4UXIA

Leishmania major thymidine kinase in complex with thymidine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
164
Chain Sequence
FRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 44
structure length 164
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxiA01
4URUR 1W1WA 1E2IA 1VIYA 4KYUA 4JLNA 2X1VA 4MYCA 2BHRA 5DI3B 4B47A 4URVR 2O8CA 2DYKA 2ZU6A 3AVXA 3C5HA 3M6AA 2PZGA 4UQOA 2HT1A 1MV5A 1IXRC 2FFQA 2XSZD 2BVNA 2LWIA 2OILA 4C0AC 4EJSC 3BIFA 1OXXK 4U5XA 1QDEA 3OEHD 1KI9A 3SYKA 3B1YA 2WJGA 1NBME 4PC7A 4IOMA 1GKUB 3KDSE 4GT1A 3IPXA 1N2CE 3K1JA 1RJ9B 5IK2D 5HE8A 1UJ2A 4BLPA 2QENA 1CR0A 1LF0A 1UDWA 4CEJB 4A6PA 2AX4A 3ZS9A 3AVQA 2W6JA 4IXMA 3K0FA 3WBKA 5GJCA 5CITA 4LDJA 4TWZA 3RYTC 1E32A 1NIJA 4W7SA 1QHXA 3SJAA 4AYWA 3OESA 4IDHA 1HE8B 2GJKA 4NCKA 3RANA 2EFHB 1ODFA 1G8PA 1NLZA 4RVCA 3I8XA 4PC6A 1AIPA 2VTKA 5KSPA 3K70B 1UDXA 2CL7X 4YDSA 3THYB 1RYFA 1ZJ6A 3LWNA 4NYMQ 3RVBA 2WWYA 1TF7A 4FN5A 1LVGA 2RCNA 4G5SA 4O0MA 5KDLA 2ZU0C 1D9XA 1FUKA 1ZIPA 4TYPA 4HDCA 1AJEA 1N25A 3CNLA 5FR2A 2WICA 1L4UA 4P3YA 4DCUA 1IY2A 1KI1A 3GJ8A 4JYBA 4Q18A 1YJ5A 5EE0A 2WTUA 1JECA 3QXJA 3GJ6A 2ZE8A 3H0KA 1TQ4A 1E9FA 2PEYA 3KJEA 2ZTSA 1W4CA 3AQ4A 1G7SA 2GF0A 1Z63A 1Q3HA 2QE7D 3FTQA 4BLRA 5FTNA 2UVQA 5JWRA 2QI9C 2V7QD 4DT1A 2XAUA 3F8TA 3PUVA 3GD7A 4OK3A 2Y8EA 4M1MA 3V9PA 2P6NA 5CB8A 5ANRB 3NBYC 1AA9A 2KI5A 1RW4A 4P32A 3MCAA 4LUCA 1DELA 2YWGA 4LY6A 2IS6A 2GXSA 2AWNA 3QY0A 3UG6A 4B71A 1J8YF 4EKDA 2XOKA 1M74A 1IN6A 3AGQA 2ZJ5A 3BB4A 2XTNA 2O8BA 2OE2A 1G7TA 2AFIE 1OT3A 2HCBA 3DKVA 3KL4A 4PHHA 4UXIA 1NN1A 1F3OA 2IXEA 1E9BA 1W0JA 4HDOB 2AL7A 2C96A 2WBLC 4Q4HA 1E0SA 1KBFA 2BJVA 2LKCA 1UEJA 3NBFA 3WNCA 1E3MA 1LB1B 1H8HD 5KYKA 3QXSA 1OV4A 2CLCX 4M9ZA 4GMDA 4Z51A 2GDJA 1IOZA 5G3YA 4JBYA 3ZVRA 2QP9X 4BECA 3QSYA 1GM5A 3TJZA 4RD6A 3FMPB 3OIVA 2ATXA 2BKEA 1G19A 4QBGB 3H2YA 1NN3A 4UNSA 1T5IA 3GMTA 4R9UC 5FL3A 3K0AA 3Q5EA 3GFTA 3CZQA 3UKDA 2ECKA 2BM0A 3CRW1 4BGDA 3ADBA 2QAGC 4MRSA 1J2JA 2GEVA 2WMNB 3QJYA 4S2EA 1QZXA 2JJ8A 1DAMA 3GEIA 4A0GA 4I99A 4TL6A 4M2LA 3U5ZB 3I62A 3T1TA 1N3BA 1WP9A 1Z83A 1N6NA 2H57A 2FGKA 4US1R 2Q21A 1G7CA 2AXPA 3THOA 2O8FB 1E94E 2C98A 4B2IA 4TYWA 3NTUA 4LBYA 1PVOA 5DYGA 4AG5A 1SVSA 5E95A 3W3ZB 2FSFA 4H9GA 3PUYA 2YYZA 2J46A 4D0LB 1NSTA 1E4VA 4GMXA 2GILA 4TLDA 1X3SA 4L9SA 1GNRA 4ZI2A 4V0LA 4Z8YA 3ZD6A 3I1FA 2ENNA 4PO9A 2ONJA 4LYHA 4BEBA 1SVMA 4R7ZA 2XB4A 4CEIB 1US8B 1Z2AA 1UM8A 4D4JA 4C7OB 3B85A 1P75A 3GFOA 2AXNA 4OI2A 2ZS9A 3GQBA 5SZHB 3EZ2A 3KUDA 1Z0DA 3OE7D 3KJHA 4F38A 5BQ5A 1YR7A 1G5PA 2J41A 5E3HA 4B76A 2OCYC 4K81B 3MWKA 2XZOA 3IEVA 3GP8A 1XFAA 1KNXA 3EIHA 4HUQA 1G8HA 4TMKA 3W6PA 4YMSA 4B3XA 4L15A 2AD1A 1U8AA 4KJZA 3VMFA 2JLXA 1SXJB 1EK0A 2F9LA 1QHSA 4M9QA 5EP3A 1F5NA 3RC3A 3FKSA 4V03A 4Z1MD 2ZJ8A 3K9GA 4JLOA 1JR3E 1KMQA 2CVFA 2QZ4A 2ZUDA 4JL5A 5CB6A 3SDZA 1KBEA 1TPZA 5AJWA 3WMFA 4HLQB 4QHYA 1D6JA 2ANBA 2IYTA 1SZPA 4FXPA 4IFEA 4B33A 3LH5A 1GWNA 5JSZA 1GOTA 3SN6A 4CDGA 2QM8A 1DAGA 1XDBA 3AVTA 2PT5A 5G53C 1OB5A 1NIPA 4A2PA 3KJIA 1DAIA 2OXCA 2R9VA 3ZVMA 2QUZA 1SVKA 2L0XA 3UWKA 2WJYA 1KTVA 4PR0A 2O8EA 4WBSA 1LW7A 2NTYC 4LC0A 3I73A 5C1BA 2DB6A 1A7JA 1M34E 2D74A 4HB0A 5H68A 5KSZA 1WA5A 4TT3D 1DEKA 1IAQA 1IHUA 4RJLA 3X1ZA 1ZD1A 4DSUA 3ZLJA 1G41A 2RGDA 1BMFD 1RE0A 4MKGA 3CF2A 1VHTA 4E09A 4V02A 2F55A 2BBSA 2DBYA 1NJFA 3FYHA 1XB2A 4B32A 1ZW6A 4PQYA 1OYWA 2HEIA 1XX6A 1QG2A 3CR8A 2FE4A 3I8SA 1HURA 5JMTA 1GG2A 1AQYA 5BYKA 1E2JA 3T1OA 1DE0A 4I1VA 2XX3A 2ZI4A 5AJVB 3KQLA 4A0HA 1HE1C 1XEWX 2CJWB 3I61A 3DZDA 2ZM5A 1P5ZB 1C9KA 2F7SA 4Q03A 2QTVB 1IM2A 1OFUX 2ZQ5A 1IY0A 3VHXA 4GOKA 4JLJA 1QHYA 3L8YA 5D3QA 1P2UA 4DKXA 1RRPA 1JEDA 4B3CA 4E22A 3ZS8A 4XWAA 1SGWA 2IYQA 2C9OA 3HYTA 1JQJC 1BIFA 5TVKA 2J87A 2WHXA 1MOZA 3BFVA 1KKMA 3CXLA 4P31A 1BOFA 1YZGA 2DPXA 3GLHB 3SC3A 2WZQA 2ZRHA 2P6RA 2B92A 4WIAA 4DSTA 2BMJA 3UANA 2GJ9A 3K9NA 2RGAA 4ITRC 1G1MA 3LXRA 2F3RA 5J4VA 3AF1A 2Q3FA 1ZM9A 1MH1A 2VIIA 4ZDJA 1KK1A 1PUIA 4ZKEA 2GJ8A 1XZQA 2V4ZA 2IHBA 5DYIA 2QMEA 3RRZA 1N5LA 4F93B 2D2FA 2GXQA 2WAXA 3FWYA 2FNFX 3KTAB 1N5IA 2WSSD 2A5FA 3A58B 2CL6X 2ERYA 5AR1A 2ZRLA 3LD9A 4RZ2A 2CBZA 4XSHA 3TQCA 4OHVA 2ROWA 2WJHA 1Q20A 4A2QA 4DLXA 3PEUA 4LC1A 4F4JA 4WW0A 1E79D 4HB3A 2BM1A 4DLUA 2V54A 3TVTA 4HZUA 1KI6A 4AG6A 2F3TA 1R0YA 1S9HA 1E0JA 4BFTA 2OAQ1 1L8QA 4OQFA 3OEHA 4TYNA 4KSBA 3AVYA 2QG6A 1KO1A 3K09A 5KHOC 4OI0A 1N0VC 2DWQA 5FUWA 2QT1A 1LTQA 1JPNA 4MUBA 3L0OA 4Q48A 4DZZA 5IK2A 3EPLA 3AF4A 5HZKA 4LBVA 4WVFA 4RCZA 2XJ4A 1OW3B 1XEWY 3X1DA 3C8UA 3ADDA 4B43A 4BUJA 1LS1A 2G77B 8OHMA 1AS3A 2JLZA 4QJ5A 1L7VC 5KPDA 4Q4AA 4D4LA 2GVZC 2P67A 5H8WA 1JPJA 3QKSB 1W4BA 2OM2A 4C0KA 3LQQA 1CJVC 1ZAKA 3WYFA 4M53A 1SXJE 3CIOA 4P4SB 4DCNA 1NL3A 2YVUA 3RNLA 3K0CA 2RAPA 4HAWA 4B48A 2ERXA 2VQSA 3RRNA 4XVRA 2FZ4A 2OFOA 2FN4A 4G1UC 3J81k 1LNZA 2P5SA 2OLKA 4BEJA 1BYIA 1KI7A 1Z6GA 2WJIA 4I1UA 3X1XA 1T8UA 1ZIOA 1M1YE 2W2XA 3T1QA 1RRCA 1C4OA 1D2EA 4GZLA 3VNVA 4IDNA 3CB4A 5CYOA 4PZZA 1YZLA 2GJAA 4JVNA 4MQBA 4DEYA 5KTYA 5KU1A 1RVDA 2REBA 1YRBA 2AK2A 3RRYA 1EX7A 1KOFA 4OQLA 