4UXIA

Leishmania major thymidine kinase in complex with thymidine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
164
Chain Sequence
FRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
total genus 44
structure length 164
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxiA01
4NKRA 1G3IA 1LFDB 2R62A 3W3ZB 3L82B 2RCNA 4KYIB 4URWR 1UBFA 4Q1FA 3W8RA 1NY6A 3FMOB 1OLOA 2ZI4A 4BLRA 1P2SA 2ZR0A 1OFHA 4A0GA 3RSLA 1XEWY 3WP0A 1VG9B 3LBHA 1OHHD 4GP6A 4LSGA 2JASA 5E7JA 1ZM7A 4ON9A 1S3GA 4YQFA 2HT6A 4L4UA 1E9DA 1FUUA 2R9VA 5IT5A 3M0EA 5BN3A 2D3WA 3THYB 2W83A 3U6BA 1XXHA 3K9LA 4LJ7A 2ASEA 2ODWA 5JSZA 2GBLC 4NTZA 3ADCA 4TN1A 4D25A 2GTPA 1IHUA 3ZIAD 1PLJA 4XWAA 2ZI7A 1Q1BA 3O8BA 5B58C 3CPEA 2PEYA 3IGFA 5CM9C 1X8LA 1XCPA 4FN5A 4LCBA 4M21A 4E5UA 1Z47A 1N5JA 4Q7JB 3TSOA 3U44A 5EXXA 1ZC4A 5HKKA 4DIDA 4NYMQ 4C0HA 5AJYA 4P4UA 2OT3B 2GDJA 2WOOA 3AH8A 5L3SA 4IOMA 1W46A 2W6JA 2KB0A 4Q4JA 3QOFA 5D3QA 5FBWB 5FPYA 5FTKA 1NVXQ 4FMBB 3WNCA 2J41A 1HV8A 4DLXA 3TSZA 3IEUA 3SYLA 5EZ6B 2PT7A 1ZC3A 2UZ3A 2PMDA 3CF2A 1JBKA 1LB1B 2NOAA 4I81A 5FOUA 1TQ4A 2AK2A 4GRAA 3PVSA 2BV3A 2WJHA 4WIAA 3OFND 4M1MA 3QKSB 2F1JA 2E9SA 2EFCB 4BLSA 3LW8A 4FMCB 2AR7A 3LBNA 1EX6A 1S1CA 2R65A 4U02A 4HLUA 4Z8YA 4B6EA 4B32A 1RRFA 2WJJA 2ZE5A 4Q1BA 1B0UA 1KBFA 3SYNA 3U60B 1II0A 1SKYE 2FN4A 1FFHA 3PUVA 1OYWA 4DDUA 4UXIA 1XPUA 1RE0A 2JLRA 4AD8A 3JVVA 5AJWA 1TBNA 2XAUA 1F48A 4RFVA 2GEDA 4KO8A 1W5TA 1WP9A 1XPRA 3NXSA 2QZ4A 2JDIA 1H8ED 4JVMA 3BWDD 3NWJA 3FOZA 3U61B 5KSOA 1OT3A 3BERA 3CH5A 1G64A 3L43A 3CRRA 4JJZA 2Z83A 4RD6A 4RFSB 5CIQA 2FV8A 4B2LA 5IHPA 4BPBA 2ZR9A 2Q9CA 2QE7D 3IUYA 4A2PA 5HZHA 1FZQA 1F3OA 2ANBA 4G3XA 2H1LA 2C99A 5J4KA 2RGEA 3KQLA 4B2IA 4KLZA 4YXWD 3A4MA 1P72A 3E1SA 4D4LA 1T8UA 3QF7A 4OL0A 4Q01A 1HT2E 1ANKA 5H8WA 3NBYC 1KJYA 3W90A 1L7VC 1U8ZA 3QKRA 5UKDA 2R6FA 4L9MA 2W2TA 3TW8B 5SZIA 4HYYA 2ZS7A 3VU9A 3EXAA 4RD2A 1Z2AA 4DSNA 3WYFA 1E1QD 1GKIA 2ZQ5A 3SHFA 4HAVA 5A5GA 4YMTA 2ODEA 3RWOA 1NJFA 2J3EA 4WOPA 3I1FA 3T35A 3GJ8A 4DCUA 4Q4AB 3KFVA 2ELIA 2UKDA 4US1R 1QHHB 4M9QA 3AQ4A 3GLIA 3GFTA 4NCKA 4G0NA 2OV2A 4GBMA 2MMCA 4DHEA 2EWVA 3K70C 2QT0A 3GEEA 1JECA 4G5RA 4JSYA 3AEZA 2QAGA 1S96A 4MDEA 5EE0A 4FWTA 1GIAA 2FSHA 2GJAA 4NYIQ 1UADA 4UXJA 4L5BA 3TUJC 1E2KA 2ZI6A 4LJAA 1JR6A 2BJWA 1X3SA 2NO0A 1GTVA 3PEYA 5FTLA 2GVIA 2ZJZA 4K81B 2A3RA 1KYIA 5JI2E 3QSYA 3AP3A 3I3SR 4LBWA 1S0UA 4M1SA 2BCGY 3KQHA 2O8EB 2Q3FA 2BCJQ 4IOJA 4MRPA 4RZ2A 2ZRDA 2JJ1A 5GJCA 1ZNZA 5C4MA 1EXMA 1ZM2A 4MRNA 4LHYA 1MV5A 1SQ5A 4MGKR 3I92A 2HV8A 1P9NA 3KKNA 1OB2A 3U3MA 2QPOA 2QROA 2JLVA 3NVAA 3BAFA 5G3ZA 3NDPA 3FMPB 2ZETA 1KSJA 4GP7A 2V8OA 4Q7LA 3RRNA 1XEXB 2HLDA 3AKEA 3CIOA 4HUQB 1I4LD 1JR3E 2RH5A 5C2JB 1W36C 4LBYA 1F2UB 1N25A 4LJYA 2ODNA 3LLMA 3K70D 1DAMA 2ZRNA 5FH9A 2CCJA 1CJTC 1MR3F 2QNRA 1UKZA 2W6ID 4AWXA 4WBSA 2YHSA 1YZGA 5AJVB 4XOIA 5KYKA 4KV9A 1IXRC 4AYXA 3E5HA 3ZH9B 4DCSA 2JJ2A 2DFLA 2V1UA 2P2LA 1N6KA 2QBYB 1NLYA 3TQFA 4BWYA 2HYDA 1OXXK 4DB4A 2QTFA 1R0YA 1QHSA 2A78A 2P3SA 4ZIRB 1CRQA 3BORA 5GJVC 4D26A 3A58B 4BRUA 4FINA 4JJKA 4WZ6A 3CRQA 4JLDA 3QPUA 3O8CA 2ORWA 2PBRA 2ZROA 4BLTA 3K0SA 2IHYA 1VYVA 2PZEA 1W47A 4NCIA 1XU4A 5L3RA 3RRYA 2X77A 3PQCA 2D74A 2QL6A 3KTAB 5L3QB 1Y8FA 3WHKA 4AKGA 1Z6TA 1XNJA 4CIDA 3ASYA 1UAAA 1E2JA 3LVQE 3SS8A 4WXRA 3C7KA 3FMIA 3NHBA 1NL3A 5AUOB 3BS4A 2IEYA 2IBMA 3NG1A 1Z6XA 4OI2A 1E2HA 1RFLA 2W6JD 3RAPR 1CR2A 2O8DA 3LAWA 1P6XA 1WBBA 3BE4A 3W6NA 1DTSA 3EWSA 4N1AA 2WIAA 4BUJA 3VR2A 2ZJBA 2P5TB 4F93B 3LX5A 2ZAOA 4GT1A 2JLUA 2KI5A 3VNUA 1E9EA 4GOKA 2YOFA 5C46F 5F9HA 4JLNA 3KDSE 2R6DA 2B6HA 2A5FA 2NZ8A 3DL0A 3CUEF 3PUWA 1FP7A 1GM5A 2HJGA 2P67A 2GF0A 2C95A 5BN5A 4ZIRA 1P9WA 4JL8A 4B2PA 2GNOA 5EXPA 4JVSB 4E22A 5FBVB 1W7AA 4ZKEA 3OIUA 4DC9A 3ZQ6A 4F91B 1C1YA 1ODFA 1EFHA 2FFBA 1PTQA 2J1LA 2ZE8A 4BASA 1JB1A 1S3SA 1CR4A 4GSYA 1OKKA 2EU8A 3EA5A 4L8GA 2JLYA 1BYUA 4KFRA 3THWA 4LDJA 4PZLA 1XB2A 2ZI3A 2JDID 2C9CA 5F2EA 3AF4A 1AN0A 4ZPXA 3U3RA 2NZJA 2WJGA 5CM8B 5BXQC 4C30A 2ZSFA 1LS1A 2ZJ8A 4C4PA 4JIMA 3ICQB 4QM6A 4A15A 3IBYA 2CHGA 2C5LA 2QRZA 1J7KA 4A0HA 4LBVA 1KY2A 4TMZA 4UKDA 3ZJYA 1BO6A 2LWIA 2WWWA 3IO5A 5GJWC 5FOXA 3VHXA 2EVWX 3CKLA 3CRMA 5KNBA 4GOXA 2VHUA 1K5GA 2WTUA 1AA9A 2IYXA 4LV5B 1VDZA 2VF8A 4ZCIA 3AVQA 4URXR 4JS0A 4JYCA 3ZD7A 1VIAA 4PXAA 1UF9A 1W1WA 4H9GA 1TU3A 3B82A 3CX7A 3DKPA 2CLDX 4YMSA 4F4IA 2GZHA 1NG9A 3RDPA 5DI3B 3HU2A 1KJWA 2X2FA 2Q21A 2X1VA 3VFDA 1GKYA 1YQTA 2WWFA 2RKOA 4DLYA 1HA3A 2IWRA 3KKOA 2HUPA 3QE0A 1XD2A 4MRRA 4DEXA 1NVUQ 2QSZA 2MSEB 4URUR 1KMQA 1D9ZA 3SJZA 1R0XA 4B76A 3AM1A 4ZI3A 3C5CA 2KBEA 4QGFA 3WNDA 4F7WA 2ZJ5A 1YZLA 1J8YF 1KI3A 1C4OA 3VQTA 2FPMA 2OBLA 2FPLA 1KSGA 2OUKA 4B3FX 4O2RA 3GLHE 1J90A 1EG7A 3E2IA 4TSFA 4EPRA 3Q7QA 1IN7A 4P33A 2R2AA 2DWOA 4MGIR 3H4MA 4DCTA 1CR0A 1DAEA 3DVLA 4B43A 2OAQ1 3IO3A 1OXVA 3P27A 5CDFE 2JEOA 3DMDA 3IEVA 1TTTA 2J0QA 5EE3A 3PENA 2OO7A 2GETA 3AVTA 1E4VA 1JQLB 2XOKA 821PA 4HSEA 2UVQA 2H16A 1WXQA 1ZIPA 2BDTA 4MYTA 2ATVA 1FNMA 1OIXA 2ZYUX 3X1WA 3NH6A 1S1MA 1IY2A 1NP6A 3KUDA 2OSBA 4TYWA 2YWHA 1XDBA 1FQJA 