4UXHA

Leishmania major thymidine kinase in complex with ap5dt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
173
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVALMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 49
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxhA01
1NLFA 1Z0KA 3D7MA 1HURA 2QP4A 1E2HA 2C9CA 3SC3A 2QA5A 1QHYA 1OXUA 2PX0A 1NMZA 3BJIA 1JBKA 1G16A 3AH8A 1T5IA 1A5TA 3LXXA 2E9SA 4DZZA 1NLZA 1X3SA 2VP0A 1E9BA 1NVWQ 2VP2A 2V6JA 2RB4A 3Q85A 2UVQA 1YKSA 4M1SA 2MSDB 4Q01A 1E2EA 1YQTA 3HYTA 4PZLA 3X1ZA 3A4LA 5EP3A 3AV0B 3I4LA 1L8QA 5A5GA 2BEJA 5LD2B 4CF7A 3ZD7A 2N42A 4Q1EA 3KKQA 2O0HA 4H1VA 2ZROA 1W7AA 2IXGA 4PFSA 3Q5DA 4MRSA 1JI0A 4UNSA 3VX4A 3CB4A 3KTAB 3ZLJA 4O25A 5HTKA 4GI7A 4XSHA 4DJTA 2WBLC 3U7HB 4MKGA 4QBGB 2OE2A 2JCSA 1KSFX 4M1TA 2RCNA 2ZQ5A 3TVTA 3V4FA 4Q02A 2QMOA 3U4QA 2R2AA 1W5SA 5CDFA 2YC4C 3UG7A 1Z08A 5E95A 4LOAA 1T91A 2QNRA 1KDRA 1XMVA 1Z83A 3UKDA 1XJCA 2J1LA 4M22A 3U3RA 3WXMA 5HKKA 3AF4A 4C0SA 2JDIA 2LWIA 1Z0IA 2WKPA 1AK2A 1G7SA 2B7CA 1R5OA 4HUTA 4I1VA 2IXFA 4ARZB 3T35A 3MAAC 2AKAB 4NCIA 4BFVA 1MOZA 4YLGA 5GJVC 1KAOA 3KB2A 3BH0A 2PX3A 2QE7D 3QPVA 4XVRA 4OQMA 1EX6A 2C04A 4AYXA 4Q7KA 5ANRB 1ZIOA 721PA 4JLJA 2ORIA 2V7QD 1F60A 1G3QA 1MABA 1JB1A 2R44A 3CRRA 4QGGA 3VMFA 1G8FA 1KJZA 1QHXA 2QPOA 3SU8A 4JL6A 1EGAA 1CJVC 4TZ6A 2BBWA 3ZJYA 4Q9KA 1U9IA 3Q9LA 3I61A 4L15A 3QVVA 4CT5A 621PA 4M0LA 1AQUA 1XXHB 1MV5A 2PJRA 1HV8A 1LF0A 1QRAA 4G5GA 3WHLA 1EWRA 2QQEA 1CS4C 1KTVA 2YWEA 2ZPTX 3FMFA 3P32A 2XEXA 3TVDA 3UATA 1N0WA 4IOMA 4LJ6A 1E0KA 1CJKC 3ZQ6A 3KZ1E 3UMFA 4DXAA 4TT3A 1E2JA 2P5SA 4KU4A 5E7JA 4QG7A 3RRNA 4I1OA 4CEJA 4G0NA 4WZBE 5J4KA 3RVBA 4C2UA 5CM9C 1Z06A 5TDHA 4KLNA 3PEUA 4F7WA 1E9EA 1HUQA 3UFFA 2GXSA 2GEDA 1SULA 3I3SR 3ONWA 4D4MA 4A36A 2IEZA 5CK4A 3LXRA 3IIKA 3VU9A 5EXTA 1JQJC 2XAUA 1OFIA 2WPDA 3A6PC 4IHQA 3T5DA 1P9NA 1U94A 3LQQA 3THOA 5FUWA 1XF9A 3GLIB 2GEVA 3THXA 2ORVA 2EYUA 5HCIA 1W2GA 2ZI6A 3K09C 4XIGS 1OFTA 2IUSA 2WWIA 5FOTA 4A9AA 5JMTA 3CO5A 4NYMQ 3VFDA 3CR8A 4FCVA 3AVUA 4XD7A 1N6LA 1AS0A 2PEZA 4RD0A 2IUUA 1O3YA 4L16A 4F4IA 3QKUA 3SYKA 4Q4JA 3P20A 5L3RA 1E0SA 3KKOA 3AKEA 3TQCA 4DDVA 4ASUA 1KI6A 4PHGA 3W5IA 4Z51A 2FSHA 5B2ZA 2P3SA 2CLCX 3T1OA 4D0NA 1EFHA 2YJTD 5FBWB 1G9XA 1W48A 3AM1A 2ZRPA 2ZTSA 2ZYUX 3RHFA 4EPWA 1D2MA 2XSZD 4M8NE 4G5SA 3U6BA 3QPWA 4U02A 4LY6A 1TF2A 1E79D 4F38A 5GVRA 1DAGA 2ZS9A 3AQ4A 3IBGA 2BMFA 4M4SA 3RS3A 1NVVQ 4LWZA 4JZKA 2C77A 2RGXA 3PEYA 3OESA 4RFSB 1WE2A 2X19A 5G3ZA 2BKEA 1DELA 1NLYA 2WAXA 4QKQA 5HE9A 1OB5A 4HDOB 2IC5A 1DOAA 4LX0A 4ZDKA 1EX7A 4JS0A 3QKTA 2W6IA 1KDTA 1BMFA 1PUIA 1XMSA 3NHAA 2JLUA 2A5JA 4HZIA 2ZAMA 1HYQA 2W6JD 1CR2A 3NH6A 4ZCIA 1A7JA 1Z6YA 4V0MA 5IDVA 1ESMA 5C1BA 1VIYA 1TTTA 1GITA 1JALA 4OHYA 1YR7A 1E0JA 1U98A 2FZLA 1II9A 1GSIA 2QGNA 1DE0A 3LX8A 4IFEA 1LY1A 4AK9A 3K70D 1II8A 1M7GA 4LDJA 4FKDA 2EWWA 2WIAA 3SN6A 3QEOA 4P31A 2NQ2C 3DOFA 3OEHA 1CIPA 3X2SA 4K8OA 4NTZA 2X2EA 2KWIA 2OILA 2PT7A 1P9RA 3U7FB 2W00A 1RRPA 4ZIRA 4YXWA 1N0UA 5FUVA 4D6PA 5FOVA 2OCBA 1YHNA 5EXXA 4B47A 3KY9A 3AKYA 3BB3A 3SHFA 1GFIA 3IEUA 3H0KA 3I5XA 2PJZA 2ZVQX 4XSGA 4AWXA 2A2ZA 2RHMA 3FGNA 2OLKA 4M9SA 1D9XA 3C15C 1KIMA 3LW8A 3UGLA 1GILA 4OKSA 3A37A 2V3CC 3DL0A 5GADl 4JVMA 4XOIA 2ZYWX 2XZPA 4NCNA 2VF7A 4PC6A 3SNHA 821PA 3WYGA 3ZH9B 2R6DA 1MT0A 1RJ9B 1SXJD 4B3FX 1MH1A 2YINC 1YZNA 3NBXX 4GSYA 2XB2A 4M9QA 4QRHA 2W0MA 2YV5A 3ZIAD 2V1UA 2FE4A 1GDDA 4WBSA 3KKMA 5GJWC 1GZSA 4LJ5A 4EJSB 2ZUDA 3Q8XB 1ZD9A 1KO5A 2P5TB 5F2EA 4DLWA 1QHGA 2BHRA 2ERXA 1NBME 2WOJA 1S96A 1YVDA 4JBXA 2PZEA 1VYTA 5UKDA 2HUPA 3MJHA 4URVR 3TLXA 2O8BB 4QGHA 5EJEA 1ZAKA 3BC1A 4MUAA 2D62A 1H8ED 2QRZA 2AXNA 4CEHA 4ESVA 1CR4A 4BASA 2OFXA 1Z3IX 1RW4A 4OK6A 1G4AE 3A1UA 2KE5A 4XWKA 3SJAA 2JLVA 3CWQA 1KMHA 2JLSA 4MH0R 2XGJA 2O0KA 1DAEA 2RHDA 2XNSA 4P4TA 1JECA 3OAAD 4JYBA 4S35A 3SEAA 4ZKEA 4ITRC 1ZW6A 4CYMA 4BLRA 1W2HA 4QOSA 1ELOA 5BWMA 2CE7A 3TUJC 1Z6AA 3B1XA 3IDQA 3PUYA 4PSKA 3VNVA 3WNCA 4JLKA 5JI3E 3TR5A 1BH2A 1QHHB 1S1MA 2HF9A 2QSYA 3PG5A 4YMWA 3TAHA 2FEOA 3WY9A 1E2QA 2WV9A 3WYFA 2QMUA 4OQNA 3OIYA 2J0VA 4QGAA 4B75A 1XPRA 5GJCA 4P33A 3RSLA 2YC2C 1G8HA 4DT1A 4B2LA 4JIMA 4RVCA 3HU2A 5DN6D 3BH7A 1CF4A 2GA8A 2F43B 4DSUA 1NY5A 5EUQB 2FFBA 3IIMA 2ZRAA 1BO6A 5BN5A 2WJJA 1CR0A 1T0JB 2A30A 2GBLC 2W58A 4KAXA 4X8MA 3BGWA 1J90A 3ZVRA 1Q1EA 1FAQA 1KDPA 4HDQB 4NHOA 4PSVA 1XMJA 2MSEB 3T1VA 5M04A 1F5NA 2OHFA 2NTYC 3ND9A 4EPVA 1ZC4A 2GWHA 3ADKA 3MCAA 4LV6A 3PXGA 1JAHA 4TTPA 3REGA 3GLFE 3LX5A 1U8AA 1IBRA 1U8YA 4D80A 4UXIA 4WW0A 4ZKDA 3UMRA 2ZRIA 1N6PA 2ZUCA 4W7SA 4AY2A 4EFMA 3LVRE 1P72A 3AF2A 1E32A 3LNCA 1KDOA 2VSXA 4PAOA 2NPIA 2VSOA 5D3MA 4LPSA 4OQLA 2BIFA 2VYFA 1OHHA 5FH9A 1ZM4A 3HR7A 3NC0C 5EZ6B 3QNUA 4FCTA 5G53C 2H1LA 2A78A 3QKRA 4AYTA 1BS1A 4A0GA 5AUPB 3TUIC 4Q5IA 2C03A 2B8WA 2QORA 3SS8A 1NIJA 3M0EA 4LSGA 2QGZA 3NBFA 3AUYA 3ZVLA 3ZVMA 2HEIA 4QNRA 4HAYA 3NKVA 1HE8B 1SVWA 4FIDA 3K0EA 3HU1A 1II8B 2CDNA 5J40A 2CHGA 4GOKA 3HU3A 1ZVQA 3W5JA 2OBNA 3KTAA 4PHFA 3CLVA 2ZI9A 5H8WA 1XTSA 1R10A 3LV8A 5B58C 2ANBA 