1EFTA 1GL7A 3FGNA 1T8TA 4QBFA 1CU1A 4QM7A 1IN4A 4MA4A 1NVVQ 4MRPA 4FW9A 2IUUA 4DHEA 2VP0A 1HUQA 3IHLA 4TQAA 4D4MA 3UGLA 4BPBA 2C78A 2RGBA 2V7QA 2BMFA 2F1RA 1M7BA 3MRSA 5FUVA 2REXB 2WIBA 4M1YA 3VKHA 1II9A 4A0RA 2J0UB 1XEXB 5FBVB 4TLCA 1VDZA 3VHLB 5L8VA 3DDCA 2VRWB 1U9IA 2XNSA 1ESMA 3EIEA 3QG5A 4IFBA 4PQRA 2D7DA 2W2TA 2ZJOA 2PJZA 721PA 1KAOA 5FTMA 3CBQA 2B8TA 5C2JB 3RRMA 2N1BA 1VKJA 3EAQA 2AD5A 3BE4A 1NVXQ 3CONA 3I5XA 4QFMA 3PENA 2P5TB 4ZIRB 1NMYA 5AJXA 1G5RA 3UATA 5F2EA 3CNNA 2XB2A 3CR7A 3KB2A 2QPTA 1H8HA 2GXUA 3CRRA 4ABYA 2BEKA 1GUAA 1OIWA 1T4GA 2FZLA 3I4LA 4A8JC 5AUOB 2ZR7A 5H1YA 3ZVNA 1DAFA 1E1RA 1KDOA 1QG4A 4O25A 4J0QA 5AWFC 1E9AA 3RSOA 4NPHA 2ZYVX 3FMIA 1JAIA 1RZ3A 3GLHE 2WJJA 4BFXA 3X1YA 2MMCA 1QHGA 5L3SB 2ZEJA 1V43A 5B30A 1YZNA 1YZTA 1XZPA 4IOJA 3IQWA 3A1VA 4N3NA 5TARA 4ZCLA 4V0NA 1U8ZA 1DO0A 1GIAA 3AH8A 4A36A 3O8BA 1JR6A 3THWA 1WQ1R 2HYDA 4NCJA 5K8LA 1TBNA 4HEJA 3G0HA 2ZSEA 5JCZA 3U3MA 1ZRHA 1MRSA 2R6DA 3LLUA 4URZR 4RCYA 1M7HA 2VP5A 2BCJQ 4KVAA 5FPYA 2FV8A 4V0OA 2JLSA 4KAXA 1N6IA 4OKSA 4JT2A 2GRJA 4B73A 4Q1FA 5CK5A 4G01B 1GRNA 4L8GA 1NKSA 1NBMD 3VX4A 4PSKA 1PTQA 1E2PA 2WKRA 1ETUA 2ZI6A 4FD2A 2JLUA 4A15A 2PMDA 2E9SA 4LHZA 1Q22A 4JT4A 1NLFA 1YE8A 5EE3A 4M1WA 3W5IA 1OH5A 4GOXA 5JI3E 4DIEA 2JATA 3PV0A 4QJ4A 2R6AA 3ETLA 4M8NE 2FX3A 1ZVQA 4B6DA 3JZAA 3ZZ0A 4NDZA 1Z6AA 2GVDC 1U81A 3Q3JB 4A9AA 4Q7LA 4EJSA 2XZPA 3FVQA 1NG9A 4LPSA 1NN5A 3AUYA 3OE7A 4DLSA 2E1RA 4RD4A 1Y8FA 4IDPA 3KB1A 1R6BX 1XXHA 2FFBA 2Z6VA 3LBNA 5EXXA 1CR2A 4WOPA 2DB3A 4NE2A 3NDBB 4WZBE 5EXSA 1P9RA 1T3LA 4OI4A 2CNWD 4UKDA 5CK4A 5E7JA 2QM7A 3PR1A 3RS4A 2PMKA 5CDFA 2ZI7A 4PAQA 1AK2A 5E7IA 2R2AA 2WKQA 3NC0C 4PSAA 2X2FA 2CLDX 4OBEA 4Z1MA 4XIGS 1VG8A 3FKQA 5FUXA 3VQTA 1P61B 4HLUC 3CM0A 3AV0B 5IDVA 1E1QD 1JALA 2J59A 5SZKB 3WP0A 1UEIA 1X6VA 1ZINA 4AIIA 1KSGA 1QHHA 1WCV1 3LVRE 3QBTA 1PJRA 1II8B 2ZSFA 5C4GB 4D81A 2ZI9A 1AN0A 4Q7MB 1E2KA 3TBKA 2A3RA 2ZS8A 5FPKA 3SEAA 2NIPA 1JBKA 1S1MA 2ZYUX 1G8GA 3UIEA 3CPHA 1KO5A 4TT3A 5D3MA 1KMHA 5FPTA 4ZV4A 5L3QA 1P73A 4Q1BA 3QKRB 1XTRA 2VO1A 3Q8XB 4L4UA 4B6FA 1CEEA 1EGAA 1BMFA 4ZI3A 3LLMA 3B13B 1X86B 2TMKA 1NG1A 5JECA 2IF0A 3MAAC 5KPJA 1MO3A 1UPTA 2IEYA 1NVVR 4QC2A 3EPKA 3GJ3A 4BZXA 1E4YA 1Q1QA 3K8YA 3PIRA 3GJ5A 5KSOA 1VG9B 5CM9C 4YMTA 1R4AA 2QTFA 3SYLA 2GCOA 4FINA 1VCOA 2CHQA 3QOFA 1N5JA 4KBFA 3REFA 4YMVA 1MABA 3LW8A 5JHGB 2XXAB 3WHKA 2HT6A 3WRXC 2CLSA 2GTPA 2GCNA 2IXGA 4E07A 1OH6A 4QG7A 5GVSA 1XMSA 5H70A 4CT4B 2OFXA 3MWLA 1EWRA 1NKTA 1DAEA 3H1TA 4ACBA 3EZ7A 3U3JA 3MFYA 4MITA 1KHTA 4YC7A 2GF9A 1G6OA 2PEZA 4PC2A 4EPXA 3KKPA 3THXB 3NC1C 2OXRA 2IYUA 1ZNYA 3SFVA 4LBZA 1R8QA 4GNKA 3UMFA 3A4NA 4OK5A 3TSWA 2EFCB 2NO1A 2QMUA 3EC2A 1ELOA 2OCPA 2XJ9A 1I4LD 1ZUNB 4RFSB 3U4QB 4Q7KA 2C8VA 5AJZA 3ADCA 2ZJBA 2PLFA 4Q00A 1U8YA 5FPHA 1NP6A 2QRZA 4DLYA 4PPFA 4UJ3A 3NHAA 3MJHA 2QY9A 1SVLA 4I1OA 3SZRA 4JLKA 1Z0IA 1UF9A 3EPHA 2QAGA 4CRWB 4GZMA 4G0NA 3BXZA 1E2FA 1E6CA 2D3WA 3C4JA 4DVGA 1FUUA 2GESA 1W48A 2QMHA 2WSSA 3QBVA 4IVRA 2OCBA 3AGPA 1VYUA 4RSGA 2FFHA 2AFHE 3CRMA 4AYTA 4EAQA 2IL1A 1DAKA 2ZRMA 3TNFA 1CLUA 3NVAA 4MKHA 1G17A 4BFZA 1IJFA 2KE5A 4URXR 4M0LA 5CLLA 1E79A 2JCSA 3B6EA 4W9MC 2WWIA 4HLDA 1M2OB 2QU8A 4OQXA 3NIBA 4C0SA 1J90A 2QNRA 3RLFA 3D3QA 4TZ0A 1AZSC 1OSNA 4KFUA 4DXAA 1OPXA 3HU3A 1VCMA 2PZFA 1GFIA 1OF1A 4Z8XA 3Q85A 1SXJC 3VR5A 5C4MA 2XNDD 1CJTC 3B9QA 1FQKA 4PZLA 4B2LA 1N6PA 2W0MA 2V1XA 2HXSA 3E1SA 3BS4A 3D8BA 2NO9A 4HAUA 4TQUS 4OQMA 2JJ1D 3WNDA 4GSYA 2OO7A 3EZ6A 4GP7A 1G291 2YINC 3PG5A 2A9KA 3K70D 2CHVA 2EWVA 5J4LA 3WYAA 2FG5A 2JDID 3BWDD 3PCRB 4LZZA 1QRAA 3BFXA 3AVVA 3DHWC 4KVGA 1XP8A 4KODA 4BWYA 2ZREA 1K6MA 2I4IA 2R8RA 3GLGA 3TE6A 2OBLA 3G5UA 3OIYA 1T9HA 4LHVA 4ESVA 4KFRA 4V0KA 4Q4LA 2DY1A 4MKIA 3RWOA 1EESA 1TU4A 4C9BA 1W49A 3PXGA 1JQLB 1G9XA 2VEDA 5FFMA 3V4FA 1KDPA 4KV9A 3FPAA 4NONA 1HQYE 1TEVA 2WMOB 2I3BA 1MO6A 3GEEA 1UBEA 3GLIA 1AZTA 3BFKA 3CUEF 2B7CA 3SOPA 2R6GA 2ZRIA 4Q4JA 3GLFB 4CT5A 2WWWA 3OIWA 2QBYB 1F2UB 2OAP1 2V8OA 5FBWB 3EA5A 3D6TB 4NYJQ 3C15C 4G5OA 4GL2A 1Z08A 1OKKD 5KSYA 1F2TA 2O8DB 2J7PD 2IYXA 3QENA 1W36C 3CKLA 4Q19A 1SVWA 3U3KA 3ZZUA 2FSIA 5J4KA 2E73A 1N6RA 2A5JA 1KY3A 3IIKA 3QF7A 3VAAA 2JA1A 5EZ6B 1XJCA 3W90A 2O52A 1G21E 3ZQJA 3Q5DA 4PPGA 3TK1A 3PUZA 3GJ7A 2VA8A 1CR1A 2VF8A 2HUPA 3U3OA 1ZNXA 3TGPA 4ACAA 5E4FA 3IO5A 2VSOA 521PA 3U44A 4AKGA 2W58A 3LV8A 2PT7A 1ZP6A 3IBYA 3MD0A 3C14C 4JSYA 4NH0A 3B2EA 1E9RA 3C7KA 3KFVA 1H65A 1QVRA 2QTHA 2VP4A 2BCGY 4TZ6A 3OF5A 4EIWA 1OHHD 4CEHA 1VHLA 1PUJA 1N0WA 2EVWX 3VR3A 4HB2A 4IDQA 1IN8A 4A2WA 3B1VA 3SE0A 2H17A 3GPLA 1OIVA 3O8DA 2JLYA 1Z0KA 2IUTA 4IEEA 2EFDB 5AJYA 3AKCA 2X2EA 2WPDD 1KY2A 1PTRA 4FCWA 2QSYA 3MGCA 2X77A 1XTJA 3QI2A 4ZCIA 4LYJA 4X8OA 4LV5B 4IOKA 1KYIA 2KJQA 3EG5A 5DISB 5FOUA 1HT2E 2FSGA 3BORA 3NH9A 1GRQA 2C5LA 5FOWA 5F9HA 1TNDA 4EPTA 4JJZA 1OYYA 1N0UA 5KNCA 1P72A 1R5OA 3KQKA 1FTSA 3I5YA 1AGRA 1EG7A 3FE2A 4DLZA 2P65A 4I4LA 2MMGA 2VPPA 4KLNA 4BFVA 3TW4A 3TSZA 1S0UA 4DLVA 1L4YA 2R65A 4MYTA 4MDFA 2G9NA 4HB4A 1SHZA 4TLEA 2ELIA 1E69A 1ZBDA 1Q3TA 2NOAA 