5K8IA 1U9IA 5DI3A 2WHXA 3OESA 3WYAA 4ASUA 3PV0A 2FPKA 2YOHA 3GD7A 4QBHA 2ZRMA 3D6TB 2QY9A 4NHOA 5JLJA 4B34A 2BBTA 1X86B 1G16A 2J45A 3B1ZA 2QTHA 2ZSDA 1AS0A 1LVGA 1T6NA 1GL7A 2H8KA 4MKGA 1YZKA 3G82C 4IKEA 4LV6A 2GXSA 1EFCA 4HATA 4IDQA 1JPNA 3FTQA 4XD7A 4UJ5A 4EJSA 3QPWA 1GNRA 2Q0HA 4PX9A 1JEEA 4FXPA 2K5UA 1CJVC 3QQ5A 4BLPA 5J5CA 3PUZA 3SBDA 2PLFA 4TL9A 3B1VA 3AF3A 4LY6A 1XX6A 2FGKA 1P5ZB 1BOFA 1SXJA 1ZCBA 2F1IA 1VG8A 1GFIA 1R5NA 2FOLA 4DLRA 2ZJAA 3GEIA 2B7CA 4Q9HA 3ADBA 2ERYA 1E0KA 1Q1QA 3EPHA 3GQBA 2WWXA 3ZQJA 1MKYA 2B92A 1G7CA 2W2VA 1IXSB 3TSWA 1S9DA 1XP8A 3UGIA 1SVSA 5TXGA 1JJVA 2ZRBA 5DYIA 1G41A 1NN1A 3ADKA 1P61B 1FMJA 2C96A 2QAJA 2HF9A 4D6PA 1U0JA 4OKSA 3TRFA 1DAKA 4C0AC 1YE8A 2RGCA 3LBIA 2GF9A 3TE6A 4TWZA 2B8TA 3U6KA 3T34A 1P4SA 2HF8A 3K9GA 2ZRKA 2REOA 5HPYB 2QEQA 3RANA 1Z6YA 1II8B 4TT3A 1E2QA 3HU3A 1LV7A 4KBGA 1GL6A 1GRQA 4AC9A 4OHYA 1MRSA 1MH1A 3CW2A 3DOFA 1OW3B 5HE8A 2F3RA 3MWLA 1OF1A 2R6GA 3PITA 2H5EA 4N0EA 4TLCA 5JWHA 1VECA 3MFYA 3ZVMA 2VPPA 1CRPA 3ZZTA 3U5ZB 4CEJB 1I4TD 3CB4A 4IDHA 2ZXUA 2VP6A 4BFUA 4RD3A 2IHBA 3RRMA 2FDCA 1ZAKA 4NONA 4DLVA 1KGDA 3DO6A 2O0KA 5FPSA 3R8CA 2IEZA 4Y0VA 1G8GA 4KSCA 3SBEA 5DHFA 1XCGB 5JMTA 2OCYC 1UPTA 4MKHA 1CJKC 4IJMA 3TVTA 3L0IB 4IVPA 2EFDB 2O8CA 4BEJA 4P0TA 1G4AE 3TKLA 2BJVA 1QHIA 5FBQB 1EK0A 1G18A 1OKKD 4Z54A 1KO5A 1US8B 1XTJA 4B35A 1DO2A 3A8TA 3SI7A 4I1OA 4HDOB 1E98A 1NJGA 1M1YE 4PR0A 2FJUA 5KPDA 1KMHB 3ZVLA 2F43A 4I99A 3HDTA 3KZ1E 3QKUA 4GNKA 1NVVQ 2HYIC 2A9KA 4LJ9A 2BMEA 1YZNA 4IRUB 3EPKA 3RS3A 3CZPA 4EFMA 2XB2A 4R98A 2IS6A 5JECA 2W58A 3A1TA 1F60A 2OEPA 1Q3TA 4PHTA 4EDHA 2N1BA 4KFTA 3KQKA 3BB3A 1YKSA 3GLFB 1II9A 5TVKA 1XTQA 1ZD9A 2EFEB 4L16A 5HCIA 2NO7A 3RABA 5M04A 3K70B 1E2GA 2A2ZA 2O8FA 2OBMA 5C18A 1RRGA 2A5DA 3SR0A 4ACAA 1QVAA 1QDEA 2EFGA 3TNFA 2CVFA 2JLSA 2P6RA 1U90A 1R6BX 1SVWA 1QRAA 2W2XA 1W49A 2VL7A 1QG2A 1DO0A 4P3YA 2XNDA 1BS1A 3NC0C 4W5HA 1M7HA 4ZCLA 3AB3A 1OH6A 4YONB 3MD0A 5AJZA 3VAAA 1E9SA 4TQAA 2YJTD 4AKHA 1U9IC 5AK0A 3SYKA 5L3VA 3RS2A 1XJCA 3CRVA 4M1TA 2GXUA 1TUIA 3DM9B 4OQNA 4LGMA 2CMKA 4ZDWA 1VMAA 4DKXA 1R10A 5EJEA 1XXHB 5G53C 1GVNB 3T12A 2BKEA 1E0JA 5JSZB 4UNQA 5TY0A 1KKMA 1Y63A 4JLVA 4R2HA 4XJXA 2F9LA 2RGBA 1UJ2A 4EJSC 1G8PA 1X1RA 2FFAA 2WMOB 4AKEA 2GCNA 3MG9A 3WBKA 3KUCA 3FKQA 2KBFA 1U0LA 2OLJA 3EZ7A 4Q9JA 3U7GA 2YC2C 4PANA 2WIBA 2CNWA 2XOKD 4A0RA 5J4LA 1JNYA 1SXJC 2XJ9A 5TDHA 3QXJA 2WBLC 5L3SB 2RGDA 5AJXA 4Q4JB 3LV8A 1YZQA 1T4GA 2GCOA 2FA9A 4ASUD 4I1SA 3MAAC 1Q1EA 4A36A 1T5LA 5P21A 4KODA 3B1WA 1LY1A 3LLUA 3WMFA 1NBMA 4MGYR 1OFUX 4EQ6A 4YLGA 4QRHA 1IBRA 1JPJA 3OIWA 4AYWA 1YR9A 4BE7B 4GL2A 4NL4H 4RD0A 4RCZA 4X8OA 4TTRA 2Q6TA 4QM7A 2AL7A 2WKQA 4G5GA 4QBIA 4F4JA 3SEAA 4XD7D 1FL9A 1GG2A 4FCWA 5B57C 2CL7X 3JZAA 2E1RA 3ASZA 3C8UA 1AGPA 1P62B 1E96A 2V4ZA 4ZCMA 1HQCA 3UMFA 1YZTA 2GEVA 4FD2A 4MGZR 2RHDA 4UNPA 3GLGA 2ORIA 2C98A 1WE2A 2EYUA 5E7IA 1KI6A 2XNSA 3GCGA 621PA 3WMEA 3NC1C 1CR1A 3SJBA 2DBYA 4Q1DA 3GLIE 4X8LA 1YRBA 1Z8FA 5EXSA 3OHMA 3L0PA 1E9BA 1YZUA 3SHWA 2ZAMA 5LD2C 4GMDA 1KIMA 5KHOC 3BC1A 4Y0AA 4K46A 2J0UB 4TLDA 3UK6A 1EESA 3MSXA 2DY1A 3LW7A 3ND8A 1EFUA 1JQJC 2QQEA 1TUEA 1W5SA 2HJVA 1RRCA 1P2UA 4ACBA 2IYUA 5DN6A 1NRJB 2BBSA 4LYAA 4Q02A 3AV0B 4OQLA 4V0KA 4TT3D 1YHNA 2ONKA 1MOZA 4HLCA 3VMFA 1TX4B 4Z1MA 3LNCA 3CONA 4HB2A 1PVOA 4DUGA 3P26A 1KDOA 1AQUA 5J4HA 2AHOA 4TL8A 1DEKA 3QKRB 4QC2A 3KQNA 1GSIA 3AF2A 2AD5A 3AVVA 4QHYA 4N0DA 5DH9A 5JCPA 3VR3A 3L0OA 4V0ME 3VU9B 4PSKA 3VKHA 5B30A 2G88A 4LPSA 3TBKA 2PT5A 1UKYA 4ZI2A 4IDOA 3PCRB 2ZPTX 5DHAA 1G6HA 2GKSA 4IDPA 3U4QA 2BM1A 1FTNA 4M1KA 1Z28A 2QMUA 1NIJA 1Q0UA 5SZKB 1XA6A 1Q3HA 4EPTA 3VNVA 4JVNA 5HR5A 2CXXA 3GLIB 2ZS9A 4MRSA 2RB4A 2VF7A 2DFTA 3ZD6A 4Q9LA 3EIQA 2P0EA 4A8JC 2RMKA 4LPKA 3UKDA 4LHVA 5BQ5A 2QAGB 2J0UA 1KAGA 3HYTA 1KI2A 2ZSBA 2JCSA 2ZI5A 2Z43A 4QKQA 2QQ0A 4ZDIA 1DOAA 4O0MA 2ANCA 1G17A 3DZDA 3P32A 2C03A 2IWHA 1UFQA 4M1OA 1XJ0A 2FX3A 2GK6A 4JBXA 4PC1A 1D6JA 1ZU5A 3FHOA 4LHZA 4OI1A 5CJPA 5C1BA 3PXGA 2G1KA 4OK3A 2H57A 1FARA 1G6OA 5H70A 1OH7A 2NO9A 2VP2A 4JLBA 4PPNA 1R4AA 4JYBA 3CX6A 2PMKA 3C4JA 2ERXA 1MRNA 1E32A 3K9HA 3RS0A 4IW3B 3GFPA 1P60A 2BOVA 4O25A 3UMRA 1P2VA 1LF0A 4V0MA 5GADl 1YVDA 2F9MA 4GOJA 3K0AA 1KZ7B 4Q4HA 3UIEA 1P3JA 2PCJA 2WJIA 4G5QA 4HB4A 2QP3A 2XZOA 1KI7A 1ZM9A 3B8HA 5LB4A 5LPNA 2ZYWX 3DDCA 3B2EA 4HAUA 1D9XA 1OPXA 2NGRA 4IXMA 3SN6A 2WKPA 3X2SA 2JAQA 2DHRA 1E94E 3PUYA 4B33A 1QBKC 4JLAA 3I4LA 4NYJR 4CT5A 2IW3A 2ZRGA 3REGA 3HP1A 3T5GA 4NPHA 2OCPA 2V1XA 1W4BA 2C8VA 2Y8EA 4LYHA 4WZAE 1TAGA 3S1AA 4QJ3A 4ESVA 2JA1A 1EFRA 1ONBA 2Z4SA 4PHGA 3QVVA 4IVQA 4RZ3A 1UM8A 5JHGB 4DSUA 2ZUBA 3IIMA 3MWKA 1XTSA 2IYSA 1UKVY 3T1QA 5J47A 3AVWA 3KQUA 1G7TA 4AK9A 4W9MC 1NI3A 3V4FA 1RYHA 2BWJA 4R7ZA 3V4RA 3GJ6A 4Q00A 2HDNB 1G7SA 1GL9B 2OFWA 4KBFA 3RHFA 5KO2A 1U2RA 5KUTA 4B3XA 1XD9A 2X19A 4P4SA 3Q3JB 3D3QA 2Z4RA 3I32A 4HZUA 4RSGA 1G8YA 3L8YA 1I2MA 2BEKA 2GAOA 2ZI9A 3H1TA 3KB1A 4ILEA 4MYCA 4TL6A 4B3BA 1ZVQA 5CLQA 1TPZA 2CJWA 2V6IA 4TMWA 3ZLJA 2CNWD 2JLWA 4EPVA 5EP3A 3L8ZA 1E2DA 3MWJA 5KDLA 1EWQA 