1XJ0A 5D3QA 4B6FA 4PQFA 4LHZA 1IM2A 4C0BA 4DT1B 3BJIC 2WHXA 2ORWA 3RAPR 2XNDD 1HT2E 2A5FA 3K70C 1TPZA 1UKYA 2HCJB 4GBMA 1F6BA 2DWOA 4HLDA 2GDJA 4M21A 1XEXB 5EE0A 5KOYA 3KQNA 1E1QD 4P4UA 1GRQA 4PC7A 1TQ2A 4DSOA 1UBCA 3UWOA 3CF6R 5KNDA 1RJ9A 3LLMA 3FVQA 2FFQA 1ZJ6A 2YZ2A 4BLPA 4NYJQ 2W2TA 1W5TA 2W2XA 2ZI3A 2H7VA 1LS1A 3KJHA 3ZGXA 4S2EA 4XTCS 1IXRC 5AR1A 4RFVA 2GEUA 4US2R 3U44B 2GNOA 2OEPA 3W3ZB 3B9PA 2RGEA 3AVOA 4EFNA 1KY3A 3QKSA 4C0KA 2XSZA 1Y63A 4RKEA 5KHOC 2ZSEA 4PPNA 1II0A 4AKIA 2GCOA 2ODWA 4OHWA 3O8RA 3FHTA 4TQ9A 2ZSAA 1UADA 4TMKA 4YDSA 2VO1A 4MDEA 4C4PA 2GCPA 3AVYA 2ONJA 3CPEA 1CU1A 3AF0A 3MLEA 4LGMA 3OIWA 1L7VC 1GKIA 4V0NA 4AURA 1DO2A 4FXPA 2BMJA 2D7CA 5DH9A 3FHCB 5L3QB 3VR3A 3K1JA 2QRNA 5DYGA 5B64A 1VG1A 3FB4A 4BZPA 1PUJA 3A36A 2WWGA 2PT5A 5TVKA 2ZE8A 3CZPA 2JA1A 5SZKB 2KBFA 2CCJA 4U00A 3T34A 3SQXA 3U2QA 4URZR 1NJFA 4B34A 3IGFA 1Q3TA 5HKKD 4BLSA 1P62B 3TE6A 1E99A 3VU9B 3RSOA 1YRAA 4ABYA 2JIZD 1SVKA 4V0LA 1ZBDA 1G3MA 1ZINA 2DFNA 2SHKA 4ILEA 2ENZA 2C78A 1E2DA 4Z1MA 1E1RA 4Q48A 4LBVA 2QPAA 1L4YA 2F1IA 2IYRA 3A4NA 2ZYVX 5FTNA 1DBSA 2CJWA 5AUNB 2ZE7A 4EPRA 4OQXA 3G5UA 1JR3A 4FMDB 5FBQB 4E09A 2W0SA 5KNCA 1FARA 4QHYA 1Z28A 3PR1A 2Q0HA 1UEJA 1R0XA 1X8JA 3NWJA 1UF9A 1IN7A 4HZUA 1KNXA 1RYHA 1IOZA 1G3RA 4X8LA 4LI0A 4DUGD 4RJLA 3ZQJA 5JI2E 4LBZA 1JJ7A 1M74A 4CGZA 3PV0A 2P6RA 1AS2A 4U7DA 2OXRA 3JVVA 3W6NA 1E9AA 3QENA 4QBIA 1XB2A 1XP8A 1YZGA 2WWXA 3AP2A 4M1YA 1R6BX 5BW8A 1IXSB 4U5XA 1XU4A 1YZQA 2ZS8A 4KSBA 2CK3D 3TH5A 1FZQA 1KI8A 1GRNA 4OHXA 2AR7A 1GWNA 3FHOA 3GJ8A 3PEWA 3W8RA 2QM8A 2BMEA 1SVSA 2HDNB 1XFAA 2G83A 2WSSA 5D3MB 1WA5A 3F8TA 4EIWA 4Y0AA 3RLFA 1E2MA 4Q9JA 1R0WA 4LJ8A 2BWJA 2O0JA 3WBJA 4D4JA 1K6MA 4URXR 3I1FA 1R79A 2NO7A 3CKLA 4Q18A 4A2QA 4FCWA 2J0UA 1IN6A 4JJKA 1XZQA 1B0UA 1TL7C 2OV2A 2W6ID 3L0IB 3TAUA 3R8CA 2DFLA 2E87A 4BRUA 3ZDQA 1G64A 2C8VA 2FPKA 4FMCF 3EPHA 1OFUX 3NC1C 2ZRGA 2F1RA 4WXPA 4LC1A 3P27A 4D26A 2D06A 4LZZA 4V02A 1ZU4A 4HAXA 4JSYA 1FTNA 1QZXA 4B73A 3QG5A 1RIFA 2IEYA 1YJ5A 1E9DA 3LAWA 4ASUD 4B33A 3KQUA 1E9RA 4DC9A 4ZIRB 3SOPA 4OK3A 2R65A 3PUZA 3ND8A 2FGKA 3UG6A 2GCNA 1KSJA 1KOFA 1P9WA 1CLUA 2GESA 1PTQA 3DZ8A 5G40A 5JJIA 3AP3A 1NKSA 1JJVA 1OB2A 1R8SA 1VMAA 4IW3B 2F43A 1E79A 1UBGA 4L5BA 3W90A 5ELXA 2GZHA 3KDSE 2V55B 2VF8A 1G4UR 2ZJ5A 2P2LA 3U60B 2RGDA 3GJXC 3KB1A 4MRPA 1VCIA 3R8FA 2JJ1A 5FOXA 2CLDX 3CWZA 1Q21A 1F2TA 2GAAA 3CX6A 2GXUA 2J45A 1YZTA 1UJ2A 2AXPA 1KNQA 2YWHA 2J5XA 3K9LA 1MO6A 1ESNA 3FMOB 1KI3A 4BFUA 1E2FA 5HPYB 5DNYB 3C41J 3U3KA 3BH6A 4R98A 1ZYUA 1Z0FA 4NCJA 2FSIA 1GG2A 4EPTA 1T4GA 2OCPA 1XWIA 2P67A 3EW9A 3VR1A 1W36D 5FBRB 3CIOA 5AJYA 5LB2A 3GEEA 2CL6X 5SZJA 5FTLA 4C7OB 3UGIA 4CDGA 5IF9A 5DGXA 1SGWA 2I1VB 3SZRA 1P2VA 2VHTA 3RWMB 2DB6A 1AGPA 1XD9A 3X1XA 421PA 2CL7X 4XVUA 1A2BA 2DR3A 2J7PA 5KPJA 3K9HA 2ZJ2A 2NIPA 4ZDIA 4QFMA 1FP7A 3NEJA 4FD2A 4L4UA 4M9ZA 3U3OA 1XNJA 1XTRA 3LBHA 1DAKA 2JASA 4A8JC 1P61B 1ZUNB 4L9SA 3V4RA 1ZIPA 2H16A 2F55A 1I4TD 1XPUA 3IQXA 3QVUA 1JAIA 1R2QA 3LA6A 3OFND 4UJ3A 5FTMA 4DRZA 1QHIA 3PCRB 3W6OA 4KJZA 4Q7LA 4TSFA 3AVPA 2AD5A 3VKGA 1Z5ZA 2V8OA 1T0HB 1XA6A 4JLPA 3UIEA 3MFYA 4KFSA 1DTSA 1VG0B 3I62A 2VEDA 2VQSA 1MRSA 5J5CA 1GOTA 2NO9A 1XX6A 4TL6A 1T9HA 1FMJA 2YUUA 5EXSA 2YOFA 4NYJR 1N5IA 2AX4A 1P60A 1T8TA 2JLRA 3T5GA 4D81A 2OFOA 1J2JA 2NO6A 2ZM5A 1J99A 2J9RA 3ADCA 3CPJB 3ZZUA 4EQ6A 1L4UA 2ZI7A 4NKRA 1RKBA 3IQWA 3L82B 2IA5A 2HCBA 4URWR 4KITB 3ASZA 3EPKA 3HYRA 4YMSA 5CJPA 2C5LA 2EFDB 2WJYA 5JSZB 5DN6A 5EE3A 3I8XA 4KFUA 1BKDR 4ZI3A 2XJ4A 4IJMA 5JZVA 1TF5A 3GJ0A 3K8YA 2VPPA 1YE8A 2A7QA 5FL3A 3QSYA 3TW8B 4DKXA 2ZSFA 4FMBB 3GLIE 2YYZA 1W49A 3D31A 4V03A 2R62A 4PAMA 5CLLA 5H1YA 3I8SA 1WB9A 4AKHA 3SDZA 5DISB 3SBEA 3BB4A 1E98A 3L8ZA 2GCOB 2IYXA 4TT3D 3OE7A 1E9FA 1DAHA 1I2MA 5AJWA 3R7WB 1OXVA 2QL6A 5TY0A 4B48A 3GEHA 3EA5A 5L8VA 1QVRA 4L9MA 4DEYA 5JJKA 2OM2A 4TL8A 1N6KA 3RNLA 1NMXA 4R71A 2AWNA 2IF2A 1S8FA 3WNDA 4A2WA 4KHZA 5C46F 1I4DD 2OLJA 4DVGA 1Z8FA 2J0UB 1Z2CA 2QT0A 5KDLA 1AIPA 1FX0B 5KSPA 3TW4A 3W8NA 1OV4A 3TJZA 4JLAA 5JBQA 3WMEA 2C95A 3P4YA 4LHVA 3SI7A 2IYZA 3SFZA 3EPLA 2Q9CA 1P73A 2G0NA 1ZM3A 1UPTA 4HLQB 2CVFA 4ZCMA 4W9MC 3MSXA 1IHUA 2PMKA 1R0ZA 3MGCA 2IWRA 2QBYA 2OAP1 1CP2A 4MGYR 2B92A 1NN1A 5H68A 121PA 1VCMA 2RGGA 4PQYA 4CZ2A 2GK7A 4BEBA 1KO1A 4J0QA 4Q9IA 4D2IA 2HYIC 1OYWA 2JDID 2MMGA 1W4AA 2EFHB 1AKYA 4ZO4A 1E96A 2O8DB 4LYHA 1VYVA 3Q7QA 2IF0A 1G6HA 3PENA 1SXJC 2ZETA 4WA7A 2QEQA 1KI2A 1KMQA 3NBYC 1XEXA 1T5LA 4JSTA 1G18A 1FQKA 2P6UA 4GDFA 1E2KA 4B6EA 3RRMA 5KYKA 1WBBA 3CX8A 2ZREA 2GAOA 3K0CC 1XD2B 3KUDA 3CR7A 4G01B 5CM8B 3AF3A 1COWA 5C4GB 4PC3A 4E07A 5FPSA 1H8EA 3R9IA 2G88A 2HT6A 2QAGC 2OESA 4HB2A 4TTQA 1WP9A 1EG7A 4C7OA 3FKSA 2Y8EA 2QAGB 2VHUA 1VECA 4GMXA 3Q3JB 1GKUB 4DDWA 4DCVA 1XEWY 1WQ1R 3TGPA 5FUXA 1U9IC 1U81A 4LJ4A 2QM7A 3TRFA 1TMKA 2IYUA 1ZD8A 1CKEA 2X2FA 1ZM2A 3LWNA 2HLDA 1SVMA 4A6XA 5TV2A 2KB0A 2VSFA 4PX9A 4C30A 2O8CA 1P2SA 3CNOA 1SZPA 1X1SA 3FFBA 2ZE6A 3LLUA 5AUQA 2FNAA 2ZXUA 2YOGA 3FTQA 1F2UA 1YR8A 3AVQA 2H17A 4IXMA 1IJEA 3ZVNA 4TZ0A 4I81A 2P6NA 