA 2NUBA 2Q5HA 3M34A 5JARA 3H83A 1WBJB 2X13A 1AE1A 1E60A 4JC0A 4PSAA 5EESA 4UCWA 5TGDA 4WEQA 4AY4A 4U9UA 4CCAA 3TB6A 1QRTA 4NCBA 5SZIA 1PYDA 2E37A 2HM7A 5F5XA 3DBLB 1YSCA 2QUAA 4A24A 5DULA 3DLIA 4JB2A 2JBHA 1IXYA 2V59A 3PLRA 1MQ8B 5JXGA 1Z6XA 3R9IA 4E07A 3PYXA 1G20A 3X44A 4FWTA 3FNBA 4MWSA 1ADYA 2QSUA 1IYZA 2A8YA 2XA2A 3GB9A 2DUWA 2YUTA 4F4FA 4CQNA 3I04A 3H2ZA 2WSLA 3LKZA 1SR8A 1IWPB 5F77A 4QWMA 4WBNB 3MTDA 1IK6A 3FHJA 3DKIA 2QLTA 4US1R 5G4KA 4MVWA 4F97A 1Z4MA 3E0XA 3FNFA 4XI9A 1QS0B 3FLAA 2Q27A 1GV0A 2AJLI 3NOOA 4IFEA 1SC4A 2VHQA 3KJNA 3LHIA 1WR8A 3N0TA 2H00A 1CUCA 1GCOA 4JHLA 4IDBA 1ZD4A 3G1TA 5J4LA 2CYBA 4PSUA 2WWFA 4TUYF 3PXXA 4YB8A 4ZO9A 2Z6UA 1T4CA 4GUAA 1JHPA 1W0KD 3RVPA 3PE4A 4N5MA 3UJNA 3THWB 1SEPA 3KQSA 2Q8NA 4NCHA 1WCV1 2UXDB 1V2HE 3RF6A 1SIWA 3U3DA 1RS0A 1SXIA 3OU7A 4FEEA 2YASA 1RI2A 3WY9A 1G3MA 3RYHA 1PL0A 1HG1A 3JQAD 2I55A 3P9QA 2C4WA 3SD7A 2VA8A 4KV9A 4K6FA 1CUAA 1H6AA 2G71A 4CLOB 1GFZA 1WB9A 3AETB 2EFGA 2I2DA 1T10A 2I99A 3BB4A 4RK5A 3OUZA 5WRFA 3B70A 3EZ2A 4GZ5A 4TKMA 3BG5A 3DT8A 3EH2A 4MMXB 5EGSA 1CUYA 1PUIA 4M9QA 4QHTA 3OCXA 1OWLA 1MMFB 3K8ZA 3ZBUA 2VYVD 1HC7A 1U8EA 1EGQA 4AJ4A 1JP7A 3LDFA 3NC0C 3QKSA 4DMFA 2W0MA 3GYBA 2DBYA 4ZYYA 1T9CA 3DONA 1RAFA 4QJIA 4CETA 3AV3A 2NAPA 3TWOA 1E0AA 3IA7A 1L7QA 4DVJA 2VUHB 5EFZA 2A9FA 2KW5A 5B1YA 4AYXA 1QNLA 3ORYA 3DD1A 4C0KA 1Q0TA 1RSZA 1J70A 1OPXA 3BRWD 3F9CA 3G5LA 4I5FA 4XJSA 2FRDC 2YRWA 3OSUA 1DWUA 4R2IA 4UHCA 5D1HA 5IPFA 1LX7A 1Z22A 1RQLA 3PFNA 1SZJG 4I08A 3EUFA 3QU4A 5T3UA 1ODSA 1JSCA 2PO7A 2IPOA 2WI8A 3KJIA 2QP9X 3OO0A 3LWDA 3ZV3A 4FJ0A 5E4JA 4BE7B 2A5JA 2IT1A 5IVPA 1L3IA 1JKJB 4JQSA 