4HUTA 5IT5A 2AK3A 4PAOA 5EP2A 2IS1A 3RS5A 4LX0A 2O0KA 1W7AA 4FMCF 2QRNA 2IYWA 4FMDB 1N6LA 4LRWA 2FEOA 2ODEA 4QBIA 4R98A 4A92A 1ESNA 1JAHA 1OLOA 4YONB 4DDTA 2EYQA 2A5DA 1NRJB 3G82C 1W5TA 4Q02A 1DG3A 4TMZA 4ESHA 2BMEA 5FTKA 1KMHB 1FZQA 1FX0A 1OIXA 2R6FA 1VIAA 3M0EA 4QGAA 2Q3HA 4MGKR 4K46A 2F43A 4ZDIA 3BH6A 4PHTA 4Q1EA 3BJIA 5J4HA 1ONBA 2QT0A 3HU2A 1XD2A 3QXHA 1HTWA 4ASUD 4Q1CA 2IHYA 1CXZA 1CKEA 1P60A 1T0HB 2XEXA 1DPFA 2VH5R 4JLMA 3AUXA 2KBEA 2EU8A 1GAJA 1W47A 2ZI3A 1U0LA 1GTVA 3B60A 4RFVA 5EE5B 5HE9A 5EXPA 1LS6A 2ZANA 3IDQA 1SXJD 3TVDA 4D0GA 2CDNA 3OZXA 2V3CC 2BKUA 3AP3A 2CNWA 3BK7A 4NCNA 4Q7JB 5TMPA 1VPLA 3R9IA 1E0KA 5TY0A 1WBBA 1QHIA 4JMPA 3UWOA 3BERA 3WBJA 1SVIA 2ZUBA 4QM6A 4OK6A 2BC9A 1BH2A 4OJQA 2WSMA 4V0ME 3P27A 5DLQC 3OEEA 3QQ5A 2QGZA 2NZJA 4FWIB 2FPMA 2H18A 1W36B 1MRNA 4FCVA 1T0JB 1E1QA 4C0HA 1G20E 2JLQA 4TTRA 2O8CB 2OCAA 2ZJYA 3IGFA 1E2EA 4PX9A 2WVJA 3W5JA 1W4RA 2VL7A 1Y63A 4UNNA 1D2NA 3MMPA 1AGPA 1XF9A 3E2IA 121PA 3ND8A 1VG1A 5GJWC 1NMXA 3NXSA 1KK3A 3GLFE 2ANCA 3A36A 2XZLA 4M1KA 2HF8A 4P4TA 5DGXA 3C5CA 4PC3A 2AN9A 4LYAA 3L0IB 2GETA 4B6EA 1UAAA 4Q9LA 4NCHA 2ZETA 2ZI5A 1HY3A 4XTRA 4CF7A 1E2GA 1SVOA 2JLVA 2V55B 2HLDA 5HTKA 3KFXA 3QEJA 4NYJR 1X8LA 1C1YA 1P9NA 1S8FA 1XU4A 1ZM3A 4U7DA 3K0FB 2OEPA 3BD9A 2AWOA 1OXSC 3BOSA 4TL9A 1W36D 5GJVC 1Y3AA 2JJ2D 2E87A 2GAOA 1S9DA 3Q7PA 4Q5IA 4X8HA 4UNRA 1YVDA 1TL7C 3L0PA 2VSFA 1E9CA 2GWHA 4JVMA 4ARZA 3N2IA 2J1LA 5FH9A 3QF4A 3FB4A 2XTZA 3A1UA 2QROA 5JJLA 1PLJA 3TAUA 2CL0X 4A6XA 1XRJA 3V4RA 3OHMA 5CLQA 2QPOA 2PCJA 2A5YB 2RGEA 5FL7D 1UKZA 2WWHA 1DOAA 2HDNB 3CWZA 3GFPA 1DARA 1UBGA 1OFTA 1LV7A 1FMLA 3PJRA 5B57C 1A5TA 1CRPA 2DFLA 4F92B 1AQUA 5EXTA 2VP9A 2XSZA 4N1AA 1D2MA 1Z29A 1FL9A 1WXQA 4LJ6A 4A8JA 3SQXA 4EQ6A 5FBLB 2ZRFA 3NDPA 3VU9A 4M1SA 1CR4A 4B75A 2F6RA 3EARA 5J40A 4HYYA 5G40A 3SHFA 4HSEA 5F3WB 4XOIA 5GADl 1H8ED 3M4YA 4DT1B 4D0NA 5JZVA 4JVLA 2F9MA 3X1WA 3DKPA 2HJVA 2WWFA 1RRGA 5B2ZA 1COWD 1CF4A 1M6NA 1ZM4A 4O2RA 4Q9HA 2ODBA 3AKDA 2A7QA 3SNHA 4KITB 1LF5A 5CDFE 4AK9A 5FI0B 1K5GA 2NO0A 2YWEA 3MSXA 4QNRA 4YMWA 1PV4A 4PO1A 4B2PA 3GJ4A 6Q21A 3MLEA 5DI3A 4D80A 4U02A 2QA5A 5JHHB 3OIUA 1G6HA 4IXNA 1UKYA 2O8BB 4NCIA 1P3JA 3L0SA 2SHKA 4FKDA 3NEYA 3KX2A 4KI0A 2IWRA 3R9WA 3UMRA 4M22A 4MRNA 2JLRA 4XVUA 4WXRA 4MDEA 4Q4HB 3ZJYA 1ZM7A 1KO8A 4UNPA 2ZS7A 2RGNA 3TUZC 1BKDR 4ZDWA 3CWQA 1U90A 5BYJA 1X8KA 1Z6TA 2ASEA 4B44A 2IUSA 1TTTA 4CEJA 4XWKA 4QJ3A 1P2SA 3PQCA 3T61A 4OHYA 1CP2A 1OXUA 4GRAA 3OFND 1TX4B 2IWHA 1BYUA 3MG9A 2IW3A 3EASA 2J45A 2RGGA 4BRWA 4DC9A 1ZM2A 3K0AB 4IKEA 2VLIA 3W34A 3WNBA 2XNDA 3EPJA 1DVRA 3ZD7A 5A0FA 3KKQA 2OBNA 2A78A 3LO5A 4HLCA 2EFEB 3EIQA 1EX6A 2QE7A 2JJ1A 5GVRA 5KOYA 1XPUA 3NH6A 4RZXA 4HZIA 1SHKA 2GZHA 4KO8A 2ZRBA 4E5UA 4F7WA 4RD1A 3NKVA 3THYA 2JDIA 3EC1A 1KZ7B 2FPKA 1IXSB 2F1IA 1XPRA 2RB4A 4RD0A 3V00A 4NL4H 1R0ZA 3WP1B 4TTPA 4PHGA 3K0SA 1E2QA 1ZUHA 5L3VA 1OFHA 3DEFA 4TYYA 1HA3A 5C46F 2W83A 4LJYA 3R8FA 1YKSA 1WF3A 4L9WA 3BC1A 2I1VB 2Z83A 5FR1A 1G4AE 1JXOA 3HR7A 1KIMA 1W0KD 3EWAA 2GJSA 5DN6D 4D26A 2ZSAA 2ZRDA 5K8UA 2YJTD 2CEAA 4TLBA 1Z06A 4YLGA 4DUGD 5C18A 5IHPA 4XH9B 4MYHA 5EE9A 3IHWA 2QEQA 2RKOA 3D31A 1KO7A 1UKVY 3QPUA 2BOVA 4NBSA 3F3YA 4YXWD 2J7PA 1FAQA 1WMSA 2FDCA 2A2ZA 1TF2A 5TV2A 2OV2A 3HPQA 2ZRNA 1IONA 4AYXA 2KB0A 1P9WA 3I32A 3PUWA 4XSGA 4ZCMA 2DFNA 4BFYA 1U99A 3W8RA 4L5BA 3I3SR 4G5RA 4HUQB 1RC8A 4TMTA 1Z2CA 2ZJ2A 2GBLC 3VR6A 2FSHA 3FHCB 2HF9A 1JI0A 1AS2A 4BLOA 1KDRA 1P7CA 3K09C 4A82A 1YU9A 2HXYA 2O0JA 1JEEA 2Z0MA 2V9PA 4BZQA 2CCJA 2ZJAA 1MO5A 1JXMA 3GCGA 2ZVPX 4IHQA 4DDWA 5GJBA 4HATA 5JJKA 1G4UR 3LY5A 3N70A 1OHHA 4TMXA 1P62B 5LDDC 221PA 5JSZB 1EFRD 4EPVA 1GNQA 3SU8A 3KQHA 1NN0A 4BFWA 1OH8A 1WE2A 4Q47A 2VSXA 5EE1A 4B3DA 1TQ6A 3QKUA 2H5EA 5LB2A 2F1HA 2O8EB 3TRFA 1Q57A 2WPDA 4GDFA 1Z6XA 4WA7A 4PXAA 3K0CC 4BASA 5BXQC 1NJGA 4RZ3A 3ICQB 2CMKA 2RHMA 4K8OA 4MYUA 3W9YA 3PEYA 3U2QA 2DWOA 2IC5A 3L43A 3QVUA 5LB4A 1YQTA 3TLXA 4AC9A 1G8FA 4LHWA 4TL8A 3MJRA 1XMVA 3SJZA 3UEJA 1MKYA 2IYZA 1HV8A 1DAHA 3W3AA 4QGGA 5LPNA 3K53A 1NY5A 4NYIR 1GL6A 1R5BA 5EUMA 4KLZA 1GILA 5DNYB 3LBHA 4EDHA 3RS0A 2ODWA 4GP6A 3IBGA 1CJUC 3CH4B 1U0HC 3Q7QA 4NZYA 5JJIA 4LHYA 3TUIC 4CEIA 1S2MA 1US8A 3LW7A 1XCMA 1J70A 4BZPA 3IUYA 4C7OA 4Y0VA 5EQTA 4KFTA 5B58C 1V5WA 3AKYA 1VYTA 2NPFA 4DDVA 3AP1A 3FFBA 3TR0A 1U9IC 2IK8A 1Z6YA 4ZO4A 1IBRA 2AR7A 2V1UA 1E9EA 4ASUA 1GSIA 4LWZA 1XTSA 3IPYA 1N6KA 2D7CA 2ZE5A 2YWHA 3DL0A 4FMBB 4HAYA 2CHGA 2IS2A 1CTQA 3P4XA 2NZ8A 3U7HB 3HPRA 1SXJA 1P6XA 1G5TA 5TXGA 3FHTA 1KSFX 4YMUA 1A1VA 3TIFA 3DM5A 4JLDA 5HZHA 3VR2A 5DO9A 5M04A 5JS7A 1KZGB 3ZGXA 2HJGA 4D82A 1CJMA 4MRRA 4US0R 1KI8A 3QPWA 3TH5A 1KJYA 5B64A 4WAUA 1KI3A 3KJGA 3Q9LA 3AKEA 3T5DA 2PLRA 4Q9IA 1IN5A 4QRHA 1NVUQ 3VNUA 5JI2E 1GVNB 3DVLA 4II7A 3DZ8A 2W6ID 2EFGA 2FF7A 3GJXC 2IA5A 1VCIA 1Z8FA 5JWOA 4M21A 4JLVA 5F98A 2GAAA 3L8ZA 4UJ5A 1NSFA 4P0TA 1ZYUA 4JSTA 3A1SA 1Q1ZA 4HZUB 1KI6B 4Q1AA 1R7RA 2A30A 1KO4A 2BDTA 1E9SA 2ZAOA 2ZRPA 5KUTA 2NO7A 4KHZA 2ZRCA 4GI7A 1DS6A 1Z0JA 1KJZA 3CH5A 4JL8A 3WXMA 1MT0A 1Z07A 3B1XA 