4UXIA

Leishmania major thymidine kinase in complex with thymidine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
164
Chain Sequence
FRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 44
structure length 164
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxiA01
4NMMA 3ZZ0A 2EFGA 4HB2A 1XA6A 2ZIAA 1JECA 4MRPA 1WMSA 5JWRA 1Z6YA 3WRXC 1UPTA 1OLOA 2BEKA 3FFAA 1NVXQ 1ZU5A 5FTKA 1KNQA 3CUEF 1G8YA 4Q7JB 2DCUA 4WXRA 5JSZB 1IXZA 1I4TD 1RYFA 5DYIA 4IOJA 3SC3A 4UNRA 3OE7A 3MJHA 3NEYA 4MYCA 3X2SA 3P26A 2C95A 2EFHB 4CT4B 4PZYA 3GJ5A 1YKSA 1X3SA 1XTQA 4NCJA 3AKCA 3NDPA 3SQXA 2GJKA 2WZQA 2WJVA 1AK2A 3B1YA 1FQJA 1OF1A 1W4RA 5EXSA 2J0SA 1Q3HA 3CPJB 5HE9A 1G8HA 2GEVA 2ZSFA 3ZDQA 3RYTC 2GETA 4POAA 1JNYA 3MWYW 1Q0UA 1TQDA 3P32A 3VKWA 3EZ9A 1VTKA 3TW4A 1K8RA 3IGFA 4GP7A 4NCIA 5DN6A 2R2AA 1ZMXA 2KI5A 1F48A 2W83A 5AUOB 3KDSE 1Z3IX 4OI2A 1E0AA 4A2QA 4U5XA 3MJRA 1GUAA 1TF7A 3SNHA 1XZPA 2OV2A 2DFKB 5UKDA 4Y0VA 1FW6A 2BEJA 4JBYA 4BFWA 2O8BA 2J7PA 4TTPA 1NIJA 5BQ5A 2YZ2A 1M34E 4A8JB 3R20A 3H4MA 4LHYA 3VU9A 5KSPA 1RRFA 1UFQA 2IHBA 3FTQA 4KITB 3OF5A 1KY3A 2RMKA 3CW2A 4QBIA 2OZEA 2J46A 3VR2A 1G21E 1ZBDA 2F43A 2RGDA 2WM9B 4CIDA 4GOJA 2QM8A 3I32A 1ZM3A 1UDXA 2A2ZA 2G88A 5D3QA 5FBLB 3V4FA 2GCNA 1CS4C 1QHHB 1OHHA 2EVWX 3SBDA 2OFOA 5IT5A 1R8QA 2IK8A 4RD2A 4A82A 5JCPA 2P0EA 1B23P 3IKJA 4CW7A 4OHWA 3FGNA 1S9HA 4LUCA 1GDDA 1GP2A 1TQ6A 4C0AC 3OAAD 1JR3D 4F7WA 2BBTA 5FTNA 3OIYA 3NH6A 2YOHA 2R6GA 2VO1A 2AFIE 2BBOA 1FNNA 1U99A 2JIZD 5C2JB 2GJAA 2JLSA 1AJEA 2GAAA 2FMXA 3SFVA 5G40A 1XBTA 4B73A 1ZM2A 1KBEA 2NQ2C 1J99A 3HP1A 3SJZA 3HR8A 3T1VA 3F3YA 2KJQA 4D0LB 4D4KA 2OT3B 4TYWA 1NN1A 2W58A 4GMDA 1NI3A 1FL9A 4JSTA 3T12A 4W5JA 2JLWA 4FCWA 2IYLD 3C7KA 4IFEA 1E99A 1NF3A 4KHZA 1JR3E 1IBRA 5B58C 1NIPA 4NE2A 4Q1CA 1IY0A 4L4UA 4D4MA 3SR0A 5BN5A 4DLUA 3C14C 2VBCA 4BFSA 1TQ4A 3E1SA 4HI0E 3AF0A 4QOSA 5FR2A 2O8CA 1KK0A 2ZJ5A 1P73A 4KFSA 1R0WA 3ASYA 4ILEA 2GZDA 2FG5A 1D8TA 3AUXA 2FOLA 3TW8B 4D82A 2QE7D 1E4VA 2PEZA 2VP2A 5HTKA 3I61A 1K6MA 1A82A 4JYBA 4G01B 2EWWA 2ZJ8A 3M4YA 4TQUS 2WPDA 5JS8A 4LZZA 3WHLA 4Q9LA 3VU9B 5DYGA 4HDQB 4PANA 4DC9A 1IN4A 4MUBA 3LVRE 4FW9A 1MR3F 4W7SA 3GJ4A 3L8ZA 3TSZA 4BLSA 1J2JA 4DCVA 4DEXA 5JEEA 5LD2C 2ZJYA 4FXPA 2YUUA 2DWPA 2IYYA 2ZANA 3THYA 4CEJA 3PEYA 1ETUA 1T3SA 4NCHA 1JPNA 2V7QD 2C9CA 1XCMA 2GZHA 3KJGA 4S2EA 3W8RA 1E1RA 3ZGXA 1GNRA 1IONA 1Z2CA 2HXSA 5EXXA 4II7A 3C15C 4LWZA 1N6LA 5EP3A 5KSZA 1Z6TA 3BRWD 4P32A 1RRPA 3NIBA 3RWMB 1E2NA 2QMHA 1M2OB 1Z22A 4NH0A 4MRNA 4WXPA 821PA 1G7SA 3OESA 4DCNA 4US1R 2QTFA 3HYRA 1HUQA 4B43A 1H8EA 1TNDA 4PPNA 5JRJA 3HPQA 3W5JA 1J8MF 1XTJA 5BN4A 2QMEA 4LRWA 1VHTA 1OT3A 1Q1ZA 1G3QA 1P7CA 1TX4B 1Z6AA 2JLXA 3HYTA 3L82B 3QKSB 2MSDB 2RHDA 2BC9A 4O0MA 5DHFA 4DKXA 1GNPA 2V1XA 3T5GA 3CIOA 4XH9B 3U3OA 2CBZA 2J45A 3NBYC 3JVUA 4LSGA 1IAQA 3W3AA 3U3JA 1GL7A 1KI1A 4PQRA 5FOSA 3KTAB 1XXHE 2CK3D 1UBGA 4FWIB 1P9RA 1A4RA 4NKRA 3OE7D 5H68A 2BJWA 3KKOA 1LTQA 4YONB 3A1SA 1OW3B 1SXJA 1Z47A 4X8OA 3KY9A 2NG1A 3RS7A 3AGPA 1XX6A 1JQJC 3ZVLA 4KBFA 3KB1A 2ZS7A 4ZDIA 4GOKA 2NZJA 4IDPA 3P27A 1VG8A 3R9XA 2GKSA 1ZUNB 3SOPA 3U7FB 3KKPA 3CZPA 1MOZA 2QORA 2JJ8A 2IYSA 3WNCA 4V0MA 2RGXA 3MMPA 1XPUA 1GG2A 1W46A 4Z8YA 3ZZTA 2PZGA 1HQYE 2NTYC 1NSFA 4FIDA 1W2GA 4PSVA 1VG0B 3MD0A 3TUIC 2F6RA 4B35A 1I4LD 1OXVA 1XJCA 4NU0A 2H92A 1JJVA 3B7GA 1YZLA 2ZRJA 1LNZA 2ENZA 1GWNA 3LDAA 4LC1A 2NO0A 5LDDC 2REOA 4OI4A 4DIEA 2UZIR 4TMXA 3RWOA 1DBSA 3BH0A 2ZRIA 3Q5EA 1JXMA 3IIKA 5K8TA 4JVNA 1E2MA 2F1IA 3AKYA 1XXHA 2Z5FA 4N0DA 5EP1A 3C5CA 1UADA 1HTWA 3IBYA 3Q85A 1KYIA 4LBVA 3NHBA 4IFBA 4Q21A 1NY6A 4OJKA 3K0CA 2AX4A 2ZYVX 4DBLC 3NC0C 2ZJZA 2JGNA 2CCGA 3AVUA 4JBWA 4LV8B 3M6AA 1AZSC 3LQRA 1X8JA 4R7ZA 1UDWA 5BWMA 4B33A 3VHXA 1K5DA 1E9AA 2JAQA 4URXR 4DIDA 1P61B 2IYUA 1KI9A 2QAGA 3NDBB 2F1HA 2GHIA 4KYIB 3BS4A 1OIXA 5DHAA 4YXWD 5J4VA 2V6IA 3QG5A 4HEJA 5FPSA 2IC5A 4DT1B 4IDHA 1EK0A 1NLZA 1W0JA 2I4IA 1HE8B 1WA5A 1H8ED 5J5CA 1CU1A 2ZREA 4U00A 3GLIA 1XPRA 1KGDA 1QHHA 1AKEA 2ZI6A 1FFHA 2BMEA 4JT2A 3NWJA 4I1UA 4RCYA 2D2EA 3RC3A 3BH6A 3KQLA 3AF4A 2B8TA 2ZSDA 2F3TA 4EPTA 2FSGA 3IPXA 3I5XA 3BH7A 1G9XA 4GI7A 3EAQA 1G19A 1XCGB 3J81k 3A4LA 2ZYTX 5DI9A 1R10A 1FARA 1W4BA 5CM9C 3EZFA 4P4UA 1E2LA 1SKYB 4AIIA 2FEOA 1YJ5A 1VDZA 4M9QA 3CNLA 2XGJA 2EFCB 2AFHE 2WVJA 4GNKA 3WMFA 4OHYA 721PA 3Q8XB 4A0RA 4QGHA 3KQKA 1CJUC 2Q0HA 3FMOB 3OFNA 3ONWA 4IDOA 3PUVA 5F2EA 1WRBA 3FOZA 2XNDD 1LFDB 3AF2A 1YR8A 4MA4A 4PC6A 5IHPA 621PA 3G82C 1N6IA 1NN3A 1YZKA 1KJWA 4IKEA 2CE7A 2VSXA 4R2IA 1G1MA 1R0ZA 2EYUA 5BYKA 4G5SA 4GZLA 4C4PA 1L4YA 3THXA 4EFMA 1SQ5A 4Q9KA 1E9FA 2OG2A 3KFXA 5CB6A 1YR7A 3NHAA 4B2IA 3X1XA 5J40A 2ECKA 4R9UC 5DO9A 2GEDA 1Q57A 3HU2A 4LYFA 4DLRA 2PLFA 2GJSA 4J0QA 5SZIA 1AA9A 3AF3A 1QBKC 3ZS8A 5HZKA 1UBEA 4QXAA 2VP0A 3Q3JB 1OFIA 1KI6B 3N2EA 4TMTA 4B34A 4D81A 1LS6A 2W6ID 4HZIA 2IXGA 2EU8A 3MWLA 4HATA 4D0GA 4AKGA 3RVBA 4TLEA 1X6VA 1MO5A 4M53A 2KWIA 4M21A 1T0JB 4R2HA 4ZDJA 4DDTA 4OI0A 2QT0A 4HAUA 1PLJA 1T3HA 2V9PA 3T06B 5EUMA 4QHYA 1HA3A 1U81A 5TB5A 3TR0A 3VNVA 1KAGA 