4YAEA 1FU8A 3A1TA 1D04A 1R0RI 2J30A 3BB1A 5KQMA 3PA6A 1Z68A 3QXXA 3P19A 2GT1A 1AKTA 5JNVA 2YYSA 2LBPA 3NHUA 4P8RA 4EA6A 3GVXA 3ZDEA 5TS3A 2H7CA 3W6PA 1IHXA 4GEKA 2C77A 2XXJA 2EF0A 2VYNA 5FAKA 2HHCA 3QKRA 1K7EB 1JHAA 3TO5A 3A6GA 4HX2A 3KTOA 1O95C 2P2SA 3B53X 3L0YA 4HDNB 3NUQA 4FJ1A 4YQEA 3L1HA 1P2TA 4KQ1A 1Z36A 4LX0A 2X58A 4P93A 2I4RA 1DELA 2ID8A 4WFQA 2ID9A 3IDFA 3E18A 3W1VA 4YCMA 2FZVA 3M6MD 3GPLA 4PVDA 4Y9RA 2ZTUA 1RWBA 1T4DA 2H16A 5C35A 4OB6A 3VYRB 2A3RA 2O3UA 3BWXA 1CB0A 1L5YA 5CH8A 2QGNA 3S3TA 3V4RA 3JQQA 5DAEA 5K0BA 3N9IA 3KOYA 3RK4A 2YDXA 2IS6A 2F3PA 2JDID 2WSMA 1E1CA 3TDNA 5JW6A 1MKYA 1Y5MA 3KPWA 3ZV5A 4INOA 4BGDA 1O9GA 3PHJA 4UDOA 3SXJA 3WQRA 4TRMA 1WPXA 3L6RA 3PSHA 4RFLA 4B33A 5AW6A 1UQUA 3ICWA 3PF9A 2J5BA 3L0IB 5LBUA 2NVOA 2XCLA 3MJ4A 2NAFA 4YI5A 1A27A 4X8LA 4GLOA 1RHUA 2CHGA 4R6XA 4XARA 4KH1A 1R9MA 3L8FA 1Y8CA 4P98A 3OG9A 4QGBA 5GZ1A 1VE5A 2XVAA 2QTHA 3AMVA 4K8OA 3RG8A 3V48A 2OVBA 1E9RA 2FPPA 3IHTA 3W5JA 4XQCA 1QAOA 2GR9A 3PT5A 1YKSA 3DCJA 1EBFA 2WAMA 4PC1A 4QC2A 2A9RA 5IW8A 4EY7A 4NIMA 3C6BA 4JB8A 4CLXA 2ZCJA 1KDZA 1JYSA 4F2WA 3SQNA 5IKPA 2HF8A 1IAVA 3KU1A 2JCVA 1UQTA 1XYYA 1ZGZA 4Q9NA 4RPLA 4REQB 3CT4A 4BUZA 4PC7A 2XTNA 1R15A 3QX7A 1I6MA 3OH8A 4I6GA 3ZU3A 3B5EA 1TMOA 2EJCA 4YFVA 4MS1B 1IZ9A 2F67A 4U3JA 3RSHA 4DZRA 4FHGA 4M1YA 3NC1C 3QXCA 1V16B 1N5DA 1YBMA 2GEVA 3O73A 1PZHA 1MIOA 3DFKA 3H1TA 4P54A 2WKWA 3HL4A 1T8RA 1X94A 2DUUA 3PYLA 4K9SA 1KI6A 2Y68A 1XXHA 2FB9A 1QXSA 3AFNA 1D4OA 4WI1A 1NX9A 2JLSA 4JT4A 1E2LA 4FQ5A 3E9RA 3TRDA 4D9HA 1WZ2A 4ZQFA 2GPTA 5KOHB 2F9MA 4LY0A 3RFUA 2HNBA 3DT9A 3L4KA 9MHTA 4FFLA 2WK1A 2AT1A 1C0EA 1V8PA 