4UY2C

Crystal structure of the complex of the extracellular domain of human alpha9 nachr with alpha-bungarotoxin.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
molecule tags Toxin-binding protein/toxin
source organism Homo sapiens
total genus 7
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4uy2C00
1CDSA 1IDGA 1QKEA 1BXPA 3BT2U 2NBTA 1CRFA 1HC9A 1TFSA 1KBAA 1IQ9A 1LX5B 3NDSA 1JE9A 1YWHA 1I02A 2HLQA 1IKCA 1KC4A 1RL5A 1TXAA 2L03A 1F94A 2H64B 5IMYC 1QM7A 1KL8A 3VTSA 1NEAA 1CHVS 2MJ0A 1HC9B 1L4WA 5DO6A 2GOOB 2QJ9C 2H7ZB 1B41B 1LSIA 1KBTA 2MHYA 3NH7A 5IMTD 1KXIA 2X8BB 1FF4A 4AEAA 1FFJA 1CXNA 2K3GA 1HAAA 2ABXA 1CTXA 2HLRA 1NTXA 4HQPF 2MJ4A 2QJAC 1NYSA 3LAQU 3U73U 3HH7A 4BDTB 2L5SA 2I9BE 3QB4B 4RUDA 5DZ5A 1CCQA 1HOYA 2JVEA 4EY8B 1COEA 2MUOA 1CXOA 1NTNA 1REWC 3ERAA 2PJYB 1F8UB 1V6PA 4UY2C 3EVSC 4BIKB 1ES7B 1MR6A 1UG4A 1NXBA 2PJYC 4OM4A 4P7UA 4QTIU 1ABTA 1KS6A 1ONJA 2ERAA 1FASA 2CDXA 1W6BA 1IDIA 1G6MA 1NORA 1PLOA 1KU6B 6EBXA 2OFSA 1FRAA 2QJBC 2QC1A 3NEQA 1IDLA 1IK8A 2MJYA 1ZADA 1LXGA 2H62C 2MUPA 3FEVA 4DO8A 4ZQYA 3U74U 3KFDE 1CB9A 1H0JA 3PLCA 1HAJA 1FSCA 1TGXA 1VB0A 3EBXA 1ERGA 1CVOA 2CCXA 3BT1U 1LJZA 2UX2A 1TXBA 1IJCA 1CDTA 1KTZB 2H62D 2CRSA 2BTXA 2H5FA 1CREA 1FSSB 5EBXA 1DRSA 2CTXA 2H7ZA 1CODA 2LCRA 1LXHA 1KFHA 1NYUA 1QKDA 4LFTA 1M9ZA 2H8UA 3KFDI 1XT3A 4XJJA 5DU1A 1MAHF 4FAOC 1BTEA 1S4YA 2CRTA 1IDHA 2LA1A 2MFAA 2H64C 1CDRA 2JQPA 2N99A 4IYEA 1JBDA 2J8BA 1ERAA 1RGJA 2BHIA 1CDQA 4OM5A 2UWRA 2GOOC 1KBSA 4FAOE 2FD6U 1JGKA 2VLWA
chains in the Genus database with same CATH superfamily
1CDSA 1IDGA 1QKEA 1BXPA 3BT2U 2NBTA 1CRFA 1HC9A 1TFSA 1KBAA 1IQ9A 1LX5B 3NDSA 1JE9A 1YWHA 1I02A 2HLQA 1IKCA 1KC4A 1RL5A 1TXAA 2L03A 1F94A 2H64B 5IMYC 1QM7A 1KL8A 3VTSA 1NEAA 1CHVS 2MJ0A 1HC9B 1L4WA 5DO6A 2GOOB 2QJ9C 2H7ZB 1B41B 1LSIA 1KBTA 2MHYA 3NH7A 5IMTD 1KXIA 2X8BB 1FF4A 4AEAA 1FFJA 1CXNA 2K3GA 1HAAA 2ABXA 1CTXA 2HLRA 1NTXA 