3KUDA 1P2SA 4RKFA 4FINA 3C8UA 2RGNA 1FZQA 2Q3MA 3KXIA 4XSHA 3PUZA 2BWJA 3EWAA 4HZUB 2GJ8A 1CJTC 3BJIA 4QJ4A 4M1YA 5AUQA 3DO6A 3LY5A 2D74A 5FL7A 3TAUA 4QHTA 3WBJA 3TSWA 1BKDR 1Z0JA 521PA 3NKVA 4IEEA 2YOFA 5A4JA 4I4LA 1EFRA 3DDCA 3W9YA 4C0KA 1EX6A 4KODA 1CJKC 4BEBA 2AXPA 1E2KA 3OEHD 2ZI3A 3W5IA 1EGAA 5CDFE 3K70C 1W47A 1UKVY 3ADBA 2ZS8A 2NPIA 2CHGA 1GZSA 4LY6A 2VP9A 1XDBA 2JLQA 1AS3A 1XD2B 4DDVA 2G1KA 3O47A 4BQSA 1FP6A 2XZOA 4LI0A 2BMJA 2Z6VA 1DAHA 4ZCLA 2J0UB 2XAUA 1KK1A 1SXJC 1QHNA 4X8LA 3IEVA 1IQPA 2C9YA 4Q4JA 4Q1AA 3ZQJA 5HPYB 4IVRA 2GILA 1CIPA 3BGWA 1G18A 1IY2A 1S3SA 5FBRB 5F3WB 3UK6A 2IYTA 4FMDF 2JA1A 4P4TA 3PQCA 2JLRA 4RZXA 3MGCA 4G0NA 5JS7A 3SE0A 1KNXA 5EP2A 1LS1A 1Q21A 2FJUA 2DY1A 2WKQA 3DL0A 5CIWA 1CBUA 4TT3A 2Q6TA 3WNBA 4CEHB 4WBSA 1SVKA 2O0JA 4JL5A 3K0FB 3SDZA 5JJKA 3NH9A 4DLYA 4RD1A 5SZHB 1AGPA 2O8CB 1W36D 4KI0A 3QXXA 2ZU6A 3MAAC 3QY0A 4TL6A 1QHGA 3BC1A 2ZSAA 4ERNA 4UNPA 3B78A 3U3MA 2YINC 1BH2A 4JKYA 2RH5A 2WIAA 4TL7A 2RHMA 1D5CA 4QFMA 5DGXA 3S1AA 3LA6A 4WW0A 2RGCA 5IRCD 4C3ZA 3E70C 5LB2A 1JAHA 3TUJC 1X8KA 4RZUA 1E94E 2XZLA 1HURA 2EWVA 1BS1A 2E1RA 2VQSA 4IRUB 2GXUA 2REBA 2LCFA 2WJHA 4MDEA 1EG7A 1U9IA 2V54A 4MRRA 3W6NA 4A6XA 4TMWA 1JEEA 1NMXA 1M7GA 2HF9A 4DCUA 3ZS9A 4DXAA 1GL9B 1PUIA 1ZNXA 2G3YA 4LYJA 1OKKD 5FTMA 5KSOA 2CL6X 2GEUA 1BIFA 3A36A 2PT5A 2WICA 4HLDA 3SZRA 1N6NA 4EDHA 1RFLA 2OCBA 2V3CC 2HLDA 4BGDA 2GXSA 1W4CA 2GVIA 1IY1A 1NBMA 3A37A 1AZTA 1HT1E 3HJNA 3CR8A 2N46A 4Q1BA 1ZJ6A 3Q7PA 2QE7A 4I1OA 1A5TA 3CPHA 2QSZA 4V0NA 3ADKA 1U0LA 5C18A 2OESA 2F43B 4LDJA 4DSUA 2CNWA 2GJ9A 3GLFE 3K9HA 1ZM9A 4BFTA 5F9FA 3L0OA 1ZAKA 2AD1A 2ZVQX 2IYRA 3A8TA 3PR1A 1QHSA 2EQBA 4LHXA 3AVOA 2CLDX 4JLAA 5JHHB 1ZNZA 4LJ8A 4TMVA 4Q1DA 4QGGA 1BO6A 2OFWA 1FMLA 3CRW1 3O8BA 2G83A 1NP6A 4EJSA 3TGPA 1LB1B 4JLDA 2FSHA 2ZRNA 4V02A 1UEIA 1RW4A 2CE2X 2GK7A 1E2FA 2NGRA 3KTAA 1ZM4A 3IQXA 3TR5A 1XFAA 5JEDA 2O8BB 1DTSA 4BEJA 2Z4SA 1OKKA 2DB6A 1W5TA 2AWOA 5J4HA 1EWRA 1QDEA 2CMKA 1KI8A 4Q4LA 2WBLC 4A15A 3ZD7A 1HYQA 2VHTA 2GCOA 2ZRCA 2OLJA 2AXNA 5CITA 3THXB 4HUQA 2FPLA 2ZTSA 1JEDA 4C0HA 2C9OA 4LX0A 2W2XA 2ZE6A 4PPFA 5TDHA 3VR3A 3VX4A 1XTSA 4TT3D 3HR7A 2IUTA 4MRVA 4A2WA 4MQBA 4Q02A 2ONKA 1MO6A 1MRSA 2BCGY 2FH5B 1S3GA 5AK0A 1F5NA 5L3QA 4YC7A 5FUXA 1HE1C 3TVDA 2PCJA 2QL6A 3LW8A 4Q7MB 4G5GA 4URZR 4JLBA 1OXSC 1OJLA 4XVUA 5E7MA 1YQTA 1U8ZA 1S96A 4NDZA 5AJWA 4GZMA 3UWKA 4MKIA 1XMIA 3ZVMA 1A2BA 5CM8B 3QF4A 4QM6A 4UNNA 3L0IB 1KSHA 5H70A 4LHZA 3BB1A 2E9SA 4Z51A 4BFYA 2QG6A 4LJ5A 2EYQA 4CVNA 3KX2A 3O8CA 2VHJA 3U7EB 3JZAA 4DSTA 4HSEA 1XPOA 3ASZA 2LWIA 4PQFA 3EPHA 3K9LA 4TTQA 3AVYA 1COWD 2QI9C 4LC0A 4KLZA 1QHXA 4OHZA 1TUIA 3QF7A 1G8PA 2NO9A 1NJGA 5HR5A 4JJKA 3GLFA 2IYZA 3EA5A 3G5UA 4BLTA 2ZETA 5KPJA 4WAUA 3U5ZB 1IXRC 1ZIPA 1YVDA 3BFVA 2P65A 3PENA 2H18A 2GTPA 3QEJA 1VMAA 2VP4A 4OL0A 2D2FA 2UKDA 2P5SA 3N2IA 2ZAMA 3AVPA 3CWQA 3WMEA 1EFRD 3MRSA 1HEIA 1E9BA 5KDLA 2DB3A 5KNDA 3S1AB 2N1BA 2ODNA 4HYYA 2QENA 2WAYA 2XJ9A 3L8YA 4JLJA 4FI3C 3EARA 4G1UC 4PAMA 2O52A 4TQAA 2I1QA 3K8YA 4BFZA 4TYPA 5JJIA 2WKPA 1U98A 4Z54A 2VSFA 1ONBA 3CKLA 4LYAA 1JB1A 1E1QA 1KAOA 2PH1A 1Y8FA 1KBFA 4KSBA 4CDGA 1ZYUA 2ZI7A 3QI2A 1Y3AA 2WWGA 1ANKA 2OBNA 2VLIA 4RZ3A 4ZO4A 1WBBA 1OV4A 1EX7A 3QENA 3UMSA 5JWOA 3UANA 2YWEA 3RS0A 1A2KC 3K70D 1YZQA 4EPRA 5DSZA 1WE2A 2BM0A 4ZCMA 2GAOA 5L3VA 2ZXUA 1Q1BA 3CH5A 2J3EA 5EXTA 4C30A 4AK9A 4A2PA 1TU3A 4B74A 4TMKA 3GLIE 3GLGB 1U94A 2FPKA 3SI7A 4A8JC 3GJ7A 4OQFA 5E95A 2QAGC 1XTRA 1E32A 2WMNB 2XXAB 1XF9A 3MFYA 2VEDA 1E0SA 2ZRDA 3M1IA 1US8A 3TKLA 4D2IA 4BLQA 2NPFA 1KK3A 4ABYA 4KSCA 1HH4A 5L8VA 4AYTA 2O0HA 3CLVA 5FBQB 5HCIA 4F92B 1OB2A 3W34A 2JLVA 4L16A 3KKQA 2ZSBA 1TF2A 3TNFA 3K09A 1Q3TA 5DLQC 3GLHA 1G4AE 2RAPA 1SKYE 2D62A 1JXOA 2ODEA 2PJZA 4GMXA 4M4SA 3N70A 1T3LA 2Y8EA 2PCLA 5E7JA 3PCRB 5G53C 3VNUA 4WZBE 2P67A 2RGAA 1LF0A 1XEXA 3U4QB 4KXFB 4PC3A 4JBXA 4JYCA 1RZ3A 4H1VA 4AKHA 2GBLC 1Q44A 2WWFA 4OQLA 1KJZA 4OBEA 1L4UA 5FI1B 3VTKA 4BRUA 3RC8A 1E9SA 1DAFA 3SEAA 2CJWA 2XSZD 3DZDA 1D6JA 1W0KD 1M74A 1XMJA 2BVNA 2HV8A 5FPYA 3RRZA 3UIEA 3GFOA 3ND8A 4BECA 1WF3A 4TN1A 2OE2A 4P0TA 2RGEA 1XMSA 1Z29A 3DKVA 2V7QA 4OQXA 4QJ5A 5FPHA 1NMZA 1SHKA 3OIVA 4URYR 1VCMA 1HV8A 4YDSA 3AVVA 4QGAA 4CZ2A 3DOEA 2XB4A 4FWTA 3K70B 1G6OA 4DLTA 3IILA 4FCTA 5SZJA 4X8MA 2VTKA 2GA8A 3EC2A 4QBGB 5DN6D 2KSQA 5EE1A 3UGIA 2GZAA 2JDID 1HQCA 2RKOA 2VIIA 3TBKA 4A8JA 4BZXA 1C1YA 4HAYA 4HZUA 1ZU4A 1N6KA 4MYUA 4D6PA 3PEWA 1HT2E 1S0UA 4LPKA 4ASUD 1PVOA 3QXCA 2OXRA 4UNSA 4CRWB 1A7JA 2JJ2A 1I2DA 2Z0MA 5FOUA 4M1WA 5AR1A 4M1MA 5EUQB 5D3MB 5FR1A 3ZIAD 4YMUA 3K53A 1W5SA 5ELXA 1TF5A 5FBWB 4PR0A 1ZD1A 4MKGA 2BDTA 3JZMA 2XSZA 5AUNB 2ZI5A 4HUTA 4ACBA 2FV8A 2IXFA 1GKYA 3ICQB 4DVGA 1YRAA 2FWRA 4RD6A 4Z8XA 4HLUC 1OE0A 1YZGA 4M9SA 1IN6A 2X19A 2IEZA 2ZRPA 2ODBA 4MGYR 5LBIA 3REFA 1TTTA 4IXMA 1SVWA 2Q9AA 3CRVA 4H9GA 2G1JA 2GVZC 3TIFA 1NVWQ 3PJRA 5B64A 3GJ8A 5FH9A 4NTZA 5B2ZA 3KB2A 2R6DA 4TL8A 4LJYA 3AVWA 2C98A 5SZKB 3EW9A 2R6CA 2WWXA 4LK2A 3LVQE 5B30A 1VYTA 1QHIA 1RYHA 5TARA 2WIBA 3K0AA 1DVRA 1GAJA 4P4SA 