4K9KA 1T3SA 1O77A 2DUJA 4EB0A 4W6QA 1IVYA 2I80A 4ODIA 3C16C 2R4UA 4WUTA 3DMTA 5C9ZA 3IAM6 3E5HA 3QELB 3M9XA 2Q7DA 3ABQB 1KXZA 3PHLA 4WBSA 4EKEA 5AVRA 1NFQA 4QOGA 4ZDWA 3UVEA 1XF9A 2IF2A 3DF9A 5HRCA 3N3BC 4KVFA 4CIVA 2VYCA 2Q6OA 4B3FX 5B6PA 4ZXPA 1WD7A 4RCYA 4QYXA 4ZV9A 4RXUA 1RBMA 1ULSA 1UP4A 1FSZA 3K1ZA 4CTOA 3T1NA 2FVXA 2EP5A 4CGYA 2BUSA 4F0JA 5DM60 2BMVA 2RHJA 4IMJB 2PKXA 4G5XA 1KEWA 3H1AA 4UHDA 5FA6A 1N92A 4B8WA 1OU4A 4R7ZA 5L3SA 1T26A 4OI2A 4XDYA 4PC3A 4CM6A 4K03A 1SKMA 1J5XA 4TMYA 4PLCA 5DKFA 1T1EA 1XDWA 5J2UB 5JVDF 4RTSA 1XJ0A 5C7OO 1W0JA 1XGKA 1X1CA 2OSVA 3DF7A 1XZLA 3PXGA 3M6WA 4FMDB 1TT5A 2OZLB 1NLUA 3TEJA 3R3UA 3UCEA 5IKOA 1K92A 4LVOA 5KPJA 2A1TS 1G3QA 3M89A 1E1RD 4OI4A 2P3OA 2RHHA 3CH5A 4FX5A 3B3AA 3RU9A 2VDWA 2H1WA 3EC2A 4D9NA 5FF9A 4JL8A 3GK3A 2HU5A 5KU7A 5K3OA 5A5VA 3R9XA 4J6EA 1T1SA 1B3RA 2B92A 5BV2P 4TV9A 2CJYA 5B3JA 4RTPA 4ZI3A 2IW1A 3O1LA 1XD9A 3EIEA 3I58A 5TF0A 5JS7A 1P0IA 2PS3A 3A3KA 2H5EA 1NJ6A 1QIMA 2BZ1A 2R6FA 3Q3GE 1M1NA 4Z54A 2OHFA 3SK0A 1O97D 4YASA 3RC8A 1PEKE 4W8GA 1RC0A 3GRCA 3QEKA 3INTA 4MR8A 3T5GA 3UHPA 3CKKA 1E4EB 1NSFA 2JD1A 2IYRA 4TQGA 3ZUPA 1HZJA 3W6ZA 2VUTA 3MHPA 6Q21A 1N2JA 2ZWPA 5GINE 3AVWA 2CV0A 3FLEA 4OQEA 2OXIA 1ATZA 5CPBA 5T41A 5ER6A 2SGFI 3SLGA 1RLOA 2QMHA 1SGDI 4GKVA 4EX7A 2DHDA 2I7TA 2R66A 3IKJA 4PZ9A 1E1YA 3X2FA 1F1BA 1JQAA 1OBOA 2PIAA 4LNUB 3P0EA 2WJVA 4AJJA 1MVLA 2WMYA 3HDJA 4LYJA 3TZLA 2IIQA 3K05A 1LXCA 3C45A 1YR9A 1EZ4A 1WMSA 1JIXA 2IZ5A 2VC2B 2VHVA 3LYAA 5HNKA 3EXG1 3NDPA 3OM8A 2XB2A 1B3BA 4LJKA 4UM7A 4EH1A 2KE5A 2JIZD 1DGQA 2Q2NA 1E0SA 1RNLA 3ZVNA 5KNBH 1QGED 1G2PA 4B3BA 4GOKA 4P36A 4IICA 