4HQPF 2MJ4A 2QJAC 1NYSA 3LAQU 3U73U 3HH7A 4BDTB 2L5SA 2I9BE 3QB4B 4RUDA 5DZ5A 1CCQA 1HOYA 2JVEA 4EY8B 1COEA 2MUOA 1CXOA 1NTNA 1REWC 3ERAA 2PJYB 1F8UB 1V6PA 4UY2C 3EVSC 4BIKB 1ES7B 1MR6A 1UG4A 1NXBA 2PJYC 4OM4A 4P7UA 4QTIU 1ABTA 1KS6A 1ONJA 2ERAA 1FASA 2CDXA 1W6BA 1IDIA 1G6MA 1NORA 1PLOA 1KU6B 6EBXA 2OFSA 1FRAA 2QJBC 2QC1A 3NEQA 1IDLA 1IK8A 2MJYA 1ZADA 1LXGA 2H62C 2MUPA 3FEVA 4DO8A 4ZQYA 3U74U 3KFDE 1CB9A 1H0JA 3PLCA 1HAJA 1FSCA 1TGXA 1VB0A 3EBXA 1ERGA 1CVOA 2CCXA 3BT1U 1LJZA 2UX2A 1TXBA 1IJCA 1CDTA 1KTZB 2H62D 2CRSA 2BTXA 2H5FA 1CREA 1FSSB 5EBXA 1DRSA 2CTXA 2H7ZA 1CODA 2LCRA 1LXHA 1KFHA 1NYUA 1QKDA 4LFTA 1M9ZA 2H8UA 3KFDI 1XT3A 4XJJA 5DU1A 1MAHF 4FAOC 1BTEA 1S4YA 2CRTA 1IDHA 2LA1A 2MFAA 2H64C 1CDRA 2JQPA 2N99A 4IYEA 1JBDA 2J8BA 1ERAA 4KSNA 1RGJA 2BHIA 1CDQA 4OM5A 2UWRA 2GOOC 1KBSA 4FAOE 2FD6U 1JGKA 2VLWA
chains in the Genus database with same CATH topology
1CDSA 1IDGA 1QKEA 1BXPA 3BT2U 2NBTA 1CRFA 1HC9A 1TFSA 1KBAA 1IQ9A 1LX5B 3NDSA 1JE9A 1YWHA 1I02A 2HLQA 1IKCA 1KC4A 1RL5A 1TXAA 2L03A 1F94A 2H64B 5IMYC 1QM7A 1KL8A 3VTSA 1NEAA 1CHVS 2MJ0A 1HC9B 1L4WA 5DO6A 2GOOB 2QJ9C 2H7ZB 1B41B 1LSIA 1KBTA 2MHYA 3NH7A 5IMTD 1KXIA 2X8BB 1FF4A 4AEAA 1FFJA 1CXNA 2K3GA 1HAAA 2ABXA 1CTXA 2HLRA 1NTXA 4HQPF 2MJ4A 2QJAC 1NYSA 3LAQU 3U73U 3HH7A 4BDTB 2L5SA 2I9BE 3QB4B 4RUDA 5DZ5A 1CCQA 1HOYA 2JVEA 4EY8B 1COEA 2MUOA 1CXOA 1NTNA 1REWC 3ERAA 2PJYB 1F8UB 1V6PA 4UY2C 3EVSC 4BIKB 1ES7B 1MR6A 1UG4A 1NXBA 2PJYC 4OM4A 4P7UA 4QTIU 1ABTA 1KS6A 1ONJA 2ERAA 1FASA 2CDXA 1W6BA 1IDIA 1G6MA 1NORA 1PLOA 1KU6B 6EBXA 2OFSA 1FRAA 2QJBC 2QC1A 3NEQA 1IDLA 1IK8A 2MJYA 1ZADA 1LXGA 2H62C 2MUPA 3FEVA 4DO8A 4ZQYA 3U74U 3KFDE 1CB9A 1H0JA 3PLCA 1HAJA 1FSCA 1TGXA 1VB0A 3EBXA 1ERGA 1CVOA 2CCXA 3BT1U 1LJZA 2UX2A 1TXBA 1IJCA 1CDTA 1KTZB 2H62D 2CRSA 2BTXA 2H5FA 1CREA 1FSSB 5EBXA 1DRSA 2CTXA 2H7ZA 1CODA 2LCRA 1LXHA 1KFHA 1NYUA 1QKDA 4LFTA 1M9ZA 2H8UA 3KFDI 1XT3A 4XJJA 5DU1A 