4C9BA 3U6BA 1CR2A 2JIZA 1K5GA 3CF6R 4M9ZA 4TYQA 3VR4A 1G3MA 4BZQA 3KQHA 1Z83A 2O8DB 1U8YA 1N0WA 2WOJA 2BCJQ 1VG1A 2BBSA 1E0JA 4IOKA 2IS2A 1E2JA 1OYYA 1YRBA 2YVUA 4F4CA 2G6BA 1KY2A 4HLUA 4FD2A 2WOOA 1E2EA 1P75A 2FX3A 1P60A 4QBHA 1MV5A 2IYQA 3SS8A 1OXTA 4EIWA 1TBOA 1IOZA 4BLOA 1C4OA 1A1VA 5JECA 1UKYA 1EFTA 1E0KA 4HDOB 5EXPA 2J41A 1SXJD 1S2MA 4JLMA 1FNMA 2W6JD 1H65A 3SN6A 1RE0A 2FFHA 3RDPA 3OEED 4ESVA 3W8NA 3O8RA 4M8NE 3THOA 1MH1A 2GF9A 3OHMA 1S4QA 2KE5A 2XTMA 4E5UA 4ZV4A 4TSFA 2DWOA 4NBSA 2C96A 1EFUA 2CDNA 2F1RA 3QKRB 3UKDA 1XCPA 2R62A 3U3KA 4P3YA 1CR4A 3QKSA 4IVPA 1TUEA 4GSYA 4LYHA 3TUZC 2ZRKA 4UJ3A 5GVRA 5FI0B 4Q9JA 1DAMA 1T5LA 2P5TB 5E7IA 1CJMA 1U0JA 1H8HD 3RS5A 5C4MA 1Z07A 1OFUX 3LLUA 4URWR 4JLVA 2CLSA 1XJQA 2IUSA 2PJRA 5TV2A 1R6BX 4UKDA 1W1WA 5EE5B 1T91A 1VHLA 1AQUA 1ZNWA 2AK2A 2QZ4A 1Y63A 3LLMA 3NC1C 4RD0A 2IUUA 4CEIB 2ZVPX 4OK5A 5GJCA 1G5PA 3GJ6A 4MH0R 3JVVA 4TQ9A 2XITA 4PO1A 4Q4JB 2GNOA 3B82A 4MYTA 2NIPA 4NYIQ 2MMCA 2J0VA 3RS3A 4HB0A 4MRSA 1KK2A 1XXHB 3RRYA 1NSTA 4DHEA 2WTUA 3I4LA 3Q9LA 4PHTA 4ZPXA 4U02A 1ZD9A 4B3CA 4NPHA 1T8TA 1NLYA 5EP4A 2XXAA 5FUVA 4AURA 3A6PC 1W0JD 2R8RA 2QGNA 3UGDA 4LJ9A 3IHWA 3WYFA 2FA9A 2DR3A 4MITA 2D7DA 2HXYA 1E2HA 3SJAA 1NG1A 4DZZA 3W90A 2CEAA 1G8FA 3PEUA 2C5LA 3ECCA 2YWHA 1GL6A 1GILA 2IW3A 2Z43A 1QVAA 3QNUA 3BB4A 1UAAA 4AI6A 4KJZA 1XU4A 1YZUA 2WWHA 3UWOA 1S1CA 1TMKA 3Q7QA 5KNCA 1LVGA 4JL8A 4P4SB 1GRQA 1E6CA 4FMBB 4M1TA 1BYIA 2OXCA 3KKMA 4NYMR 4PXAA 1LV7A 3VHLB 3QVVA 3HWSA 4B75A 2W2TA 2HT1A 1R7RA 2OM2A 3B1WA 1G5RA 3KL4A 1KDRA 4FMCF 1VG9B 2V8OA 4PZLA 2A7QA 4N1AA 4NYMQ 1NKSA 4RJLA 4V0ME 3QBTA 2V6JA 3VR5A 1XB2A 1G291 1AQYA 1M7HA 1TQ2A 3QE0A 2FDCA 1II9A 2H57A 4ASUA 2QP4A 2B7BA 2C03A 1DADA 3K0FA 3UPUA 2DFTA 2H16A 2QAJA 2OO7A 3PVSA 4B6EA 3V4RA 3QVUA 5EE9A 1R4AA 3SYKA 2PX0A 2ZU0C 3LBNA 3M0EA 1E79D 4G5OA 4RD4A 1XP8A 1J70A 2J0QA 5CK4A 5EZ5A 3U2QA 3EG5A 3CM0A 3KJEA 3U61B 2ERYA 1SVIA 2J59A 4EFLA 4ITRC 1DOAA 3FVQA 4NYJQ 3QPUA 1VIAA 3DOFA 4YMTA 5EE3A 3G0HA 3AP3A 1YE8A 221PA 2ATVA 3UEJA 1P5ZB 2J0UA 4IOLA 2CHVA 2IWHA 5JMTA 1KI4A 1NVVR 2C78A 5KU1A 2YKGA 1OH5A 5GVSA 2ASEA 3AVXA 4RD3A 1OFHA 1X8LA 3GLHE 4QG7A 1G7CA 2XNDA 3T1OA 4A4DA 4BUJA 4QKQA 3H2YA 3HU3A 1GM5A 4K8OA 1PZNA 1E9EA 5D3MA 2X2FA 2ANBA 2HLDD 5CLLA 4RFVA 2B8WA 4TTRA 2AK3A 2J7KA 3PEVA 4Q47A 4JKIA 2IYXA 3TSOA 1RRCA 2BMDA 1N0UA 2C04A 2Q21A 4GL2A 4YMWA 1T6NA 1VIYA 2ZYWX 4OQMA 3AP2A 1AS2A 2HCJB 1P4SA 1ZRHA 4Y0AA 2DYKA 3BWDD 3GCGA 4C0JA 3LAWA 4D26A 3WBKA 1E9RA 1ESNA 1G64A 1WP9A 1SXJE 3K0EA 4C0QC 1KO5A 4AKEA 3AV0B 4A6PA 1JI0A 5FOWA 4V0OA 1DPFA 3LO5A 1XEXB 3U4QA 4DB2A 2ZUCA 2WMOB 5BW8A 5JI3E 2EFEB 1ZW6A 4B3XA 3DVLA 3EPLA 1CXZA 3SYLA 3A4MA 4TYYA 4YQFA 4PAOA 1W4AA 4GPTA 3QPVA 3DEFA 4H1UA 2YNMA 3T34A 3AQ4A 1KDOA 4YXWA 3EZ7A 4TL9A 1Z0FA 5TY0A 1P9NA 5AWFC 2J1LA 4HAXA 3NBXX 1N25A 5GJWC 4EPWA 4EUNA 2ATXA 2VHCA 4KBGA 1E1RD 1F2TA 3U3RA 1V5WA 2FZ4A 5K8LA 1TEXA 2ZYUX 3AF1A 3GJ3A 2K5UA 3NXSA 1IHUA 2GESA 4CEHA 2QY9A 4RY2A 3QF4B 2GK6A 4ZI3A 2FPMA 2ZRMA 1VKJA 4QHSA 1WB9A 3RHFA 2GWHA 3B9QA 4PQYA 1KI7A 1F6BA 1IM2A 1KI6A 2H8KA 1UJ2A 2BM1A 1E98A 1FUUA 3ETLA 5AJXA 3UXMA 3AUYA 5DI3A 1VPLA 3SBEA 4BLPA 1P62B 4OJQA 3K0AB 3DMNA 4M0LA 2MSCB 3WY9A 5F9HA 1EFCA 3R7WA 4EPYA 1II8A 4UXJA 2PMDA 4MGZR 1XTIA 3SYNA 3D6TB 1Z63A 2ROWA 2DWQA 1EFHA 3QOFA 5C4GB 2BKEA 2D4HA 5K8UA 1PTRA 1D9XA 1XWIA 4RFSA 3RSLA 1CJVC 4I1VA 2BOVA 2KBFA 4LBYA 2A30A 5KDOA 5KUTA 1LY1A 3EIQA 3THWB 3U44A 1TAGA 3DM9B 2ZE5A 4Q4AB 3RAPR 4JJZA 2DHRA 1KMHB 4DLXA 2A5DA 2YWFA 4C2TA 5KTYA 1MO4A 1II8B 2D06A 1O3YA 1COWA 1ZUIA 4LBWA 2PT7A 3ZJYA 1CLUA 1SVMA 4Q03A 3RS4A 4I1SA 2NZ8A 4ARZB 4QL3A 2O8EA 4BFXA 2W6IA 1Z28A 1NBME 3FKSD 5FTLA 1DARA 1FMJA 2XB2A 2F3RA 3THYB 4CEJB 1TBNA 4V0KA 1QHYA 2JDIA 2ZRGA 2IXEA 4Q66C 2WWIA 1GVNB 2Z4RA 4JS0A 2OAQ1 4BPBA 1DO2A 1VYVA 3REGA 5HZHA 1SXJB 1AKYA 4MYHA 4UQOA 1KDPA 4UJ5A 1Q1QA 4D4JA 4QNRA 1QF9A 1KKLA 3LV8A 4NYJR 2BIFA 2ORVA 4XOIA 1ODFA 3R9WA 1KSGA 1OXXK 1E1QD 4L5BA 4MDFA 5FPTA 1F3OA 2QTHA 3SJCA 3WHKA 1U0HC 1SVLA 3BE4A 2J5XA 4S35A 4B47A 1L8QA 1M6NA 3U6KA 1IJEA 3X1WA 1IJFA 3I8SA 1MT0A 2LKDA 2IHYA 3MCAA 1ZP6A 2CCKA 1G6HA 1U2RA 3ZLJA 1KSJA 2HUPA 4WZ6A 3LX5A 3I8XA 1F2TB 3BFKA 3B60A 1RPZA 3NTUA 4JVLA 3CX8A 4YDHB 3WXMA 3EZ6A 1NN0A 4L15A 4TWZA 4L9WA 4QJ3A 5JBQA 4ZDWA 2HYIC 2CVFA 1W49A 2H7VA 1R5OA 3VFDA 4HUQB 2XJ4A 4DWJA 5E4FA 2IT1A 2ORWA 1P72A 2F9MA 4NONA 1VCOA 4O2RA 2V4ZA 3BK7A 3B2EA 4P33A 2ZE7A 2ZAOA 2FF7A 2QGZA 2TMKA 2V1UA 4UXIA 2L0XA 3KJIA 4QRHA 5GJBA 5GADl 3VX3A 2BJVA 4ZDKA 2V55B 1OYWA 5L3QB 2YOGA 3ZH9B 2OBLA 4NZYA 1N6RA 2GRJA 3QKUA 1US8B 3GQBA 4DDWA 3ZVNA 3R8FA 1UBFA 2JJ1D 2QROA 4K46A 1P2TA 2Z83A 3LBIA 1D2EA 3LBHA 3CNOA 3EIHA 2X8AA 5FPKA 4YLGA 1TADA 3C5HA 5JZVA 1YZNA 4Q48A 1VYUA 2BHRA 2JLZA 3FB4A 2W00A 3X1YA 1KZ7B 4DUGD 2FNFX 1AIPA 2JATA 1RJ9A 3EWSA 4KLNA 4M22A 4XTRA 2FU5C 2QBYA 5EE0A 5H1YA 4OHVA 2W6JA 2WKRA 3K09C 2IWRA 3H84A 1J90A 5CDFA 3AVTA 2I3BA 2ZROA 4B3GA 4AKIA 4WA7A 4CT5A 4DT1A 2O5VA 3AH8A 4D80A 3CX7A 4W5HA 1II0A 2OFXA 3GEIA 3CX6A 2XEXA 4KFTA 4CYMA 2C99A 4B3BA 1WQ1R 