4DCSA 1LR7A 1E6KA 1RP7A 1FU4A 4MITA 2CJXA 3LX5A 1J2YA 1CXZA 3HCDA 4HQLA 5LA6F 5A9RA 3IPXA 3I12A 1L8LA 4OMUA 1NC3A 3NTRA 2XGJA 1PJ3A 2ODPA 4B2PA 5CCEA 3MCTA 2C9BA 3D0RA 4FNMA 2FUKA 2Z08A 5JROA 3C4JA 4WZAE 1I94B 1BMQA 5B2ZA 3OZWA 4EHIA 1SEVA 1Y98A 5B3AA 4RQAA 3EEIA 3PWKA 4MHTA 3T3HA 2XVYA 3FYUB 3PHGA 5DX8A 4HSGA 3T41A 5CM8B 4J7XA 4DM3A 2XNDD 2R8PA 4NONA 5BW5A 2WFLA 1H3EA 4ROSA 1VI6A 4DBVO 3QFTA 3MCZA 4EY8A 2BGIA 3DKVA 4N48A 1TJPB 2Q4EA 4UHJA 1C4WA 3D4NA 4A2QA 3BMQA 1A2QA 1ZD3A 4YFYA 3WNVA 3AB8A 4I50A 1BWSA 2ESRA 2FR8A 1TQ2A 3BH0A 1BX1A 4GQAA 5DIFA 1NURA 3QEAZ 4FYMA 4V3CA 1W52X 2HF7A 4J3NA 2C7RA 3FSJX 1PEYA 2YZ2A 3IXLA 5AK0A 4EHLA 4FILA 1AHIA 2FA9A 2ZATA 1LFAA 1T9ZA 3K0CC 4BRZA 1A0OA 4N5DA 3OJWA 1NBEA 2PNFA 5BR1A 3CLVA 1Y6FA 3BGSA 3PDIA 2WQ7A 4B7AA 3KUUA 2G88A 4KR0A 1GA6A 4G5GA 5E2BA 3WGNA 3H1PA 3WB1A 4TVKA 1W76A 2ZUDA 4OF4A 2R7LA 5I8WA 3AI3A 2J85A 3Q9LA 4AMVA 5B1EA 2O57A 3DR3A 4Q3NA 4K9PA 4Y9DA 5AYVA 4Y6QA 2Y27A 2W9XA 1AHHA 1IUPA 2HA4A 5ILQA 1MFPA 2COUA 4WK2B 3F98A 1WQ3A 3IPCA 3QVGB 4QPCA 3GI1A 1HL7A 5JHGB 4OVKA 2SNIE 3T1YB 1HE3A 1Z2IA 3U56A 3SQWA 1R2QA 4A92A 1WCIA 2JKZA 2UXBB 1UJBA 4H1UA 4QFDA 2WYWA 1WKBA 1U6IA 3OKPA 2JH8A 4AKHA 5IKMA 1NAHA 1Z29A 3VHXB 4G5RA 3G2LA 1PTJA 4DWJA 4L0CA 2RGBA 4A1OA 4UVDA 5DW3A 3NJRA 4MIYA 2WT4A 1TF2A 1JZQA 2E85A 1AD2A 3TQRA 3C5HA 3G3EA 2ZRKA 3H8WA 1V6CA 4YCLA 3G9UA 1U9IA 2R96A 1OZFA 1UWCA 5IJ9B 3SEZA 4UFOA 5K0FA 4NG5A 1XG5A 3ICPA 2EX1A 4JJ6A 2F4VB 1B73A 2AN9A 4L78A 5ALOA 4RYDA 5BN1A 3HKEB 4A16A 4UTXA 3VDQA 1VLHA 3W05A 4CN8A 3HGTA 5F2OA 2OVOA 4OREX 3T4XA 3ZWVA 4EQZA 1CZKA 1RZVA 2FG5A 4DV7B 4V0QA 1CT9A 3PFIA 3N87A 