1G3QA 3D31A 3AP2A 3EARA 4MA4A 4X8MA 2DB6A 1M74A 2O8DB 1AS3A 4KU4A 4NDZA 4HAZA 1G5TA 3FKSA 4IEEA 4K8OA 3TQCA 1DPFA 3UPUA 2GHIA 3HR8A 1AIPA 4NBSA 3EZ6A 2EQBA 3EC1A 3GP8A 5FI1B 3O8RA 2JLQA 3PIRA 2XZLA 1DG1G 5FTJA 1R0ZA 2BKUA 2G0NA 3LH5A 3Q7PA 4IOKA 3K0FA 4RZXA 4DJTA 1N6HA 4KVAA 1ZD8A 3RS7A 2CE2X 3PG5A 4G5OA 3X1XA 5CK4A 1F2TA 1HYQA 4BLQA 5KNDA 2PEZA 4UJ3A 4A82A 2HT1A 1W48A 2AN9A 4IFEA 1NN5A 2IYRA 3CF0A 1BYIA 4NH0A 2YOGA 1JI0A 5C4GB 2V55B 1NLFA 5SZJA 3THWB 1W36D 1KSFX 2YWGA 5GJBA 2BHRA 1N5IA 5HKKD 3F8TA 4QHTA 1QG4A 4RCYA 2J9RA 1KOFA 5FPHA 4BZQA 2E87A 2Z0MA 3AUXA 5FOVA 3QBTA 2I1VB 4BLOA 1KY3A 1H65A 3BB1A 1FP6A 2B8WA 3FMFA 4WZBE 2ZUDA 1WB9A 3NEJA 2D2EA 2AFIE 1ZRHA 2WMNB 3BBPA 2H17A 2HXSA 2QENA 4EIWA 1OXUA 1S2MA 1L4UA 4PQFA 1DBSA 4TMKA 1KI4A 1ELOA 4V0NA 2CLSA 3Q9LA 4Z1MD 3QENA 1M8PA 4PFSA 2QMOA 2W0SA 1RFHA 1G9XA 1YRAA 4PTLA 1NY5A 5FBRB 3WNBA 2ZS8A 4POAA 3HU1A 1HE8B 4C0JA 2RGGA 5JJIA 1ZCAA 421PA 2NTYC 3AVOA 2NPIA 1JEDA 5TB5A 5JS7A 4QGGA 4V0OA 3DZ8A 2Q3HA 4WA7A 2W0MA 3QXCA 5AUQA 1XD2B 3RWMB 4D0LB 2ROWA 3JZMA 3QVUA 3AGPA 3ONWA 3Q85A 3SJCA 3B60A 1SVKA 1U0HC 2YKGA 3A1SA 1KI1A 3LX8A 3WBJA 4EPWA 4PSVA 3EA0A 3T5DA 4GPTA 5LBIA 1VCIA 2JIZA 4TLAA 4IVRA 2WICA 5F9FA 2QN6A 4TZ6A 2HCJB 4W7SA 2QUZA 2EWWA 1Z0DA 3HJNA 2IL1A 1GKUB 1CS4C 3VKWA 2IUSA 4IXNA 5KPJA 2WPDA 1IJFA 3BH7A 4DLSA 4KITB 2R8RA 3L2OB 4ARZB 3BRWD 3BJIC 4AURA 1GNPA 2HEIA 3CM0A 3RSOA 2Z6VA 5JEDA 1Z0KA 3SDZA 3LFUA 3FFAA 5GVSA 4PPQA 1G3RA 3Q72A 2DWPA 2N46A 1Q44A 4TTPA 2F55A 1A2BA 5IK2A 2W00A 5EXTA 2CCKA 1IJEA 4DDWA 2Q9BA 3NKVA 5CJ2A 3WMGA 2WWYA 1G5PA 1MO6A 1Q21A 3NDBB 2ZYTX 1NMZA 2VP5A 3JVUA 4BQSA 2XZPA 1G8FA 1ZUHA 2OG2A 5EE1A 5E4FA 4BFXA 1SGWA 1HEIA 2ORVA 1FX0A 1GOTA 5FL7A 2QA5A 3R9XA 1OFTA 4RD4A 1IN4A 3OE7A 3P20A 3IBGA 4YC7A 5AWFC 4CEIA 2GCPA 3QY0A 4EJSB 2QSYA 2D4HA 4JVLA 3N2IA 4FMDF 3R9IA 1XMVA 1KJZA 4A92A 2ZSEA 1ZNYA 1E3MA 2QP4A 3CWQA 1KHTA 3CWZA 1AGRA 1CP2A 1DE0A 1OE0A 1TADA 3C16C 1SXJB 3I62A 3MUFA 2IF2A 1W0JA 4ARZA 2WM9B 1JXOA 4PO9A 4XH9B 3AVPA 1AZSC 1O3YA 2ZRIA 2ZU6A 4UNNA 3O47A 2ZIAA 1Q12A 2AFHE 2ZE6A 3QUSA 4KVGA 2G9NA 1MABA 2CK3A 4DZZA 3OIYA 3HPQA 4MRVA 3AVYA 4TLEA 1B23P 4KLNA 4DSTA 3BFVA 4MQBA 2ZTSA 5B64A 4ZO4A 1OH5A 1KZGB 2JJ1D 3IHWA 1ZINA 5DGXA 3LY5A 3DMNA 1VHTA 2BBWA 2ATXA 5KDOA 1N6OA 4IHQA 3N70A 1Z29A 5DYGA 3BH0A 2ZM5A 1DG3A 2J7PA 2JGNA 1DELA 3RLFA 4B3DA 4CEHB 4FW9A 4D0GA 4DCNA 2C9YA 2YYZA 1V43A 3W5IA 5GVRA 2FG5A 2WV9A 2DFKB 2RAPA 2ZVPX 3BGWA 1VIYA 3TAUA 2HLDD 5E7MA 4A2QA 1UDXA 1QHNA 1EFTA 1N2CE 3M4YA 5HZKA 3EZ2A 2JLXA 2AXNA 1ZW6A 1IN5A 1E2PA 2OE2A 3IILA 2VBCA 4HB3A 2JJ8A 4ZKDA 3THXA 1R7RA 1SHKA 1Z22A 2AWOA 2KWIA 5CB8A 3CXLA 2IYWA 3RNLA 1QF9A 2PZFA 4HB0A 3U3KA 3GPLA 2Q9AA 5ANRB 4PO8A 4MUBA 3AVXA 3QF4A 1WDTA 4PAOA 5KNCA 2JJ2D 3TR5A 2AK3A 4M53A 2DCUA 3SNHA 1CTQA 3DKVA 2WJVA 1RYFA 2OESA 3QJYA 5LD2B 2VRWA 1ZNWA 2J0SA 2D7DA 1Z5ZA 1EWRA 5DE3A 4MITA 5TARA 1Q57A 3UEJA 2O8CB 4LHXA 4TYQA 3VR5A 4NZYA 3BB4A 5JCZA 4KXFB 1LTQA 5LDDC 2PZGA 1RJ9A 4US0R 2AXPA 4DT1A 4NP6A 2A5GA 1GRNA 4HEJA 4OHZA 4JBYA 1E1RA 8OHMA 1SVOA 4CEHA 2FSIA 2F43B 4QGHA 2G6BA 4ABYA 4XWKA 3B7GA 4FCVA 4QNRA 4RZUA 2IS2A 1ZJ6A 2F6RA 1N0VC 2R44A 4A6PA 4F92B 3GJ0A 2XXAA 4TLBA 4UNRA 1SULA 3TGPA 5HE9A 2XSZA 3FE2A 4QXAA 4EUNA 2ZVQX 4W5JA 2J0VA 3C41J 2DFNA 4JLOA 4A1FA 1OSNA 3TW4A 2AX4A 3UGDA 2VP9A 4KHZA 4TYPA 2ENNA 2R6AA 3GLFE 3W8NA 2ZJOA 4YMUA 4HUTA 2OAP1 2X8AA 2GVDC 2O8FB 1SVMA 2XB4A 3OFNA 4Q1CA 4A8JB 5A0FA 4A9AA 4C0KA 2QMEA 2ZANA 4AIIA 1KBEA 1VCMA 1DVRA 3KL4A 4KSBA 1RRPA 2FFHA 1EX7A 1D8TA 1NVVR 3RYTC 1COWA 2ZE7A 3KB2A 1QVRA 2MSCB 4R2IA 5FOWA 3HR7A 4CDGA 4PSAA 1HURA 4LBZA 3G5UA 5CYPA 4CRWB 1PJRA 1XWIA 2OZEA 3GLHA 5K8UA 5TV2A 4LC0A 1X1SA 4LJ4A 2H18A 5CITA 1R0WA 1Z07A 4C7OA 2JIZD 1XXHE 3EIHA 3K9NA 1KO1A 4LJ6A 2IC5A 3VKGA 1KNQA 1JALA 3UGLA 3GJ7A 1NMYA 2DB3A 2QPAA 2IX3A 1NLZA 2WPDD 4CZ2A 3LXXA 4XWOA 3X1DA 4FI3C 4GMXA 5HCNA 2OCAA 1P2TA 4N3NA 4DEYA 1FTSA 1DADA 4OYHA 1QHYA 4Q7KA 5DI9A 3ECCA 4M4SA 2HCBA 4C0QC 3X1YA 1RW4A 4S2EA 5H68A 2H7VA 3M6AA 2IUUA 3RS5A 2PLRA 4JT2A 5FPTA 4BZPA 2VH5R 5IK2D 2OXCA 5IF9A 4P31A 4YXWA 3ZDQA 3CO5A 4PO1A 4Q21A 2F1RA 1T9HA 2EW1A 3SQWA 2REBA 5D3MA 3G0HA 2PX0A 2QT1A 1LNZA 3MWYW 4A8JA 2HXYA 2BVNA 3H2YA 3E70C 3KFXA 2GCOB 4XIGS 3IQWA 4YDHB 1G7RA 4LRWA 5JZVA 2C04A 4DRZA 4OI0A 4HAWA 3GJ4A 1DAFA 3T06B 4EQ6B 3UEYA 1KSHA 4IDNA 1GAJA 4CW7A 2TMKA 2WWHA 1JAHA 4DIEA 4WW0A 5FL7D 5F98A 1DAHA 1XFAA 3THOA 4I4LA 3OE7D 2WWIA 4C9BA 2XTNA 4AY2A 3K0EA 1XF9A 1CBUA 1DS6A 2G77B 2OHFA 3CF6R 4DVGA 4E09A 4AKIA 2WSSA 1KKLA 4WAUA 4WXPA 4R9UC 1CULC 3FYHA 3MJRA 4TSFD 5FFMA 4V03A 3RS4A 1U81A 4YMVA 121PA 3MCAA 3GLGB 2OFXA 1NF3A 1X8KA 1PLKA 2YUUA 1KK0A 5JJLA 1KI6B 4V02A 1W36B 3D7MA 2FGJA 2FU5C 1KK2A 4I1VA 3OEEA 2ZITA 3WRXC 1G5RA 3A36A 1GZSA 1V5WA 3CZQA 1O87A 3U7HB 5JFGA 2B21A 1P7CA 3OF5A 1RVDA 4BEBA 1FQKA 1XMJA 2ZRFA 3EZFA 1EGAA 4I1UA 5IDVA 2J7PD 3QXXA 1E2MA 2B7BA 4LUCA 5BYKA 1R5BA 1TMKA 3UG7A 1E9AA 4OQXA 4US2R 4F4CA 1XZPA 2ZRCA 2RGNC 4DSOA 4C2TA 1TF2A 1E4YA 4A0FA 3UXMA 4KYUA 1VYTA 3IPYA 1ZUIA 2AD1A 3IHLA 1F5NA 