4US2R 5KNBA 2OLKA 1DS6A 4XVRA 5A0FA 3LD9A 3QIAA 3CRRA 3PFIA 2N42A 3IIMA 5FL7D 2R6AA 2YJTD 4DSNA 1N6PA 1N5JA 4X8HA 3T61A 2E87A 1ESMA 3AKEA 5DIFA 1RVDA 3LW7A 2A9KA 2ZJAA 2JEOA 4PAQA 5JLJA 2BBWA 4IW3B 1E96A 3T5DA 4Z1MA 4AY2A 1ZC3A 4BFUA 1UM8A 1E2DA 2WSSA 3HPRA 2J87A 4N0EA 5ANRB 4NP6A 3EC1A 5GJVC 1AS0A 3F5FA 2OCAA 5EZ6B 3ADCA 2OILA 1XRJA 1OXUA 2H5EA 4QNMA 4V0LA 1TEVA 3FMPB 4B71A 3EX7C 3CPEA 2IYWA 2PL3A 2WAXA 3QXSA 4A0FA 3B5JA 4JL6A 4PC1A 3T35A 4HLQB 1ZUHA 3LWNA 2ZRAA 4NYIR 5BXQC 3KXKA 3QJYA 1CTQA 2UVQA 4I99A 4GDFA 4GT1A 4Q9HA 3VAAA 4URUR 2VP6A 3FHOA 4ON9A 3AP1A 3WRYC 1G3UA 2YWGA 2ZI4A 1ZCAA 2QRZA 3GEHA 3TE6A 1GFIA 3B13B 2PBRA 5LPNA 3KQNA 3D31A 1E4YA 1NL3A 1XEWY 4RSGA 2XTZA 2HF8A 4L9SA 2QQ0A 3IO3A 1PUJA 3RNLA 1N5LA 2A5YB 1J7KA 2HEIA 1OHHD 1XD9A 1ZVQA 4L8GA 1SZPA 1CRQA 1DG1G 4PO8A 3UGLA 4Q9IA 1KJYA 4EKDA 3R8CA 2NO6A 4DSOA 2PEYA 3L0PA 2NO7A 3AB3A 2JCSA 4KFRA 1GTVA 1SKQA 2VHQA 421PA 4AYXA 5HKKA 2ZS9A 2QUZA 3KQUA 3SQWA 2ZR7A 1E3MA 4XTCS 3LFUA 3FHTA 3P20A 4XD7A 2RGNC 5FOTA 1SGWA 1XD2A 3LNCA 5KOYA 2VYFA 3SJBA 3D7MA 4KYUA 5E3HA 4Q7KA 3HDTA 3T1QA 4GBMA 1SHZA 4UXHA 3E5HA 2KBEA 3TVTA 1I2MA 1RFHA 4A1FA 1NMYA 4Q18A 4HDCA 4RCZA 1FPMA 1Z6XA 1C9KA 1SVSA 3QXJA 3W6OA 4B2LA 3IUYA 4TYNA 3RANA 4Q4HB 4YMVA 1UBCA 1JAIA 3EXAA 2DFNA 2ZE8A 4ESHA 3X1DA 4B76A 5CLQA 5JFGA 1E69A 1N5IA 1IXSB 4DRZA 1GRNA 3BJIC 1U90A 4GRAA 4O25A 3PIRA 4AYWA 1NLFA 4B3DA 3KJHA 4OYHA 1W0KA 1HY3A 2KB0A 1G7RA 3P1JA 4WVFA 3V00A 3QUSA 1MRNA 1GIAA 3CZQA 4M1KA 4XD7D 5J4KA 4Q7LA 1W7AA 4Q4HA 3KFVA 1EESA 1OIVA 3WYGA 3I3SR 4LJ7A 1T5IA 3QPWA 2AN9A 1FP7A 1Z0AA 3AEZA 1CRPA 2D3WA 3OIWA 1G17A 3GLFB 4PFSA 2JLUA 5HCNA 3TRFA 2G9NA 1CEEA 2BV3A 2X2EA 4BASA 1MABA 2ONJA 2VRWA 1OPXA 3ZD6A 3A1TA 2ZM5A 4ARZA 2WJGA 3QBVA 4A0HA 2F1JA 4EJSC 2WJIA 3ZZUA 2PX3A 2HJGA 3D3QA 2Q9CA 2ZJOA 3WNDA 1CR1A 3K9GA 4IEIA 2CVHA 1GRRA 3B1XA 3I62A 1PJRA 1XTKA 4F4JA 1OIWA 2AKYA 1J8YF 3IHLA 1UEJA 1Z0KA 3GJXC 2A5GA 2YC2C 3NBZC 1M7BA 1GKIA 3WP0A 2BKUA 2ZI9A 4F91B 3ZYCA 1VECA 1Q20A 2FGJA 1VCNA 4PHGA 4URVR 4RFSB 2AR7A 1GITA 4E07A 3A4NA 4PSAA 1XD8A 3BD9A 4ZI2A 4UNQA 4BRWA 2AWNA 2PLRA 4AD8A 5JRZA 3PV0A 2PZEA 1FUKA 2VL7A 3OEHA 2GCPA 5BYJA 1EWQA 3TJZA 2VPPA 4EQ6B 4PO9A 4P31A 2OCYC 3I5YA 2WJYA 3NVAA 3TMKA 2VSOA 3IPYA 3FWYA 4OHXA 4Q1FA 2IBMA 3GLGA 4TZ6A 4JMPA 2HJVA 2VF8A 3PG5A 4KO8A 2CXXA 3QKTA 3EIEA 1G20E 1NVVQ 2P6RA 1U9IC 3DM5A 1KI3A 3ZIAA 1U8AA 4MKFA 5JSZA 3IEUA 4EQ6A 5KDDA 4JZKA 1Z5ZA 3A58B 2ZUDA 4A36A 2DBYA 1SVOA 2REXB 1CULC 2R65A 1E79A 4PHFA 2G0NA 5J4LA 4JT4A 1BYUA 3FKQA 2ODWA 4IOMA 1N0VC 4JSYA 4ZKDA 5KSYA 1OH7A 2UZ3A 4PSKA 5DISB 3QSYA 2IYVA 1KO1A 2AL7A 1AN0A 3R9IA 1OSNA 1ZCBA 2WPDD 2DPXA 2ZRFA 5FL3A 3PUXA 1F2UB 4AWXA 2RGGA 1D9ZA 2OAP1 4M2LA 2F9LA 3DKPA 2XOKA 1KI2A 2JLYA 3ADDA 5CB8A 2O8EB 3KUCA 4WIAA 3EZ2A 2FFAA 2H17A 3CF2A 4FCVA 1E2PA 3GLGE 3LXXA 4GFDA 1QVRA 1YHNA 4BWYA 3RABA 2WSMA 1G8GA 1E2IA 1DEKA 2RCNA 5G3ZA 1D2MA 2XTNA 5JHGB 4CEIA 2ZITA 2FEMA 2CCJA 2EW1A 1NG9A 1O87A 2QP3A 3CNNA 3MWJA 1P2UA 1JBKA 5TVKA 1ZNYA 4US0R 2SHKA 3BB3A 5DH9A 2W2VA 3WMGA 5CYPA 4G5QA 3QEOA 3GFTA 2OBMA 5L3SB 5IK2D 4JVSB 3GMTA 1R5BA 3EA0A 2Q3HA 3CO5A 4OI1A 4O2LA 4QC2A 2QAGB 3ZVRA 1X1RA 2VRWB 4A0GA 1UKZA 3AKDA 2IEYA 3B8HA 2JJ1A 4C2UA 2QSYA 3FYHA 3H86A 5AJYA 3H1TA 3OEEA 1R0XA 3IIJA 3CRQA 3CONA 1KOFA 3F8TA 4WOPA 2XNSA 3B9PA 4IDQA 5JI2E 1Z6GA 3KZ1E 2CL0X 1T9HA 3T15A 3PUWA 3CRMA 3SU8A 4EPXA 1I4DD 4D0NA 2VF7A 3FKSA 2IS4A 3AM1A 2XOKD 2NOAA 2A5FA 4RVCA 4C7OB 4M1OA 2ANCA 3MSXA 2YC4C 4EJSB 6Q21A 3PXGA 3FMIA 2Q9BA 3FFBA 3QG1A 4TLCA 2B92A 2PMKA 2QPAA 2WWYA 1UF9A 4HAZA 1EXMA 3BAFA 4LBZA 3GEEA 1NNEA 1GKUB 1AGRA 3ZQ6A 2VHUA 3VR1A 1ZM7A 1W2HA 2MSEB 4LJAA 1W36C 5IDVA 4Q19A 3F0TA 4C0BA 5HKKD 4HAWA 1R79A 1DAGA 4NCNA 2QPOA 4HAVA 4ACAA 4QM7A 3RRNA 3VQTA 2QP9X 1R2QA 3FMFA 4Q1EA 5CJPA 5KPDA 4U7DA 4GP6A 3I73A 5FBVB 4XIGS 3BFXA 1S1MA 4FKDA 2HYDA 5DE3A 3DZ8A 3U60B 1XMVA 3NEJA 1AM4D 1KMHA 4IDNA 1IN5A 1BMFA 3AGQA 4XSGA 4FN5A 3GD7A 4HB4A 2CLCX 4D25A 3BXZA 4LV5B 1RIFA 2OHFA 3B1VA 1NJFA 4R98A 4OK3A 1N2CE 2FSIA 3DHWC 4F4IA 4F38A 1DAEA 4EPVA 1RKBA 3BORA 1YU9A 3C16C 5EJEA 3SHWA 3D8BA 4HLCA 1KZGB 4IHQA 3C4JA 2XX3A 4IXNA 4MKHA 5FUYA 3TLXA 4B32A 1T8UA 3IBGA 3LXRA 1WDTA 1OFTA 5B57C 4NL4H 4Q00A 4EFNA 1MKYA 4ZCIA 3CB4A 1FTSA 2A3RA 3FE2A 1DAIA 1MABB 4QBFA 4TLDA 1KTVA 5CIQA 4BFVA 1XEFA 4JIMA 4JLPA 3EPKA 2P2LA 1KIMA 2OUKA 8OHMA 4E22A 5EQTA 1G16A 4MUAA 1FX0A 4Q4AA 5DNYB 3EPJA 4A9AA 1OB5A 4KFUA 2O8FA 1G41A 1XEWX 3O8DA 2GF0A 3OAAA 1N5KA 4KVAA 4RZ2A 3UMRA 5KO2A 3A1VA 2ZSEA 4GOXA 2EFDB 2XZPA 1DAKA 4DLSA 1QG4A 4LPSA 2QQEA 3UFFA 5G3YA 3WYAA 1RC8A 3W6PA 4B2PA 5FTJA 1W36B 2W0MA 2W0SA 1G5TA 1R0YA 2QA5A 2CK3A 4TSFD 5F98A 4Q5IA 3CXLA 1Q1EA 4HB3A 3B85A 2J7PD 4KAXA 4K81B 3TH5A 3GPLA 4R71A 5FOVA 1G4UR 1CP2A 2G77B 4OKSA 4A92A 2F55A 3LX8A 3NG1A 2I1VB 2Q3FA 1FTNA 1QZXA 2GDJA 3FHCB 4JLNA 3UEYA 1FQKA 2VP5A 1R5NA 3TAHA 5AUPB 1E2GA 1YR9A 1DG3A 1S9DA 1X86B 2R44A 2GVDC 4BE7B 3ND9A 4B6DA 1GNQA 1ZIOA 2QT1A 4LOAA 1N6OA 4NCKA 4DEYA 5C1BA 4ZKEA 3V9PA 3DPUA 1X1SA 1N3BA 1LW7A 3N5CA 2OSBA 4TLBA 2CL7X 