2BN4A 5EZYF 5AW9A 3L8CA 3IIEA 5BN5A 3ZE7A 1Q0RA 3H5WA 3HGMA 1OX4A 2BLNA 3JSXA 2F1OA 5EKTA 2HA0A 1EVYA 3B6MA 3ZE8A 4GU5A 2PK3A 2YOHA 1YZTA 3QLTA 4KQEA 1LF0A 5GIPE 4JD5A 1FFYA 2RH4A 1SXQA 2R86A 1FS5A 3ZJ4A 4F04A 2QPAA 5K4AA 2LDBA 1XEXA 4URVR 1KO7A 3HYTA 3GT0A 3K1AB 4GOMD 2H54A 3H2HA 3MC1A 2A9PA 1DUVG 2H7YA 1CETA 4NNPA 3SZOA 1T4MA 3CT6A 2ZOSA 3L8MA 5J2TA 1JPVA 1PN3A 5HK8A 1PWZA 1ODFA 3NDBB 2R6R1 2VPIA 3JPWA 3HR8A 5LMZA 4PR0A 2VQSA 2ZQ5A 4MCJA 3GQBA 1QP0A 1SUFA 3KR2A 3PFCA 3CF4A 5FIUA 5JXHA 1AX9A 3QTBA 4RH1A 3UV7A 1I24A 1IY0A 4EHBA 4FKZA 3UFFA 2MYUA 4FIZA 5TSDA 4MCAA 1IN1A 2Q5CA 3HRHA 4DIKA 2WE8A 1G7TA 4FOTA 4YRLA 5HUHA 3UEYA 1NVWQ 2G5GX 2C0CA 5CU7A 5GM2A 2QM7A 2XZLA 2XTMA 5EXTA 2HRQA 3T15A 3UG7A 4QPZA 4NCAA 4M9XA 4MW7A 3ZGVA 1RXWA 2D0OB 3A6ZA 4M7RA 1XMPA 2D00A 3PGXA 3D6AA 1SURA 4JCOA 4MEAA 3WTCA 3LNCA 5HDBB 3KL2A 4DMKA 3JSAA 2XOEA 3EF0A 3WLJA 1I4DD 1D2HA 2AI1A 3GN1A 4U7PB 2C3UA 3I32A 3I01A 1K2WA 1QG0A 2XSZA 4AMZA 1G8KA 4EM6A 4DA4A 2G70A 4NDAA 1FCJA 4RM3A 4CLRB 1T6NA 1TYDE 3ER6A 5IDYA 2XVXA 3MUEA 4X93A 3ZTWA 5HIAA 1UBMS 4TQUS 4I1PA 2BC9A 3DMRA 3TOCA 2P68A 1V1MB 4QDXA 1I80A 3OJOA 1J7KA 3DDUA 1WUTA 3DFZA 5K3FA 1AZSC 4MUNA 1XVIA 1JRLA 1SUSA 1RU3A 3DKKA 4HBGA 3PFKA 4M7WA 2BGUA 5DWVA 4BMDA 4B74A 3MWDB 4BP3A 4ND8A 2FUNB 3AERA 3HDGA 5DM0A 1PR2A 1R5NA 1L7XA 2OCXA 3FGZA 3X0DA 3R5KA 5B2EA 3RADC 1WXQA 2IEIA 4S04A 1LI7A 4BNTA 4Q6BA 4WLUA 5JRDS 1T2AA 4LI0A 2XQFA 3BTVA 4GEGA 2QTVB 3ASYA 1KK3A 4URUR 2WIJA 2W2KA 5GVSA 1JLLB 1QFYA 1YCHA 1ZAKA 3AL3A 3ETDA 3VKHA 3FIJA 3OZBA 4OMFG 4TRJA 5B1DA 4WY5A 1IM5A 4X54A 1CGJI 1SO8A 2XCQA 1OPRA 2YC2C 1UEJA 3TIVA 1GL7A 2J0VA 