4C0JA 2CE2X 3PUXA 1GAJA 2BC9A 3O8CA 3THYA 2GK6A 1NG9A 4TQUS 2QN6A 2QY9A 2ZJOA 4TYNA 3QF4A 3GLIA 1AQYA 3DO6A 1G6OA 1LVGA 4KI0A 3GJ5A 1EESA 2O8DA 1VHTA 4PO9A 1BIFA 2QAJA 2ZR0A 3AB3A 1D5CA 3QIAA 1ZM7A 4E03A 1UDWA 3NG1A 3IBYA 4CIDA 1IAQA 3E1SA 2B6HA 5HZKA 4AI6A 2MMCA 1PLKA 3IPXA 4OHZA 1US8B 4Q4LA 5K8IA 4JBWA 4DLTA 4HAVA 2WTUA 4QL3A 1G21E 3G82C 4TMWA 4Q03A 3Q7PA 3L43A 4XWOA 3AGQA 4B44A 3H1TA 1RFHA 5F98A 4LV8B 1U0JA 5DO9A 1GTVA 3NVAA 4PPQA 5JECA 2XJ9A 3LD9A 4LJ7A 1GM5A 4YMUA 3W3AA 1ANKA 4H1UA 4D0GA 1G3IA 1N5KA 3AGPA 4LBYA 2FNFX 3BE4A 2GJ9A 1IONA 1OPXA 3DOEA 3IHWA 3LVQE 2QAGA 1KKMA 2WOOA 1G7RA 1CJTC 2PL3A 3MWYW 2ZUBA 3RWOA 2GJ8A 4L8GA 2XTZA 3RS2A 3CRQA 3PITA 4Q7JB 1G5RA 2VHCA 4TL9A 1T3HA 4MUBA 2H8KA 2BMDA 2ZE5A 4Y0VA 4POAA 5B30A 3EX7C 2PH1A 1J8MF 2ASEA 1M6NA 1XEWX 4IXNA 1KBEA 4DSTA 2QG6A 1PZNA 1NBMA 2ZJZA 4ERNA 2YOHA 1ZUIA 4B76A 2GJSA 3U7EB 3TSOA 1SQ5A 5CYOA 2FSFA 1E1RD 3WBKA 4TMTA 3THYB 1E69A 1CEEA 2NGRA 3BB1A 5GJBA 2WICA 3CXLA 3BK7A 4PZZA 2UKDA 4PTLA 3RS7A 3X1YA 2GZDA 2QMHA 5JFGA 4QJ5A 3CZQA 4A1FA 3QBVA 3VQTA 5JCPA 5EP2A 2R6CA 4LRWA 2ZAOA 1Z0JA 4JLOA 1QF9A 2PBRA 2GXQA 3LFUA 3BIFA 4M1OA 5F9HA 4KYIB 4MKFA 4GPTA 3NTUA 1V43A 2LCFA 2G77B 2IHYA 5L3SA 4PC2A 2AK3A 2DCUA 2GXAA 4DCSA 3H4MA 2N46A 1XEFA 1SVLA 2CHVA 3GEIA 3K53A 4NPHA 4RZ3A 1R5NA 3W34A 3ZS9A 3I92A 5DI9A 4GOJA 3QF7A 1XTIA 1Y3AA 3QXXA 4H9GA 2O8FB 2IYLD 2CNWA 2G1KA 3P26A 4MA4A 4Z54A 221PA 1RC8A 2EQBA 1W36B 3EZFA 4LV5B 2F3RA 5JCZA 5JHGB 4IDQA 4CRWB 2XZOA 1VHLA 4G1UC 4RZUA 1OH7A 2CBZA 1LFDB 1Z6XA 3GLGA 1PLJA 1U99A 4CEIA 4PXAA 2FH5B 1TQ4A 3LW7A 4ZDJA 2RGNA 3BFKA 5J47A 1DAFA 2IX3A 3UGDA 4RFSA 1RYFA 2YHSA 2VHQA 2FEMA 3ETLA 2B8TA 3TMKA 1SKQA 1UBFA 2O8BA 4K81B 4NZYA 2O5VA 3SFVA 5IHPA 4P0TA 1TUEA 1UKVY 5CDFE 4NYMR 1VKJA 1LS6A 1VDZA 2J0SA 5DSZA 3Q5EA 4JKIA 2GF9A 2Q21A 1P75A 4TLEA 5B57C 2WJHA 2JLXA 3ECCA 4HLCA 4D0LB 5FBVB 2VL7A 4EUNA 4NCHA 1MRNA 5JS8A 1Q57A 5CK5A 3B2EA 4FMDF 1OW3B 1XD8A 4G5OA 4KFTA 4TL7A 4Z1MD 4TTRA 1A82A 2DPXA 3AVVA 3GLHB 3KKPA 1OT3A 2EU8A 4QHTA 4AG5A 2I4IA 4RY2A 4XWAA 1FOEB 4NBSA 4BFWA 4F91B 2PLRA 1TNDA 3EAQA 1N5JA 1SKYE 1G20E 3B13B 1HEIA 2E1RA 2W83A 4LHXA 3DEFA 3EWSA 2ZSDA 1NRJB 4HI0E 2LKDA 4LCBA 4DUGA 1UKZA 1KGDA 1N6RA 2IBMA 3C5CA 1P5ZB 4LUCA 3DM9B 2J59A 5DHAA 1HQCA 4TQAA 2GVDC 4NH0A 2JLZA 4W5JA 1Z07A 4MYUA 3RS4A 3WNBA 1NSTA 4DSNA 1M7BA 5CIQA 2O8EA 3A1WA 4FMCB 4HLUA 4A2PA 1WMSA 4JLNA 2WM9B 4NMMA 4YONB 2WVJA 2VRWB 1A2KC 3NHBA 4TYYA 2OZEA 3KUCA 2AD1A 2GILA 3ZZ0A 5JWOA 2IYVA 3BD9A 1OKKD 2F1HA 3DMDA 5TB5A 4G3XA 3KXKA 1QVAA 2REOA 4MGIR 5EE9A 1F48A 4II7A 3BOSA 1N6OA 1FFHA 1E4YA 1XZPA 4FINA 4A82A 2DWQA 2F9LA 3R7WA 2VLIA 2XOKA 3WRYC 3VR6A 3FFAA 1T3LA 3NIBA 4X8HA 3SJBA 3BAFA 2D3WA 5EP4A 4HUQB 1GNPA 3QPUA 2ODNA 3IPYA 4QM6A 1FL9A 4GZMA 1OXTA 2OBMA 4DLUA 4XVQA 3TKLA 1YR9A 2EFEB 3KXIA 2ONKA 4KSCA 2QP3A 1EFRD 3THWB 1YZKA 1JQLB 2GF0A 2YNMA 4RKFA 1ZP6A 2G6BA 3H84A 4KV9A 3ZS8A 4FWTA 5E3HA 4BLOA 1OXXK 1VPLA 1YU9A 2AWOA 5J4HA 3PUVA 2WMNB 4Q1CA 3AVWA 1FQJA 1Q1QA 1N6IA 4JT4A 2C9YA 1JR3D 4RD2A 5KSZA 2QQ0A 1EWQA 4EPYA 2PEYA 2FU5C 2BBSA 4N0EA 4F92B 2JGNA 4XTRA 2CL0X 3ZYCA 2ZRFA 3C4JA 2HT1A 3GFTA 1HE1C 5KO2A 2J3EA 3KFVA 1XTJA 4L9WA 4DDTA 1ZM9A 4EFLA 2RAPA 4OI0A 1JNYA 4YMTA 1GNRA 3EXAA 4W5HA 3NH9A 4DLSA 4BUJA 3GP8A 3T1TA 1GNQA 4LJ9A 4C0AC 2HV8A 3CRMA 3U5ZB 1SVIA 2XB4A 5EE5B 3GMTA 3LRPA 4RD6A 1VG8A 4GP7A 2C99A 1JEEA 4PAQA 4LPKA 4MRNA 3NDPA 1AA9A 1N6NA 4BQSA 2F1JA 1XDBA 4LJAA 4I4LA 2ZITA 1VIAA 1EFTA 4UXJA 4Q9HA 3W9YA 2F3TA 5JRZA 1JEDA 1KHTA 1UM8A 3T12A 1S9DA 1OH5A 3PVSA 1NN5A 3QKSB 4JLMA 3SBDA 2OO7A 3B9QA 3LO5A 4MYHA 2G9NA 3WHKA 4O0MA 2ROWA 2OUKA 1U8ZA 4HB0A 2IWHA 1G5PA 1OH6A 2D7DA 4Q1AA 4EJSC 5GVSA 1RE0A 3B85A 2JLYA 3ASYA 1COWD 2NPFA 1ODFA 3B60A 3TR0A 1KK3A 2P0EA 3RABA 2FGJA 1TQDA 2QENA 4WXRA 3K9GA 1ZNWA 4C9BA 2BV3A 3FOZA 2R8RA 1FUKA 2IL1A 4TYQA 1OIWA 3JZMA 3LBNA 4Q21A 2EFCB 1SHZA 3JZAA 3N2IA 3OEEA 4K46A 4ZPXA 1UDXA 2RGBA 2ZJ8A 3L0OA 1RRFA 3UANA 4BFZA 1VCNA 3X1WA 4BFXA 2NO0A 2O8CB 2ANCA 1U0HC 1QG2A 5TMPA 4TYWA 4EAQA 3MWJA 4JLBA 1AN0A 1E0AA 1FNMA 2LKCA 3I32A 1NBMD 1Q0UA 4P3YA 1NY6A 3QUSA 2Z5FA 4WVFA 3UK6A 2H18A 3K9NA 3THXB 4TMZA 1UFQA 1KSGA 2X8AA 3F0TA 3FE2A 2OT3B 2QUZA 2RGNC 2J7KA 3VHLB 2NMVA 1ZCBA 1V5WA 3A1VA 4A4DA 3E5HA 3VX3A 4EDHA 4P4SA 1G7TA 4M1MA 4B71A 4TWZA 5BN3A 1AJEA 1W0JD 3KQKA 2ZEJA 3KX2A 2JJ1D 4AD8A 2WKRA 3M4YA 5AJZA 2KBEA 2MSCB 4F4CA 3O8BA 4YMVA 1H8HA 2BCJQ 1CTQA 5IK2A 3H86A 5JLJA 1ZD1A 3QXHA 3GLFB 1KO8A 1US8A 3KJGA 1CULC 2FV8A 3GD7A 3BXZA 4OYHA 4NU0A 3VR5A 4NP6A 2JLQA 3FKSD 4HAUA 5FPKA 1NJGA 3RS5A 2FSGA 2Q3MA 2Z6VA 3EZ9A 3HP1A 4XH9B 4GRAA 4IVRA 1J70A 1RPZA 3RC8A 1DAMA 1J8YF 1U90A 4N0DA 2V9PA 3EZ2A 2FFHA 1XTKA 2Q3HA 5KTYA 4HB4A 1DG1G 4FWIB 5CLQA 4X8OA 2ECKA 5JS7A 3CM0A 1JR3E 3BS4A 4Q4AA 5IT5A 4KXFB 4QXAA 4UKDA 1GVNB 3UXMA 1M2OB 1DARA 2GHIA 4HEJA 5E7IA 3ICEA 2V1XA 2A5YB 4OJKA 5AWFC 3EZ7A 2OG2A 5EUMA 1DG3A 3G0HA 2Q9AA 1CXZA 1Q1ZA 3MUFA 1G41A 1XXHE 2TMKA 2IS6A 6Q21A 1Z29A 4TSFD 1NNEA 2EFGA 5FR1A 4PO1A 3VTKA 4WZ6A 1W0KA 2JJ2D 4KODA 4US0R 5LD2C 4JBYA 2CEAA 3B1VA 