1M6NA 4UQOA 3FB4A 4NYMR 4QJ4A 3CPHA 3U2QA 2CHQA 2VO1A 4PAQA 4BECA 4S35A 1FOEB 1G21E 3B9PA 4RKEA 5JBQA 2F1HA 2W6IA 1ZM3A 4JLMA 5KSPA 2WVJA 4BZXA 1N5KA 4Q66C 1DAIA 3KXKA 1SXJD 2ZYVX 3D8BA 3H86A 2QU8A 1R2QA 4NMMA 3WHLA 4DXAA 2GJSA 2JLZA 1Z0JA 3U4QB 2QM8A 3GJ5A 2ZJYA 1ZM4A 1QHXA 2IYVA 2OLKA 4DBLC 1AM4D 2KSQA 5A4JA 2ZRPA 3Q5EA 1Z3IX 2GILA 4UNSA 2A7QA 2QTVB 3DOEA 3CR7A 2VHQA 4D82A 5BN4A 4B44A 2C77A 3QIAA 4LYJA 5FR1A 1DAGA 1VHLA 2O8BA 2GWHA 4KCGA 3K53A 3X1ZA 4X8HA 1T3HA 3W6OA 4B71A 3CLVA 1XRJA 4Q03A 4Q9KA 1NIPA 2E73A 1E1RD 1WRBA 1ZNXA 2NQ2C 3AKDA 5K8TA 2XGJA 1E9FA 4TL7A 1KK1A 3QEJA 4LI0A 3LRPA 2V6JA 2J5XA 1AZTA 1N6NA 2P5SA 4OBEA 2WWGA 4JKYA 3VR4A 1XMSA 1JAIA 2XSZD 4IOLA 4JL5A 1TF7A 5FUXA 4JLPA 1D2MA 1K5DA 1P73A 3K0AB 4Q4HB 5DISB 1E6CA 1E2FA 1QHGA 4OHXA 4Q7MB 1CIPA 2GAAA 3PEWA 3CR8A 2N42A 1T8TA 2LKDA 4Q18A 2G0TA 2GEUA 2GESA 4HZIA 2P65A 3U3OA 3QXSA 3Q5DA 3IDQA 1J8MF 4AI6A 3PR1A 4LWZA 1BMFA 3TUIC 2PJZA 1KDPA 5JWRA 4RKFA 1U8AA 1VPLA 1COWD 3P4XA 2REXB 3A1VA 1Z0IA 4H1VA 3S1AB 5AUNB 5EUQB 1HE1C 3THYA 2FEOA 2FNFX 4M9SA 1N6RA 1WQ1R 4F38A 3TJZA 1OXTA 3LXRA 3U7FB 1G3UA 4G5SA 1QZXA 3EZ9A 1A4RA 3B6EA 3O8DA 5DNYB 2IXGA 1XMIA 4XSGA 5K8LA 3I5YA 3RC8A 3VR1A 3QI2A 3CH4B 4GFDA 3IKJA 4HLQB 4RD1A 1SHZA 4TQ9A 3TVDA 5JRJA 2RGAA 2VTKA 1G8HA 3FVQA 4ZDJA 5IRCD 3PEVA 4C3ZA 3VHLB 1K6MA 3AUYA 1IXZA 4P4SB 4E03A 3CNOA 2XX3A 4OQMA 1NSFA 2NO6A 1GNQA 1NMXA 2BMFA 4HZUB 4EAQA 4Q48A 2WKRA 3LD9A 4URYR 4PPFA 1TQ2A 3L0SA 2BC9A 4EKDA 2CJWB 1UBEA 2FMXA 2ZR7A 1Z6AA 1SVIA 1WBDA 3VX3A 4NYIR 4D2IA 5H1YA 4A4DA 3NBZC 1XD8A 2ZREA 1NNEA 2WSMA 5CK5A 1L2TA 5BW8A 1Z83A 4LX0A 3EPLA 2IXEA 1T0HB 4OJKA 3FPAA 3QKSA 1XZQA 5FTNA 3UANA 1A1VA 1WMSA 2IYLD 1GP2A 5FPKA 5FI0B 2G1JA 4B3CA 3BJIA 2LKCA 2JATA 3IIJA 1R8SA 2D7CA 2VHTA 1XBTA 2IT1A 2ZSAA 4D0NA 2XNDD 1SKYB 1W4RA 1JJ7A 1RIFA 3AF1A 1N6IA 4U7DA 1ESMA 2IYZA 1NKTA 5FOTA 1N6PA 4R71A 3UFFA 2YVUA 1Z08A 1E79A 1AK2A 1S4QA 5E95A 1UBGA 2IA5A 3K0FB 2A30A 1AJEA 3HPRA 2VSOA 3GFOA 4PHHA 1ZP6A 2IF0A 2QG6A 1F2TB 2NMVA 2WSSD 2YINC 4Q1EA 2VYFA 3QPVA 3WXMA 2C9OA 1CJUC 4P4TA 4AG5A 3F3YA 1GUAA 4Z8XA 1IQPA 1CF4A 2D2FA 2FF7A 4L9WA 2X2EA 2YZ2A 3B85A 4RFSA 1T3SA 1DARA 1Q1ZA 2WAXA 3PEUA 3MLEA 3F5FA 4L9SA 5CLLA 2NG1A 3SC3A 4BFVA 3WY9A 4OQFA 1T3LA 2LCFA 2CL0X 3OEED 4M9ZA 2AKAB 5TMPA 2YV5A 3TMKA 1MO5A 2NIPA 2QP9X 4DCVA 1Z06A 1IN8A 2GJKA 1VCOA 1E9CA 3GEHA 4H1UA 4B74A 4NYJQ 3W3AA 4RVCA 1KDRA 2F7SA 3TK1A 2ECKA 3TR0A 1CU1A 3SOPA 3H0KA 3P1JA 1P75A 2ZU0C 1IY1A 4NE2A 3RC3A 1IN6A 4ESHA 1K8RA 3K09A 5G41A 1W0KA 1GWNA 3QKTA 1M7BA 1NBMD 2WAYA 3ZZUA 3TUZC 3CNNA 2ODBA 3FHTA 1RZ3A 1TBOA 4G01B 2G83A 2QGZA 3GJ3A 4Q4LA 4QBFA 1A82A 5FOSA 5F3WB 1ZIOA 1OIVA 2XTMA 3NH9A 3A37A 5KDDA 3A6PC 1UKEA 2O52A 4FMDB 1TEXA 4FMCF 1D2EA 3LVRE 3LDAA 4J0QA 3VX4A 2GJ8A 3ZS8A 1I2DA 4TMTA 4Q4AA 2BMDA 1FW6A 3NBXX 2BIFA 1J99A 1QHHA 1KK3A 3T15A 4JBWA 3K8YA 2ZRHA 4D80A 2QGNA 1E2EA 5FUYA 5FUWA 4M8NE 2QM7A 3OAAA 1TL7C 1OB5A 3IIKA 3EWAA 1G20E 4IFBA 2L0XA 4PAMA 5EE5B 3EAQA 3EASA 3MRSA 1RKBA 5ELXA 3UWOA 5FR2A 3V9PA 2Q3MA 1WCV1 4L15A 1ESNA 3ND9A 4EPYA 2PL3A 2O8EA 2WZQA 2OBNA 4HLUC 4GZMA 1WA5A 4A2WA 3MMPA 3BXZA 5EP2A 1IAQA 4KAXA 4LC1A 2J46A 1J2JA 1U99A 1E0AA 5DN6D 1NVWQ 1PV4A 2D06A 4HLDA 3UATA 1YR6A 2IYTA 4EFNA 1M34E 1NN0A 4URVR 1S8FA 1E2IA 1H8HA 2DYKA 2MMGA 2J87A 1HH4A 4Q5IA 2QRNA 3TAHA 1Z0FA 3U3JA 2KE5A 2VHJA 5J40A 5JRZA 5KSYA 5L8VA 4DUGD 1LS6A 2CEAA 4RJLA 4CGZA 4OI4A 1XEXA 3ZVNA 3QXHA 3W5JA 3BFXA 4HUQA 4HAYA 2FNAA 3KX2A 2ZRLA 4U5XA 1ZU4A 2BEJA 1F2UA 1W4AA 3UWKA 4KI0A 2WOJA 1AS2A 2FH5B 2VLIA 1SVLA 4NCJA 1KO7A 4LZZA 1TNDA 3EG5A 2IK8A 3SE0A 1VG0B 1ZBDA 4BFSA 3TIFA 2MSDB 5EUMA 5KTYA 3R20A 4LOAA 1FX0B 2GZAA 1VKJA 4BFTA 4B73A 5CB6A 5LB2A 4CEIB 4YMWA 1W4CA 3DHWC 4M1YA 1BMFD 2ZJ2A 2FSFA 3AP1A 4U00A 2P6UA 3T61A 2QBYA 2FSGA 3N5CA 1YR8A 2V7QA 1ZYUA 3FDIA 2CLCX 3IPXA 2PJRA 4UXHA 5DO9A 3AVUA 1PUIA 3W34A 3KKQA 2V54A 2ZRAA 1SXJE 2VP0A 5B2ZA 2ONJA 2CDNA 1RC8A 4M2LA 4C0BA 3R9WA 4TYNA 4LV8B 3DEFA 1KO4A 1PUJA 4DWJA 4QNMA 4URZR 4BFYA 2QMHA 2GXQA 3FWYA 4ERNA 4LHWA 3SU8A 1Q22A 4Q19A 1Z2CA 1MABB 3KTAA 5L3QA 1BKDR 3OEHA 2OCBA 1TEVA 2DR3A 3J81k 1P9RA 1ETUA 3C14C 4D4KA 2V3CC 2IUTA 4G1UC 1E9RA 4QJ5A 5DSZA 3BFKA 1R79A 3HWSA 1G4UR 1XTKA 2IS1A 1JR3A 1M2OB 1MO3A 4TYYA 3CRW1 2NPFA 4JL6A 2XJ4A 2J59A 4II7A 4EPXA 2GJ9A 3T1VA 1PTRA 5EP1A 2F3TA 4D4JA 2O0JA 3EX7C 3NHAA 4LJ5A 2QAGC 2EYQA 2I1QA 1R8QA 4B75A 4NU0A 5KOYA 1L4YA 3THXB 3MJHA 1A7JA 3AGQA 3FGNA 3KJGA 4AG6A 2XTZA 4PQRA 2Z5FA 1N3BA 1TU4A 1HQYE 2FZ4A 3K0CA 3QG5A 2D62A 5E3HA 1ZMXA 1PZNA 3QF4B 1E99A 1W2HA 4JLJA 4LK2A 1FMLA 1EFRD 2A5JA 2G3YA 1N0WA 4FCTA 3PUXA 4B6FA 4D81A 2QORA 2UZIR 1E79D 5DIFA 3GMTA 1VCNA 3VR6A 2VRWB 3SQXA 4O2LA 4GDFA 5JS8A 1G1MA 3K09C 3NEYA 4JKIA 1U98A 2I3BA 1TQDA 3RRZA 4B3GA 1XEWX 1S9HA 2EFHB 2VHCA 3CPJB 3A1UA 2GA8A 4Q1AA 4TMVA 1RJ9B 1UEJA 1YJ5A 4C2UA 5JEEA 1Z63A 1HY3A 2FEMA 4XVQA 3NIBA 1UEIA 1IY0A 3SFZA 4DT1B 3T1TA 2XEXA 4W5WA 2ZRJA 1A5TA 2FE4A 1KTVA 1OYYA 3Q8XB 4TQUS 3W6PA 3LQRA 4LJ8A 3SZRA 1G19A 3PJRA 1OIWA 1M7GA 4PQYA 1HT1E 2XXAB 2VP4A 4AYTA 1E2NA 