4E03A 4C7OA 1MO3A 1RRGA 3Q5DA 2LKCA 2GCOB 3CF0A 4IJMA 2HDNB 4KVGA 4B3FX 1DO0A 1KSFX 4TZ0A 4B48A 1OH8A 3BIFA 3BBPA 4M9XA 2WV9A 2ZJBA 2AKAB 1YZTA 4M1SA 5BN3A 1YR6A 3KKNA 1M8PA 1TL7C 5CYOA 2FN4A 3K0CC 2YV5A 3LQQA 3RLFA 4I81A 3UMFA 4KCGA 3B1ZA 5FOXA 4RKEA 2ZUBA 3FDIA 4B6FA 2X1VA 2AD5A 1Z8FA 1W48A 3L0SA 1E9DA 2GXQA 1FOEB 2IX3A 1NN5A 2X77A 3ICEA 1E2QA 2OCPA 2ENNA 2VA8A 1ZC4A 3W3ZB 1R8SA 3OIUA 4KV9A 4JLKA 1PV4A 1T4GA 2PZFA 3CR7A 1F60A 3VKGA 1S8FA 2QN6A 3SFZA 2A78A 5LD2B 1V43A 3SHFA 3TQCA 3RS2A 4AG5A 3VR6A 3FPAA 2IA5A 4KU4A 3THWA 1KO7A 4EAQA 2CNWD 3KXLA 1Z0DA 5HE8A 5KHOC 2YHSA 2B7CA 2F7SA 3U7HB 4JLOA 1PTQA 5CK5A 2IF2A 4N3NA 2BMFA 3CWZA 1JPJA 2OEPA 2E73A 4OK6A 4DLVA 2ZJ2A 1NKTA 4FMCB 5JJLA 3TK1A 2O0KA 2RGBA 1JALA 4NHOA 4PX9A 4Q01A 2FFBA 4DLWA 5H8WA 1FAQA 1T0HB 1ZINA 3PUYA 3UG6A 3RSOA 3GLIB 2ZRBA 5M04A 2RB4A 1XZQA 2WWWA 4XWOA 1CR0A 5G41A 5TXGA 2AHOA 2NO1A 3K1JA 2FFQA 4DLZA 1KMQA 2WHXA 1JQLB 3AVQA 4LV6A 3OZXA 3UG7A 3A1WA 1F2UA 4XWKA 1PLKA 2CHQA 1FX0B 2J9RA 3B6EA 2QMOA 3EASA 4D4LA 1P6XA 4PZZA 3R7WB 4XVQA 121PA 1Z2AA 1D2NA 1B0UA 1OH6A 1E9CA 3TQFA 4LGMA 1WCV1 2ZRHA 3MLEA 2R6FA 1Z0IA 3GFPA 1M1YE 1KHTA 4PTLA 1WBDA 4QGFA 1W44A 2NMVA 2FE4A 4E09A 3UATA 3GP8A 1G7TA 1GOTA 1QRAA 4AG6A 1IN7A 2QEQA 1CF4A 2A5JA 2B6HA 2VH5R 5L3SA 4DUGA 2O8DA 2P3SA 1NVUQ 4ZIRB 2ERXA 2FNAA 4G3XA 3RRMA 5JCZA 3CBQA 4LHWA 1G3IA 1NY5A 3I72A 4W5WA 4V03A 4L9MA 2ZRLA 3X1ZA 2IS1A 3LH5A 4BZPA 1Q22A 1QG2A 2GXAA 2O8FB 4G5RA 3MWKA 2HT6A 2D7CA 1P2VA 5FUWA 2C2HA 3BOSA 5J47A 2MMGA 4OQNA 4C0LA 1Q12A 1LF5A 4YMSA 4MGIR 5JWHA 2B21A 2DFLA 2QU8A 3GLHB 1XJ0A 1SULA 3E2IA 4ZIRA 5C46F 3VKHA 1CKEA 2IF0A 1KDTA 4FMDB 3P4XA 2ZR0A 2QM7A 1BMFD 3IQWA 1L7VC 1NRJB 2R9VA 3U44B 2ZEJA 3K0SA 1H8HA 5LB4A 1TPZA 1BOFA 4TLAA 5J4YA 2ZPTX 4CGZA 2GBLA 1VCIA 5P21A 3L2OB 2WSSD 5KYKA 3QKRA 3NBFA 2IS6A 4XJXA 2QMUA 2WJJA 1G3RA 1ZD8A 4MGKR 2QRNA 1IN8A 1P3JA 4BLRA 3K9NA 4LCBA 3IDQA 4B44A 1WXQA 1JR6A 4XWAA 3I92A 2CJWB 1N6HA 2C77A 2FZLA 1L2TA 1Z08A 2P6UA 1RJ9B 4LHVA 2HCBA 3QXHA 5DI3B 4F93B 1GSIA 1DELA 2C8VA 5L3RA 4PC7A 2ZR9A 3HU1A 2JASA 3DMDA 3VMFA 5IF9A 2H1LA 4PC2A 5K8IA 1UKEA 5FFMA 4PPQA 1JJ7A 3IO5A 2G0TA 1P9WA 3MUFA 4DDUA 5TMPA 3WP1B 4AC9A 2YYZA 3U7GA 3BERA 3Q72A 4PHHA 4DJTA 5CJ2A 3MG9A 4IVQA 4DB4A 4W9MC 4JVMA 2QNRA 3L43A 4Z1MD 1JR3A 4DCSA 4TMZA 1PLLA 2FGKA 1DE0A 1XNJA 4O3MA 3LRPA 4LJ6A 5A5GA 4LJ4A 3P4YA 3OFND 1KO4A 2ZQ5A 3GJ0A 2QPTA 1KO8A 3PITA 5AJVB 1NBMD 3I1FA 3QQ5A 5IK2A 3T1TA 2JJ2D 3H0KA 2QTVB 2P6NA 2QBYB 4WZAE 2ELIA 2IL1A 1KKMA 1TU4A 3A1UA 4CF7A 2ORIA 3C41J 2FSFA 4C0SA 1ELOA 1Z06A 4DCTA 4PPGA 3CH4B 5AJZA
chains in the Genus database with same CATH superfamily
2VF5X 3R6LA 4MXDA 3ZZ0A 1IW4A 4Q3AA 1AGYA 4HB2A 3KBOA 4IGAA 4HG2A 3D2LA 3K73O 1FXUA 1EFLA 3M1AA 5TEVA 1WMSA 4K8RB 3T7TA 1PJLA 4QFCA 5KYWA 1UWKA 1N92A 2FMUA 5THQA 1U80A 4M86A 2GTIA 2KLBA 4PGFA 1VMEA 1L4FA 1M34B 4QOFA 1SRRA 1ZU5A 3I04M 3IVXA 4UARA 2IEGA 2R1TB 3MINA 4MS4A 1JQBA 2VJCA 3H0EA 4Q7JB 4BN4A 3TSAA 3UNXA 5JSZB 1I4TD 4Q6WA 5A71A 2W8BB 1RP7A 3SC3A 4YY3B 3MOIA 2H2FA 3P26A 3I9JA 4CDRA 2C95A 2EFHB 1OZGA 1SG0A 2PMBA 2Y1DA 3G0CA 4ZT7A 4CT4B 1E7RA 5JY6A 3TGLA 4MCHA 1YKSA 1XTQA 4NCJA 3RJMA 4AF8A 1PFYA 5T3YA 2UYCA 1E1NA 2H4YA 2GJKA 2I3ZA 2B2CA 3C3WA 2YJ5A 3OU2A 5I48A 3V7FA 2EEPA 3DDSA 4X84A 3CPJB 1G8HA 2GEVA 3DZJA 3W1WA 4BRZA 5I3ZA 5KX5F 4F5EA 2SNIE 3BF8A 1WL8A 2GETA 2WD9A 3NCHA 3HGTA 4J4BA 1TQDA 1V3QE 1H2RS 4Y9RA 1OLXA 2K2WA 4DMGA 1VTKA 1Z18A 4NCIA 3P94A 2EJCA 1CVIA 2FB9A 4HADA 1F48A 2W83A 3PA6A 4CUZA 1EGHA 3JD2A 1Z3IX 3KDSE 4BTEA 4Q9NA 4X7PA 4YAOA 3E53A 1GUAA 1VSQA 2XTAA 1XZPA 1Q15A 2VP3A 3B7PA 2DFKB 4N03A 5UKDA 4YRIA 2BEJA 1FW6A 3SM9A 2ZCJA 1L5QA 4RY0A 4Y2HA 4KVZA 4BFWA 5HRAA 1I0ZA 5E8RA 3HUFA 4TTPA 1NIJA 4RK5A 4X1KB 5BQ5A 5LL6P 1SG9A 2FUCA 5L6LB 1M34E 3SMVA 4A8PA 4RGYA 2CB0A 4KXUA 4YJGB 3S5UA 3FDXA 4OFZA 3VU9A 1E77A 1MXFA 4HRAA 2BHNA 3V1LA 2FPWA 3WGJA 5JNSA 5J2TB 1WSWA 3FTQA 4OTZA 5GM1A 1RWMA 1MB9A 3OF5A 4JBGA 4CMIB 4FOLA 3G5AA 4EMTA 1VM6A 3PQEA 4QBIA 3GJZA 4U9UA 2J46A 5K0SA 2IBSA 1G21E 2CXOA 1ZBDA 5F9MA 4HJRA 1UUCA 2RGDA 3OTGA 3NAGA 5I4IA 3I32A 3BREA 3VYTB 1UDXA 1WKBA 2M6SA 1SD5A 2W2QA 1QDLB 1IB6A 1MTOA 2GCNA 4URFA 3R7AA 3V4FA 5BR8B 5H4GA 4OHFA 1U2EA 1OHHA 3QIVA 2FWJA 1L7MA 4AZ3B 4JP2A 4NARA 4CJXA 4LFCB 5CFLA 1IHOA 3R2JA 1E3IA 3D8TA 3WXBA 4EIWA 5G4KA 3BIOA 3A4TA 3FSRA 3KZCA 3K2EA 4GBED 4UUPA 4LUCA 1GDDA 3AEXA 4NE7A 1GP2A 4C0AC 2GM3A 3L0YA 3JWJA 5FTNA 5IF3A 1VLMA 3BHNA 1D4AA 1L7QA 2GEBA 1RYNA 3JSXA 5CHEA 3ONEA 2IYFA 2AFIE 1ABBA 4N4AA 4MVJH 2R4TA 3U26A 5MFPA 3U9SA 4F2GA 1RCTE 1HG0A 1UP7A 2JIZD 1BFDA 4Q05A 5CNJA 5C2JB 2UUOA 2WT8A 3A11A 2XD4A 4PAGA 2CXUA 4QYXA 2PXHA 1E1LA 2JLSA 3QHQA 3TRDA 1VXRA 1MAAA 2FMXA 2POCA 1N5DA 5G40A 2Q3LA 1XBTA 4JDUA 4TVKA 4LOLA 3KOMA 4EJMA 4Q7EA 4CNQA 3VVBA 4B73A 1ZM2A 1BX0A 1J99A 1MB2A 3HP1A 3L04A 5LA6A 4F3RA 1FMFA 1UC8A 3HR8A 1SWVA 4DGQA 4D0LB 3OM1A 4EYQA 4D4KA 2OT3B 2ET6A 4TXHA 4TYWA 4C0WA 2W58A 3FHLA 3ROFA 2OD2A 2DUUA 2VAMA 4JSTA 1VJDA 3HB9A 3C7KA 3GX1A 1AURA 1ZVMA 4FE3A 1QDUA 3MJCA 4IMJB 5IKOA 