3PUWA 3ADDA 4RCZA 3KQLA 2AFHE 3SYNA 4Z8XA 4B32A 2IS2A 1M1YE 1NF3A 2ZANA 1FUUA 4A0FA 2R6AA 2GJAA 2RGCA 4RZXA 4YQFA 5DE3A 5CITA 1GL7A 1KSHA 2G1JA 2WAYA 5CB8A 2IHBA 1I2DA 2I3BA 2Q3FA 4LJYA 3EG5A 2XX3A 3JVUA 1AS3A 3K0AB 4IKEA 3TBKA 2J41A 4TN1A 3AP1A 4YC7A 1KI4A 2R9VA 5JJLA 3X1DA 3AKDA 1R8QA 4IOKA 2GVZC 4Q1FA 1TADA 5CYPA 3QY0A 3MWLA 2G3YA 3I73A 4N3NA 4HZUB 1DAIA 1AM4D 4GFDA 5FBLB 4BLTA 1TBOA 2F7SA 4IDPA 2IYTA 4IFBA 4LHYA 4MGKR 1LF5A 1N6HA 4TLAA 1R4AA 3DMNA 2D2FA 4QC2A 1K5DA 1D6JA 1HQYE 2F9MA 2X1VA 2XITA 3B5JA 3OE7D 1ZUHA 3ZZTA 4AKGA 4FN5A 1J7KA 1WDTA 5FI0B 3LH5A 3DKVA 4JVNA 2VBCA 3U3JA 1NVXQ 1ZMXA 4NDZA 1TQ6A 2HXYA 2J7PD 2XXAB 3D3QA 1C9KA 4TYPA 4CEHB 4C3ZA 4PZYA 4OI2A 4HATA 3AUXA 4RD3A 2ZRNA 4V0ME 2BVNA 4C2TA 3P4XA 2ZJBA 3QXCA 2GBLA 4DCTA 1FX0A 2KJQA 2XOKD 1KMHB 1D2EA 4BE7B 1JXMA 4JYCA 4G5QA 2IW3A 4DCUA 1AZSC 4A8JB 1NG1A 1HY3A 3GLHE 1NKTA 1W44A 4KLZA 1S2MA 2WWFA 2BM0A 2VHJA 5CB6A 4B3GA 3THWA 3E70C 2ZSBA 2ZR7A 2IT1A 3DHWC 3N2EA 3VNUA 3GCGA 1YRBA 2QTFA 1RFLA 3O47A 4DEXA 5FUYA 5KSOA 2Q6TA 4BZQA 4B3CA 2CHQA 3OHMA 3KJEA 1LB1B 2RGAA 5EZ5A 1MO3A 3BERA 1RRCA 1A4RA 4BFTA 5KDOA 2WJVA 4LYJA 3L2OB 1DADA 5DI3A 2Q9BA 3UMSA 4DHEA 4DLVA 1CJMA 1DPFA 3RS0A 3OIUA 3HDTA 3PEVA 3K0AA 1KBFA 2D74A 3K0SA 1E2PA 1W1WA 1T3SA 5J4YA 2QTVB 4XJXA 5FTKA 4ACAA 4ZDWA 4PSAA 4MKHA 3UEYA 1TU4A 3TSWA 1HH4A 3N5CA 4G5RA 1H65A 3GLFA 4W5WA 1E2IA 5LPNA 1EXMA 1UBEA 1KZ7B 1S3GA 1KY2A 1S9HA 1WRBA 1XJQA 3QI2A 3RRYA 1KI9A 3WYAA 4B35A 1E2GA 3L8YA 4KBGA 1TBNA 1F2TB 1ZRHA 2EW1A 2ODBA 4KO8A 5CJ2A 3T06B 3VR2A 3HWSA 4IVQA 4US1R 3KJIA 1CR1A 3P1JA 3F5FA 4IOJA 3K70B 1GIAA 2JATA 3FDIA 1W4RA 3S1AA 3U4QB 1G7CA 2BOVA 4KVGA 4I1SA 1KAGA 4KCGA 4QBHA 1NVVR 1PV4A 4NONA 4R7ZA 5F9FA 2UZ3A 5AJVB 5P21A 2BDTA 3FWYA 2HXSA 1D8TA 2N1BA 4OHVA 3TSZA 5J4LA 5DHFA 4UNQA 2HLDD 4DLRA 1EFUA 2CCKA 4OK5A 3CUEF 5JHHB 3B8HA 2NZ8A 1P2TA 3CPHA 3OZXA 4QBFA 2QT1A 4TLCA 4LYFA 4QM7A 3SR0A 4DWJA 5SZHB 2QTHA 2A5DA 4R2IA 4M9XA 2EYQA 2BCGY 4HUQA 1MO4A 3VKHA 4UNRA 4C0HA 4CEJB 2J87A 3GJ7A 4F93B 3OEED 5EXPA 1TU3A 1XCPA 5SZIA 4O2RA 1Z6GA 1EK0A 3T61A 1Q12A 4PANA 4R9UC 3T15A 3SYLA 1UKEA 4JVSB 2QBYB 2BBTA 2HJVA 3J81k 2GTPA 2ENNA 3DVLA 5DI3B 1Q3HA 1Z63A 2QP9X 2ZYTX 2PZGA 4PPGA 2DBYA 5FTJA 3RYTC 4EPXA 4E5UA 1P6XA 1VCOA 1AKEA 4Q00A 4UXHA 3I5YA 2DYKA 1OE0A 1NP6A 4GT1A 1KJYA 1W47A 2IYSA 3U3MA 3B78A 2DHRA 4ZCLA 4DB4A 1W4BA 5LB4A 1IY2A 2E73A 2Z43A 5F3WB 4I99A 3ZD6A 1D2NA 5C18A 4DIEA 2EVWX 3QOFA 3GFOA 1KO7A 2QROA 3NXSA 1FP6A 4QJ4A 2OCYC 4PQRA 5K8TA 2F6RA 3R20A 3NEYA 5BQ5A 4EJSA 4BWYA 3MG9A 2ATVA 2AL7A 4B3BA 3EIQA 3C5HA 1Z2AA 4B6DA 1N25A 3QG1A 4KVAA 1B23P 2I1QA 2QI9C 5C2JB 4WIAA 2A5GA 2H92A 1JPJA 2X77A 4CW7A 1FW6A 3RANA 1RRGA 4R2HA 1JXOA 4N1AA 3QKRB 1M7HA 1GKYA 2HJGA 4AC9A 3B1WA 4BFYA 4NYIQ 2ZJYA 3QEJA 2QMEA 4JMPA 1E94E 4KFRA 3CRVA 5DYIA 4BRWA 3VHXA 2RH5A 4AYWA 3M1IA 2GRJA 1JR6A 1E6CA 1CRPA 2IK8A 1Z47A 5FL7A 4A92A 2JLWA 1CRQA 1PJRA 2D2EA 1Q44A 1DVRA 1XRJA 3PFIA 2DB3A 3AVXA 3RC3A 3DM5A 4JLVA 2W2VA 4WAUA 4XD7D 5AJXA 1OIXA 4OJQA 1ZC3A 2OXCA 4GOXA 2IS4A 3D8BA 5E4FA 4AG6A 4MDFA 3U61B 2WZQA 2Z4SA 1QHSA 1QHNA 3V00A 1XMIA 2CJWB 3MRSA 3B1YA 2Z4RA 3C14C 4BZXA 4A6PA 3QXJA 4Q9LA 4B3XA 4OBEA 1G8PA 5FOWA 4PHHA 2GKSA 3BORA 3F3YA 1NMYA 2QU8A 1G1MA 1GP2A 4B2IA 5L3SB 4Q1DA 5IRCD 1G5TA 2CNWD 3LQRA 2WMOB 3CNLA 1ZNXA 2QZ4A 4D4LA 2PLFA 4FI3C 2FPLA 4Q1BA 4EQ6B 5EE1A 4I1UA 4UNPA 4ZI2A 1NVUQ 5JWHA 3N70A 2R6FA 1KJWA 3SHWA 4GZLA 5JWRA 1LW7A 1NL3A 4TLDA 1OIVA 3TQFA 5JSZA 5FFMA 2AN9A 2OBLA 2WSMA 1E9CA 4DLZA 1XD2A 5KUTA 2ELIA 1FTSA 1GUAA 5FPHA 1TEXA 2DFKB 1SXJA 1R0YA 3VKWA 1BYIA 4HB3A 3CNNA 2V6IA 1IXZA 1G3UA 1TEVA 1RZ3A 4PPFA 3DKPA 3WMGA 3EPJA 2BJWA 2IUTA 4MITA 8OHMA 2WWWA 3KQHA 4A0RA 5AUOB 4Q4AB 5G41A 5EP1A 3EIHA 4IRUB 3QBTA 2R6GA 4HAWA 5TARA 1MR3F 4Q7MB 4ACBA 1OKKA 1MO5A 4DIDA 1E2LA 2GJKA 2FZ4A 5L3QA 3HPQA 2BKUA 1WF3A 4V0OA 2RMKA 3CBQA 2WWYA 1OHHD 2WKQA 4WZAE 3OEHD 4IEIA 1AZTA 3B7GA 4CT4B 1BOFA 1ZNZA 3CW2A 3DPUA 4IEEA 1TAGA 2PCJA 4ON9A 3R9WA 5EQTA 1EFCA 1I4LD 2NOAA 3TNFA 3TK1A 1M8PA 2NO1A 3GLHA 2FMXA 1IY0A 3U7GA 2HYDA 3EWAA 2W6JA 5FI1B 3B6EA 2OFWA 4Q4HA 1DS6A 3O8DA 2XTNA 3LY5A 5BYKA 2C98A 4B43A 3E2IA 3PQCA 2FA9A 4QJ3A 2CVHA 2QPTA 5IK2D 3L0SA 1EFRA 1R5BA 1IN5A 3A1TA 2O52A 3WRXC 1NN0A 4DB2A 4OI1A 4IDNA 1TX4B 5KU1A 2FX3A 3TUZC 4URYR 4M53A 4PO8A 4OL0A 4JT2A 2C9OA 3CF2A 2KI5A 3KL4A 4HYYA 3FMIA 2IYWA 2V54A 2V7QA 2ZR9A 3VAAA 2O8EB 2ZVPX 3RDPA 1E9SA 4B2PA 4E22A 1SKYB 3KKNA 4HSEA 1TF7A 2CCGA 2YWFA 4NCKA 4M2LA 2ZRLA 2C96A 2ZRKA 4IDHA 1DEKA 4GP6A 5BYJA 1IN4A 4CEIB 3BFXA 1CJUC 3NBZC 3OIVA 1KI7A 1O87A 3A1SA 4RD1A 2JEOA 2VP9A 2OCAA 2K5UA 4ZV4A 1XPOA 3BRWD 4M1KA 4ESHA 3K0FA 3GQBA 1VYUA 1TUIA 3RRZA 2XXAA 1OSNA 4YDHB 3OAAA 1XTQA 4Z8YA 5C4MA 3PJRA 1E3MA 5K8LA 1Q1BA 1VTKA 4Q66C 2VIIA 2XZLA 4QNMA 1MKYA 4BLQA 3MMPA 5HR5A 4MRVA 2FDCA 1M34E 1XCMA 3FKQA 4URUR 1KK0A 3MD0A 1W36C 4NYIR 2WPDD 4PR0A 3SQWA 3SJZA 4BECA 5KDDA 4CVNA 2FWRA 4MQBA 1KK2A 4A8JA 4M1WA 4MRRA 5BN4A 3H2YA 1OLOA 3WP0A 2WJGA 4DLYA 3DDCA 3M6AA 5DIFA 1ZU5A 5BXQC 2GZAA 3SJCA 1SVOA 4LHWA 2YWGA 3CONA 