3LNCA 4OQNA 4DWJA 3H4MA 4OHWA 1W44A 4BRUA 1K5DA 4JKIA 1QBKC 2KBFA 5A5GA 5DH9A 3MWYW 3ASZA 2FJUA 4M1TA 2WOOA 5EJEA 2YOHA 4DLWA 4DCVA 4TSFD 5EP1A 1Q1BA 2CCGA 3CZPA 2JJ2A 1VECA 3BGWA 4Q4AB 2CJWA 3T12A 5TB5A 3REGA 3KUCA 1ZC3A 3SJCA 2W00A 5DE3A 4B35A 2J0SA 1WRBA 4GFDA 1I2MA 2F1JA 4DCTA 1E9DA 4OJKA 3OAAD 2G0NA 2Q9BA 2UZ3A 2DFTA 2FEMA 2W0SA 4XJXA 2GHIA 1IJEA 2D06A 2OSBA 1FMJA 5DSZA 1XJ0A 4XD7D 3T1VA 4Q21A 5HKKD 5BN4A 4HDQB 4TMVA 1B23P 4Q9KA 2PX3A 2BIFA 5G41A 4D2IA 1RPZA 1YR6A 2IYYA 2J0VA 2QP3A 1G3IA 1A2KC 5FL7A 2VHQA 2ZSBA 3GLHA 1NF3A 5JCPA 1R79A 1N6HA 3LQRA 1CIPA 5LBIA 4B34A 3QE0A 4D4KA 3C16C 3CLVA 4QL3A 3LBIA 2WIAA 2KWIA 2FU5C 2J9RA 1YHNA 3CX7A 3CPJB 4TYQA 821PA 1D8TA 2B7BA 5JFGA 3JZMA 3PEVA 3QEOA 1E96A 4KXFB 1S3GA 2G3YA 2REOA 2RMKA 4AWXA 3FHOA 1HEIA 4UXJA 1KKLA 2NO6A 2C9YA 4ERNA 1Z28A 3SJBA 2CXXA 3LDAA 1FPMA 2ZIAA 3WMGA 2ATVA 1H8EA 3KTAA 1YR8A 2JIZD 4P33A 3CF0A 1Q12A 2ORIA 2QQEA 1COWA 3DO6A 4DEXA 3VR1A 2C99A 4MRVA 2VHCA 1XD9A 1CBUA 3HJNA 1JR3D 1AKYA 2EW1A 4LI0A 1F60A 1TF5A 3W6NA 1OXTA 4TQ9A 5HCNA 4WZAE 4QHSA 2VHTA 1ZMXA 1I2DA 3ZVLA 2G1JA 1EFUA 1KNQA 2J3EA 4FMCB 4M4SA 1X1SA 4ZPXA 2OBMA 1XA6A 2C77A 1VTKA 3ZQ6A 4LV8B 3FMOB 1KI2A 3WYGA 1ANKA 2QL6A 2WM9B 1S96A 1IXZA 2ONKA 5JS8A 2ENZA 2YV5A 2VP6A 2ZROA 4PANA 2CK3D 1RRFA 3LAWA 3U61B 1ZU4A 2Z4RA 1T3SA 1A2BA 1XWIA 1NLYA 3ZZTA 4LOAA 2YKGA 3ICEA 4CIDA 1E98A 2FNAA 1R8SA 2J5XA 3A1WA 4LJAA 2ZUCA 3R20A 4ON9A 1SULA 3OFNA 2ZJZA 2NPIA 3AVWA 2P6UA 3UEYA 421PA 3S1AA 3TW8B 4KSCA 5HPYB 4AY2A 2G83A 4JLBA 3P4YA 2XGJA 3VKGA 2YWFA 3QKSA 1NMZA 4DB4A 1G64A 2C04A 2CVHA 2G6BA 5FUYA 5EUQB 4C4PA 2ZSDA 5KDOA 4P4SA 3ZYCA 4BLQA 1JJVA 4PFSA 4W5HA 4NTZA 2IXFA 2I1QA 3B5JA 3VKWA 4DLRA 3THWB 4DIDA 2VHUA 4X8LA 5FOSA 3VTKA 4IOLA 5BW8A 5TDHA 2QPAA 2O0HA 1ZNZA 3M1IA 4DRZA 3HU1A 1E1RD 1M7GA 2QSZA 4LYFA 2H7VA 3LX5A 4KFSA 1OJLA 3LXXA 2C95A 5K8TA 3U7EB 1GDDA 2Z4SA 1G16A 4TN1A 2OESA 4RKEA 1KGDA 1Q21A 3UGDA 1W0KA 3RC8A 4I1SA 1NI3A 5DN6A 3NEJA 3SFZA 3DOFA 5AUNB 3AVOA 4LJ5A 1E2LA 4A0FA 4CZ2A 2Z43A 4XTCS 4B3BA 4DUGA 3BH0A 4LJ9A 3FFAA 4EJSB 1LY1A 4MKFA 3UXMA 1GKYA 4MGYR 4KBGA 1MO4A 2J0UA 1XEXA 4YXWA 1R2QA 1SKYB 4PZYA 2ZRAA 1HQCA 5SZJA 1XXHB 1TQDA 4LGMA 2YC2C 1I4DD 4IEIA 2VRWA 3ZH9B 2B21A 5KNBA 2BEJA 2UZIR 4FWTA 4S35A 2QN6A 2WJVA 3DPUA 1FOEB 3I92A 3WRYC 3PUXA 3LRPA 2DR3A 4A1FA 2H16A 5JEDA 1ZC4A 1Q44A 5DHFA 2PJRA 4MH0R 2OLJA 4ZIRA 3R8CA 2ZAMA 2KSQA 2UKDA 1DG1G 4NKRA 1L2TA 3AB3A 4IW3B 2H92A 5EP4A 2DFKB 3EZ9A 3I72A 1ZUIA 1CJKC 1T91A 4ZKDA 4LJ7A 4DB2A 3K9HA 1EFRA 3EA0A 1KSHA 2YZ2A 1GKIA 2OT3B 1QHHB 4C2UA 2FH5B 4POAA 1NBMA 4FI3C 4AURA 1ZCBA 1VCNA 1R0XA 1G7RA 2ZYTX 5L3SA 2O5VA 4I81A 4W5WA 1P2TA 1GITA 1M8PA 2QGNA 4GOJA 4OHXA 1HYQA 3O47A 4WXPA 1G3QA 5JLJA 4X8MA 2D62A 1RFHA 5D3MB 2IYRA 2WAYA 4RZUA 3TR5A 3B1WA 5L3QB 1S3SA 3R7WA 5F9FA 1CULC 5L3RA 1ZD8A 2IYVA 3RS7A 3RHFA 3NBXX 4B3GA 2EWWA 1UBCA 4R2IA 3W8NA 3U6BA 3AVUA 4JKYA 4PPNA 5KDDA 1T6NA 2YHSA 4NYMR 4CVNA 2EYUA 3ECCA 1A82A 1HH4A 2GCOB 2YOFA 3EW9A 3QUSA 4C0LA 3ZIAD 1MABB 5BWMA 1GZSA 4BLSA 2Q6TA 2IYLD 1UKEA 1XNJA 3RSLA 1G3UA 2HCJB 4BFUA 1TUEA 2D4HA 2W2VA 2G0TA 4URWR 5CYPA 4OHZA 3TMKA 5JRJA 1OXVA 4MGZR 3JVUA 1RYHA 3PEWA 4OYHA 4PC1A 4AI6A 3HP1A 5P21A 4RKFA 3R9XA 1G8YA 3VX3A 3A4LA 2RGCA 5J4YA 3T35A 5EZ5A 2Q9AA 3TUJC 3WHLA 1AS0A 3FMFA 2ZRKA 1FTNA 2MSDB 4HAVA 2XITA 4IVPA 3F0TA 1G3MA 5K8IA 3O8CA 4AKIA 1K8RA 2ZVQX 5DIFA 1B0UA 2QAGB 1YRAA 2MSEB 3KZ1E 4O2LA 3TKLA 1CS4C 2JASA 2AHOA 2C2HA 4DSNA 1I4TD 3FDIA 3QXCA 1EFHA 4URYR 1YZUA 4M1OA 2N42A 3SBDA 2YOGA 3QPVA 2GEUA 3PFIA 1TEXA 3SYNA 1YR9A 1II8A 2W6IA 3BAFA 1QVAA 3SQWA 3N5CA 2YNMA 1W46A 3CX8A 3T15A 4AKEA 2Q9CA 4E03A 1UFQA 1VG0B 3GJ0A 4JL6A 5UKDA 1E2HA 5DHAA 3O8RA 4LPKA 5IRCD 1G18A 4BE7B 3AF2A 2ZR9A 1F48A 3HDTA 3QKRA 1XCPA 4QBHA 5JRZA 3KQNA 1PLLA 4W5JA 2Z5FA 3AEZA 4Q66C 1W4AA 2W6JD 4RD2A 3NG1A 2DHRA 1R5NA 4LCBA 1OFIA 2GA8A 3L82B 3U60B 1WB9A 5LD2C 1XPOA 5FPSA 1R10A 1T5LA 3HR8A 1XTKA 4FIDA 1SKYE 2X19A 1XD8A 1YZKA 3SR0A 4GBMA 2H1LA 1XXHE 1NY6A 2P2LA 2Q0HA 3CF6R 1AM4D 3DOEA 2ZPTX 1ZU5A 4TSFA 3BRWD 4RD3A 2XXAA 4IRUB 1KDTA 3TQFA 3AP2A 4NP6A 2IT1A 1E99A 2QQ0A 3H84A 3QKTA 1JJ7A 5DI9A 4FMDF 3IO3A 3OAAA 2LCFA 2LKDA 4JZKA 4NYIQ 2GBLA 3CO5A 1RKBA 3LX8A 3GLGB 3BJIC 1DBSA 4BLTA 3THXA 1TUIA 3ADKA 4PSVA 4JLPA 3P20A 3TSOA 3P1JA 4XD7A 3U3RA 2BBOA 1Z5ZA 2WKPA 5HKKA 5CIQA 2GNOA 2ODNA 1N5KA 3HYRA 3IIMA 1F6BA 1FNMA 1HT1E 4B3FX 3ZDQA 3BBPA 2DCUA 3GLIB 2IS4A 3A8TA 4RFSA 3U4QA 4Q4JB 2JEOA 3LA6A 3RS3A 4NMMA 5FOTA 3T5GA 4US2R 1RJ9A 3S1AB 2OZEA 3RWMB 3Q72A 2IF2A 4B74A 4D6PA 1FP7A 4YQFA 4UXHA 4H1UA 4EPYA 1TQ2A 3WMEA 1F2TB 3CRQA 2P0EA 4LJ4A 1Z3IX 3SS8A 1E2NA 3KKMA 3UPUA 4EFLA 4C0BA 4Q01A 4JS0A 3RS2A 4EUNA 5SZIA 1T3HA 1ZCAA 2JIZA 3KXLA 4HAXA 2N46A 2OFWA 1KI4A 4H1VA 4CW7A 2HYIC 3P26A 5HR5A 4AKHA 2XOKD 5FOVA 1XJQA 2ZE7A 4LV6A 5A4JA 4F4IA 1JR3A 3K9LA 1Z47A 4XWOA 1W5SA 4A4DA 5E7MA 3VR4A 1RIFA 2A5GA 1W0JD 4M9SA 3U44B 2YUUA 4KYIB 4U00A 4LHXA 2NMVA 4MUAA 1GNPA 2IYSA 1UBFA 2RGXA 4C30A 2JGNA 3B1ZA 4UNQA 4LSGA 1TBOA 4CEHB 4NU0A 5J47A 3JVVA 2PZEA 4QKQA 2ORWA 1OB2A 