1LRJA 1UOPA 2DBQA 1MUUA 1NJ8A 4JDUA 2BISA 2B83A 3FUCA 4C29A 5TJHA 3DZCA 1T2FA 3L3BA 1RBQA 1WIWA 4H1VA 4NS4A 1W4RA 5ECWA 3DE1X 2CBXA 4ZT7A 3RO7A 2FFQA 4J4TA 4NY1A 1R50A 1GZ5A 2O06A 3LJKA 2OYSA 5TMDA 4AYTA 4Y6RA 3BMOB 1MIHA 2NUTA 3DOUA 4RQBA 4GE0A 4Y9UA 1NIPA 3GELA 1JIUA 4LDNA 4M88A 3JWEA 1DAOA 3LIIA 2GKRI 4UXJA 1ZDMA 5KJCA 1RRFA 1Z2EA 3AM3A 2WZDA 1S7GA 4L4UA 4ZTUB 5CX1A 1DC6A 3SAJA 4AJ9A 4CV0A 1FXSA 3RFTA 5DFAA 4AL4A 5KWSA 2DFLA 1MNQA 4I3HA 4PZDA 5E7IA 2OGZA 4LSZA 1L1QA 2C7GA 1C1DB 4RL4A 1Z2NX 1E1NA 3U61B 4HGZA 1IUOA 2IE0A 3VH2A 4GXRA 1PHRA 4OXIA 3DTVD 5GJVC 3KQUA 1QIEA 4X61A 1C14A 3C7TA 4MIOA 2CFCA 2OK8A 3WDKA 4HNQA 3GJ7A 4KB5A 2IL1A 3LXXA 2Y1FA 3E3MA 3OAAD 1BCRB 4ENWA 5JI3E 3MOGA 1H2HA 1H2RS 1OYVA 3CQ9A 3HCAA 4Q4DA 1G3RA 4JQCA 1TJYA 3PRHA 2F3RA 3C6KA 4ZVSA 3E3AA 4IL5A 1SZPA 1NTRA 2OV2A 3WK8A 4EGQA 3N6RA 4DKJA 2WQ6A 3MPOA 3H75A 1I2ZA 4BNMA 2GCNA 4L4RA 1QBGA 1YMVA 2XYPA 5EIHA 4KQFA 5A3SA 3ENWA 4XJVA 1Y0BA 4WCFC 4F4UA 2IUSA 4MI3A 5GGXA 3CIOA 2CF5A 4BLOA 1NRJB 2D1QA 2BI8A 2H2FA 4IIFA 1AKMA 1BWRA 1N2ZA 1NJ5A 1G9SA 1AZTA 4CPDA 4EA8A 1XD8A 3DPSA 4ML3A 5HWSA 1QH9A 5ALWA 1F5SA 1T5TA 4A8HA 1ADJA 4OGLA 4WEOA 4ND1A 4O4LB 1XRQA 5K4HA 4R2HA 2ZVDA 2CDAA 1KK1A 2AB0A 1X0VA 3PGMA 2CYAA 4TLMB 2NZJA 1J20A 3CUSA 2GAOA 4AZ0A 1LQUA 1CB7A 4BMVA 2H4XA 4KAAA 4WLNA 2FWPA 3ANXA 3ETGA 3LZDA 4I8XA 4QARA 2X0JA 2X9GA 1RQ2A 2AJBA 3D8NA 4U00A 5DJ5A 4HMPA 3ZE2B 2IYUA 3A6PC 1G5HA 5K20A 1OF1A 2Q3EA 4MA4A 3UJBA 2OOKA 4QIHA 4AUNA 4MXDA 4F1JA 4F6RA 4DLWA 4YV1A 1Y5RA 5KJEA 3V4VB 2W8BB 1W5AA 3NV9A 1I13A 4JGBA 3TXXA 4BX2A 4DREA 1K6EA 1AV6A 1FMLA 3EW9A 4ARIA 2GEBA 1AK9A 4AJEA 3AUTA