4LYAA 4LBWA 1S1CA 1P7CA 4JKYA 1GRRA 3QF4B 2ODEA 1S0UA 1H8HD 1WXQA 2WWHA 2V4ZA 5AK0A 3EZ6A 3K09A 3T1QA 3VR4A 3WP1B 2ZRMA 1WBDA 3V9PA 1P2UA 2J46A 4TMXA 2ZIAA 1F3OA 4JLDA 2GVIA 4IVPA 2QE7A 2A3RA 1QG4A 2HF8A 4B3DA 5G3YA 1KK1A 2GETA 2ZU6A 2XNDA 4MKIA 2CMKA 1XCGB 4UNNA 4JJZA 5J4VA 1Z0DA 1ZCAA 3EC1A 3U6KA 4Q47A 4RCYA 2AFIE 5FOSA 2VP6A 1QDEA 1D9ZA 1LV7A 3Q72A 1E1QA 4PHTA 2C2HA 1N2CE 4RD4A 1X8KA 2VP5A 1N0VC 3B1ZA 4Q19A 1GL9B 3A8TA 3IIJA 2VA8A 1DO0A 4GMDA 3FMPB 3QE0A 1G291 2FF7A 3IHLA 3S1AB 4A0HA 2FN4A 3ICQB 3U44A 1CBUA 2OSBA 3C7KA 3UEJA 3GLGB 4QGFA 4KYUA 2Z83A 1UEIA 4C0QC 2JJ8A 1IJFA 3IO3A 1G19A 1OH8A 521PA 3L0PA 3SE0A 1X6VA 1LNZA 3W6PA 4HAZA 4FW9A 3HR8A 2FOLA 3C8UA 5LDDC 2H57A 2ZI4A 2WSSD 1ZNYA 5K8UA 2A9KA 1P3JA 1IQPA 2BM1A 3GJ6A 2XTMA 4D25A 4HDCA 4D82A 2AK2A 2Z0MA 2IYYA 4LK2A 1ONBA 4F4JA 4HLUC 3QJYA 1UAAA 2J0QA 1NN3A 1T6NA 3NDBB 1K8RA 1W46A 2REXB 2NZJA 4YXWD 1PLLA 1NSFA 1IY1A 1G17A 4V0KA 4NE2A 3IUYA 2PCLA 2ZI5A 5FL7D 5HCNA 3GJ3A 3GFPA 3IKJA 3PIRA 2UZIR 3CF0A 4O2LA 1JPNA 2CLSA 1W0JA 5DLQC 3GLGE 2G0TA 2IS1A 2ZS7A 3DZDA 4AKEA 2VP4A 4UQOA 4TLBA 1W0KD 2JJ2A 3KXLA 2D4HA 1KI1A 2L0XA 3AF1A 2ZJAA 4OI4A 5KNBA 5HZHA 2BEKA 2VH5R 1KZGB 1Z6TA 4Q4JB 5FPYA 4RSGA 1IN8A 1OFHA 1Q20A 1G8YA 2AHOA 2FFAA 3CRW1 1BYUA 1KI6B 3FPAA 3WMFA 3ZIAA 1Y8FA 4EKDA 4A15A 5JEDA 1E2NA 1OYYA 2FJUA 4LC0A 3AEZA 2BBOA 5JEEA 2YKGA 2FG5A 4GL2A 3UPUA 2DY1A 2O8FA 2ZRCA 3EASA 3A4MA 3QXSA 5LBIA 4AIIA 2VRWA 5L3VA 1WCV1 3BFVA 4OQFA 3EARA 3I72A 1HA3A 2QSZA 3EIEA 3IILA 4C0LA 1OF1A 2AKYA 2REBA 1SXJB 2DWPA 2RKOA 3EA0A 4P32A 1X8LA 1YZUA 5KPDA 3R9XA 3KFXA 3IO5A 4IOLA 1FMLA 1GL6A 1Z0AA 3MJRA 1X1RA 3HJNA 5HE8A 3K0FB 1XXHA 1BMFD 4JL5A 4MYCA 3IEVA 1VG9B 4UJ5A 2H5EA 1Q22A 4IDOA 3ADBA 1OXSC 3GPLA 1K5GA 2ERYA 2CK3A 3K0CA 1C1YA 1NI3A 1C4OA 1Z22A 2B7BA 4KBFA 4PC1A 1A1VA 3LDAA 5TXGA 5FPTA 4TMVA 1U2RA 2JAQA 5H70A 1N3BA 5A0FA 1QBKC 1F2UB 2P65A 1KYIA 1T8UA 1KO4A 3REFA 4DLXA 4DBLC 1PTRA 2ZRBA 3AKCA 3HPRA 4BEJA 1KKLA 2ATXA 2NG1A 4DDUA 2BJVA 1RVDA 2FPMA 1U0LA 5A4JA 3CH5A 1OJLA 3OF5A 2DFTA 3BWDD 4BGDA 3CX7A 5FOUA 1YR6A 2ZRJA 4Q4HB 4JL8A 1QHHA 1SXJE 5KSYA 3OFNA 4BFSA 3C16C 1W4CA 2B21A 1XBTA 2WIBA 3B82A 1X86B 4MGZR 4NL4H 4JVLA 4MYTA 2ZRDA 3LBIA 4P4SB 3EC2A 1LTQA 5JRJA 1S4QA 2KSQA 3MWKA 5E7MA 1HTWA 2PMDA 1NIPA 1HT1E 1L2TA 2IXEA 1YZLA 1FNNA 2JIZA 3CH4B 3UWKA 4BPBA 4D4KA 1R7RA 2ZU0C 4GNKA 2ZRHA 2VTKA 4WOPA 1P4SA 3AVTA 4RZ2A 4O3MA 2OAQ1 3FYHA 2CXXA 1FPMA 1SHKA 5CIWA 4ARZA 4DCNA 3D6TB 5FR2A 2YVUA 3TIFA 1PVOA 4B74A 1AGRA 2EWVA 2IYQA 3GJ4A 3A58B 3BBPA 1S3SA 1N5LA 1ETUA 4QHSA 3QQ5A 2WJIA 1E4VA 1G8GA 2PZFA 1MABB
chains in the Genus database with same CATH superfamily
1NLFA 3D7MA 1HURA 2QP4A 3X1DA 5BT8A 2BF7A 5BSUA 1QHYA 1S20A 2YVAA 5JYCA 1DBIA 5KHLB 2APJA 3GNSA 4PBRA 4KX3A 1E5XA 1MDFA 2R7MA 2RJOA 4XPIA 1H4QA 1IZ0A 3PRKE 4II3A 3AY3A 1NYRA 2VP0A 3BD6A 4OQ4A 1NM5C 2D13A 2X58A 3STHA 3EIXA 1JU9A 2V6JA 3KOZA 1B1AA 1YKSA 4HYEA 2J8ZA 4C7BA 2MSDB 1LPOA 1ZI9A 4HFNA 4Q01A 5AK3A 3HYTA 3QVKA 4LK3A 4PZLA 5C8XA 2WIFA 3PE4A 1GG5A 4HNAB 4CN8A 4QUHA 3AOEA 4HDKB 5EP3A 4ARIA 1H2ZA 1EK2A 4RF4A 1N2JA 1U0TA 1YONA 1L8QA 2QVYX 2ZJ6A 4OQYA 1ISGA 3H2JA 5THKA 4CF7A 1SCIA 4XWGA 4Q1EA 1N4AA 2C59A 3ZDDA 2O0HA 5LNK6 3BTOA 1QQBA 3ZN2A 1UPUA 4I4NA 1X80A 2YYYA 2AZDA 4EJ2A 1J22A 1TCBA 2WU4A 3DONA 1X39A 3H5RA 3CB4A 4Y8VA 3BT7A 1IWPB 3CRZA 5JALA 5DHQA 4RTMA 1OXKB 2YL2A 3H2SA 4MKGA 1KSFX 2QG9A 4OFWA 1OFVA 3K2IA 5TSDA 7YASA 5JD5A 2HIGA 3VDPA 3BAZA 3QELA 5JNTA 4R9RA 1W5BA 1ZKMA 4HG2A 1N2SA 3W04A 3WK7A 3U16A 1VSUA 1W5SA 2FN9A 4PM4A 3KDAA 2YC4C 2XTJA 4FFSA 3D4OA 4HS9A 5E95A 1UANA 1DOZA 2J30A 1FJGB 3FNRA 1XMVA 2J1LA 3U3RA 3IXLA 4X1KA 5I9NA 1P0QA 1QSGA 2JDIA 2XRYA 3WAJA 1MHTA 3A3YA 4WKCA 5KYGA 1T13A 5CFZA 3UM9A 2AOTA 1LUAA 4MQ5A 3T35A 2VBGA 4Q37A 5HBGA 5ES4B 4BFVA 3GFBA 1JVNA 1R0RE 3KC2A 1V26A 4B40A 3ICWA 3GFVA 3URMA 4MW2A 5GJVC 4C3VA 1KAOA 4UDOA 1VDMA 1Y5LA 2Y2VA 2PX3A 3AFNA 5EMMA 2ZQYA 5AKJA 5D5PA 4Q7KA 4QASA 4AYXA 3PUJA 1DBRA 1ZIOA 1YB6A 2A9RA 1THZA 1QIHA 4MA0A 1F60A 1BX0A 1G3QA 1MABA 2HQRA 3C5WP 4BMYA 2J4DA 2HU5A 4E32A 3EY4A 3PFBA 3L7AA 3EVCA 3SU8A 1Z4QA 4C05A 2PYZA 4KAAA 4C5CA 4TZ6A 2Z9CA 1TCAA 3C85A 4WCVA 3U7RA 1LX7A 3I61A 3QYPA 1I32A 4G0MA 4IJ5A 1IC6A 2GSWA 1MV5A 2D1SA 2VDRB 2ZWPA 1LF0A 3AUJB 3PS9A 4MV0A 4N03A 4ZK2A 2RI0A 2ZPTX 1CF9A 1FUEA 4I1IA 1HFEL 4PYLA 4GLFA 3ZQ6A 4EY5A 1A0OA 4KU4A 4EVSA 5A7FA 4TRNA 1XZIA 2NYRA 1GXSB 2FETA 3BD8A 3DHYA 3EUAA 5JE8A 3RFVA 1BQEA 1Z06A 1K7EB 4B7AA 1EEHA 4KLNA 1CY6A 3PEUA 4UEKA 3U81A 2CLKB 2XVXA 4F7WA 1X2BA 2XKAA 3I3SR 3OQIA 2GEDA 1SULA 2PGLA 3NEPX 4WK0B 1P33A 3RVRA 5K0TA 3PFFA 4WXHA 3O8OB 4GI2A 1IEWA 2IEZA 2PKCA 2ZDHA 3KKZA 1JT9A 1PGNA 5EJGA 1GUZA 5EXTA 1JQJC 2XAUA 5GV8A 3SVZA 5A0VA 3NP9A 1I1NA 4IHQA 2QSJA 2QLLA 1P9NA 4FFRA 3RVNA 3TPCA 4AX8A 3GL9A 3THOA 3T3HA 1XF9A 3FLEA 1W0CA 4YXFA 5L51A 2GEVA 4DIKA 2WP0A 2ORVA 2EYUA 5U4XA 4NK4A 3JVIA 3GZNB 3MZ0A 1RAFA 4RHEA 2QJWA 3NATA 1Y8CA 3CO5A 3DCJA 4XD7A 3ADCA 1T8YA 2HF2A 2PEZA 1EFVA 4KXXA 3UGKA 1O3YA 4H3KB 4CQMB 1XCJA 3UUWA 3QKUA 4JJ7A 3QHQA 