1KK2A 1ZNWA 4D25A 3F5FA 1R0WA 3EZFA 2YC4C 3KXKA 3U7GA 1FFHA 3BH7A 3U6KA 3KY9A 2ORVA 2CK3A 4FCTA 2NGRA 5FBRB 5ELXA 4F4CA 2GZDA 3NHBA 4HLUA 4QGFA 1IY1A 2XTMA 2CE7A 1BO6A 1DTSA 1XMIA 5CJPA 3A6PC 3NBZC 2QAJA 3A37A 3CPEA 2GCPA 4QNMA 4DJTA 5JEEA 1LFDB 2HV8A 3H86A 2GKSA 1WBDA 3LFUA 5HCIA 4G5GA 4ZDKA 4IJMA 3B82A 1FW6A 2BWJA 4XVQA 4BQSA 4HI0E 1D9ZA 3EX7C 2GXAA 1OKKA 2OHFA 2FPLA 1P2VA 2V6IA 3U7FB 1JNYA 4JJKA 4PAMA 4V0MA 1TADA 3IILA 1KAGA 1OE0A 4PO8A 5FBQB 2EQBA 3GEHA 5FTLA 2ZXUA 4LBWA 3MUFA 1PLKA 1IN7A 1KSJA 2PH1A 4IDOA 4LJ8A 3B7GA 4PQFA 3RABA 3UG7A 2V6JA 4DCSA 3A4MA 3W6OA 3RDPA 1MR3F 5CIWA 1J7KA 4G3XA 4JLAA 4EFNA 5BN3A 1OH7A 2J0QA 5LD2B 2OG2A 3RAPR 1II0A 4QGHA 3GLFA 1SQ5A 3VFDA 2QBYA 1F2UA 4P4UA 5AK0A 1NNEA 2ZRJA 3IKJA 3L2OB 3IQXA 4TLAA 2IX3A 4Y0AA 1Q0UA 4QHTA 1TAGA 5J5CA 1GRRA 3FOZA 5FOXA 5FTJA 1W2HA 1W2GA 2O8DA 5JBQA 3AVPA 3TAHA 2PCLA 4OI1A 4JBXA 1O3YA 1FX0B 1S4QA 3BB1A 4CGZA 3R7WB 2F43B 4MGIR 3IEUA 5BN5A 4DLTA 2P3SA 1XD2B 1Z0AA 1BS1A 2C9CA 4L16A 4EPRA 1WDTA 3SBEA 2OUKA 2MSCB 2PBRA 3HWSA 1ZD9A 3QG1A 4C0JA 4RY2A 4C3ZA 1N6OA 2BBTA 4O3MA 1YZQA 1U0JA 3FKSD 4M9XA 4HAZA 1NVWQ 3ND9A 3E70C 2BV3A 2O8FA 1XTQA 2RGNC 3SHWA 3WY9A 2C03A 2GK6A 1FQJA 2ZE6A 4JVSB 4KU4A 1D5CA 5AUPB 1PZNA 1GL9B 2RH5A 3KKNA 1VMAA 4TMWA 4C2TA 4Q9JA 3P32A 1RFLA 1U98A 1JB1A 1A4RA 3UK6A 5KNDA 3B8HA 1EFCA 3UFFA 2GEDA 3B78A 2G88A 3GLGE 2VF7A 4PPQA 3E5HA 1Z0FA 2G1KA 2VP2A 2ZITA 4PTLA 1EWQA 1XBTA 3A1TA 5CM8B 2IEZA 4AD8A 4KCGA 3DM9B 3UMSA 1O87A 3LVQE 1E0AA 2R6CA 3MWJA 3QVVA 1CRQA 2H8KA 2ZR0A 3K0EA 621PA 2AKYA 2DWPA 2CE2X 1FARA 3GLIE 5JWHA 1XMJA 3K70C 3B9PA 2GZAA 2FGJA 2K5UA 2FFAA 1FNNA 3ONWA 4EPWA 1UADA 4L9MA 2X8AA 3EWSA 4IVQA 3T34A 3IIJA 1FP6A 3CRVA 1U2RA 4GPTA 1XTIA 1XEFA 4JYCA 4NHOA 2BMDA 3DMNA 1GP2A 2WOJA 3PITA 1KK0A 4DSOA 1KJWA 1G3RA 1QF9A 3OEED 2WV9A 3SI7A 4BFSA 2FMXA 2WWXA 1XCGB 3KQUA 5FI1B 2ZYWX 2RHDA 1DADA 2R62A 2JAQA 4LK2A 4DBLC 1X8JA 4ARZB 1VYVA 1E2DA 2IBMA 2QORA 4JIMA 4CYMA 4DDUA 2VBCA 4G5QA 3QF4B 4C0QC 3ZIAA 2GK7A 4JBWA 4TL7A 2FOLA 4TTQA 5CJ2A 3N2EA 3UGIA 5AUQA 2BJWA 2PL3A 1EXMA 2JLWA 2NQ2C 1S1CA 3QXXA 1J8MF 2VHJA 1X1RA 3PVSA 3QNUA 2HLDD 2BBWA 1U94A 4WZ6A 3KXIA 1E2MA 1P4SA 1Z22A 2Q3MA 3T06B 5G3ZA 1QHNA 4F91B 1TU3A 2R44A 2WWGA 2ZRGA 4OL0A 4R71A 3KKOA 1AKEA 2QP4A 3D7MA 4QOSA 4Z54A 5IF9A 4PHFA 4YDHB 3AM1A 2FA9A 5KO2A 4A8JB 1TMKA 2NG1A 1IQPA 1Q1EA 4EQ6B 4R2HA 2J7KA 3VU9B 4N0DA 1DO2A 3NWJA 2PX0A 3CNOA 2B8WA 2AKAB 2FWRA 3BB3A 3QIAA 2B6HA 2D2EA 4Q1DA 3CX6A 3CW2A 1J99A 2QMOA 3ASYA 2CCKA 1SKQA 4ILEA 3EXAA 4N0EA 4QXAA 3AF0A 2GVIA 3C41J 3DMDA 4EFMA 3AF3A 3X2SA 2VYFA
chains in the Genus database with same CATH superfamily
4Q05A 4M1QA 1U1DA 1QVVA 4JC0A 4KYUA 2GPBA 3ID6C 3EVTA 4RU1A 2BI8A 4RTKA 2O2HA 4N5LA 2Z8XA 2O8CA 2DYKA 3AVXA 1ISHA 2QRLA 1MV5A 4M0MA 1FFYA 1P4RA 3TQTA 4UPEA 3UEOA 4WN9B 3HBNA 2XSZD 3T3EA 1YA6A 4JI8B 2BVNA 2LWIA 4NZOA 3VYUB 4EATA 3BGIA 5FNVB 3T38A 1O97D 1LBTA 1QDEA 3OEHD 3VKFA 1KI9A 4RKYA 3SYKA 1L5KA 1SOVA 2OCDA 1AKWA 5I4IA 4HF7A 3BXHA 2ID9A 4IOMA 3TZHA 1N2CE 4ZO9A 5IK2D 4G0YA 4P2BA 4P34A 5C8ZA 1CR0A 5DX8A 1LF0A 2V7BA 2BEWB 3E2MA 4A6PA 2GQ0A 2X5NA 3AIKA 1HLGA 2ZGVA 3OLZA 3F2VA 1O5OA 1JFVA 1ZMTA 2W48A 3ADPA 3AVQA 2K2WA 2YXBA 3O1HB 3QKIA 4IXMA 3WBKA 5CITA 4OFBA 4C7XA 1XLVA 3EG9B 4UW9A 5J2UF 4G37A 4JCOA 4WNAB 3RYTC 1E32A 3OT1A 5PGMA 5M2QA 4A10A 3UVEA 2ZJ6A 4LMBA 1COZA 1JIJA 1QHXA 3FSRA 3K92A 4R16A 1XO1A 1HDLA 1I7SB 2GJ4A 3DLCA 4HMQA 4KR3A 1W29A 4IH9A 4QRDA 3WGNA 2BF4A 4K05A 4PVCA 1G8PA 1KR5A 3BRWA 3I39X 3V1LA 3N2KB 2EGUA 2WGCA 1QYIA 3I8XA 2VTKA 5KSPA 2V59A 3K70B 2CL7X 1SPXA 1RYFA 1ZJ6A 1WZIA 3LWNA 4NYMQ 4UBJA 4BX3A 3JWGA 3ROKA 3GJSA 1U3DA 3VH3A 5KDLA 3C97A 4PLHA 1FUKA 2Z1DA 3L1IA 3FLBA 3GZNA 4O4JA 1N25A 1UM9B 1UIRA 2B94A 3HB7A 1GTZA 4F2PA 1AJEA 2X7XA 1SBHA 5FR2A 3NZEA 5H0IA 1IG0A 3I5AA 2A0FA 5EMMA 3TTYA 1GDHA 4YMIA 3GJ8A 3HUEA 4JYBA 4DCUA 2WIDA 5E6UA 6CHYA 5K3EA 5EGSA 2YZMA 4F71A 1C1DA 3PQ8A 4H60A 3VISA 3H0KA 2W2LA 9LDTA 3UYLA 4HGPA 3SX4A 4MMYB 3ANTA 3ZY4A 1QSGA 3GV0A 4IMPA 2FUEA 1N2HA 4JP8A 2AEJA 3PE6A 5DLDA 5C35A 3W78A 2IZ1A 2QE7D 2XECA 4BLRA 1L7AA 3ER9A 2RHGB 3OCVA 4JBHA 4RZHA 3R2JA 4L7QA 3P96A 5DHSA 1F7UA 2UYOA 4TN5A 4EF6A 5C4IA 3KK0A 3HRKA 3Q4GA 5KVQA 4H3KB 1EE9A 4RV4A 1BC5A 4ZPJA 1AA9A 5ITVA 1LLUA 1O6CA 3F73A 2YW2A 3KEFA 1DWUA 4YY3B 3NHZA 1N92A 2AJBA 2V98A 3QY0A 4BUCA 1EWTA 3L6OO 4KIGA 3UW1A 4C4XA 2TMYA 1L1RA 4FJ2A 1RCTE 1NXQA 1EI9A 5LDGA 1X70A 2O8BA 2IKSA 4DABA 1SC6A 1X1QA 1G7TA 3DKVA 1K6XA 1OT3A 5ILQA 1KEUA 2O2EA 3WGLA 1NN1A 4BATA 2I4TA 2IXEA 1E9BA 1UUFA 1W0JA 4QECA 1PNOA 3WNZA 4HPWA 3NWBA 3CSSA 1QVZA 3WNCA 4XJSA 1TYDE 3ZHXA 1E3MA 4I1RA 2C7PA 5KYKA 2ZXEA 3EXEB 4CKEA 4GMDA 4HDSB 1XCLA 1U3WA 5CGQB 4UUPA 3TPCA 4Z51A 3Q1LA 1RAGA 1IOZA 1CUIA 1PZHA 2VPWA 3C5EA 2CY0A 5G3YA 4UPDA 4JBYA 3O9ZA 1Y37A 4C4ZA 4O2BF 1R0BA 3DLTA 2XLCA 2BKEA 3RVSA 4WKCA 4UHBA 1M5TA 1T5IA 3IP9A 3K0AA 4FLMA 1M2JA 1P0PA 1EFPB 3CZQA 2HQOA 5ERXA 3O1JC 4QDXA 5J5AA 2JA2A 3UKDA 2JAOA 1NLMA 2DHDA 4LZNA 1WY7A 1QZXA 4JJFA 4A0GA 1QU3A 4I99A 3DV9A 3DULA 2WM3A 2NVWA 