1K06A 3IAFA 3G88A 5JQGB 4Q1CA 1DIRA 3AUFA 1RYEA 2ZT5A 3C3AA 1RMQA 5EZYA 3GGOA 1U3CA 1U2GC 2VDVE 1GGJA 4RA6B 3I9V6 4D4MA 2W42A 2QW1A 4GM0A 3OJ0A 2VBCA 5JSFA 4HI0E 2G06A 3O03A 1D07A 1WXHA 1A2QA 2ZCVA 3AESB 4CV2A 1Q50A 2DAPA 3QVWA 4CQNA 2O8CA 4CLOB 1NLUA 5J23A 1P73A 2BFDB 2GZDA 2JC3A 4O02B 4JOCA 1QP0A 3FC3A 4PIVA 2CF6A 3WSTA 1O89A 2YIJA 2WWRA 3AUXA 3DWFA 3I9LA 3NGXA 2V7VA 4TWBA 4F4FA 5JSQA 4L5IA 5GIOE 4ML3A 4D82A 3EK2A 2FHPA 4HMQA 1PK9A 2P5UA 1DP4A 2VP2A 1ECCA 2H1CA 2A9QA 4JYBA 5CM2Z 2FKAA 3GLTA 4CCYA 4D8VA 3I0ZA 4G41A 3Q15C 2WPNA 3P9PA 4Q9LA 2ZSUA 4DC9A 2HW8A 5LQAA 4XLTA 3OQOA 3LVRE 4FW9A 1GYPA 1MR3F 5DXAA 2FLWA 1LSOA 5KQLA 1FFYA 2ZJYA 1XCLA 2DWPA 5JROA 3THYA 4CEJA 3D2AA 3P9YA 4UHHA 2EOAA 1KVUA 1T3SA 1VKNA 1X7WB 3BRCA 3MT9A 3PXBA 4UMVA 1V37A 2VDUE 3KJGA 2HHJA 2W4MA 2WYOA 3ZGXA 1GNRA 1IONA 1Z2CA 5EXXA 3S8YA 3C15C 2AT1A 2XUHA 3OH8A 1XJ5A 1T0IA 2H1SA 3B5IA 3FSGD 3IA2A 3IT2A 2YY5A 1Q1GA 3OE4A 3CNQS 1N2IA 1QONA 3NIBA 3QK7A 4FGUA 4PG5A 1NJ5A 1EDOA 1H2YA 4C04A 4A23A 4NH0A 821PA 2AG1A 2RHBA 3PGA1 3N76A 1LI4A 3OESA 3P19A 2MR6A 2R4UA 4QO7A 1JJBA 5G4LA 3HCFA 1GQFA 1B4DA 1PYOA 2FW6A 1H8EA 2Z8ZA 3FFTA 4H0CA 4NEHB 2MOKA 4O2BB 3IXLA 1BXRB 4U2CA 8ATCA 2HB6A 3RNOA 1W8IA 2FAXA 1VHTA 2YIDA 1PCEA 1C2YA 1OT3A 4D9BA 4YT8A 1G3QA 2JLXA 1TX4B 2O5RA 1Y9DA 3BWMA 3OBBA 4FGWA 2CNBA 1UBMS 1A9OA 3L82B 4FEYA 4K0RA 4O0MA 4UU8A 5DHFA 1GNPA 2GN6A 1J97A 2V65A 3OJLA 3T5GA 4GOND 2A67A 3MRTA 1ECFA 5K3SA 5IZ4A 5I9IA 1LUAA 3KT8A 3QV2A 3EQ7A 2OSVA 3MBIA 3I0MA 4RIGA 5AVUA 1N2HA 1RM0A 2WTXA 3K3PA 3WK4A 1GL7A 1E18A 1FFCA 4PQRA 1JV2B 3KTAB 1X13A 4M0KA 1UBGA 4FWIB 1Y48E 3JCZA 5EGSA 2MT9A 4ONEA 5DX1A 5H68A 3E7PA 4D3DA 4XGQA 5HUHA 5IBRA 4FC7A 1X3LA 2BRUA 2VR1A 3KY9A 1BHQ1 2WYUA 1GLNA 3EJ6A 3MILA 2H2HA 3NWBA 3RS7A 4Q7QA 3ORSA 3R3WA 4KBFA 4ZDIA 1X1CA 2X9VA 2NZJA 1D2HA 2A94A 2FWBA 1NW8A 3C48A 1O0SA 4EKNB 5A6SB 2GKSA 1J00A 1ZUNB 2QTNA 2PKYX 3U7FB 5B4UA 5C1DA 3W4IA 4H6XA 4AU1A 4GVXA 2AJLI 2EARA 5LQRA 1XPUA 4UHFA 2LRHA 1GGEA 2KMLA 3EDQA 2W6PA 1X7GA 1IYZA 3ZZTA 2PZGA 1HQYE 3OUZA 4E5MA 2J3LA 3PGMA 3FI9A 4GZ5A 3TUIC 4B35A 4C07A 5FDFA 1OXVA 1UBUS 3M1LA 1C0EA 3OECA 3UICA 1XZAA 3O0DA 2ZB4A 2H92A 3LF1A 2WF6A 1C29B 1JJVA 4I46A 3UMGA 3UTDA 4S1OA 3WOVA 3WGQA 5LDDC 4OAPA 2ADFA 2WVHA 1FFXA 3QUTA 1NU6A 4KPYA 2UZIR 3DKRA 4DQDA 1DTWA 3EY4A 2I6TA 2IELA 3DEIA 4XQEA 4HN2A 1JXMA 1FUIA 1SUSA 2O50A 3HEBA 3WB2A 1X15A 5CB0A 2I91A 1BRMA 1TA9A 2GPSA 1RBZA 3KZVA 3LKDA 4K05A 3D9QX 5KNCA 2Z6UA 2PZBA 4N0DA 3DWGA 1GUBA 1SA0A 3OTWA 3HYSA 1WSAA 3IBYA 1BVHA 3Q85A 3TLAA 1E3TA 1KYIA 3NHBA 4F2WA 4RY9A 1NY6A 1D7OA 4OJKA 4WY8A 4XGIA 2B5OA 3MT8A 2AX4A 2HKIA 3M9LA 4W99A 2TECE 4ITVA 4J2TA 3W78A 4AJOA 1XTUA 1WF6A 2CCGA 2JGNA 1RZRA 4CF3A 4BFLA 4JP3A 3IBSA 4HPXB 5C8YB 2C2BA 3M6AA 4LV8B 3LQRA 1MNAA 3IEKA 1I5RA 5EZYB 5SV2A 4R7ZA 4MIYA 4B33A 2AZ4A 5I4KA 1OGYA 4UCFA 4DA8A 1Y1TA 1RWQA 1HI9A 4DIDA 3RJ9A 1EZ4A 4BNZA 3N2GA 1DT5A 2QSUA 4MUYA 1OIXA 2FX2A 1T9AA 3LLSA 4IIVA 3ZOZA 1RJDA 3SZ3A 5J4VA 2V6IA 3P2IA 3QG5A 4GQIA 4DT1B 3T99A 3RFXA 3ZQKA 4IBOA 4DG9A 3TLYA 2F3QA 4FDAA 4M36A 1H8ED 2QZ9A 5I7FA 1SY7A 5IVHA 2CUNA 1GG9A 3TW8A 3HFRA 4DQXA 1KGDA 1J2RA 1XPRA 3LC1O 2ONCA 5KTMA 4JT2A 1HPTA 4LJLA 3U0BA 3KEFA 1IUNA 3EAGA 3D2CA 4MGHA 2LBPA 1XAIA 1MJBA 4DMMA 1FY7A 3H87A 1N5OX 3ANLA 2PQMA 3FPJA 2H0RA 4N40A 4PE5B 2XWBF 4GP9A 2F3TA 3DAHA 4ZO7A 5DWVA 2FSGA 3R3JA 4OBXA 3DQPA 4N0QA 3UOAB 4F1WA 5BSHA 3I5XA 4YAIA 3OJXA 1KYWA 2PAFA 1HE3A 4PLYA 2P9FA 2C4NA 3AJDA 2C57A 4EG4A 2OB2A 2ZYTX 5GWXA 4E94A 5K2OA 3OU7A 5AKXA 3EXHA 2PO7A 4YRPA 1FDUA 1BMTA 5CGZA 1JAYA 1Q77A 3PFCA 2L69A 2XDAA 4TROA 4R83A 3TXXA 5JW6A 2R6HA 2C5AA 4Y9UA 3X1MA 2QYHA 1I6MA 1OLUA 3ANXA 1VDZA 4I9NA 3UUGA 4AIIA 1W30A 3CNLA 2V6FA 1Y4SA 4ODIA 4GNKA 1A9ZA 3Q8XB 2CWFA 5I45A 4MQ5A 4QGHA 5HBRA 2TMDA 1CJUC 4I3FA 1FS4A 3V4VB 3ONWA 3PUVA 3OY2A 3A9RA 2Q4BA 3ACDA 1LFDB 4HDRB 4MA4A 1NVMB 5IHPA 4G8DA 3A1FA 2QQDA 2C0CA 4I9FA 1YUMA 4KQHA 1OI4A 3SM3A 1EQUA 3TE7A 1NN3A 2WT4A 3QMVA 3R5JA 3DLCA 3IVCA 4IKEA 2VSXA 3CVVA 2CYCA 2X76A 2R8BA 1CQJB 2EHJA 2YMMA 1VE9A 4O4IA 2EYUA 4RTMA 1I14A 1C30A 3R41A 3N74A 2WIJA 3RQIA 4E7PA 4FONA 2DT8A 4K3UA 3D0KA 4E2YA 3PD0A 4OF4A 2MYUA 3FHJA 4CIYA 4YQYA 1QGDA 2GHRA 2ECKA 3O2QB 1ADCA 2G9QA 2CYAA 4YJFA 3RTCA 3AXTA 3DPIA 4HL6A 3NZEA 4IF4A 4M46A 1EPUA 1MDBA 4JJ6A 2XCUA 3DZGA 2GJSA 2C1XA 1M6EX 3VAZA 5KNLA 2ZCUA 3IH5A 1MUUA 1AA9A 3B6KA 1QBKC 3MQ2A 3ZS8A 4B87A 3ENZA 2J48A 3C8MA 1YTPA 2VP0A 1PE0A 4M87A 1OFIA 1HL7A 4MHOA 4O4JB 1A72A 1KFKB 1UC5B 3NTVA 4MI6A 4WZZA 3TZHA 1RQXA 1XWFA 1GQSA 1HT3A 1JLRA 1V95A 4JJ4A 4QOEA 4WOBA 4ZYWA 3RVBA 3MLBA 4TLEA 1X6VA 3JQAA 2IVFA 3KYDA 4M21A 2H8GA 4ZDJA 2G70A 4D57A 4S0ZA 4HAUA 3IT1A 1PLJA 1X80A 2UYQA 5GAJA 5FWXB 2HA6A 1HDXA 2J3JA 3OLYA 3OOEA 4HDSA 4O5AA 3EEYA 2Y0DA 1JXQA 1KAGA 1P2SA 4RKFA 5DM4A 4FINA 3JASA 2Z4TA 2RGNA 3RUIA 2X22A 4X6XA 3PUZA 4BMNA 1LPMA 2JBAB 3EWAA 3G0GA 2GJ8A 3TZLA 5CFZA 4ZOLF 1DAPA 1QTNA 3ICVA 2AZDA 4Q6BA 4E7OA 1Z8DA 2MSKA 1CUCA 1FK8A 1Z45A 3TSWA 3NKVA 3NOOA 3RE1A 4GEKA 3TZ6A 3GBPA 4I4LA 3PX2A 1V1JA 1EX6A 