3N2EA 4KFUA 4MYUA 3FKSD 5JHHB 4TTQA 5CIWA 4BGDA 4QGAA 1CJMA 1W0KD 4OHWA 1LW7A 4E07A 4BRWA 5EZ5A 3AKCA 2GK7A 4YDSA 2VQSA 4JMPA 3U7EB 3LO5A 3T1OA 5JI3E 2IXFA 3R7WB 3QBVA 4DLWA 3KJIA 5FBLB 1I4DD 4XTCS 3UMSA 1FAQA 4HDQB 3NTUA 2GZDA 4HAXA 1OJLA 1OHHA 4OK6A 1GDDA 2C2HA 3B1XA 3ETLA 1XEFA 3TLXA 6Q21A 1XPOA 1J70A 3V00A 3LWNA 2CHVA 2QPTA 2YWFA 2XITA 4XVRA 1NKSA 1CLUA 1X8JA 2GVZC 4B48A 1N6LA 2RGNA 4DDTA 4PZYA 3C5HA 2CCGA 1GILA 3GLHB 1IM2A 3AKYA 4PPGA 2VSXA 4M9XA 4Z51A 1MO4A 2PH1A 3B1YA 1VG1A 2R6CA 3ZIAA 3DM5A 4C7OB 4JT4A 3LQQA 3OAAD 3I8XA 2H92A 1YR7A 1A2KC 4CVNA 3EPJA 3ZGXA 4C0LA 4XVUA 1Z6GA 3WRYC 2J7KA 2DWQA 3KXIA 1TF5A 2FFQA 4XSHA 1W2GA 2O0HA 4ITRC 1VTKA 2YWEA 5FUVA 4EFLA 1CEEA 3I61A 1G291 4D4MA 2KJQA 4FIDA 1E0SA 2ZUCA 2O5VA 4MUAA 4MKFA 1PLLA 3SFVA 3IQXA 4JZKA 4A6XA 5AUPB 3ADDA 5AR1A 3VTKA 1RPZA 4HDCA 1H8HD 1D2NA 2AKYA 2BM0A 3CX8A 721PA 1E69A 4DLUA 1XTRA 4Q47A 1OFIA 2I4IA 3I72A 3P4YA 4MDFA 2NO1A 1Q20A 1XJQA 5D3MB 3R7WA 1NG1A 3FHCB 3REFA 1KAOA 3I5XA 1AKYA 2BBOA 2GBLA 2CBZA 1AKEA 1R5OA 2RGXA 3B9QA 4PC3A 3KXLA 5BYJA 1T0JB 2VIIA 3ZS9A 5J4VA 4M0LA 4PC7A 221PA 4QG7A 1NBME 1IOZA 1X6VA 1OV4A 5CYOA 1ZUNB 3UG6A 3KKMA 1KNXA 3I8SA 4GZLA 5BWMA 3ICEA 4P32A 2QI9C 3B13B 2ZEJA 4Q9IA 3KKPA 1XTIA 3FFBA 2YNMA 2V7QD 3A1WA 4MKIA 4PC6A 5EE9A 4M1WA 4FKDA 1U94A 2CL6X 1N5LA 3H84A 5CDFA 4OJQA 3B5JA 1H8EA 2V9PA 2VEDA 3GLGE 4OK5A 1LF5A 4QHSA 2PX3A 5JWOA 3OIVA 1T5IA 1KDTA 3K0CC 3DPUA 1N0UA 1BH2A 1UBCA 4KJZA 2VSFA 4CYMA 4JLKA 4DLTA 4DDVA 1NSTA 2QE7A 3C15C 1OXSC 1OH8A 3KY9A 3CNLA 3HYRA 4M22A 1F6BA 1UDWA 4FWIB 3OEHD 3GJXC 3EIEA 3I73A 1Y3AA 2OXRA 3AF0A 1II8A 2PCLA 2OM2A 2BMJA 3EW9A 3OZXA 4CT4B 1Z0AA 4BFZA 3LA6A 1W44A 1JR3D 1G3MA 2OILA 2RHMA 521PA 4PC2A 4RY2A 3EC2A 3KJEA 1HTWA 4V0LA 3ZVRA 1KI8A 1KO8A 5JJKA 5EQTA 4DLZA 3ZYCA 2P6NA 4WVFA 3TH5A 3BD9A 3QNUA 4NCHA 5HTKA 4CEJA 1E1QA 3RVBA 3M1IA 1FUKA 4HI0E 2OFOA 4NCNA 4QL3A 2C78A 2CVHA 1BIFA 4DB2A 3BIFA 3A4LA 4C0SA 1D5CA 1IONA 4QBGB 2CE7A 4MH0R 4JSTA 4PHFA 5DLQC 2IS4A 2FWRA 3NBFA 4OHVA 2GXAA 3K1JA 3WP1B 2A5YB 1FNNA 1W0JD 3ZZ0A 3B78A 1FPMA 5G40A 1GITA 5J4YA 1CKEA 1US8A 2VA8A 3SJAA 1SKQA 1JXMA 1HUQA 1XCMA 3A4NA 1ZD1A 4QOSA 2YC4C 5KU1A 2CK3D 4CF7A 4XTRA 5FL3A 5SZHB 3BOSA 5G3YA 3R8FA 4GI7A 1KMHA 4B47A 2WJYA 3QG1A 4QFMA 2O8BB 2AWNA 4MYHA 2IYQA 3PFIA 2DPXA 3QEOA 3F0TA 2IYYA 5FTMA 4PZZA 4BFWA 4O3MA 5KSZA 4B6DA 4TMXA 4TZ0A 2SHKA 1SZPA 2FZLA 1VYUA 1T91A 3BH6A 3CBQA 2GRJA 1MT0A 4KFSA 3U44B 3W9YA 3KJHA 1U8YA 5EP4A 1AQYA 1GRRA 1KI9A 3BK7A 3MGCA 1NN3A 1C9KA 1CXZA 4ZDKA 3WYGA 4IEIA 1WF3A 3GLFA 1TQ6A 1E2LA 1YU9A 4LYFA 2ENZA 4ZV4A 1L8QA
chains in the Genus database with same CATH superfamily
2FCRA 4NKRA 1OFUA 2VRCA 2CUZA 1H6DA 5K0JA 1KQNA 4L9AA 3L82B 2VHZA 5C7LO 2BGJA 4TS3A 5HF5A 3G5AA 4EG8A 3I52A 4H4CA 5C8YB 5EHXA 3WTBA 3FMOB 4PW0A 1OLOA 1H66A 1MVLA 2ZI4A 3LC7O 3SOZA 4CF6A 3H9QA 1OFHA 4F72A 4A0GA 4G36A 5E1OA 4NZ9A 2YJ6A 1VG9B 4DZTA 3FUVA 1PNVA 1NR5A 4XA8A 4MW2A 4D9HA 5E7JA 4ON9A 5AI8A 1S3GA 4DUPA 2IOYA 3O03A 1PZHA 3IAS1 1FUUA 4HF7A 4J0DA 2FCAA 4C29A 3BDVA 3U6BA 1M1YA 1XXHA 4DGSA 1RXWA 1INLA 2NZVG 3MTGA 2ASEA 2NSHA 5JSZA 1PS0A 2GBLC 3KOUA 3I9KA 4FEGA 4K2AA 2RBKA 2Q5FA 2WNIA 4TN1A 3UXEA 4D25A 2JPDA 1WIWA 3R0ZA 1KC1A 1EFVB 2C58A 1PLJA 4R4JA 2ZI7A 4W82A 1KJQA 5B58C 3IGFA 2VHEA 3EXFA 1X8LA 3AYZB 3B6KA 4I8DA 3HP4A 1J20A 2EHDA 2WINI 5BVGB 3MMNA 4FN5A 5J2TA 2ZIZA 3K0KA 3QYFA 2DU8A 1ZRMA 4YFVA 5K01A 1ZC4A 2VDWA 2JGMA 1B76A 2FPIA 4DIDA 3BL5A 5AJYA 2CF6A 3A1EA 3O0TA 3ROZA 2G6TA 3ZGOA 3R0VA 5A05A 5JHWC 1TD9A 1P1RA 1U63A 2X8BA 4K2HA 1WD5A 1V4BA 3K4HA 1SU8A 1UOOA 2YVKA 2NU9A 4QWMA 2A7XA 1HV8A 3JQFC 3IEUA 3MAJA 3NDRA 1SKMA 1P74A 2RGUA 1NR7A 2PT7A 2B3DA 3U7QB 2A5LA 4U2FA 2UZ3A 1XQWA 3CF2A 3SHQA 1UXGA 1T26A 3N3AC 1OT5A 2VI5A 4KC0A 4PXSA 4BGEA 4GRAA 1VHDA 2P4HX 4BBZA 1X70A 3QUAA 3M3DA 3TO6A 4BLSA 3KKZA 4Q3BA 2Q8QA 4X5OA 3C6KA 1EB8A 1IU9A 4HLUA 4Z8YA 4EHBA 4B32A 2WJJA 3SYNA 1Q7RA 5T57A 1ZHOA 1DOHA 1P0FA 3BHMA 4KQGA 4N3BA 2FN4A 2GKTI 4KWIA 2WUEA 3PUVA 4RQAA 5CVDA 5JATA 1TIBA 4RMJA 3CSDA 2BGGA 3C3JA 1SRQA 1RI5A 1V8BA 3OJWA 4TTAA 3OXFA 1C8KA 2D0DA 2VXBA 2HLHA 3CSSA 1TBNA 5LP1A 3R3YA 4E31A 3F9RA 4QULA 1VSQA 4IJVA 4DC0A 2GBPA 2GEBA 1F48A 4LXUA 5CLGA 1ATZA 2PLWA 3Q8MA 1E7WA 4ARUA 1WP9A 5BVGA 1JVSA 4HEQA 1T0UA 2JDIA 2O20A 4JVMA 3BWDD 4NENB 3HBJA 3NWJA 4E2XA 3W3AH 3LBFA 4GOOD 1E3LA 1T9KA 2PGIA 2FDXA 4JP8A 4RK6A 3CRRA 4JJZA 2Z83A 4RFSB 1K27A 2HN9A 4GE3A 1BVUA 2FV8A 1V41E 3OI7A 4B2LA 5IHPA 3UAZA 2QE7D 3D5EA 1OOEA 2LNDA 3IEMA 5EWLB 3EW7A 3CLSC 5DHPA 4CIYA 4LNUB 1YB5A 5J2TF 2H1LA 2C99A 1WVIA 3NFYA 3UUGA 2Z5GA 1EUYA 2A92A 3H6HA 1GFZA 4KLZA 4B2IA 3A4MA 3ESRA 4QBKA 5DV9A 5A06A 3HB1A 1ISFA 4M89A 4TTVA 2XE6A 3A9RA 4Q01A 1HT2E 4PLFA 4YJKA 1F1JA 3W90A 5T64A 4JLUA 1FMTA 3FTCA 3TB4A 3QKRA 4RNCA 3F4LA 3WDSA 2BLNA 4R83A 4ZV9A 5SZIA 2PK3A 4LXIA 4FHEA 2FRDA 3ZWXA 2OFFA 1QH0A 4J94A 3FJYA 3A1DA 2R5WA 4KAAA 2PUJA 1EM8A 3I42A 5AVVA 4AXBA 4HAVA 5A5GA 1BXKA 4R5HA 4ADSG 4EBBA 4WNIA 2ZBEA 3KAPA 4MUNA 1BQEA 2XRMA 2CUNA 3QVJA 4L0DA 3GJ8A 5ERYA 4FS3A 3LC2O 3ISVA 