3EGXA 4M2LA 1Z5VA 2FQWA 4LXIA 4Y2QA 1NW8A 1RM4A 1N3BA 2BFAA 2QGFA 1A2OA 3X44A 2ADOA 1WP9A 2XCUA 2BY4A 4Z9BA 1Y5MA 2DWUA 2GZ3A 1NQ5A 4US1R 4OHPA 4WCFA 1DKOA 1CQXA 1G7CA 2AXPA 2QYOA 4GLOA 5K3FB 5CXUA 2C54A 3M1YA 3QVWA 3PNYA 1M67A 5AW6A 1FYDA 3WXBA 1NVFA 1WXFA 3LLVA 3NTUA 4LBYA 4UMFA 4D74A 1KVUA 4AG5A 5HILA 5E95A 2XBUA 4QQ8A 4U1RA 3GT4A 4GP9A 2HRQA 1N1EA 4L5YA 4R1SA 2V4UA 2GD2A 2H6EA 1K3TA 2WF8A 5DVZA 1GPMA 1NLUA 1BEEA 4ZYYA 1EHIA 2C3UA 3WYEA 4Z6KA 2DP4E 1NW4A 1E4VA 2W8ZA 1DPGA 5CD9A 1IAVA 4BU1A 5ADUS 1JPVA 1X3SA 1L4GA 2ZWPA 1L3IA 1TZCA 1ULAA 4V0LA 5IJAA 4C78A 3A1NA 2QAIA 3KAPA 2ENNA 1XCOA 3OM1A 2B1JA 4LE1A 4PO9A 2YWCA 2ONJA 4PBRA 4C6TA 4C7VA 1XRPA 4CXMA 2XB4A 1J39A 1LK7A 5ALVA 3KBOA 4Y6LA 4YALA 4PCUA 1Z2AA 5IKOA 1M0EA 5GINE 1A9QA 5AOCA 3K8OE 4FE4A 1JH8A 3G2MA 4OI2A 4FPXA 2Z2JA 4WXMA 2W70A 5C9ZA 1Y34E 3T5CA 3LQFA 1LQ2A 2L17A 4MWCA 4B46A 1QDUA 2XRYA 4TTIA 1YCFA 1AKUA 1Y9JA 1A9YA 3GWZA 4D02A 1Y5LA 3T5AA 2EP5A 3MS7A 2G1UA 5LBTA 3HWRA 2NZYA 1MX3A 3GP8A 4QBKA 2HU8A 3MJDA 3RYCA 1T2NA 3CUKA 1XDSA 2QRKA 4B81A 2GKOA 4TMKA 4YMSA 1A0OA 3O38A 3V2GA 3JQPA 3KKKA 3PWZA 1U8AA 1ULZA 4Z0NA 3BUSA 3FD8A 3RWBA 4CG1A 1J9GA 1UJMA 5ALOA 1F5NA 4MUJA 2IY8A 4V03A 4UU0A 3K6SA 4Z1MD 3OXFA 3MUNA 3TQIA 5FV4A 4JL5A 3TD9A 5CDSA 5MFZA 1W1IA 2HRZA 3HDGA 4IRMA 1Y3CE 4IGEA 1JB9A 5AJWA 3S4YA 4M88A 4Q7EA 1BVYF 1OREA 1SZPA 4FTWA 4B33A 3AKZA 1V9CA 3HXLA 4MARA 5JCXA 2BEUA 4OREX 2P68A 3KFLA 1TAHA 2QJFA 2ZB4A 2O1SA 1P5FA 5G53C 5BSRA 1V16B 4UU7A 3SZGA 3UJAA 1KZHA 3ZH2A 3OQIB 4CCYB 4N39A 3TOAA 4DV7B 5E3JA 1J2YA 1JMYA 3OI7A 3OMLA 4GD3Q 1LW7A 3T7SA 2O8EA 1O0BA 5KYUA 2DB6A 1M34E 4JASB 4WTOA 3FM9A 1YQWA 1DEKA 1IHUA 3R7DA 2VAWA 1ZD1A 1Q84A 3I8OA 4E4YA 1SXIA 4JQZA 1D4AA 1YCHA 2IFTA 3H9JA 4NS4A 4F3NA 4L3OA 3NAMA 1RE0A 1RT9A 3NP7A 3LUDA 4V02A 4F60A 4QSHA 4PSUA 3X1JA 2WSBA 2DBYA 3NDIA 1IATA 1ZW6A 2W2QA 3ELUA 3ODGA 4PQYA 4XDZA 1YQ9A 4OD0A 3S40A 1OYWA 1J8FA 2IGBA 2YWXA 3E05A 4U2EA 1M8FA 2Y6UA 1J9ZA 5J2UA 1JSXA 4XUGB 2XUZA 2ECOA 2XBLA 2IHVA 4J43A 4DNPA 1PWZA 3HXKA 3IBFA 4I1VA 1YVUA 2X0RA 2ZI4A 5K0NA 3N74A 2HGZA 5HP4A 4FHCA 2XKJE 1YQGA 2CJWB 3WLQA 4EG1A 4Q15A 1WLSA 4EEZA 3ISJA 1I13A 5DEIA 2IEDA 1RACA 2ZM5A 2WSYB 4YGXB 1C9KA 1QV7A 2F7SA 3FNIA 3N6XA 4Q03A 1IWOA 1K98A 1EK1A 4OPMA 2I55A 5LYYA 4MB2A 4FQ7A 2ODPA 1RAFA 3L8YA 3KVRA 5DNWA 1RRPA 1C3LA 2P9YA 1F38A 4QPDA 4UC0A 1K7SN 3LKVA 2IYQA 2PGLA 4M8IA 5H02A 3DAFA 2B2CA 1HDXA 1JQJC 1BIFA 5BN4B 2J87A 1MOZA 4DKJA 3UOWA 3D0QA 2R1VB 2VUTA 2QM0A 2SGEI 1EVKA 1P1JA 1ULBA 1QLHA 3SC3A 1QQ7A 2PKCA 3DE1X 4DSTA 2BI7A 2BMJA 1VBMA 1X9HA 2JFYA 3D5EA 3EQ2A 4J0HA 3BTVA 4K6OA 1E3TA 4OP1A 4YAOA 3UANA 4W5TA 4C14A 3DSRA 3KKZA 1H6AA 1GUYA 2NSLA 3PFBA 3PJDA 2ECFA 4IYRA 4RY0A 3ZCTA 4LG1A 5EUBA 1A9TA 1XQ1A 3F78A 5FWAA 1KK1A 1GQRA 3IEXA 3QELA 5MN5A 3VNBA 2GAIA 1PNTA 1GFZA 2FPIA 2JCXA 1D3AA 3L92A 1XZQA 5F1PA 3RVOA 4YREA 4X24A 1QH1B 2JHCA 2D2FA 2GXQA 3KTAB 3UTDA 5D85A 4ALNA 2A5FA 5LKRA 4LOKA 4MKRA 4RF4A 2CL6X 2FSPA 1JJIA 3GVIA 3HA5A 2ROWA 3RUEA 3ZW7A 1JHOA 1U9YA 4AJ2A 1QS0B 1ZH6A 3JW8A 3JCZA 4DLXA 5A5VA 1DZIA 4G09A 4M38A 1DMRA 1Z0ZA 4S1OA 2C4VA 3CZ5A 1QK3A 2WQZA 3P5SA 4NBVA 3UJ9A 4CMIA 5AD1A 4KOAA 3Q88A 2JANA 4EENA 5ALNA 4AG6A 2F3TA 2A0WA 1LU9A 2QSJA 1CQZA 4R3WA 1P2BA 1NQVA 3LQ4A 2JG3A 2OAQ1 1L8QA 2C9ZA 3MOIA 4OQFA 2R8BA 4B40A 2HD4A 4KSBA 4E1RA 4QQKA 4OI0A 3D0OA 1O8BA 2B37A 5C3UA 2V1CA 1OI2A 5BQOA 4D5GA 3UV7A 2LVBA 4O2BA 1LTQA 1JPNA 3AUUA 4AAYA 4Q48A 3JQRA 4DWVA 4FK8A 4LBVA 1YDGA 1DX6A 4AN0A 1K88A 1EK2A 1IHDA 3C8UA 4F2WA 4Z1OA 3ADDA 4B43A 3G8DA 4BUJA 1U8EA 2G77B 1DXOA 5HRCA 2P6MA 4R9RA 3FYSA 4BB9A 1GXSB 4QLAA 6REQB 4BNMA 4QJ5A 3THRA 1BVHA 4WMLA 3H1EA 4Q4AA 4EY8A 5EWMB 1CUSA 1L5OA 2QT9A 4H0NA 2PMWB 4YPVA 3Q7SA 3QKSB 2OM2A 3SE7A 2CVPA 1BSVA 1ZAKA 4YCBA 3HRIA 5K0CA 3IT0A 2RHLA 4P4SB 3RNLA 2YVUA 3JQ7B 3HKBB 4RAQA 4RVSA 4BMVA 4D8YA 4DCNA 1W2WB 4JQCA 3D9QX 5CNIA 1E59A 1NPDA 1GUBA 3VC2A 2AFRA 2OFOA 1W3SA 3J81k 3FOFC 2SKCA 3GEMA 2P5SA 1RRVA 3TD2A 3TCKA 1J8QA 3ET5A 3ZDZB 2C3MA 1T8UA 2WU3A 1UJ6A 4MDYA 2DPLA 3R7LA 2JFPA 3A7EA 1YRHA 3T1QA 3T7DA 4EGSA 2Q2QA 1EA5A 1H3NA 2XT6A 4IDNA 4BYGA 1FP2A 1VPTA 1XLTC 4XQEA 2G7MC 4G41A 5KTYA 2X4IA 3WLPA 2R68A 4BNXA 5KU1A 2REBA 3R3VA 1EX7A 3CE9A 1GL7A 2JH9A 3O7WA 4QBFA 1M1NA 3DNFA 1YV9A 4QM7A 1IN4A 1J00A 1JFFB 4FW9A 4D4GA 4MR9B 3G9ZA 2C78A 1L5YA 2RGBA 3ANYB 2WJPA 2A9RA 2I87A 4Z49A 3MRSA 3D4OA 3EFEA 5FUVA 4BDSA 5JJ5A 5TC4A 4ALLA 4M1YA 3ZD9A 1N9GB 4UFOA 2J0UB 1V26A 1XE3A 1CUJA 1CZHA 1LX7A 1T10A 5L8VA 4CG3A 4F1KA 5HQTA 5JY1A 3I58A 4UHCA 5F2KA 4LF7B 4PQRA 3O4FA 1MJNA 5IJZA 3PZRA 1N2EA 1OJ7A 2FB9A 2PJZA 2QRVA 3TNDA 3CBQA 3ASVA 3IQHX 4CL0A 5JZOA 4IICA 1YCGA 2D5IA 3P9NA 3BE4A 4JI2B 3QWIA 3P19A 1FCJA 5LQDA 4QFMA 4Z9YA 4ZGGA 4DV3B 1ZSYA 2JRCA 1XZNA 1E8NA 5AJXA 1G5RA 2VTBA 4E5NA 2D0DA 1A5AB 1SKAA 4G07A 3ZQ4A 1E1DA 5HWSA 2XB2A 5K0LA 3KB2A 5JARA 5KC9A 4MQ4A 1A9ZA 2GXUA 4ABYA 1EAMA 2PZKA 5LKAA 4Q82A 3I4LA 3HVUA 1RPNA 2IIVA 4TMTA 2DLCX 2ZYSA 1KDOA 1QG4A 1WD5A 4O25A 1VLMA 4UVIA 3IQZA 5ED0A 4BN5A 5AWFC 4D3DA 4QIHA 1CK4A 4NPHA 4PG8A 