1LCIA 3LOPA 4J8PA 2PYDA 2MYTA 4ER5A 2UYCA 4Z51A 3T99A 2VKTA 5DGHA 3URKA 2OHXA 1HT3A 1D5WA 3TLJA 2HMSA 3AL2A 3IUMA 3LPLA 2Q1WA 5KYXB 2CT8A 5TMDA 3U9LA 1GJRA 3L7KA 5FBWB 3AR8A 3LCJA 4TTJA 2HK6A 4G4JA 3ZHRA 2ZRPA 1K2VN 4WNAA 3JCZA 1OR8A 4M8NE 1EUCB 3TRKA 4U02A 4LY6A 1FS6A 3ROXA 2XE7A 1DAGA 5EI5A 2ST1A 2X76A 3IBGA 3COPA 4M4SA 2BE7A 4WRRA 4N5DA 4PRZA 4U2KA 1NVVQ 3E3NA 3G59A 4YCMA 1A27A 2A4KA 2RH9B 3GC6A 3PEYA 4ND1A 1WE2A 3L5KA 1KE1A 2X19A 3TRHA 3AW9A 1C8KA 2BKEA 3VVLA 1M0WA 2D0OB 4IIYA 4M54A 4AP6A 2SCUA 3IHTA 4FJ2A 2Q7OE 5HE9A 4A8TA 2IYNA 4HDOB 1NF8A 1U6JA 1FBTA 3UBTA 1DOAA 1WCIB 2H1FA 3STTA 2E82A 2I4MA 5L4SA 1ORDA 1XMSA 2ACKA 2PUDA 4Q12A 2AGVA 4DAOA 4F4FA 4HMOA 2QRLA 3HNOA 4FGLA 4M7WA 1A7JA 5IDVA 1VGQA 3QMWA 1ESMA 3LO8A 2W90A 1KA9H 1GITA 1RC1A 2LP4Y 2WD9A 3EVAA 3HCEA 5GM2A 2RE8A 1JALA 2ZWMA 4IQGA 4F2HA 1TOAA 1X80B 4EB0A 3H05A 3CN7A 2E4ZA 2A0FA 1GSIA 1B8NA 3LX8A 1IQRA 4IFEA 4ZCQA 3K70D 2E4AA 5ENVA 1M7GA 4EEKA 4JU9A 1AURA 4BNXA 1ZR2A 1M2NA 3HY4A 1Z15A 3OEHA 3PQ4A 5AM0A 5DSTA 2F48A 2WU3A 5FHQA 5BYBA 3UCEA 4ALKA 4BNZA 3U7FB 1V1JA 1PUXA 2Q2WA 1ZOOA 4N5LA 2ROQA 4D6PA 2QTNA 3PF8A 4RACA 1M34A 2GUGA 4NCBA 1R64A 1VL5A 3HL0A 4XJVA 6ABPA 2VBFA 1GQQA 4XYGA 4B47A 4X60A 1AO0A 4GAEA 2W5UA 2ZJ3A 2FOIA 3MHTA 3AKYA 3LGXA 2R96A 1FU7A 3R5XA 4G26A 4MCHA 2F8TA 3IEUA 3H0KA 2PJZA 2FPPB 4FEAA 9LDTA 2A2ZA 1YAHA 2NAPA 4ONEA 3HKEB 1ZRMA 2I3AA 1D9XA 1E3JA 1JDJA 1FFDA 1W9HA 3C15C 1Y5MA 3PU6A 1TZBA 1SD2A 5JSFA 2ZBUA 3FIJA 1AQJA 3IV7A 4FX5A 4JVMA 1UJMA 1ZOPA 2JFBA 4PC6A 3M6FA 2ZFUA 2GKGA 4RAOA 5LKAA 1RJ9B 2ODPA 3QTTA 1GZUA 1TM4E 3TPZA 3MB5A 3FW1A 3L6UA 4CG3A 2R79A 4C4RA 4KI7A 2OBFA 1K88A 4CMCA 1J9ZA 4B17A 1NE7A 3Q8WA 4WBSA 4WN3A 3KKMA 3BRWA 3LUJA 3QYFA 1YH3A 2D0DA 4LJ5A 4BX9A 4DMLA 4MARA 3IQZA 1TEZA 2DPMA 3R3SA 5DTJA 1H9AA 1YSCA 1ZDMA 1KO5A 5F2EA 3B20A 3ETDA 3UWDA 2ERXA 1NBME 2R11A 2AJDA 3JYOA 4LJLA 4HGQA 2GD0A 3MTAA 3BJMA 4K6FA 4OB8A 4WV3A 3TLXA 4QGHA 1RXYA 4URVR 1KPIA 3VZSA 5F33A 5CD1A 4I5IA 3H0EA 5AW4A 2FPGA 4HQKA 4K6CA 4N48A 3ROKA 1H8ED 1GKKA 4XX0B 4IIFA 1WBJB 3BF8A 3RASA 2GEFA 1ARZA 4ESVA 1CR4A 3IE2A 3WO0A 4OGLA 2YXPX 4JOBA 3KYIB 1T2AA 2ODTX 4D3YA 1PFVA 3JZFA 1LPNA 2R8PA 4PV7A 5ALKA 4OU5A 2B1RA 3ZY5A 2UVPA 1KMHA 3CWQA 5ADUS 4FJ1A 3IB6A 1P81A 2O0KA 3WLFA 1P4AA 4OAPA 3AUAA 2BFOA 1SUCA 3KIPA 1QAQA 4NY1A 4JYBA 1EGHA 1XLVA 4S35A 1XAGA 2ZKLA 1WIWA 4PTZA 4R1SA 3VPBA 1ZW6A 1SGPI 3FR7A 4A8PA 5BMVF 1KAHA 5DB4A 2LBPA 4D8TA 5ARBA 1SG6A 1Z6AA 1V5IA 3K6RA 4LE1A 4XRRA 1VSTA 3IDQA 5HF9A 2B82A 4EVIA 1PJCA 3C3WA 2H7XA 2IYPA 1BH2A 1KYTA 2A86A 1JL3A 1SBQA 1TJ5A 3M34A 1E2QA 2VVTA 2WV9A 3ND5A 4AO6A 5BN3B 2J0VA 4QGAA 5BRAA 3SF0A 2V1CC 2OD1A 2I2CA 5HWSA 2JANA 3RSLA 3GIDA 3D7NA 1G8HA 4OMFG 2GASA 2HH9A 1S2DA 4NFHA 2AEEA 4CWAA 4QO8A 3AHFA 4RVCA 1XZLA 5EWMA 1V1MA 2EFYA 1JEQA 5J4KA 1TM7E 2F43B 3GARA 4PZEA 4DSUA 3Q15C 2ZRAA 1ORIA 3FTCA 1Z45A 4RVOA 1CR0A 2PXXA 1T0JB 1RCFA 2VS1A 4LECA 1RYMA 2W58A 5H82A 4LC9A 5M29A 3DP9A 4X8MA 2FR0A 2OO3A 3KHKA 5E4YA 4O4IA 3WLKX 4ZHQB 3FSXA 4PNHA 5CCMA 3MRVA 3UGQA 4UVHA 5CT9A 3HMQA 1I3CA 2HU2A 2OHFA 2HPVA 3GNTA 2NTYC 5AVJA 1MIHA 3MCAA 5THQA 1P9LA 4CI0B 1JAHA 4G4GA 3DBRA 1GRVA 1TW3A 2FMFA 4D80A 4UXIA 2K7ZA 1PNVA 3EVZA 4EA7A 2CZGA 3UMRA 4F4UA 2GKOA 1EP1B 1F4VA 2WAMA 3OJLA 4BQPA 4HX5A 5KYWB 4AY2A 2H08A 1AUVA 4YGYA 4Y2SA 3GJSA 4BUZA 1RYBA 4QREA 2P8JA 4RIGA 3FNHA 4YP9A 1XE3A 4J0DA 1KDOA 4FB4A 5DHSA 2ERCA 4ND8A 1SH7A 1E3LA 2BIFA 1IWBB 2NU6A 3OZGA 1ZM4A 3SZMA 4IIEA 2EHDA 4Z0NA 1EP2B 3QKRA 3VHRA 2NP7A 4EKGA 1GAWA 3ABZA 1BS1A 2I7TA 3BGSA 2BFFB 3BXFA 4XWWA 2BSXA 3CSSA 2V58A 2YVKA 3FCSB 1S7GA 1WXGA 1NIJA 1YI1A 3M0EA 4KRXA 4LSGA 1D2RA 4YT4A 1Z4KA 4X6YA 2DKOA 3AUYA 4KNYA 3ZVMA 2B5WA 3K3PA 2JRCA 3G9XA 3Q11A 4DCGA 3PC3A 2QRVA 3U39A 3NKVA 5FWDA 4M38A 3WGUA 4LXGA 3KQTA 3HU1A 1II8B 2HSEA 4HNUA 1A8IA 5J40A 2CHGA 4B31A 3GPIA 4EJMA 5REQA 5JHWC 2X7XA 4NLLA 3VR4D 3W5JA 1N5MA 2Z9BA 2Y71A 3CLVA 4JEUA 3L84A 1H93A 3IDAA 1JRLA 3KSBC 1T6BY 3FJ1A 2PVCA 2ANBA 5K0JA 4E5SA 1XNRB 1X7HA 1M34B 4PQFA 3T5AA 3LF2A 5TNXA 4ABTA 3A14A 3E61A 2K7FA 3K9FC 4C0BA 4DT1B 1MVOA 3U7JA 3ZU4A 5DAEA 1PZXA 2XUQA 4O33A 5KVSA 2J5QA 1V8DA 2RKWA 2A7XA 1ZWLA 5CHYA 1CUDA 3BWYA 4D56A 1SEVA 4EH1A 5G0TA 3AUFA 2DWOA 2POCA 3ORHA 5EE0A 1XEXB 4XUCA 2DEUA 3MSCA 1E1QD 2CNBA 4JROA 3FSJX 3VZQA 3WGKA 5LN1A 1YDWA 1K89A 2AYXA 3WGMA 1K9SA 3CF6R 5DM2A 4MUMA 1ONSA 1ZEJA 4UEJA 4EFDA 3BMNB 2X52A 5HA5A 4DA9A 2JIMA 2FFQA 1ZJ6A 3KU1A 5I7WA 4AJHA 2C82A 3K1AA 5M2QA 2W2TA 1NI4B 4KO1S 4PW0A 3RRFA 1U2DA 3KJHA 1MAWA 4RY8A 1IXRC 3UC9A 1NULA 4US2R 1PD0A 3CR3C 4L3VA 4BDTA 3RM3A 1LSJA 5BR4A 5JTUA 2ZBQA 3KPUA 3AETA 3RVKA 4Z86A 3W3ZB 2GN8A 2HTFA 2XOXA 1MEOA 5LWHA 2Z5LA 4EFNA 1SCKA 1KY3A 3QKSA 4ZEMA 1KKUA 2X8JB 2JKZA 1II0A 1TFUA 2RHTA 5FFNA 3LSTA 4JGIA 1I5OA 4OHWA 1GPJA 1M67A 5LQDA 1PR3A 5A62A 5ELMA 2GTIA 3E7WA 3F2VA 4P53A 2VO1A 3MTEA 4HH3C 4QXOA 3HTXA 2GCPA 1TUBA 2HSWA 3AFOA 4GE0A 2ONJA 2BTOA 1CU1A 3CPEA 3MLEA 1L7VC 1GKIA 4A6DA 4V0NA 4AURA 1IN1A 4JB0A 4FXPA 4L9AA 1WMBA 3FI9A 4P22A 1VZ3A 3N8IA 1D2AA 3FHCB 5IJ9A 4L27A 1Q19A 