1MAHF 4FAOC 1BTEA 1S4YA 2CRTA 1IDHA 2LA1A 2MFAA 2H64C 1CDRA 2JQPA 2N99A 4IYEA 1JBDA 2J8BA 1ERAA 4KSNA 1RGJA 2BHIA 1CDQA 4OM5A 2UWRA 2GOOC 1KBSA 4FAOE 2FD6U 1JGKA 2VLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDS A;  1IDG A;  1QKE A;  1BXP A;  3BT2 U;  2NBT A;  1CRF A;  1HC9 A;  1TFS A;  1KBA A;  1IQ9 A;  1LX5 B;  3NDS A;  1JE9 A;  1YWH A;  1I02 A;  2HLQ A;  1IKC A;  1KC4 A;  1RL5 A;  1TXA A;  2L03 A;  1F94 A;  2H64 B;  5IMY C;  1QM7 A;  1KL8 A;  3VTS A;  1NEA A;  1CHV S;  2MJ0 A;  1HC9 B;  1L4W A;  5DO6 A;  2GOO B;  2QJ9 C;  2H7Z B;  1B41 B;  1LSI A;  1KBT A;  2MHY A;  3NH7 A;  5IMT D;  1KXI A;  2X8B B;  1FF4 A;  4AEA A;  1FFJ A;  1CXN A;  2K3G A;  1HAA A;  2ABX A;  1CTX A;  2HLR A;  1NTX A;  4HQP F;  2MJ4 A;  2QJA C;  1NYS A;  3LAQ U;  3U73 U;  3HH7 A;  4BDT B;  2L5S A;  2I9B E;  3QB4 B;  4RUD A;  5DZ5 A;  1CCQ A;  1HOY A;  2JVE A;  4EY8 B;  1COE A;  2MUO A;  1CXO A;  1NTN A;  1REW C;  3ERA A;  2PJY B;  1F8U B;  1V6P A;  4UY2 C;  3EVS C;  4BIK B;  1ES7 B;  1MR6 A;  1UG4 A;  1NXB A;  2PJY C;  4OM4 A;  4P7U A;  4QTI U;  1ABT A;  1KS6 A;  1ONJ A;  2ERA A;  1FAS A;  2CDX A;  1W6B A;  1IDI A;  1G6M A;  1NOR A;  1PLO A;  1KU6 B;  6EBX A;  2OFS A;  1FRA A;  2QJB C;  2QC1 A;  3NEQ A;  1IDL A;  1IK8 A;  2MJY A;  1ZAD A;  1LXG A;  2H62 C;  2MUP A;  3FEV A;  4DO8 A;  4ZQY A;  3U74 U;  3KFD E;  1CB9 A;  1H0J A;  3PLC A;  1HAJ A;  1FSC A;  1TGX A;  1VB0 A;  3EBX A;  1ERG A;  1CVO A;  2CCX A;  3BT1 U;  1LJZ A;  2UX2 A;  1TXB A;  1IJC A;  1CDT A;  1KTZ B;  2H62 D;  2CRS A;  2BTX A;  2H5F A;  1CRE A;  1FSS B;  5EBX A;  1DRS A;  2CTX A;  2H7Z A;  1COD A;  2LCR A;  1LXH A;  1KFH A;  1NYU A;  1QKD A;  4LFT A;  1M9Z A;  2H8U A;  3KFD I;  1XT3 A;  4XJJ A;  5DU1 A;  1MAH F;  4FAO C;  1BTE A;  1S4Y A;  2CRT A;  1IDH A;  2LA1 A;  2MFA A;  2H64 C;  1CDR A;  2JQP A;  2N99 A;  4IYE A;  1JBD A;  2J8B A;  1ERA A;  1RGJ A;  2BHI A;  1CDQ A;  4OM5 A;  2UWR A;  2GOO C;  1KBS A;  4FAO E;  2FD6 U;  1JGK A;  2VLW A; 