1HLDA 4NNPA 4MW4A 1RZ3A 3X1YA 4EJ2A 4J1QA 3GO4A 2X5XA 5TPZA 2ZEJA 5I7UA 3SOZA 1FEZA 3F6BX 3HGTA 1YZTA 1KP3A 4I3GA 3FIUA 4IMIB 1SGPI 4RVFA 3T7RA 4DMGA 5KNCD 2R7MA 4XOUA 4FI3F 4N3NA 5TARA 3TE7A 1IU9A 3OSUA 2IP2A 3OH8A 3WLAA 4E0BA 1IW4A 3K6RA 3FUVA 2C3OA 1U8ZA 1DO0A 4UCWA 4A36A 5A06A 1JUDA 1QWSA 1TBNA 3OQ1A 1KYWA 5GV7A 2CNLA 4BCBA 1RQRA 1CT9A 1DV2A 1RWKA 3I45A 2AN3A 3VU3A 4RCYA 1O4VA 1M7HA 1TPYA 4FYKA 4GBED 4QFBA 3MWDB 1WIWA 2FV8A 1N3YA 2FQYA 3AONB 4KAXA 1TUBA 3MELA 2BLNA 4JT2A 4QPNA 2NYAA 4GG1A 4OHOA 4G01B 1D1SA 3F2IA 4B7AA 2HU5A 3IT1A 1NBMD 4Q9AA 3VX4A 1CDEA 1ECLA 2WKRA 4XWYA 1ETUA 4QUBA 4OLHA 1HDCA 4JVOA 1ORVA 2X40A 2RH4A 3FW1A 2I5PO 1V5GA 4MQUA 4UREA 1QF7A 3AETA 3IQEA 3B3QA 1Y4UA 2X8LA 3WL5A 3T4PA 5KS2A 3KOXA 3PFWO 2TS1A 1U81A 3P9XA 2VK8A 1X77A 3FSEA 1JU9A 2KMRA 4PBSA 4PZAA 5ALRA 1J09A 1XTTA 5HF5A 2CLKB 2Q62A 3T1NA 1FYFA 1BWPA 1NN5A 2CNNA 4MQEB 2E1RA 2D3TA 3HUTA 4G0PA 5I4CA 2Z3VA 1R6BX 2ERWA 2Z6VA 3LBNA 5EXXA 4IQGA 4PEVA 2QE6A 2XDYA 3MB5A 3NHPA 5DXAA 2DB3A 1IY5A 1JF8A 2CWGA 1OBCA 1UQTA 1T3LA 2V58A 3CURA 3KQOA 3Q3VA 4HQFA 5EXSA 2DXIA 2V6MA 5CK4A 1EPUA 4LJKA 1DRWA 4R54A 1G8KA 3UN1A 4R81A 5CAEB 3RJZA 3U4HA 1JDZA 4YUXA 3RS4A 1RCFA 2DPMA 3U7QA 3P7MA 3R8XA 1AUVA 1D2HA 1ZOOA 3V1UA 2GZSA 3KOUA 1AK2A 5FKJA 1BE6A 2WKQA 3H65A 3NC0C 1IQUA 4PSAA 5E7IA 2ILTA 2G40A 4R0MA 1ISJA 2G9ZA 4LE0A 4V0SA 4XIGS 3AZQA 1Z0SA 3OCWA 1U5BA 3P4UA 3OWXA 2GB4A 1RLOA 4GW3A 4DWOA 3PX7A 2JF0A 3IQFA 3CM0A 4FDAA 1QU2A 4DFDA 3D3WB 5D87A 2PUCA 1E1QD 2QR5A 3D1LA 4MSUA 5KYTA 1DRUA 1MVOA 2CXQA 3B7PA 4J0FA 2B1IA 2IBSA 2FPXA 3F3KA 4UQLA 3DH0A 3ZKAA 4I4NA 1QHHA 1I2CA 1TKBA 3QBTA 4JWKA 3EB9A 4MINA 1PJRA 3GR6A 5CW2A 5C4GB 3ZWVA 5IT0A 3VZDA 2Y3IA 1AN0A 1PGPA 1E2KA 3FI0A 5TJ9A 4CLOA 5FPKA 1E6KA 3VI3B 2NIPA 3I9NA 1JBKA 4DMKA 1JG1A 4GR5A 3HGMA 3CPHA 4HVLA 4IJKA 4TVSA 1ZGBA 2AJDA 1KMHA 5D3MA 4RTMA 2HN9A 3D8RA 1VDDA 3LX4A 4A0QA 4Q1BA 5L3QA 1IXYA 1QTNA 1ISSA 2COEA 3HVJA 3NGXA 2H1HA 4L4UA 4OOEA 4PLCA 3AL3A 5KNBH 4WK4B 3VPHA 1X86B 3LPAA 1ENOA 1X80B 4QREA 3I6IA 2IF0A 1M0SA 2FUG1 1NVVR 5C5DA 1T4MA 5C8XA 2RG7A 1Z7EA 3BJRA 2ISQA 1Q1QA 1MIOB 3ELBA 4MP8A 1T4CB 4XX0A 4YAFA 3WGTA 4RGYA 5G0VA 1GNTA 1VG9B 1YBHA 2QTFA 2PX6A 1FNCA 4MS1B 3TLEA 4X7MA 2YHUA 4E30A 4DAOA 4W5OA 4FINA 2FZCA 2ZFUA 2CMGA 3MCZA 2C1ZA 2EZUA 3QVGA 4ZVNA 3EXFB 2PT9A 1S2GA 2HSZA 4LFCB 2BGJA 3DUFA 2AEMA 1SC1A 1YRYE 2G9VA 1B8PA 1WAMA 1XL1A 2HT6A 2VJDA 1SGQI 3BMOB 1T13A 1Y4AE 5JU6A 5H70A 4CT4B 1BFUA 3DZJA 3R7AA 4XX1A 3EVGA 3GEGA 3H1TA 2XHZA 3EZ7A 2HO4A 1R00A 4HRAA 4R8SA 3MFYA 4ACBA 4KO3S 2EXXA 2N3ZA 3G6WA 4QUEA 1CF9A 2GR9A 3WDKA 1G6OA 4EPXA 3TGWA 2B0JA 2XZTA 1NNI1 5K5EA 1VE5A 1NT2A 3Q7IA 1B4DA 3AR3A 5FWNA 2OXRA 2I2WA 5BUSA 4N5DA 5IN5A 3T52A 4LBZA 1R8QA 1C7RA 3ZXIA 2X76A 4AJHA 4B6SA 2Q5EA 5DYTA 3TSWA 2FZKA 6ABPA 4RIFA 2EFCB 1XELA 1IBLB 1NJ5A 1V9LA 2NO1A 3L1VA 2QMUA 5LZ8A 4XB1A 3D54D 2OCPA 1P9GA 2P90A 4DYVA 1ZUNB 3KU4A 3STWA 4BZPA 2ENWA 4IG9A 2QZPA 2YBEA 2N17A 3QLUC 1LRJA 1WY5A 3VYRB 1QGED 3KB8A 2E37A 3KLMX 1J0AA 3R0QA 1CD5A 2P2SA 1KDZA 4BNKA 3QA9A 5JSKA 4K7JA 1ECFA 3KWLA 3MJHA 5G1OA 2QY6A 2C31A 1Z4KA 1W85B 3NOQA 4I1OA 5F7JA 3NTVA 1UF9A 3PGXA 4CRWB 1OT5A 3WR5A 4G0NA 5DM0A 1BXKA 1E6CA 4M46A 1NDUA 1V5FA 1C5KA 1SIWA 2GESA 4QRIA 3FVRA 2ODTX 3W8FA 4BP3A 4JYAB 1W48A 1GU7A 5CPBA 3T3IA 5IJ0B 1MCZA 4BO9A 1GPAA 1CIJA 4DR7B 2FQXA 1J0CA 2FFHA 3OJXA 4MTCA 2IL1A 1SBNE 3FCSB 3QYFA 3EFBA 5LMCA 2VNHA 3L0ZA 4CM4B 4URXR 4M0LA 1TO1E 1OV6A 3CJRA 3CTMA 1NX9A 1E79A 4G5FA 3B6EA 4KZKA 4YT2A 3LTEA 4GI3C 2OPHA 3VBCA 3L8MA 2JI6A 2PQ0A 2WWIA 4X85A 3TRJA 4BVKA 1MX1A 1U8FO 3DTVA 1RQGA 3DT9A 2QVYX 3NIBA 4P84A 5E4YA 4C0SA 2QNRA 1PJZA 3RLFA 2ZB2A 3WLRA 4BO4A 1RMTA 2Y6VA 3OPMA 4L7VA 1OSNA 2V7VA 2YW9A 4AP6A 1MIHA 2AG1A 2D0OB 3L8HA 5G0TA 1QORA 4F97A 1BN7A 1GFIA 1OF1A 2VSNA 5DP2A 4Z8XA 4EX6A 4URHA 5EINA 2OVOA 2QLTA 5C4MA 1MB0A 3SGBI 3R5XA 4RH1A 2CW5A 4KI7A 1XZLA 2FUKA 3B9QA 1FQKA 2XGSA 3LLSA 1WR8A 1H2RS 4TQUS 3D8BA 1RWQA 4GDMA 3TM4A 1WHTB 3ZE7A 4DPLA 1MAUA 1X42A 4N48A 1HDEA 1PKXA 2A9KA 4LIPD 3L07A 3RYFB 3AK4A 4Z4HA 5LLTA 2FG5A 1QGAA 4ZAGA 1KJQA 1ECJA 3O8QB 4NV3A 1K6MA 3QJ5A 3HNPA 2QX9A 1ESEA 1PN3A 3UJPA 4EQZA 4WVLA 5I7SA 2YMLA 1X15A 3D00A 3WFJA 4ESVA 3PXCX 4WECA 3HXMA 2DY1A 1NAHA 1F20A 1GGMA 3K1ZA 3O73A 3RODA 1W49A 4C9BA 3G79A 4QXPA 5L6MB 1Q7EA 3I52A 1NQOA 4I5IA 4KV9A 4NONA 3M9WA 3BDIA 3ZWOA 4GLJA 2H4ZA 5DTEA 1YS4A 3ILSA 3FVWA 1PJ2A 3LY7A 3M6WA 4ZAFA 3UHJA 4DVJA 2FP4B 2IIPA 2ZRIA 3DFZA 3NGLA 4Q4JA 3RASA 5HGJA 10MHA 1F2UB 4F46A 4MZDA 4F5WA 4EGQA 1Y4SA 2R0QC 1D0VA 3EA5A 3D6TB 3K0KA 3C15C 3KHTA 5LQAA 3ZK8A 2ECPA 1OKKD 5KSYA 1GSAA 3G49A 2YFHA 4W6QA 5BY2A 5AW1A 1UBLS 1ZVKA 2IYXA 4NG5A 4U4AA 2PUVA 1W36C 5KYYA 1SVWA 4HN2A 5I7AA 4U9UA 1KQOA 3ZZUA 4GZ5A 1LUAA 3I2FA 5FO1A 1XSEA 2FQ1A 3IIKA 3C74A 3QF7A 1GARA 5EZ6B 1J22A 1XJCA 3EDMA 3W90A 3ZCPA 3ZQJA 1XTUA 1XTVA 4UM9B 1BW9A 1C9YA 4PPGA 5T3YA 5FEMA 3UAGA 3PGKA 3WGJA 1ZJ5A 4MV7A 3U3OA 2P9JA 5FADA 2FRDC 3L6CA 5CT8A 1MJGM 2PT6A 3OG9A 2Z8YM 4L0DA 1RADA 3TDNA 1QR6A 1YZYA 1KY5A 3M6LA 4DBVO 3SICE 4AKGA 