3O8QB 2YQZA 3Q6IA 4JB8A 1QHHB 5T4BA 3AQ4A 4EHDA 1TT5B 4PRZA 2CNOA 1C3OA 3RF6A 2LUYA 3VU1A 4ZOQI 1SG0A 4RJ2A 4DHEA 2EWVA 3KT0A 5ILGA 1S2LA 1TVKB 4HDNB 3UH0A 3I9FA 3H5LA 5TEWA 3HBFA 5F35A 4MDEA 3H3JA 5J63A 1JL3A 2FSHA 4F8YA 1E1KA 3EF1A 5AKEA 3BUSA 7ABPA 3OJCA 1JR6A 3LCMA 3RIYA 3CGWA 4EI7A 1SBIA 4M37A 1Y1KE 1MGPA 1P1FA 3TLAA 2G9QA 5AW4A 5FTLA 3QSYA 3AP3A 3I3SR 4LBWA 1H3FA 4MKXA 2BCGY 1TI7A 5FPQA 3F73A 2O8EB 1J8DA 2AOUB 4RGBA 1HYGA 3SLRA 2JJ1A 5C4MA 1QYWA 4HWSA 1EXMA 3T9FA 1ZM2A 3SWWA 4LHYA 4YBRA 2QJRA 4DGQA 5IM4A 2AJDA 2NZXA 3HCAA 3A3KA 2PJDA 3PFCA 1WTAA 3PDIA 3QWHA 3KKNA 1P9NA 4EVQA 3E4DA 3U3MA 3DOOA 4LF9B 3G8DA 4JVOA 2JLVA 1M1ZA 4QZVA 3LXMA 1Z16A 1XIVA 2I1WA 1TO6A 3BKWA 4GP7A 4BIIA 3EG9A 4LXTA 3AKEA 3CIOA 2ZAIA 1I4LD 2YWDA 4OXYA 1AGNA 2M5XA 1JR3E 2RH5A 3X2FA 4QDOA 1N25A 4ND1A 4QUJA 1NRWA 1DIGA 2VRCD 3LLMA 4HVCA 3BF7A 1PG5A 3L3BA 3H83A 4GBED 4UC0A 3W9BA 4NBVA 1MR3F 1QANA 2QNRA 3CT6A 4ND4A 5DCUA 4HFMA 4AWXA 1T25A 1MB3A 1N4DA 1UFKA 1TUSA 1YZGA 2CDCA 3F7OA 4JQZA 4NS4A 3R7BA 5A7FA 5LMZA 2REQB 2GEKA 1TT5A 2OGUA 3ZH9B 2JJ2A 1GPKA 2IZ1A 2GHRA 1M8FA 1YIOA 2Z3ZA 3KYCA 4IGIA 3IEKA 5JTTA 1SU6A 2PRZA 2IRWA 1NLYA 2LZ0A 3KSMA 4GIBA 4AROA 4J07A 3LQFA 2QTFA 3OBBA 1EUQA 4ZIRB 3LDUA 3AHJA 1X15A 3A58B 1EFDN 1O9GA 4IXDA 4RJKA 4BRUA 1A8IA 3ZDDA 4Y9TA 1EWTA 3OM0A 4G0XA 1OLSB 1NVAA 2IUYA 4JJKA 2XQVA 2OPHA 1TCCA 3S70A 2NPOA 3LPNA 4UULA 5A9TA 4PZ9A 5DBOA 3LLSA 3E6AA 3B2NA 1RM5A 2GK3A 4QUKA 1DEOA 1Q14A 1RLUA 2PZEA 2Y93A 4FFVA 3P2OA 5LJIA 4MWGA 1XU4A 1TJYA 3GBVA 4DA4A 1MX3A 2H6EA 4ZALA 1CK4A 1IDOA 1QXSA 1U3DA 1Z9BA 3KTAB 2DHCA 1Y8FA 5ICCA 3I9NA 1PU2A 1XNJA 4HGNA 1D2GA 4CIDA 2H31A 4RJIA 2O3QA 4C14A 1E2JA 3LVQE 5LYJA 2OZLB 1EU1A 3N07A 4WXRA 3C7KA 3FMIA 3ACDA 3GP3A 1V1RA 5IP5A 1NT2A 1IHOA 5ICSA 3NG1A 1Z6XA 3RVKA 4AJLA 1DJLA 4WNAB 4A91A 3CE6A 1M1XB 1CR2A 2O2CA 3A32A 3CCCA 1P5HA 4TV9B 5D7NA 3DFIA 2DPGA 4MV4A 3RYHA 1CHDA 2B0CA 3BE4A 1LDYA 2EW8A 1X7ZA 3GN1A 4M87A 4NU6A 4RV4A 5G02A 4ETNA 3UMBA 1HDCA 1PT9A 2JBAA 3KSRA 4O02B 4MW7A 4WK4B 5SYMA 3V97A 3VR2A 4OU4A 4BUJA 3HUDA 1GLNA 3WRYA 4B45A 4HR7A 2ZAOA 1KE2A 4CN9A 4DCJA 3LT4A 4URFA 4KV7A 3EN0A 1HLGA 4IHKA 4RA9A 3FF4A 4JLNA 3TEMA 4EG4A 2VZ9A 3DBIA 3KDSE 4YRJA 2R6DA 3D7SA 1IBMB 6NULA 3PUWA 4MV0A 1K7CA 1NVMB 2P67A 2WDZA 3BWMA 4PX2A 4Z3DA 2C95A 4BHTA 1GM5A 3FETA 3OTWA 3SR4A 2YICA 4ZIRA 1WOYA 5IFLA 5LLDA 2PBLA 2QLFA 4KACA 4FE3A 4ZKEA 2R0QC 1I1HA 2JIRA 2FFBA 1EFHA 5LDGA 1DIOB 4CE6A 1I6KA 4R2MA 1X7WB 1MFPA 3LT2A 4LWOA 4BASA 4BCDA 1S3SA 2AQKA 3BMCA 1ZI6A 5E7QA 3W4IA 3KCQA 4GSYA 1OKKA 2O57A 4I1YA 4JJ6A 5TS3A 4JI3B 1Z2NX 3F74A 5A9SA 1JUDA 1T43A 3CPSA 3FOWA 4PZLA 3JQ7A 2ZI3A 2VAVA 3TQSA 2JDID 3ACCA 1SO8A 2XZTA 2NZJA 4RH0A 3NHUA 5BXQC 4RY9A 2IU6A 1NJ6A 1KQ3A 4G5FA 3DMHA 1KZHA 4CG2A 2ZSFA 4Z7NB 3A2LA 3SAJA 3PPIA 2EEZA 4JIMA 2OORA 4QM6A 4A15A 1A9XB 3H1PA 4CLRB 4NFSA 2CHGA 1S2IA 3H8JA 5DHSA 4TMZA 4UKDA 3O3OB 4P84A 4Q9AA 2W42A 1IUKA 3IO5A 2WIFA 4LAFA 4TWBA 1M72A 2HPHA 3TB6A 4WEQA 5CLIA 2H2AA 1KTIA 4GOXA 4C6HA 1PCEA 1A8UA 1V7QA 2DBVO 1ZL2A 4HJRA 3A6FA 3P0EA 1Z3CA 4PXYA 4BNKA 4DNPA 1L7OA 5CDHA 5LYJF 4NZOA 1ADBA 2VF8A 4G5XA 3N05A 3QU5A 4W63A 1UIMA 4DLNA 2OAGA 1L4LA 4JYCA 3JX9A 2CZGA 2NZWA 4C4TA 1VIAA 4PXAA 1NLUA 1UF9A 3KVVA 1SBHA 3OJOA 4H9GA 2WJWA 5KB3A 2VT2A 1A72A 1C9EA 1W3SA 4F6RB 3T6KA 2ODAA 5TIIA 2XGOA 5AHKA 1NG9A 3GR6A 3RDPA 4UCFA 3EXG2 2YHIA 3PJFA 5JZOA 1Z4PX 1UXOA 2X2FA 2X1VA 2X7HA 4FGLA 1W75A 1BHSA 4ITUA 5AI0A 1NM5C 3HJHA 3X1KA 4BLWA 1HA3A 2IWRA 5AMXA 3I04M 1K3FA 4KB5A 3HKBA 3C7CB 4DEXA 2VTVA 2MSEB 4NHEA 2NU8A 1TXGA 3SJZA 2KW5A 4FJ1A 5CFNA 1M5TA 5LP6A 3AHHA 3Q12A 4LX8A 3GEGA 3WNDA 2Y27A 3N0VA 4F7WA 1YZLA 3KQYA 4P7KA 3WIVA 4DCPA 1B0ZA 1K5PA 3PFWO 1X80B 1N1GA 2PMWB 1KKUA 1EG7A 3GLHE 3E2IA 4O2RA 4WOKA 4EPRA 3I1IA 3HKEB 3IEXA 3D3NA 4OHCA 4YYEA 1E3IA 5BNWA 2WJ3A 2PZMA 1D0IA 3VZSA 1PNRA 3LZDA 3DJYA 4WY8A 3WIEA 1RVV1 4TKZA 2ZWPA 1T1GA 2AFIA 2EL7A 3MRTA 4DJDC 3CG4A 5IUJC 2EG5A 3NUZA 4L4YA 4CPDA 4F5YA 4MYRA 3TFQA 4I50A 4EELA 1XZDA 2XYQA 2RCYA 1PNTA 1JQLB 4HSEA 4IZIA 2KMQA 3GHHA 5JY1A 1ZIPA 2BSXA 5CM2Z 4F11A 1OIXA 2ZYUX 1YHZA 3X1WA 3VUFA 3S2UA 2QI9F 1NP6A 4XCXA 2OSBA 3GT4A 1WKBA 2YWHA 4TYWA 1PVDA 2A9OA 1U9IA 4J2TA 5K8IA 2BAGA 4UAJA 4ASUA 2YOHA 4PNZA 1YFZA 1R4MB 2ZRMA 3QFFA 1TIHA 1I2AA 1XUOA 3UJAA 2VDVE 3ELYA 1R8XA 1ZLYA 2W8BB 3IT1A 4B34A 1V7ZA 2XQKA 2YY6A 5FWYB 3B1ZA 4C5CA 1Y4UA 2IHKA 5IPFA 3AM5A 3RVPA 4ED9A 2QLLA 1T35A 5HBRA 3VBCA 4BMVA 1KIAA 5ALVA 4LV6A 2GXSA 4N54A 5CH5A 3RVRA 3WSTA 4J16C 1ND5A 3FTQA 3I0NA 3LSTA 5FHRA 3QPWA 1GNRA 2H0AA 3T7AA 3ZY2A 3AJEA 1SD1A 2G4VA 2Q0HA 4GM0A 2X9NA 1JEEA 3LPMA 4FXPA 4RMIA 3TRKA 5LFAA 4C0WA 4IDFA 4TM7A 1IZ7A 1Q7CA 3DNFA 1FP2A 3DHVA 5F7XA 3B1VA 4EG1A 3ANNA 3CFYA 2FGKA 2QQCA 3T0IA 3IULA 1ZCBA 3U4MA 1VG8A 4RPIA 2FOLA 3EH1A 1B15A 1VKNA 3AEYA 5LP6F 3ZUGA 4RPGA 3R6LA 1E0KA 1WDLA 1PRYA 2CVPA 1DKLA 1MKYA 3CS3A 2DPHA 2OCKA 4HNRA 2W2VA 3P52A 4YMHA 4FR5A 2FWBA 2NXJA 1XP8A 3AMVA 1SVSA 5TXGA 1JJVA 4QUBA 1MQ8B 3GDFA 4E14A 1G41A 1Y7LA 3EXIB 4F04A 2IV3A 1XZGA 2QAJA 2DPYA 3DFFA 3OO0A 