2HQ1A 4JK3A 1CJKC 3EVEA 4X92A 1QC5A 3WS7A 4BEBA 3GRVA 4V3BA 5IX8A 3OEHD 3WQRA 3C45A 5CD9A 1EGAA 4XZ3A 4S3MA 2FPXA 1C3XA 1NJ6A 4RH1A 2BISA 5CAEB 4Q3DA 1Y7LA 5EIXA 4YUAA 1YI1A 4HQ6A 2DBVO 1PG2A 2VP9A 4B4KA 3CMMA 1XD2B 4G56A 1DCTA 1M75A 3O47A 4F0JA 1F8GA 4CL0A 4RIEA 3ESZA 4WCFA 4EO7A 1GQ2A 3BULA 4EKYA 3WLKX 2GD6A 3KQSA 2XADA 1HC7A 4J43A 3JX9A 3DVQX 1R0LA 2I66A 2UYYA 1YGPA 2GILA 5CH8A 1LSSA 3WWZA 1IY2A 1XQ6A 3VC1A 4KQFA 5EXEA 1ML4A 1M8CA 4PRZA 4IH4A 3RSZA 3ZWXA 6REQA 1M8KA 2IYTA 1P1JA 2GCIA 4PPYA 3UHAA 3QQPA 3PQCA 3N8IA 3MOGA 1K8YB 2Y9PB 3PWTA 5EP2A 2B1JA 2FJUA 1I30A 1QRSA 2VUUA 4LRUA 3EXG2 4WBSA 2YWBA 1Q83A 3ORYA 2O0JA 3D7LA 4ILKA 3FXAA 4JL5A 3RUDA 3K0FB 1IBCA 4I55A 1JHDA 1BG6A 4MRMA 3D3WA 1SU4A 4MV3A 4WXYB 5SZHB 1TEZA 1W36D 4WOCA 4Q12A 4BX3A 4KI0A 2XDQB 2ZU6A 4CWAA 4C7MA 2JFOA 1TYBE 4GMFA 3MUOA 1Y6QA 4OMDA 3BC1A 2ZSAA 4ERNA 4ETIA 1XC7A 3B78A 1BMOA 2AJTA 4XUCA 1X7ZB 5CXQA 5C7LO 4QFMA 1Y3CE 1QYDA 3W77A 1ESZA 1NHGA 1ZO8A 3MWEA 2XT0A 1J7JA 4FNGA 2J9ZB 4JFRA 4WW0A 5ERXA 4W5OA 4UOQA 1JAHA 2OORA 4HVAA 4MJ7A 2WTAA 1E94E 2JS7A 4XX0A 1HURA 5IJZA 1AXRA 2EWVA 2O7SA 2C2MA 1BS1A 3EZNA 3W04A 4ER5A 2WD7B 1FVFA 5B4TA 1NWCA 2E1RA 1XCOA 8AT1A 3WZMA 4D9JA 4MDEA 5IVPA 2NV2B 1EG7A 2Q27A 4YTEA 3OX3A 1XZ8A 4F71A 4ZJZA 2V54A 2EIHA 4HQNA 3ET5A 4L78A 5H3HA 3W6NA 1LWOA 3O8QB 1JEEA 2EL7A 3VO2A 1J5PA 3ZS9A 2VHVA 3IP7A 4PRYA 3UN1A 2YL2A 2G3YA 2ZRQA 5FPQA 1E1MA 3RFTA 2CL6X 2GEUA 1ODJA 3A36A 5HKOA 2NXWA 2PT5A 4HLDA 4DNCA 3FWNA 5ALYA 2OCBA 1ZQ9A 3VXKA 1G9TA 5C52B 4QG3A 1DDOA 1N3YA 2P35A 3GFVA 3HYCA 1X7XA 2HLDA 3FJ1A 2GXSA 4DVJA 1W4CA 2XA2A 2WLTA 4BGDA 3LT2A 1AZTA 3HJNA 3CH6A 4PEVA 4OLHA 2RAVA 2QE7A 3OU6A 3Q7PA 2PH3A 2H54A 2IHTA 4I1OA 1A5TA 1Z0ZA 2R86A 1AKTA 1ECGA 3CPHA 4I5GA 3ADKA 2Q5EA 3I9KA 5C18A 3G8BA 5ALEA 2F43B 2QXYA 4Z1OA 4I50B 1I4WA 1H9BA 4LDJA 4YDRA 1IHPA 3K9HA 5DOVA 1E61A 1TA0A 1DZIA 5G1OA 5CW2A 4AS1A 4R9NA 1QHSA 3OA0A 3JWPA 3RTEA 1O95D 3AVOA 5HPYB 3KT0A 5JHHB 1JEAA 3NGLA 2G1PA 5AVJA 4J1SA 1FEZA 1LU9A 3FPEA 5IEJA 2OFWA 1OR8A 4RPCA 2G83A 3N0RA 5THKA 3FYSA 3K8ZA 4JLDA 2ZRNA 1LPBB 2OWEA 3RBAA 1KQOA 3H9GA 3PXXA 4KPUB 3MD9A 4UAVA 2CE2X 4BS9A 4WA8A 1F2VA 2XBLA 1N4DA 3UFXB 1CVLA 4AMZA 3LKZA 3R6GA 2BW0A 2OXFA 4BEJA 2GSDA 1OKKA 2DB6A 1XVUA 2VUTA 3GZ4A 1W5TA 4G5HA 1SHUX 1QNLA 2QPLA 2AWOA 4JSRA 4C4TA 1EWRA 1H3EA 4C4SA 4GR4A 4LMBA 4CG0A 1VJTA 3FCYA 4GI3A 2AXNA 2CDRA 2ZYIA 3A2LA 2FPIB 4IV0A 5AKJA 4HUQA 5CITA 4NMXB 4YJ2F 5HZMA 2C9OA 4LX0A 2CMHA 3PQDA 1PD0A 1HYHA 2EBHX 4K87A 5TDHA 4DDHA 5LOVA 3FLMA 1P7VA 4M7OA 4X95A 4MWDA 4NMHA 3HR7A 3WKAA 4BB5A 4WQMA 3TPCA 5B4VA 2IUTA 4MRVA 4DDMA 2GBFA 3AL3A 4FFPA 4Q02A 4RM2A 3RH0A 4E4TA 1B41A 3TJRA 4EFDA 5CFQA 5KWJA 1W93A 5J8FA 4HPWA 2QUHA 4QDJA 1Z34A 1HE1C 4QYIA 4AZ3A 5HJ7A 2QR3A 2QL6A 1YJXA 4K3VA 3AR8A 3R7DA 4TTVA 1GPYA 3G68A 2IV7A 4R6XA 5IKMA 1PV1A 4WI1A 4JGBA 1YZYA 2WFLA 1LWNA 5AJWA 1UINA 3UWKA 4H6VA 3FSJX 3ZVMA 2IY9A 4FT4A 3L0IB 1RABA 2VAPA 2FN8A 3KIPA 3ZU5A 2YHIA 3DVSX 4BFYA 1L1FA 3CZMA 2EYQA 3ONNA 4U4AA 4XI9A 3U16A 4X90A 4E2FA 2I6XA 1A8SA 2JI8A 2V7EA 3T3HA 4ZREA 5B1HA 3ASZA 3CNHA 1R4NA 2FEAA 1NBIA 4PQFA 1YVPA 1COWD 2QX7A 4I19A 4A5SA 1O97C 1LBSA 1QHXA 4KLZA 1HNZB 1G8PA 3PB3A 1IN1A 4MNTA 1DI0A 4O4LF 5HR5A 4RENA 2C1EA 3T94A 3ZGZA 1QIKA 3LL7A 1LLUA 4RA9B 5A7HA 4CV0A 3DUFB 4FD3A 1V9CA 4J29A 2ZULA 3TEFA 4DYDA 1CUSA 3E9ZA 4OL0A 3SIRA 2ZKLA 5J1SB 2EJTA 2OPBA 2QD5A 2UKDA 2ZM5A 3TO7A 4AQ7A 3SNKA 3ICCA 3AVPA 3IQFA 5LZ7A 3EFEA 4AW9A 3ZXIA 3ENWA 2C94A 3DR5A 3EF1A 4J7AA 1HEIA 2VF4X 3SSOA 4OGLA 4ZAVA 2DBZA 5KDLA 5TLSA 3ENVA 4LOHA 3UJBA 2H52A 3DKIA 2C2ZA 3ZJVA 1EXVA 3Q3HA 3S1AB 1CWUA 1TKAA 2N1BA 1L5NA 3OZUA 5HX7A 1CRWG 3L8YA 1Y8QA 3D8SA 4JLJA 4FI3C 3EARA 2GPAA 2P9BA 2G1AA 3JATA 2BLNA 1C1HA 1Z0SA 3WLQA 3R5HA 2IP4A 4TYPA 2BTOA 3NT5A 2E6KA 1NFFA 5ADVA 3CKLA 1ONBA 1RJGA 4PINA 3FMGA 4JYPA 3TQTA 4RSRA 1E1QA 1SUWA 1E6UA 3VJKA 1BEEA 2OHXA 2B2XA 2PH1A 4CDGA 3DHYA 3LE8A 4C22A 3HXQA 3M3DA 2VLIA 5AKKA 4WECA 5C5IA 2V4UA 4UDOA 3SIWA 1OV4A 1EX7A 1NPTO 1V71A 3NHSA 3UMSA 3ZV6A 4EH1A 4REOA 2YWEA 1RC1A 3LP5A 1F12A 3K70D 2Q3CA 2BM0A 2WM3A 5EHXA 3KV1A 2Y1EA 1UZNA 1Q1BA 3WDKA 2ZXUA 2J3EA 3FX2A 3TPZA 1XNHA 1L7OA 4FUQA 3TB4A 4H4DA 3ZNOA 4TMKA 3AR4A 3VV3A 2V53A 5T4BA 3D6MA 4B74A 1U94A 1FSZA 3A6ZA 4EVIA 3GLGB 3FETA 2PUEA 1JIUA 2VOJA 4JUBA 2B8EA 4YP7A 1W36C 2X15A 2YWDA 3KAJA 2WMNB 4NPAA 5SYAA 3LHIA 3RYIB 1VGQA 4BB0A 3MFYA 2XXAB 4RK4A 4I1YA 2GYVA 4J4TA 3QX3A 4LJRA 1US8A 3GQBB 1K7CA 3SHTA 1EK2A 1K0UA 4BLQA 4ABYA 4H3KB 4ESOA 1NC3A 1CEXA 2Q8QA 3TQOA 2Y0EA 3CCBA 2F3UA 3CLVA 5FBQB 3BXXA 1N1DA 4N5IX 5G1NA 5AW8A 1OB2A 2JLVA 5CW1A 4HDKB 4L16A 1TF2A 3OZDA 4TMFA 1Q3TA 4OXQA 5DLQC 4GMXA 1G5QA 1SKYE 2D62A 2IKQA 2NUBA 2PJZA 2VNAA 3HVHA 2GM4A 4MEJA 4I55F 2G80A 2P6PA 3D6JA 3KYCB 1Q74A 2OB1A 3BJEA 5G53C 2EJBA 1FXWA 3PQ8A 2IZ0A 2CFSA 3VR5H 1XEXA 4EHNA 4KXFB 1XIVA 4PC3A 1Y5RA 5C7IO 4ZI7A 4JB0A 4E51A 2Q4DA 3DFZA 4OQLA 5CT9A 1E59A 3P96A 4RSHA 1L4UA 2QVGA 2WJZB 2GRUA 1Y89A 1GYQA 3O4IA 4L5AA 4JODA 3GH1A 2HMWA 2W48A 1XMJA 2PSJA 4L0DA 5FPYA 3RRZA 3IE1A 3FCSB 