3LV8A 3E7PA 2VBGA 4EB8A 2VKTA 4CKYA 3R0XA 3B12A 4ANFA 1E9RA 3C7KA 1V1RB 2QTHA 3H2HA 4EY6A 5EHIA 4AW9A 4JEUA 4PU0A 1OLUA 4K9LA 4EIWA 1OHHD 4MA0A 1L5WA 1VHLA 2X2PA 3PDUA 5FNVF 2AS0A 5KQRA 4OQPA 4D9NA 3ZE6A 1N0WA 1DMSA 2EVWX 4I50B 1SZCA 1XRLA 2GMWA 1YXMA 2BUBA 1Z7GA 4IDQA 5E7QA 5I8PA 3SE0A 3GPLA 2CLIB 3WTCA 1R9MA 3BMQA 3INTA 3F6SA 3VPXA 3AUFA 3HCRA 5C81A 1U5KA 2AI2A 3AKCA 1YJBA 2WPDD 3U26A 3X2FA 2CUKA 2RGWA 3LP5A 3MGCA 3PRYA 1Y80A 1VP9A 4RNCA 4ZQGA 1NVTA 4LYJA 4LJLA 4NFHA 2KJQA 4ZVPA 5DISB 4F5YA 3GEPA 3EMDA 3QFTA 3NH9A 1S8OA 4B9AA 3MHPA 5F9HA 1CVIA 3F46A 4EPTA 2I7XA 5IUKC 1YDHA 5EIXA 1D5WA 1C8LA 1P7YA 3TPFA 3HJCA 2VFAA 5TIIA 1FTSA 3BZBA 3NORA 4DLZA 2GWRA 3HEMA 3HJUA 2Q41A 2AW5A 4MB0A 4O33A 5F1YA 1S0UA 5JTUA 3ADOA 4J4HA 3BE6A 2QS9A 1SHZA 2FKAA 2HBYA 1R50A 4I46A 4KZPA 1E69A 4YXFA 3P9ZA 5KHLB 1Q3TA 3Q12A 3HVKA 4MVCA 5EP2A 3HADA 2Q8QA 1CZUA 2O7QA 1NP7A 2RK4A 1JHRA 3D59A 1RJFA 4QDZA 3RS5A 1NUPA 3WKEA 4FMCF 1V6SA 4X64B 4F06A 1SXQA 1W7AA 3W05A 2AMLA 1LPNA 2XHEA 1JDBB 3HZOA 1N6LA 2YDXA 1B2RA 2FEOA 2AE2A 3E03A 4R98A 2H2DA 3AY3A 3LKDA 2CFOA 4DDTA 4RL4A 1YHYA 3JQFC 4E1VA 1M2NA 4IXTA 1T0IA 1SUAA 1DG3A 2HAEA 4J0DA 4TMZA 4KEAA 4ESHA 4Q3KA 4Y9RA 1OIXA 2R6FA 1VIAA 3EN0A 2IDZA 2Q3HA 4QGAA 3E9QA 3U9LA 2V65A 4V3BA 4WUVA 2CHUA 3G0GA 5ER9A 2D8AA 3QXHA 2QT0A 3HU2A 4BN4A 5J4HA 3EK2A 5KMGA 2IHYA 1CXZA 1T0HB 3SG0A 5M3BA 5DPMA 2XEXA 1QGOA 3LUFA 3VPBA 4MICA 4RENA 2B9EA 3TX6A 1GAJA 3EDCA 4RPGA 2WHPA 1WPXA 4BAUA 4JBNA 2Z95A 2GH1A 2M98A 4M0FA 1WETA 3OZXA 2XYRA 4E15A 5L7WA 3AP3A 4RE6A 3NDRA 3GF4A 3BK7A 4NCNA 3DD1A 1VPLA 5TMPA 2BFBB 2CJYA 2F64A 5DLYA 4ZAYA 3T94A 3G88A 4ZO8A 1C0LA 1TZMA 1SVIA 8AT1A 1R27A 4QM6A 4OK6A 5GIOE 1T9KA 4F1JA 4H77A 3QOXA 4M7WA 4ER7A 4BNGA 3G8YA 2FPOA 1E64A 2PXCA 1SIOA 1FPQA 2VJMB 3QQ5A 3QVLA 3V8MA 1MZPA 1H2YA 4CQLA 5KX5B 2H18A 1MRNA 1BJKA 4INOA 4FCVA 5JAQA 3NBQA 1C3EA 3DZCA 1CETA 1I1HA 1TFRA 2PZJA 4LDPA 2P4EA 2C82A 3HS3A 2JC3A 3IOMA 3MFQA 3HP7A 4DMHA 3I6YA 3CY6A 4MUKA 3NXKA 2YQ4A 2DJIA 5IXSA 3DC7A 2VRBA 2QYHA 5FTWA 5U1PA 2NAFA 2IXBA 1QC5B 1DXQA 1CQPA 2IELA 3KWJA 1XF9A 4PO3X 2V7GA 3SQMA 4CI9A 2R00C 4OU5A 1KK3A 3GLFE 2Z8ZA 5E8JA 3MTQA 2GT1A 2UYCA 3R41A 4PC3A 4KPUA 4ND1A 1OAKA 1UAAA 5B55A 3X1KA 4NCHA 2UVDA 2HSJA 3Q6MA 4IUDS 3W04A 4CF7A 1PFQA 3LBFA 4LEIA 2V55B 5EQFA 1IJKA 2NXEA 4IX9A 3LC2O 1X8LA 1EDBA 2Z1NA 4JK3A 3H97A 5I5GA 4KC0A 1SAYA 2Z2IA 3HNOA 5JJBA 1Z74A 3OLCX 1GA6A 3K0FB 3BD9A 4ARVA 2BHLA 2H5JA 3KSAC 5EMLA 3BOSA 2W90A 2ACWA 2C1EA 3IB6A 3Q1KA 1Y3AA 2GAOA 1S9DA 4K86A 4Q5IA 3H11A 1L5SA 2H2FA 2B3DA 2JLAA 2AFIA 2HDOA 1TL7C 2XY4A 2Y67A 1ZEJA 2VSFA 3A04A 4JJ4A 4P3OA 3TEJA 1E9CA 3TI7A 1SHLA 2FEWB 1T1EA 5F5XA 4AX4A 1XRNA 1OTYA 2GEKA 4Y98A 4MI1A 4O4IB 5BV7A 2XTZA 4DG9A 4MS4B 5K99A 2XUFA 5JJLA 1R0KA 1JEQB 2D5LA 2GAJA 2QMYA 3CNQS 1GR0A 3IUMA 5KYXA 3QYJA 5B1YA 3MERA 4FNOA 1HQKA 2F8LA 1Y8RB 2GNAA 3DOHA 3GRRA 3OHMA 4IUCS 3VH1A 3RKUA 1C3OA 1O96B 2RGEA 5FL7D 5H3CA 1BFKA 4TGLA 1AUPA 1UKZA 4Y6OA 3WGMA 2AYZA 1XC7A 2ILVA 4AS3A 1N7IA 2BEVA 4REQA 4GEGA 1BDBA 3HV0A 1FMLA 1L9KA 2I2DA 3CUWA 3JASB 5B57C 4NARA 3TZCA 2Q28A 4M0DA 5EIEA 3EA4A 2XSZA 3AIIA 5EXTA 2HLPA 3GT7A 2C4UA 1SUFA 3N6RA 4C4SA 5I5EA 3SQXA 2B8JA 4QJIA 1EK6A 1JW9B 4B17A 3VU9A 1SEPA 2H31A 4AS2A 4KYVA 3F5MA 2BL4A 2F6RA 1NSYA 2YX1A 5J40A 3GXBA 4ER5A 5G40A 3NVKI 3K72B 5F3WB 1XZHA 5GADl 5JZVA 4NECA 3I2IA 3KSZO 2HJVA 5B2ZA 3SKYA 5J2TB 2HSWA 3O3CA 2ODBA 3AKDA 4KITB 2HPAA 1QYXA 1LF5A 4KWHA 1H2HA 1W5EA 2NO0A 3M70A 4V38A 5GIPE 1PTJC 2CXUA 2YWEA 3MSXA 4QNRA 4Y1EA 4P3XA 5IVDA 4KVFA 4PO1A 4CFSA 3FAZA 3GJ4A 4W1QA 3MLEA 1C14A 4DCJA 2JI8A 4A3SA 5SV2A 2X0DA 3EUWA 5KWVA 1VI5A 3BHNA 3NGMA 3U16A 3HJFA 1A96A 3U48A 4F4HA 5BMOA 3IURA 3OE5A 2D1QA 3U0BA 2GLXA 2XIQA 3D2BA 3FYCA 3K1AB 4WN9A 4EHBA 2OHOA 3LHFA 3NEYA 4MHTA 4FWBA 5FNVA 1BFDA 4DNCA 2YFQA 2JJYA 4Q4HB 3SDSA 2FEKA 4B1FA 1L8XA 1SR8A 4ZVQA 1KO8A 3P45A 1I6KA 1UBTS 1C9DB 1MC1A 2EQ5A 1A69A 1BKDR 4H6WA 4ZDWA 3V4OA 2MT9A 3WZLA 3TUZC 3QMWA 3PC8A 1X8KA 1JVNA 1Z6TA 2PRJA 2IUSA 2BEWA 4B44A 4DIFA 1FJHA 1PCXA 1NW5A 4MVJD 2OGUA 3OFND 4HEA6 2NV0A 2IWHA 1RKUA 1WUYA 2R6ZA 3OCYA 2V74B 5KKAA 2E49A 2OCKA 2PWZA 2QTWB 3EASA 2WNHA 3EG9A 4R2WA 4RXUA 3WQRA 4BRWA 4FNMA 2QN9A 2X5OA 1B6GA 2EBHX 1VIDA 2IVZA 3F9CA 4WNAA 3DG9A 4CLXA 1S02A 3D4BA 3ZD7A 3O6VA 4RPKA 2PX8A 4WH0A 1GGEA 1O9HA 3LO5A 3NNNA 2EFEB 1W5FA 4TS4A 1EX6A 1P4GA 2QE7A 5GVRA 1E5VA 3HM2A 3NH6A 3C7AA 3ESRA 3JVIA 4RZXA 4BGIA 4KO8A 2CUNA 3N2KA 4E5UA 3LBYA 3AR2A 3NKVA 5CVTA 2JDIA 3EC1A 1I1OA 4V1CB 2FG6C 4E14A 5LQRA 3TTWA 1U2GC 3Q8MA 4DJEC 4C06A 4BO2A 2Z1MA 1M6EX 1UC9A 2YNMC 4WV3A 5HNKA 1T1JA 2OBXA 4ND3A 2AEFA 4UEKA 2LIPA 1MHPA 5HIJA 2C8JA 2GUGA 3WP1B 2UDPA 1GG5A 1RQ2A 1UM9A 4FC7A 5L3VA 1OFHA 2IZZA 5C46F 4XQCA 2W83A 2XYHA 3NIDB 5FWDA 3QPBA 1CUGA 5HKLA 3R8FA 1T29A 4WKNA 1K8XB 4X63A 1WF3A 3E3OA 1ZJWA 1TURA 1UVFA 3F7TA 1ZBQA 1LI7A 3QAHA 3WMXA 2I1VB 2Z83A 2A9PA 1QH8B 3H2ZA 3JY6A 1G4AE 2FPUA 1U3FA 3DHVA 4XI9A 3ZD8A 3HR7A 2PAFA 1GYRA 4IF6A 3EWAA 2Q1UA 1NXSA 4ZJPA 3DUWA 5K8UA 1JLKA 3KCQA 1ZN2A 5C18A 1BEZA 5PNTA