1M6VA 4OOFA 3BWVA 2JPDA 3C8HA 4G2NA 4Z2YA 1PUJA 4XR9A 3A36A 1IY8A 1JKXA 1FX1A 2XMBA 2JH3A 2WWGA 5IVDA 4JJAA 3HXTA 4LF8B 2WR8A 2D4AA 2ZCVA 5D87A 5SZKB 3T34A 1ULZA 3SQXA 2CUTA 3AONB 2FUNB 4UU8A 3T9EA 1WKVA 2BSQA 5HKKD 1QF7A 3I23A 3LDGA 2V7VA 2HW8A 4ABYA 1YRAA 3BDVA 3IURA 1S8NA 3HUDA 3UWPA 4BJ1A 1NNI1 3ACCA 3BXEA 4TKUA 2HN9A 1ZBDA 2FG6C 4TKLA 3U7QB 1L0BA 1ZINA 3PFNA 3L7JA 1BEUB 2IKSA 3QSGA 2C78A 3OJ0A 1E2DA 4Z1MA 4EMTA 1E1RA 1HPLA 2C07A 2EW2A 1L4YA 2BMVA 3F46A 4DANA 2CJFA 2QMZA 1T2VA 2ZE7A 4DIFA 1R4NB 1F8FA 3OZRA 2JGAA 5FBQB 2X23A 3KU4A 1FARA 1NRIA 4KE8A 4QHYA 4EELA 4CHGA 5I48A 2P9YA 4MVXA 1YBFA 1FRZA 1X8JA 5LOVF 1WOYA 3IP6A 1UF9A 2CLIB 4E2ZA 2VF5X 3F2IA 2IUEA 2NSYA 3CTPA 3JVDA 4XQ0A 5IT9A 3F1LA 3KD3A 1M74A 3RYCB 5TQJA 4PN7A 1Q6ZA 4WD3A 1AS2A 2M9MA 1I6LA 4RZSA 3W6NA 4JI1B 4GYYA 1E9AA 5JV5A 1WXDA 1DFIA 4GDMA 2VAVA 1PG2A 3QENA 4QBIA 1XP8A 4M1YA 5G4KB 1R6BX 5BW8A 1EUCA 4K40A 2AHRA 2PWZA 5ER9A 1CNFA 2DBZA 3H9BA 4HY3A 4YB8A 1CQIB 2WF5A 1DUSA 1I24A 3JWIA 4B5KA 3DZJA 2X1MA 5T4EA 1GRNA 1YIOA 1ZVMA 3CFYA 4MYRA 3FHOA 3UJ8A 1O4WA 1DRUA 3UB3A 3W8RA 4D42A 2HDNB 2QM8A 2WSSA 2YZNA 3RB8A 4WKGA 3NWOA 1KBOA 1WA5A 4RXUA 3UAVA 3OJFA 4Q9JA 2A20A 5I3CA 2VXCA 1LFAA 2BWJA 3WBJA 3L40A 4D4JA 5HRCA 1RHQA 4IQ4A 4OXYA 4UARA 4YJ2F 4DV0B 1C3OB 1CZKA 4EY7A 2C0PA 3I1FA 3IAAA 2PX2A 1R79A 3U40A 4J2OA 1N0IA 4Q18A 3AU8A 4S1WA 2FSVC 3N2LA 2OZKA 2BGGA 3QWIA 3AUSA 4R3UC 2W6ID 4KV7A 4YP5A 3R8CA 2DFLA 3ZBQA 2E87A 5TJHA 3V8BA 2C8VA 4L8YA 5KTOA 1JIKA 1SCQA 2R5WA 2W2KB 3RYFB 3EPHA 1OFUX 3NU1A 2IXBA 2P9FA 2ZRGA 4WXPA 2GARA 1NC3A 4LC1A 2ZW9A 3W4KA 1JT2A 1DCMA 3PNQA 3E84A 5CEFA 1FTNA 2X5KO 2P2ZA 5T8KC 1RIFA 2Z5VA 1E9DA 2VJMA 2QJOA 1S89A 3KQUA 3BWCA 4LRSB 4MAAA 4ZIRB 3OTQA 1CFZA 2EIXA 4MP8A 4OK3A 4AY5A 1GKLA 1JU3A 1CUBA 2IU6A 4B4VA 4YPOA 5D1NA 4MKZA 4Z7JA 1PTQA 4KRYA 4NDNE 2VNJA 1NKSA 2H2HA 2H00A 4N0MA 2JAXA 5JXJA 2FZCA 4DYVA 1S4MA 1OB2A 1R8SA 1VMAA 2Q5JA 4BWFB 4NMLA 4PNPA 1E61A 1UBGA 3W90A 4BX2A 4QZVA 3Q3VA 1OZHA 3W5VA 1C9YA 2X41A 3KDSE 1DAOA 2VF8A 4PFKA 1U4NA 4QEKA 5EINA 2P2LA 4Y18A 4JZYA 5FOXA 4TGLA 1Q15A 1BW9A 4H27A 5ALEA 1F2TA 1U0OC 1L7OA 5JSKA 1YZTA 4YEDA 1NU8A 1QJ4A 2O3TA 2J5XA 3CH7A 3K9LA 3P0IA 4L85A 2QVCA 3F4KA 3ME5A 3ZDFA 3FMOB 1RACA 4PPYA 5BSTA 4OXQA 4TKMA 4D97A 2I3DA 3EVDA 1MJGA 4R98A 3HWRA 1FMFA 4JY7A 1FLDA 4ODIA 2W6NA 4MJXA 4G63A 4D9GA 3E03A 3VJKA 3TFOA 1MJBA 1XWIA 1NUSA 3HXQA 1TT7A 4P7GA 1NR1A 1W36D 1MMFB 4QX6A 5I7UA 3JAKB 4JXZA 4R0MA 1R6XA 4LCEA 4CDGA 1Z8NA 3K6JA 1PW5A 5IF9A 2B25A 2OV4A 3SZRA 3O2QB 2JVKA 1FS4A 2PL9A 5A5EA 5KNBH 4YPFA 2O2CA 3GQBB 4UEOA 4BU1A 1KZ1A 3V48A 4CKWA 3SYRA 3L18A 2CFTA 3NT2A 1EGMB 2XYRA 3K9HA 2NIPA 2OCGA 3DWFA 4ZDIA 1U3UA 1FP7A 1GZ5A 1L3CA 3NEJA 2FI1A 2QI9F 4FD2A 3U3OA 4F04A 3CCCA 1QH1A 3M5PA 3PGLA 3HB9A 1AY0A 2JASA 4A8JC 5AH0A 3N28A 4L9SA 4QU5A 1ZIPA 4X3CA 3V4RA 3DNMA 2F55A 5E1DA 2NNWB 5DIZA 3KZKA 2V3VA 1WGCA 2X0FA 3OFND 2O3RA 2PTHA 2R8YA 3LL4A 4ZREA 1M1UA 4Q7LA 4TSFA 3W6OA 2O9JA 5EJ2A 5B1SA 5IMBA 4YUYA 3V3TA 4YACA 1H6BA 2IZ6A 3MFYA 3SC6A 4ENPA 1GUBA 3I62A 2LGJA 4Z3KA 5J5CA 4CTNA 3OKFA 4MVJI 4CM1A 4RMIA 1U0BB 1T9HA 3QKIA 1FMJA 2YUUA 1YQ9A 2EP7A 4NYJR 3VO9A 5KNDH 1P60A 1RBZA 2AE1A 2WV7A 1D3AA 5AW3A 1PYOA 3JV7A 3NCTA 3T5GA 4I55B 4D81A 1QUEA 1YQUA 1GGMA 1YQWA 5HX7A 5ICMA 1VP9A 3ZZUA 4AQYB 1WJGA 2ON6A 2ZI7A 4PYRA 1UBUS 2JEYA 4WZBB 3H9CA 1UMCA 2HCBA 4GLJA 4A27A 2LRHA 3RODA 2WIGA 4F2WA 4KITB 2LE0A 2GN6A 1BX3A 4MB2A 2Q4TA 4UMVA 2ISCA 5COQA 3UMVA 5AW6A 5FBHA 3VOTA 3P0EA 1CY7A 3JXEA 1XA4A 2GEBA 2Q2QA 4MW0A 3V42A 3ZHVA 4Q3NA 4ZI3A 3R0QA 2XJ4A 2QK4A 2BEVB 3DCYA 3ENWA 4W5QA 1E5LA 4ZVTA 1IBCA 4F56A 3TOBA 3C3BA 3Q0EA 3K8YA 4YRLA 2VPPA 1EWKA 2A7QA 3EE6A 3TPFA 3QSYA 3DYVA 1RC0A 4G65A 4IUCS 4GKJB 2YYZA 3NTLA 5CLLA 3VPGA 1WB9A 3WQRA 3I8SA 1AZLA 4BMXA 5I9SA 4AJKA 3EXG2 4RF2A 1WDKA 3D4PA 1WD5A 5DISB 1H0ZA 3SBEA 2ZBRA 5KI6A 2J3IA 3L8ZA 2GCOB 3V2IA 3OE7A 1XZKA 1UBMS 2ZYIA 2Z8ZA 4GLLA 1I0IA 5AJWA 2X5NA 5AKIA 2QL6A 3Q3HA 3R7WB 2QVZX 1C3JA 4QIHA 4CKWB 3FOFC 5L8VA 2X6QA 4G89A 4RTLA 2B4TO 4L9MA 5B5SA 5CBPB 4TL8A 3DCIA 2OXFA 3AJ8A 1E7RA 2CDRA 2E5WA 3N2GA 4LWQA 1ZI8A 3TLGB 4BC1A 5BT9A 3E4CA 4R71A 2IF2A 1P4RA 4WJZA 4UM9B 2A67A 2M6KA 3GEPA 1I4DD 4NS1A 5C46F 1Z8FA 4UE2A 5BNTA 2X7HA 5AW9A 1AIPA 1OV4A 1F8UA 3D0QA 5AKZA 3TJZA 3WMEA 4MWSA 1V7PC 4QXRA 3EPLA 4PFQA 5CNJA 1SHTX 2G0NA 4HLQB 3TM5A 2QLTA 3ZKWA 3IUSA 3MSXA 4HPXB 5DTRA 3PDUA 4H7FA 3VISA 2PMKA 4C4SA 1MVLA 2QRQA 3LKZA 4B4OA 3JASB 2HRDA 3F6YA 4PE5B 3GFRA 2IWRA 2PS3A 4DM4A 2QBYA 3WLOA 4MGYR 121PA 2RGGA 3D4BA 3NEAA 4LWPA 3IPCA 3CX3A 4BEBA 1KO1A 2HLPA 4D2IA 5BSVA 2HYIC 2MMGA 3OQOA 1UFKA 2XT9A 2ZYHA 5HJ5A 2YDXA 1GUDA 1IVYA 3O8LA 3CF4G 2WMDA 3GT0A 4Y67A 1NUBA 1E3TA 1S3IA 3WYEA 1RLTA 1VYVA 3Q7QA 1G6HA 3EN0A 4BS9A 3PENA 2YUIA 4R4JA 5IAKA 2OYSA 2GDZA 4WOKA 1XRMA 1KMQA 1VP3A 3GA5A 3KSUA 1EJ2A 3DTTA 3QTLD 1N2HA 3UK7A 3ZR4B 1T4CB 4FSDA 4J16A 2AVDA 4GDFA 1LBQA 1REQB 2YUTA 2Z57A 4B6EA 1Z2OX 2VTVA 2HK8A 1CGJI 5KYKA 2FW6A 3KHTA 1Y1BA 1V16A 4YP1A 5IXSA 1P18A 2H1WA 2P2GA 1XLUA 1L9KA 1RQRA 2REQB 1GO2A 