#chains in the Genus database with same CATH topology
 1CDS A;  1IDG A;  1QKE A;  1BXP A;  3BT2 U;  2NBT A;  1CRF A;  1HC9 A;  1TFS A;  1KBA A;  1IQ9 A;  1LX5 B;  3NDS A;  1JE9 A;  1YWH A;  1I02 A;  2HLQ A;  1IKC A;  1KC4 A;  1RL5 A;  1TXA A;  2L03 A;  1F94 A;  2H64 B;  5IMY C;  1QM7 A;  1KL8 A;  3VTS A;  1NEA A;  1CHV S;  2MJ0 A;  1HC9 B;  1L4W A;  5DO6 A;  2GOO B;  2QJ9 C;  2H7Z B;  1B41 B;  1LSI A;  1KBT A;  2MHY A;  3NH7 A;  5IMT D;  1KXI A;  2X8B B;  1FF4 A;  4AEA A;  1FFJ A;  1CXN A;  2K3G A;  1HAA A;  2ABX A;  1CTX A;  2HLR A;  1NTX A;  4HQP F;  2MJ4 A;  2QJA C;  1NYS A;  3LAQ U;  3U73 U;  3HH7 A;  4BDT B;  2L5S A;  2I9B E;  3QB4 B;  4RUD A;  5DZ5 A;  1CCQ A;  1HOY A;  2JVE A;  4EY8 B;  1COE A;  2MUO A;  1CXO A;  1NTN A;  1REW C;  3ERA A;  2PJY B;  1F8U B;  1V6P A;  4UY2 C;  3EVS C;  4BIK B;  1ES7 B;  1MR6 A;  1UG4 A;  1NXB A;  2PJY C;  4OM4 A;  4P7U A;  4QTI U;  1ABT A;  1KS6 A;  1ONJ A;  2ERA A;  1FAS A;  2CDX A;  1W6B A;  1IDI A;  1G6M A;  1NOR A;  1PLO A;  1KU6 B;  6EBX A;  2OFS A;  1FRA A;  2QJB C;  2QC1 A;  3NEQ A;  1IDL A;  1IK8 A;  2MJY A;  1ZAD A;  1LXG A;  2H62 C;  2MUP A;  3FEV A;  4DO8 A;  4ZQY A;  3U74 U;  3KFD E;  1CB9 A;  1H0J A;  3PLC A;  1HAJ A;  1FSC A;  1TGX A;  1VB0 A;  3EBX A;  1ERG A;  1CVO A;  2CCX A;  3BT1 U;  1LJZ A;  2UX2 A;  1TXB A;  1IJC A;  1CDT A;  1KTZ B;  2H62 D;  2CRS A;  2BTX A;  2H5F A;  1CRE A;  1FSS B;  5EBX A;  1DRS A;  2CTX A;  2H7Z A;  1COD A;  2LCR A;  1LXH A;  1KFH A;  1NYU A;  1QKD A;  4LFT A;  1M9Z A;  2H8U A;  3KFD I;  1XT3 A;  4XJJ A;  5DU1 A;  1MAH F;  4FAO C;  1BTE A;  1S4Y A;  2CRT A;  1IDH A;  2LA1 A;  2MFA A;  2H64 C;  1CDR A;  2JQP A;  2N99 A;  4IYE A;  1JBD A;  2J8B A;  1ERA A;  4KSN A;  1RGJ A;  2BHI A;  1CDQ A;  4OM5 A;  2UWR A;  2GOO C;  1KBS A;  4FAO E;  2FD6 U;  1JGK A;  2VLW A; 