3TRFA 3U7JA 1OWOA 5DHQA 2DQ4A 1PTJA 1YE8A 3C98A 4LY3A 5DM4A 3DZGA 3V8MA 1FDRA 3U6KA 1YF3A 1JLSA 4KQWA 4RTLA 2AW5A 2HF8A 3E9QA 5SYAA 2FEXA 3ZNOA 3K9GA 1NTOA 3QLUA 2QEQA 4Q05A 1Z6YA 3V7UA 4TT3A 2O9JA 3WNQA 4YR7A 1N2EA 5REQA 3QTLD 1E2QA 3PNOA 2DQYA 4KVZA 4K6MA 1LV7A 5T6MA 3HTXA 3ABIA 4CWAA 1VL6A 3R7FA 1GXSB 4FX2A 5C51B 4AC9A 4OHYA 1MH1A 3O26A 2YWXA 4EYOA 5DNEA 1BGXT 3H9JA 4I4TA 1FTQA 3PITA 1B26A 4MQEA 5KAMA 1JF8A 4OIMA 2H5EA 4ZZ2A 3L07A 1VECA 1NBHA 2CNKA 2PD4A 3ZVMA 1QGUA 3VR2D 1BWQA 3ZZTA 4ZMRA 4CEJB 1TZMA 4LC9A 4ZYVA 4N6GA 3GHYA 2RAVA 4AULA 1ZLXA 2KHZA 1CQIB 4K6KA 3H5IA 4E2FA 4BFUA 1ZXXA 1PL6A 3RRMA 5IJAA 4DLVA 3DO6A 5FPSA 4JXXA 2B25A 2JJQA 4GOND 1KBOA 1R9MA 4XGRA 4PNEA 2D0IA 4EGSA 1ZJWA 1XCGB 1EDOA 2IOHA 2V7VA 3PX2A 1ZOSA 2ID7A 5FA5A 3U4GA 1C8BA 1UPTA 2GFHA 2SCUA 5E6UB 4CKXA 4YIKA 4EW3A 1ZGAA 2O8CA 2EFDB 1G4AE 4KWEA 1OZGA 3ZZ1A 3ND6A 1OKKD 5ITWA 1JJAA 1US8B 1XTJA 1DO2A 5EXEA 1Z68A 3O8OB 5TPWB 2OHVA 4M3NA 1Z2IA 3WFJA 5CH8A 2AYXA 4I3HA 3VC3A 1E98A 2C4TA 4G26A 1K0UA 1M1YE 2FP4B 1ARZA 5HKLA 3P9NA 1EH5A 1NKVA 2B4TO 4BNMA 2HDWA 5DNAA 1LH0A 2DKVA 4MA5A 4PLTA 5DM60 1QQ6A 4C4SA 2P41A 4FYIA 4LDZA 5HIMA 2V6GA 5IT0A 1N2CA 1ULHA 3O4FA 1CY6A 1I2CA 4BS9A 4P1ZA 4ZRDA 3P7MA 1BA2A 5DP1A 4LJSA 1HG0A 2PBFA 3T9BA 3HCDA 1FBNA 3AHGA 2XGMA 1NJ2A 5JECA 4BTLA 1X1QA 2VXOA 1L4FA 2OV1A 1Z0ZA 4QRIA 3U39A 4EFDA 3QUQA 1DC8A 2VT7A 3DXFA 2I80A 4YP5A 5F1PA 1ZRSA 3EVZA 4PCUA 4TS9A 2GN6A 1ZD9A 2EFEB 1ISHA 3UV3A 4U63A 3S5UA 1BEEA 3TI9A 3PC4A 5M04A 1FFAA 1M83A 1UK9A 2FPSA 2NO7A 2X76A 3GY0A 4RAQA 2WHYA 5DTEA 5C5EA 1PD0A 3VTZA 1QDEA 2OECA 2X9GA 4I4TF 2CVFA 3FSGA 5AOAA 3TZQA 2K7FA 1PHPA 4A6DA 2P6RA 4TXMA 5JZMA 1PJSA 5BUSA 3ETEA 5FV7A 1ZISA 1BS9A 2E37A 3KRTA 3QWAA 2W2XA 1XLWA 2VL7A 1QG2A 3KYJB 4L2IB 2XNDA 1BS1A 4Q3LA 5BQPA 2EWMA 2QRJA 2RH4A 3AB3A 1DC3A 1HE2A 4ZCLA 1G60A 2JYYA 1YU6C 1PJZA 1GA4A 5DDIP 1SNYA 2HX1A 5IAOA 1SXPA 1I1QB 5LZ7A 3SSMA 4A27A 1E9SA 4TQAA 1KEVA 2HXGA 4KXNA 3CRVA 4FHFA 4KMSA 1YDWA 4S24A 3R44A 3JD3A 3UQYS 1I5EA 4OQNA 3MINB 2IYNA 2R8EA 4X20B 4MX8A 3RVJA 5EJEA 4NBUA 5AKHA 5G53C 1GVNB 1MCZA 1ZHHA 4JN6B 4PAWA 4ZI7A 1KU6A 5TY0A 3QPCA 4QNNA 3FPFA 3GFSA 3B48A 1P7WA 4DIKA 4O4HB 2WYVA 3BGSA 5C37A 3PS9A 3NGLA 3ONDA 1B74A 4GZ6A 2WY2D 2HBRA 5LA6B 4EJSC 1WZCA 2R2GA 2QN9A 2XRYA 2Z2XA 3O75A 3KB6A 2WMOB 2GCNA 3HG7A 3NETA 3VDNB 2F3CI 4F21A 3GNQA 3FKQA 1XAHA 1BZYA 4JXZA 2BGRA 3BMXA 1RR6A 2QKYA 3EQ8A 3EZ7A 4PANA 4OQQA 2IDKA 3BXGA 3N87A 4OBXA 4NE9A 4Q7EA 5CLHA 3HZOA 4OBBA 5KYWB 3M89A 1L5WA 3L1VA 4KRGA 4FU0A 3MS2A 1UFRA 4NJEB 3PFGA 4Q4JB 3LV8A 5SICE 3UMJA 2ERCA 4GEKA 4NABA 3HKCB 3VGJA 3O1HB 2E85A 4UAVA 4BV9A 4E08A 2PO7A 1P0IA 2GCOA 5EWJA 2I67A 5BQFA 2SGEI 5K7SA 4ASUD 5E1MA 1RJDA 4DPMA 1NR1A 4H1TA 5U9CA 1TTPB 2Y3IA 2PH7A 3LLUA 4G2TA 1NBMA 3MOIA 4MGYR 1OFUX 4A6EA 4DUYB 3C8DA 1QCZA 4R5MA 4YLGA 2DUNA 1FSGA 4QRHA 4DLPA 5JAHA 4YACA 3EBOA 1NUPA 4X1OA 3WK9A 4GL2A 4YIHA 3SM3A 3UCXA 1PJ2A 4U6SA 4JOBA 4DV1B 4JT8A 1MT1A 4RHCA 3ZW9A 5JXHA 1C2TA 2AL7A 4F4JA 2AMYA 3MIIA 4BX9A 3SEAA 5A4MS 4F2DA 5JISA 4Q3DA 1FL9A 1GG2A 2QX7A 4WUVA 1LV8A 1Z4QA 1VMEA 5MFPA 1LLCA 3JZAA 4FE7A 4PS0A 1GAQA 5C34B 3PKIA 4NICA 1P62B 3K2BA 3G8BA 3WWEA 3X1JA 1YB1A 2Q2QA 2B1IA 1HQCA 1I8TA 1YB7A 3UMFA 4FD2A 1ESZA 1XN4A 3G0GA 1HDYA 2ORIA 3OJXA 3HZHA 1WE2A 1TFUA 1DKPA 1KI6A 2QLTA 2XNSA 5FUBA 3S2SA 3NBQA 2GYWA 1BE8A 3V4OA 1EFLA 4HXGA 1IOLA 3CZ9A 1PW5A 4Q1DA 4K28A 2AOTB 4FEYA 3ANXA 1Z8FA 4KGZA 4RUKA 5T8KA 4PX5A 4RHYA 2WQZA 4W4TA 1PGNA 2IYFA 3L0PA 1J2EA 1E9BA 3BFJA 5AM3A 4GMDA 1BFKA 1KIMA 1GUFA 3GV0A 3AFHA 4K46A 4TLDA 3HJRA 5JASA 3KE8A 5EG5A 3DUFA 3MSXA 2DY1A 1FPQA 3LW7A 4KWTA 5TF0A 1EFUA 1HZZA 2HJVA 3WR5A 5HRUA 4CQNA 3GZJA 2IYUA 1OVOA 1ZR4A 4H3HB 4Q02A 2P2NA 3AV0B 5IYZA 2Y1CA 1HNXB 3JASA 4UREA 4CM4A 1T1IA 3F5MA 4TT3D 3U5TA 4BNDA 1YHNA 1FXSA 1EHYA 4HLCA 4XCVA 2H5JA 3U4CA 3ZHZA 4AZ0B 3WGIA 1F4PA 1D2RA 3FTDA 2AEJA 3C4VA 3GJYA 3LX4A 4PHCA 4PCVA 4YCBA 2NU4I 1GPDG 3TO5A 1AQUA 2I2DA 4EA8A 2C2GA 2FPPA 3T3PB 4TL8A 3GMIA 2R6JA 3KQNA 2BRUA 3AF2A 4LQLA 5ALGA 1RYMA 5E3PA 4GR9A 3OBIA 3OU2A 3L0OA 5TQ2B 2Y1GA 3UGJA 4PSKA 1G21B 4WFQA 1ZXLA 4FHCA 3PWSA 1YMUA 3K6RA 5EZQA 4BVEA 4X6XA 2FR1A 1RM3A 3PC8C 1MFZA 3TBKA 2FSPA 4L3OA 3C3MA 4BO7A 4IDOA 5CVTA 2YCBA 1OLXB 2ZPTX 3PGJA 3FOFC 1NYQA 1SEPA 1WZIA 3R5CA 1CY7A 1E4OA 1GQFA 1XAIA 3HLTA 3OTOB 3D4PA 5JSKA 2QMUA 3ECSA 3NORA 1ULNA 2MYUA 3ESAA 1Q0UA 3GD5A 5SZKB 3KHTA 4MRMB 3ONNA 3RM3A 2QTVA 5I51A 3RUAA 1VIVA 2DFTA 2JLCA 3EIQA 5IBRA 5L9AA 2WFAA 1Z38A 2RMKA 2P4QA 4R0MA 5BQ5A 1Q0HA 2EKLA 3HYTA 4CLHA 2YW9A 1KI2A 3DAOA 2VVTA 4OFZA 4YROA 2JCSA 4J0CA 5AW0A 5JCXA 3PSAA 4JXJA 1DOAA 1ABBA 4GE0A 3P32A 2IWHA 4G0PA 3SEQA 5BSRA 3UA4A 4GHWA 3CGGA 1NQTA 3TG2A 4WADA 2R66A 1CHOI 4LHZA 5IKMA 3PXGA 2G1KA 4CKWB 4OK3A 3ENKA 4YV1A 5JMOA 1FARA 4MHSA 2XCTB 2VP2A 3CX6A 3L46A 3ZDCA 2ERXA 1RQGA 3I05A 4XB2A 2FRVA 3IR5A 1MRNA 1E32A 4MMXB 4JC4A 1HGXA 2V3WA 4J9VA 1P60A 5K2MA 3DEHA 3ZV4A 3DCJA 4X7MA 4DZRA 2QR2A 1GTMA 4GRDA 5DWVA 3UMRA 2P30A 1LF0A 1EP2B 1GSAA 5TQ2A 5AVXA 3DVAB 1DIRA 3K0AA 4Q4HA 4WESA 