2ZREA 3CX8A 4WLFA 2C8KA 1E1YA 5AJHA 3U3ZA 1I80A 2BEUA 4HWKA 1QRSA 2B7LA 4H4EA 4M37A 1XZBA 3VKUA 4GH5A 3FLBA 3WLHA 3N74A 5KS2A 4PG5A 5C4GB 5IJ0B 2QZJA 5J58A 3EEQA 1H8EA 2P9CA 3U31A 1RQXA 2EJBA 4X41A 3BDAA 1XHLA 2OESA 1OLXB 5E7QA 3RIMA 2A92A 2J5KA 3AJDA 4TTQA 5F5LA 3RPEA 1K8QA 3M89A 2PSFA 4C7OA 1DKNA 2DWCA 4MYSA 3DKRA 1W93A 5KYUA 1JFTA 2X22A 2FMTA 4WZAA 1AKRA 4GMXA 4MTCA 1XNQB 1GKUB 5HOEA 1WQ1R 5C7IO 3TGPA 2G71A 2DPGA 1P1BA 1VE9A 3ILXA 3P9KA 1ZH2A 4GGPA 3IT2A 4FNGA 3FDFA 2DQYA 1TMKA 1YMVA 2IYUA 1ZD8A 3GN2A 4LJ4A 4XCXA 4Y6PA 5L6MB 1SGRI 2O14A 3NUQA 1NDUA 2HLDA 3WQQA 4A6XA 1FMTA 2H3EA 3WB1A 4CPDA 2VSFA 3EGDB 2RBEA 3MELA 3N1UA 5DJ5A 3WGTA 4Z7NB 1P2SA 1UIRA 1SZPA 3FFBA 4BY9E 3S8YA 1IBMB 4E33A 5J43A 1HFWA 3RLIA 2E55A 1NXPA 1TGSI 3FTQA 1W3SA 1SU7A 3H65A 1EHYA 3RRBA 2P6NA 2OV1A 2PH5A 2CE2X 1FYDA 2XWSA 4RVHA 4ZAYA 4C0JA 1GAJA 2BC9A 5ARDA 4UE3S 3O8CA 3THYA 1RM0A 2DR2A 5KJEA 3NTQA 2X8BA 1IPHA 4UM7A 4LOIA 3PFGA 2GBFA 3DO6A 1TAUA 3PHGA 1HZZA 3FOCA 4IP0A 4O4HF 4RE6A 2D2XA 3HKDA 4Z53A 4Y9RA 4E03A 3FCEA 2PRIA 3F6BX 3LL7A 3AEKB 4G2TA 1FLAA 3KCNA 1YDGA 2JJYA 3O6VA 3IIIA 4MQFB 1IAQA 1A9TA 1RU3A 1ZJJA 3I9NA 3USCS 1OBHA 1QWSA 1RHMA 2HB6A 2G9UA 4L7QA 4MAFA 2L2QA 2SBTA 4AXBA 5LWQA 4WXMA 3SCZA 5TQ0B 3JQFC 3ZHQA 3SIRA 2FDCA 1PLKA 3IPXA 2PV7A 4Q4LA 4GE3A 3RU0A 4MRMA 4DLTA 4HAVA 2WTUA 1ZD2P 4A7PA 3G82C 3RHTA 2C84A 1QV7A 3M5WA 3H1TA 1K6XA 3JQPA 2D8MA 4HVCA 1WU7A 2EJWA 5IBRA 3Q8KA 1U0JA 1ZHOA 1DEAA 3OMWA 5DO9A 4CCAA 2PMFA 3NVAA 5GINE 3GRZA 4LJ7A 1BMTA 4YMUA 1RABA 1XTPA 2I87A 2J9GA 3NAQA 1E1LA 3P7MA 3AIIA 2PQMA 3GRPA 5JW6A 1O58A 2FCAA 1GA4A 1OPXA 2DR0A 1IBSA 2GJ9A 4MS3A 2WHYA 2PMEA 1NM5A 5J2UA 1JHVA 1NOIA 2EBUA 2PL3A 1A98A 4EG3A 2LXNA 2JZCA 3CXRA 1U1GA 1WZNA 1AQLA 2EIHA 2BH9A 3R5FA 4G1BA 4L8GA 4PICA 3W4JA 4C6TA 2FPXA 4TL9A 1VPVA 1T3HA 4P34A 4PLWA 1M9NA 1F20A 2H8KA 2BMDA 2ZE5A 4RIHA 1L4KA 4D9HA 1L7AA 1OUMA 1U9JA 2JI7A 1UPFA 2L8EA 5GONF 3W05A 1Y48E 4KYVA 4ZMBA 3JYLA 3TG8A 3T7KA 3LUKA 2JGDB 3EOAI 3BRCA 2VR1A 1NBMA 2ZJZA 4LF4B 4QUGA 4EO9A 1ZUNA 2YQ5A 2Z3WA 2GEKA 1ODIA 2GJSA 3QJ5A 1IHYA 2FZVA 4OUKX 3TSOA 1DWPA 4R7GA 5ILOA 4BNIA 2RH4A 3NC4A 2ZT5A 3CXLA 1YJBA 1JKJA 3K1ZA 4JYZA 3C3CA 3PHBE 4PTLA 1AVTA 4NECA 1SR8A 3X1YA 4XEHA 3L1VA 1JHPA 2GAFA 4XYEA 5CXUA 1SHUX 1SUAA 4RK6A 4LF7B 3QBVA 2GK4A 5DF1A 3SHVA 1UOQA 5EP2A 5DYTA 4Y9DA 1Z0JA 2PZ8A 5TQ2A 4JLOA 1NA5A 2GXQA 2VJMB 2A14A 1KOJA 1Y9ZA 1EXNA 3L7MA 3S5JA 3PR3A 4IQFA 2OC4A 4GWKA 4PLHA 1ZQ9A 4EHDA 4KQCA 5FKJA 2AK3A 2DCUA 4E5KA 2GXAA 1QQ5A 2N71A 3H4MA 5D84A 4RZ3A 3WBFA 4NPHA 4QXPA 3R7AA 5HM6A 3C6MA 3LP8A 1MAHA 1PVDA 2F1OA 1E3IA 2JB9A 3CZAA 4GOJA 3QXXA 1Y3AA 1PFYA 5LLSA 3R0VA 2O8FB 2CVQA 2HRZA 2IYLD 2XDYA 3K5WA 4C21A 3LLCA 3MOSA 3HUFA 3NHWA 1I1QB 4MA4A 5CA1F 4YHHB 221PA 4WTOA 1W6UA 3KEOA 4ZEVA 5LUBA 2EQBA 3F5MA 1W36B 5D51S 3LOQA 1PV2A 1CRZA 2F3RA 5EIWA 3SG0A 1RKXA 1XRPA 3JW8A 3EJWA 3FOAA 3M7IA 2EDAA 2CBZA 4AFNA 2CDCA 5B53A 3DDOA 1GAXA 1RBMA 1U99A 2MYPA 2KMPA 4CEIA 1OVMA 5C1OA 2HNAA 1PJUA 2R1TB 1ZJZA 2WF7A 2QE6A 4H0CA 2V98A 4AMYA 3G7UA 2JHGA 3F1KA 3IP1A 1UXGA 2B78A 1SXHA 3LZDA 2A1TS 3B8EA 2FEMA 5BWOA 2BPOA 2Q1XA 1SKQA 1UBFA 3TMKA 1NUQA 3H5WA 2CFCA 3PDNA 2FQXA 2W71A 5EVJA 1LPPA 3RIGA 4ALJA 2OOKA 4ZYYA 1FY2A 1LPAB 1UKVY 1Y1QA 2J3QA 3K5PA 4P0TA 4BBJA 5JNSA 1AKQA 1OREA 3DOJA 3DAFA 3LVFO 1L5YA 1X19A 1U3WA 4IIVA 3N3AC 2OK8A 3C6BA 3KJFA 5AVUA 2Y1WA 1H2BA 1AMUA 4C87A 1NDHA 1P75A 4M1QA 5J59A 4QHSA 2VK4A 2JLXA 2WKWA 3ECCA 4HLCA 2F2TA 3L7CA 1SELA 1K5HA 4NCHA 4PQEA 5JS8A 2W70A 5CK5A 3VPXA 2GBPA 4G41A 1Y4ZA 5IZCC 3W2TA 3AC0A 4JJEA 1LSUA 4BNJA 1PFGA 4KFTA 1P0CA 4QEZA 4Z1MD 2DPXA 2XTAA 4OL9A 3AM5A 1U7WA 2YWJA 3GLHB 1SIBE 2Y0PA 2VZEA 1XLWA 3O21A 1OVGA 4EO7A 5BXYA 3FBWA 4WXEA 1YB7A 4RY2A 4EI8A 3DUFA 1EEXB 2OLEA 3C1OA 3PJEA 3IEXA 1B74A 3UKOA 4K9RA 2DKNA 3DZIA 4LHXA 3O1IC 1BXZA 3EWSA 4CL2A 4WOBA 4ZI7F 4MQ6A 3DP7A 4BV9A 2FUG6 2VDWA 4L8FA 5GP1A 3R0JA 1L7BA 3DMFA 1ZSVA 4QWWA 4CM8A 3U4GA 3H1GA 1HQCA 2K87A 3EGEA 1PGOA 1U8TA 2VJLA 3NIWA 3PNYA 4K28A 4OM8A 3M82A 3TEMA 5K0EA 2UZAA 4LXYA 5K09A 3UENA 1QF6A 1OJ7A 1XN4A 2AN1A 4MYUA 1JKIA 1B8UA 3HG7A 1U8CB 2ZIWB 1Y8QB 3KDPA 5EGSA 3GBVA 2OAGA 1O97C 5JNUA 3LX6A 4TYYA 1A2KC 2VRWB 2R8XA 4X91A 3ER6A 2H1VA 3GB9A 1BE6A 2OZEA 3Q10A 4JA2A 3UHFA 2F3UA 4BLUA 1LLQA 3EVEA 1WEKA 3UV3A 5EY5B 5JWOA 2BEVA 4E94A 1NW6A 1L4FA 2J5BA 2VKQA 3IUPA 2YIDA 2FEXA 4RNDB 2QLBA 1KORA 4H16A 4K8OA 5LZ7A 4OQZA 1P19A 3FWPA 4PBSA 2JCBA 4I3HA 1IY9A 3LDUA 2UDPA 5FA6A 5F3DA 2GBCA 1UT6A 2RHGB 4MHTA 4JJIA 1E4YA 1PKXA 4FINA 4FYPA 4A82A 3OZCA 4CKCA 3RSQA 3W5DA 2I78A 2NTVA 1X74A 3FFAA 1O0CA 4X8HA 3SJBA 4Y1GA 1JVSA 4OIMA 4CTKA 1GNPA 1ATZA 4RK1A 3CLUC 1UFOA 3FPKA 4EHLA 4YAGA 4QM6A 1DLJA 1FL9A 1SIWA 4IZ6A 3QEBZ 3KT6A 2O2XA 3HLKA 3KM0A 3PQFA 1IVNA 3CT6A 4KGXA 4PIVA 4CFZA 4J76A 1IOWA 1EIZA 4KSCA 3DBHB 5AI0A 3K2EA 1CUIA 3OE5A 2IV3A 3U37A 3THWB 5EMKA 3D6UA 2J0EA 4JBNA 4RKFA 4S2UA 3VXKA 3H84A 3IL2A 7REQB 5F4BA 4ZI7B 2WTAA 1ACLA 1Q7BA 1VPLA 4G36A 4HX2A 1BDIA 2AWOA 1QYXA 1FQJA 4M0KA 1N6IA 3FAKA 1DHRA 2C9YA 4H0NA 4BMSA 4EPYA