#chains in the Genus database with same CATH homology
 1CDS A;  1IDG A;  1QKE A;  1BXP A;  3BT2 U;  2NBT A;  1CRF A;  1HC9 A;  1TFS A;  1KBA A;  1IQ9 A;  1LX5 B;  3NDS A;  1JE9 A;  1YWH A;  1I02 A;  2HLQ A;  1IKC A;  1KC4 A;  1RL5 A;  1TXA A;  2L03 A;  1F94 A;  2H64 B;  5IMY C;  1QM7 A;  1KL8 A;  3VTS A;  1NEA A;  1CHV S;  2MJ0 A;  1HC9 B;  1L4W A;  5DO6 A;  2GOO B;  2QJ9 C;  2H7Z B;  1B41 B;  1LSI A;  1KBT A;  2MHY A;  3NH7 A;  5IMT D;  1KXI A;  2X8B B;  1FF4 A;  4AEA A;  1FFJ A;  1CXN A;  2K3G A;  1HAA A;  2ABX A;  1CTX A;  2HLR A;  1NTX A;  4HQP F;  2MJ4 A;  2QJA C;  1NYS A;  3LAQ U;  3U73 U;  3HH7 A;  4BDT B;  2L5S A;  2I9B E;  3QB4 B;  4RUD A;  5DZ5 A;  1CCQ A;  1HOY A;  2JVE A;  4EY8 B;  1COE A;  2MUO A;  1CXO A;  1NTN A;  1REW C;  3ERA A;  2PJY B;  1F8U B;  1V6P A;  4UY2 C;  3EVS C;  4BIK B;  1ES7 B;  1MR6 A;  1UG4 A;  1NXB A;  2PJY C;  4OM4 A;  4P7U A;  4QTI U;  1ABT A;  1KS6 A;  1ONJ A;  2ERA A;  1FAS A;  2CDX A;  1W6B A;  1IDI A;  1G6M A;  1NOR A;  1PLO A;  1KU6 B;  6EBX A;  2OFS A;  1FRA A;  2QJB C;  2QC1 A;  3NEQ A;  1IDL A;  1IK8 A;  2MJY A;  1ZAD A;  1LXG A;  2H62 C;  2MUP A;  3FEV A;  4DO8 A;  4ZQY A;  3U74 U;  3KFD E;  1CB9 A;  1H0J A;  3PLC A;  1HAJ A;  1FSC A;  1TGX A;  1VB0 A;  3EBX A;  1ERG A;  1CVO A;  2CCX A;  3BT1 U;  1LJZ A;  2UX2 A;  1TXB A;  1IJC A;  1CDT A;  1KTZ B;  2H62 D;  2CRS A;  2BTX A;  2H5F A;  1CRE A;  1FSS B;  5EBX A;  1DRS A;  2CTX A;  2H7Z A;  1COD A;  2LCR A;  1LXH A;  1KFH A;  1NYU A;  1QKD A;  4LFT A;  1M9Z A;  2H8U A;  3KFD I;  1XT3 A;  4XJJ A;  5DU1 A;  1MAH F;  4FAO C;  1BTE A;  1S4Y A;  2CRT A;  1IDH A;  2LA1 A;  2MFA A;  2H64 C;  1CDR A;  2JQP A;  2N99 A;  4IYE A;  1JBD A;  2J8B A;  1ERA A;  4KSN A;  1RGJ A;  2BHI A;  1CDQ A;  4OM5 A;  2UWR A;  2GOO C;  1KBS A;  4FAO E;  2FD6 U;  1JGK A;  2VLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...