5F64A 1WF3A 3IX7A 4TRJA 3R9KA 1Z29A 3EFBA 2R00C 1ST3A 2VHYA 4IZIA 3BKXA 4QJ5A 5FPHA 1FNDA 4FYYA 5KTOA 5M2QA 1K6IA 3QKIA 2KX7A 3GV0A 4ZVRA 4YDSA 3AVVA 2R8OA 3V55A 4LRQA 1OTXA 4Y7DA 3O7WA 2OD9A 3ET4A 3HI4A 5HF6A 1V25A 5FAKA 5K51A 1DJPA 5I5EA 1SRQA 4KX3A 2XDWA 3RSCA 3WDMA 1V41E 3IILA 1W75A 2RHOA 1GNLA 2FRXA 3A9CA 4X8MA 3U09A 4L6IA 3RIGA 2IP1A 4QBGB 1DG9A 2R0QC 2Y1WA 5D7BA 4YT5A 4OATA 4LVUA 4MPIA 3FNEA 1JUDA 4E4RA 4G86A 2O3TA 3PQ5A 3KKZA 4ZARA 4R8KA 3VPSA 2WUVA 1NT4A 4QT0A 1TVKA 4D6PA 4ZGBA 4JHLA 5E3QA 5ESXA 3T9FA 4JXZA 1S0UA 4ASUD 1PVOA 2WUEA 2HWXA 2OXRA 3QXCA 3W5BA 2HMVA 2PRSA 1Z35A 3Q3GE 2P4QA 4P8RA 2JJ2A 2Z0MA 4LXYA 1EJ0A 4L4YA 3HCNA 3I05A 2WNSA 3DOJA 4M1WA 1LR8A 3A4YA 3CY6A 3QVXA 5FR1A 4YMUA 1YS1X 3Q87B 1MAWA 1TYDE 4F3TA 2BEVB 3MWFA 5ILGA 3RTDA 3UH1A 4MKGA 4AXXA 2ODTX 1EVJA 1ARZA 3JAWB 1PL8A 1Q0PA 4IGKA 2Z98A 2ZI5A 3RKSA 4CLEA 4DJFC 4RNCA 2FV8A 2IXFA 1GKYA 1MVLA 2QMQA 3EW7A 3UJ6A 5BUQA 2FWRA 3F98A 3HXOA 4HLUC 2UZ0A 3MHTA 1HMPA 1E62A 4QVKA 4RE6A 5DYTA 3L9XA 3REFA 6ABPA 1QV6A 3TFOA 1SVWA 4ND2A 4KXXA 2DG2A 2IDJA 4H9GA 5KIAA 4R1TA 1FXSA 3PJRA 2PG3A 3GJ8A 3ULKA 4E5VA 4AQYB 4RM3A 4RMIA 3RFUA 1PW5A 1RFGE 1TM5E 3BN3A 1JKJB 3CLSC 4LJYA 4B3HA 4I9UA 3AVWA 1TZCA 2C3PA 2M6KA 5JPCA 3PF9A 3VZQA 1LPAB 3K6JA 5B30A 3ROXA 2O1SA 1AK1A 1VYTA 1KRXA 1QHIA 1UODA 3A6FA 5AW7A 2AOUA 4ITUA 5CLIA 4MV1A 5EWMA 1RAEA 5GGYA 1H6AA 5CT5A 4I5FA 2Q50A 2VXOA 1RWPA 2JIZA 3INYA 3T38A 4B6GA 4UU7A 4E30A 3QJ5A 1SKAA 3EFOA 2WOJA 1N0WA 3P2KA 2IH5A 2BCJQ 2X7XA 2QQFA 4ISCA 3M83A 1JKJA 1DC4A 4GUDA 1YAHA 3KQQA 1OYYA 2B1IA 2OGUA 4X0EA 2G6BA 5AM3A 3GA5A 4Y2UA 2HWYA 3OLVA 1RI5A 3ZY4A 1XZIA 1HFJA 1XL1A 4IQ4A 5ALKA 4NNOA 4CMEA 1MXHA 1MV5A 1YBHA 2BTEA 1JU3A 4MVJF 4H4EA 5EZYF 4BLOA 1ZMRA 1M2GA 1TMGE 3GRCA 5JECA 1RLUA 4HEA6 4QXOA 1A1VA 2G36A 2UXBB 2AI1A 1J33A 3OOYA 5E6UB 4GGPA 4JLMA 1H4QA 1ZUWA 2BFAA 4FYKA 5HFJA 1RE0A 2M1XA 5J63A 5LQMA 3HLKA 4WNAB 2FFJA 1Y7PA 3CBGA 1G4HA 3H5NA 4HDNA 2M32A 3W8NA 4DIKA 1DQZA 5CB4F 5ALVA 2H07A 2VLBA 4M8NE 4YECA 4YRLA 3U17A 2XTMA 4ZV4A 3NJ8A 4QXRA 4AMUA 2DWOA 4ZN6A 3WGVA 3L7YA 2C96A 3N3AC 3VZDA 3DL2A 5AOVA 2P75A 5EIOA 4EG7A 1TM2A 1CUDA 1YZ3A 4OJYA 4UEWA 3PS9A 3P9CA 4ZKDA 3NDIA 1P6UA 7YASA 4NFHA 5BVHA 4CR7A 3TUZC 1JSRA 3CVJA 3NGMA 4TXJA 1DAMA 1JE1A 1T5LA 1IY8A 2IYNA 4RKWA 3VGPA 1CJMA 1K27A 1B73A 1H8HD 1PSDA 3A10A 3KB8A 3KQMA 3NHKA 5E2AA 3LLUA 2V0CA 4LECA 4PLTA 3AHCA 3B12A 1AZLA 1L4LA 1WDLA 3R5DA 3EYAA 4I3HA 1TUBB 2C88A 4BVJA 2FZKA 3NC1C 3OXFA 2CEKA 3GJ6A 3IAS1 3ORRA 4KZPA 3RF6A 3JVVA 3KKKA 3SOZA 3T4EA 1JWBB 3UKOA 4EOGA 4P1ZA 1UXOA 1C3VA 2JLCA 1EAMA 2OMKA 1CETA 2VYCA 2NIPA 4RJTA 2MMCA 2J0VA 3EVDA 4K86A 4A5OA 2HR1A 5A1TA 5TR9A 3M6VA 5A04A 1CY7A 2Q5FA 2QQGA 5KAPA 1RAAA 1T24A 2LPMA 3BJRA 3ROTA 3ZHZA 3H75A 4YRJA 2QG9A 3GUYA 1ZD9A 5C5CA 1XK6A 4NPHA 4B3CA 2IUFA 1NLYA 5C81A 1WHTA 5FUVA 1TCBA 5FF9A 2G5GX 3AUAA 3DDZX 3B70A 4P2BA 2FA9A 4MITA 3EQ8A 1BW9B 2HXYA 1U28A 4QBTA 4B80A 3SJAA 2L8EA 1NG1A 2XYHA 5AKHA 1KZYC 1TGSI 2C5LA 2QX4A 1VIMA 2EFJA 3DW1X 3OE1A 2XNHA 1GILA 2C5GA 3KD3A 3QNUA 3L0CA 2NNWB 3RIYA 2RKWA 4AI6A 4KJZA 5DHQA 1EX1A 5K01A 4DMFA 1Z2PX 2O7RA 4L7QA 4M88A 3ZDZB 2R3SA 2Y0BA 1T0PA 3ETEA 1S1CA 4GX2A 3UWOA 1GQYA 4GGOA 3EIUA 5LN1A 4YUXA 1RI4A 4EJFA 3OHSX 1U7WA 5KTRA 4FMBB 1I3LA 1QVVA 1P1BA 1WQ3A 2F8LA 3NUQA 4IGEA 4JI5B 2IU4A 4D4HA 1Q11A 3GLUA 4EG0A 2Q4RA 2W2TA 3WMFA 1OTYA 3RV4A 5HK9A 3JWIA 1UJCA 3FG9A 5DVZA 1KDRA 1UOOA 1VG9B 3AW9A 5JC1A 3PR2B 3UUEA 1DEAA 4N1AA 1NKSA 1TFRA 4RJLA 2XUQA 4V0ME 3RHTA 4DJDC 4G23A 1ZK4A 3QBTA 2V6JA 3FOFC 5C7YA 1WY5A 2X6TA 2X9NA 2DLNA 3BMCA 3Q10A 5DHTA 5DM2A 3HS3A 1VPEA 1IEXA 3GPBA 3S68A 4BNYA 4PBSA 1GPDG 1M7HA 5LIRA 2LP4Y 1RSZA 3QE0A 1II9A 2KW5A 1O58A 4W8OA 3PGKA 2PUAA 5H9VA 2H08A 3PSAA 3VKUA 3K0FA 5KC8A 5LJIA 4MV4A 2DFTA 3UPUA 4BFCA 1N0HA 3IRVA 1NJ8A 3AJ8A 3I2IA 2GAIA 3OKPA 3TOSA 3LBNA 1GN8A 4G5OA 3QLVA 3W7AA 4RD4A 1XP8A 1J70A 2IZ6A 2J0QA 1X77A 5DM1A 2BP7A 1JLLB 3E4CA 4DIUA 1YS2X 3U61B 3G85A 1SVIA 2AJDA 5MN6A 1MAVA 3HU5A 4KEAA 3CYFA 4P38A 5JCXA 2PSDA 1UJBA 2AOWA 3KSMA 4NFYA 4GKAA 4RX1A 1YR2A 4TVOA 3WGKA 3R74A 4RTJA 4LSWA 4KLAA 4YMTA 1MT3A 1XLTC 5EE3A 3G0HA 4ABTA 4IOLA 2ATVA 1P5ZB 2K4MA 2QRUA 2I6FA 3EQ9A 3GH3A 4P3PA 3DD1A 4ZYLA 4BY9E 5BR1A 1OH5A 5AKYA 2ASEA 3BRWA 3JWHA 4LZLA 3SY8A 1J8DA 1JIXA 1OFHA 2IXDA 2BZ0A 2SICE 1G7CA 3QXGA 1L1EA 4EGSA 3NXKA 3UOEA 2WP8J 5EIAA 3VPHA 3I42A 5DTMA 2NVUB 3IP6A 1RXSA 1PZNA 2NW6A 2FG7C 1GZ3A 3MERA 4U6NA 1B0AA 1VL0A 3ZY6A 1UJNA 4C5CA 5JY1A 2ANBA 3E9QA 2HLDD 1RHKA 2P27A 3LFTA 2NUTB 4AP5A 2BONA 4GOLD 4U7HA 1XRQA 4LFBB 1M1NB 2P9GA 4YPFA 4IH1A 1T6NA 1VIYA 2ASVA 2ZYWX 1HSZA 4LMPA 5KTKA 2AEEA 1MQ8B 4G85A 2QRHA 3GCWA 5DNVA 2NU8B 1M6WA 4M0CA 2PZLA 5T5QA 5EQFA 1UT5A 3WGHA 5ICEA 1R1DA 2FF5A 3UMCA 4FZ3A 1VBNA 1H1TA 2NQTA 1JHPA 3K0EA 1C7JA 3IMGA 3RVQA 2FWIA 2HL6A 4A6PA 1IG3A 2CD7A 1JI0A 2V3VA 3IQZA 4V0OA 1DPFA 5PGMA 5K8JB 3LO5A 4DB2A 2WMOB 3QFTA 3KLNA 5AD1A 2EFEB 5DW3A 3ZX5A 2H4XA 1B2LA 3EMVA 3DVLA 1D6SA 5JQGF 3IJEB 4R1SA 5F5XA 4E1BA 4FHFA 1T43A 2RC5A 4MPJA 2O1WA 4G26A 5I5GA 5KMGB