5IYZF 1A7KA 2JCXA 5LQCA 4G5QA 1EWVA 4HB4A 3RWBA 4PZAA 2QP3A 3W5VA 4KXVA 2I2BA 3LXUX 2XZOA 4OJTA 1AF7A 3AXTA 2PGDA 2MYNA 2IUFA 4IXMA 4TKVB 1K7UA 1P0CA 1Z7EA 3AINA 4H31A 1RM4A 4WLFA 3RE1A 5THQA 4PSUA 1SUDA 3T52A 1O97C 3JWEA 1ZIYA 1QBKC 4JLAA 3I4LA 3FSGD 1QNLA 3R23A 4NYJR 4JI7B 3VPDA 4G86A 4ZCRA 5JDCC 3E03A 3L7KA 4NPHA 1NA5A 2N1MA 1F8XA 2Z3WA 1T9CA 1W4BA 4M98A 2C8VA 2Y8EA 3GDHA 5I9IA 1KAQA 4EB6A 1TMYA 4RL4A 4ECEA 2ADMA 4BP8A 4WE3A 4PHGA 4FW8A 4Y3UA 4DSUA 4U3JB 2ZUBA 1HLFA 4NMHA 1XTSA 4EEZA 1UKVY 3AI2A 2O5RA 5LC1A 5TX7A 4AY3A 3D4OA 2NVWA 2Y66A 1XHLA 3V4FA 1T5TA 4FC7A 4CM6A 3DCYA 4FEAA 2AW3A 4NH4A 5D3ZA 3T94A 3H3FA 4JQOA 5FP0A 4ZICA 2JIPA 1H4TA 3CVWA 4KBFA 3RHFA 5CURA 1YTLA 1QTNA 3CY6A 4I08A 3IBSA 4UVGA 5D1HA 4X63A 4ENWA 2XB8A 5KO2A 3OIGA 3QU9A 4B3XA 1Y9JA 2EP8A 3LP5A 1V1JA 4PVDA 4RLFA 2VR1A 5ESWA 4CUZA 4HNSA 4AS2A 3D3QA 2Z4RA 2CXRA 3I32A 3WGJA 3RYFB 4RSGA 1G8YA 4B1FA 1I2MA 2BEKA 2GAOA 2ZI9A 3EDRA 3FPGA 4TL6A 1ZVQA 1ORWA 2BMVA 5CLQA 3AZPA 1W2WB 1FYXA 4IQGA 5I9BA 2CJWA 5HK8A 2DVMA 3WK7A 3ZLJA 1KORA 1U7DA 4UMDA 4MR7A 1CUZA 4DM3A 1SHTX 1XCOA 5JANA 1B2LA 5LQKA 3D31A 1ADJA 3EARA 3LHIA 5BSVA 4UTOA 2P40A 3O6VA 1OLUA 4X8MA 1XVAA 4KU4A 2Y99A 3AUTA 1JDTA 1LBQA 2QLJA 4CL0A 4EAAA 1TDJA 3E7DA 4JLWA 2D0OB 4C89A 3HK2A 2JA2A 4BMNA 1WGCA 4CU2A 3ZR4B 4HYEA 5A3QA 3M9XA 2GHIA 3HR8A 1ZUD1 4KLCA 4NBSA 3UBTA 2EQBA 4Y1RA 4XUGB 2G4LA 1XT6A 3HU5A 3O8RA 3SICE 3J80A 2IZOA 5IF3A 4N47A 3HXPA 1T2AA 1BQ4A 2D5AA 4J0FA 3Q6NA 2H08A 2NUAB 1RHQA 2GPWA 4BRZA 4B6PA 3Q3VA 4PGFA 2GPTA 1H3NA 4H35A 5FQOA 2QVGA 1ZSNA 3AEKA 4GL4A 4KVAA 2HCFA 2MINB 4GBGA 4KUHA 1WXGA 5BN5B 3PG5A 5B36A 5JNUA 3WC4A 1KP3A 1MW9X 2EBUA 3DE0X 3AT1A 4BLQA 3BIJA 5KNDA 4HQKA 3FF1A 4J91A 2A1UB 1NF2A 5K0GA 2HT1A 3QI7A 4ZCSA 5E3JA 2UYQA 2BEWA 2IYRA 3DZKA 3TRJA 3KEOA 1P1HA 3UUFA 3QW2A 5JV5A 4JB3A 5C4GB 2Q5CA 5AESA 3AOGA 1FE8A 4ND8B 3ZE6A 5KOHA 1XDSA 1NLFA 1VM6A 2ZB7A 4BB9A 3THWB 3K72B 3F46A 2H1CA 1KSFX 3UYLA 1L4KA 3HY6A 3V7NA 1W36D 2YWGA 4G0VA 4K9SA 2CHEA 5GJBA 1P77A 3E58A 1P8AA 3F8TA 4QHTA 3RU0A 1K7FB 4HNQA 5HM8A 1KOFA 4G81A 1QVVA 4JU8A 1BAPA 3VOAA 1A69A 3WLOA 2I2XB 5LZ8A 4DCCA 1Q77A 2WE7A 2IDZA 4RPJA 2WFMA 4KQIA 2WFLA 1FP6A 1R66A 2NN3C 2XMPA 2ZUDA 5KX5A 5MGNA 3KSAC 2D2EA 4XI9A 1GPMA 1N2ZA 2AFIE 3EJ6A 4RWEA 5ALQA 2JFOA 3BWBA 1MXHA 2N0SA 4LRQA 2JFYA 4IV8A 2HXSA 2QENA 5F64A 3RUIA 4EIWA 1FLVA 2RK6A 3TCNA 1G8AA 4PQFA 2JF0A 3RKSA 2R1ZA 3W7BA 4P54A 1GTSA 2JI6A 4I7EA 5CCLA 1AK9A 3D0QA 4PFSA 3UK7A 2FG6C 1DKQA 2NUAA 3BMOB 2CWGA 1YRAA 2P9JA 1UPFA 2IOFK 2PSEA 3ILSA 5FBRB 3WFIA 4WQMA 1H0HA 1XN1A 2RGGA 4MS1B 5TE9A 2MINA 3RG8A 3WKDA 2NTYC 421PA 3ZDBA 2HI0A 1CSEE 4V24A 5L7YA 3SKYA 3HRKA 3LX6A 2B98A 3TOCA 4G07A 4V0OA 3M5CA 5BOSB 4CJXA 1F8UA 3CX3A 4TSFD 3PT9A 1YS1X 4KL8S 4ZAVA 1GCIA 1KOJA 3SJCA 3KXDA 1GPBA 1DLIA 1U0HC 4BMDA 2YKGA 1KJJA 3HVRA 4EPWA 3BYZA 3ZHUA 2YY7A 3KWFA 4H0CA 1VCIA 2JIZA 2W98A 3CUTA 4BKPA 2GPNA 4GSLA 5F9FA 2PE5A 4TZ6A 3EOAI 1W25A 1G20B 3DT8A 3PGVA 3HJNA 3UN1A 4UBKA 2IYAA 1QP7A 3JZFA 2IUSA 3DW3X 2FF5A 4IXNA 2FOXA 2WRZA 1QSGA 3BH7A 2R8RA 4DLSA 4B83A 1CEQA 1PT7A 1GNPA 3O9ZA 2FQWA 2VPXA 2HEIA 2QB5A 4OIFA 5AHXA 5I4CA 1FFDA 1PFQA 1Z0KA 3SDZA 1J0CA 2TYSB 3Q5GA 3G3EA 5AW3A 4RTNA 1G3RA 3Q72A 3TN7A 2A1IA 1Q44A 4O5AA 2F55A 4MV3A 1F38A 2YWRA 3UK0A 1WUYA 2HNKA 2W00A 2CCKA 2M1ZA 2BZGA 4GF5A 2Z9DA 5BYBA 3D6NB 3HFJA 2Q9BA 4WXMA 2HBYA 3UMYA 2G5PA 2ATEA 1D8AA 5KX5F 1J9EA 2LP4Y 1Q21A 3DDZX 4EA6A 4B4KA 1XCBA 3LO8A 5E9WA 5ALHA 1N8TA 3CZRA 5H9WA 5M2QA 3IKTA 1CEYA 1NMZA 2W6QA 4I5FA 3OH8A 3OO1A 1SAYA 4RDHA 1BVHA 3AUJB 1NXQA 5CT4A 2K87A 1Z4IA 4MS4B 3VOBA 5BOSA 2XWBF 2UDPA 5KAPA 2PWZA 1SGWA 2Q49A 1HEIA 1K8QA 2SECE 5FKJA 5LZ9A 4YVFA 1LQTA 5FL7A 4MUXA 1I01A 2QA5A 5HX7A 3R9XA 1X1AA 1NI4B 3BWVA 3AF6A 1IN4A 3G7UA 4YC7A 5AWFC 3MHPA 1DMRA 3X1MA 1LNSA 3N2IA 4FMDF 2QLBA 3UJ7A 3BCSA 1K6XA 3UW1A 4D79A 5EPOA 1G20A 2GPBA 3CWQA 3WDKA 1L8AA 3M1YA 4FFOA 1CP2A 3V42A 1TADA 1TM5E 2Q2NA 3MUFA 2IF2A 4KJXA 1JDBC 1OASA 5JS2A 4NATA 3RSCA 3VU3A 2ONCA 4GGPA 4ZTUB 2XQGA 3M9WA 1AZSC 1O3YA 3LA8A 1JSZA 3NRBA 1EINA 5GAJA 3ZI7A 1LDNA 2ZIAA 1M34A 2ZVDA 2PJUA 4MRVA 4UVDA 3GWZA 2HA3A 4CMHA 1P9GA 1WDWB 2A59A 2YFYA 1G0NA 4DA0A 2ZTSA 3FPHA 1WL8A 1UL1X 2BTOA 1CGII 3SEKC 2JZNA 2OXFA 3FDXA 1ZINA 3IHWA 4KYTA 3DMNA 4WTOA 4D9KA 1VHTA 2IE8A 2FB9A 1SXHA 3I6ZA 3QVGB 5BWBA 3IESA 5KDOA 1N6OA 2VBGA 3CA8A 3N70A 4IHQA 3RH0A 1YRHA 5DYGA 3TTWA 1E1YA 2NAFA 2PSSA 4C87A 2J7PA 1IEVA 1DELA 3FVRA 4YAFA 2B30A 5EJMA 4CQJA 2YYZA 1ECJA 1WVMA 4MVJM 5KKNB 2PQ0A 2ODTX 5AM2A 2KMPA 1NNUA 3KSDO 1AO3A 5LMUB 1L7BA 1CB0A 2ZVPX 1H69A 1E3WB 4M0KA 4MWZA 1N2CE 1ILWA 3OP4A 5HZKA 2O7NA 3KVOA 3GVPA 1OYVI 4KXMA 3DLHA 1C1DA 1E2PA 2VJAA 2E1PA 3CN7A 2HRCA 1A77A 3KZNA 3QP9A 5KJEA 1JT2A 4MICA 3RR2A 1Z22A 2AWOA 3RVOA 1X1TA 2X86A 3EIWA 4FS8A 4ZO8A 3A9VA 1CUHA 1HE3A 2PZFA 2I66A 3MTAA 3K92A 1Q6YA 4PO8A 3E18A 1QKIA 4EF4A 3AVXA 1YZFA 1QKJA 1UMDB 2I87A 3UFXA 1DUSA 1XVLA 5AOCA 1L6RA 1QE3A 2LDBA 3GG9A 1C3LA 3ZEAA 5KNCA 5KYXA 2ZTUA 2XY4A 2DCUA 3SNHA 5LIRA 1VFPA 1RYFA 3I8OA 2JGAA 3M4XA 3EEFA