4UY2C

Crystal structure of the complex of the extracellular domain of human alpha9 nachr with alpha-bungarotoxin.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin-binding protein/toxin
total genus 7
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4uy2C00
2CCXA 3EVSC 1FFJA 3NDSA 1F8UB 1KTZB 4EY8B 2MJ4A 1DRSA 1COEA 2MUPA 2CDXA 1KS6A 5DU1A 2MUOA 1CDSA 1VB0A 2PJYB 5EBXA 1NYUA 2L03A 2H64B 1S4YA 2QJBC 2GOOB 1HC9B 2H62C 2QC1A 1JBDA 4DO8A 1RL5A 1JGKA 2L5SA 2ERAA 1IJCA 1IQ9A 1NEAA 2NBTA 4P7UA 1ONJA 4QTIU 2MFAA 2H62D 2OFSA 3FEVA 1CXOA 1G6MA 1FSSB 1CCQA 1CODA 2UX2A 1YWHA 1CTXA 4HQPF 2QJAC 1CRFA 2UWRA 3HH7A 2N99A 2QJ9C 1HC9A 1ERAA 1IKCA 1XT3A 2J8BA 5DZ5A 2K3GA 2I9BE 1ABTA 1MAHF 1QKDA 1LX5B 3QB4B 4FAOC 3VTSA 1IDHA 1HAAA 1CVOA 3ERAA 1ZADA 2ABXA 2MJYA 3LAQU 4LFTA 1V6PA 4AEAA 1TFSA 1CXNA 4UY2C 1CDTA 3U73U 2FD6U 3KFDE 1CDQA 1BXPA 4XJJA 4FAOE 2MJ0A 2BHIA 1PLOA 1NXBA 1CB9A 4BDTB 1FASA 1UG4A 2JVEA 1TGXA 2LA1A 1CHVS 3EBXA 1CDRA 1FRAA 4BIKB 1KC4A 1IDIA 3NEQA 1H0JA 4OM4A 5IMYC 2BTXA 1ES7B 1NTNA 1L4WA 2PJYC 2CTXA 2H64C 2GOOC 1NTXA 1REWC 2CRSA 1QM7A 1FF4A 2H7ZB 2X8BB 5IMTD 1KBSA 1IDGA 1LSIA 1NYSA 1KBTA 1KFHA 4OM5A 4RUDA 2HLQA 1TXAA 1KBAA 6EBXA 1LXGA 1B41B 1LJZA 1ERGA 2HLRA 2MHYA 1HAJA 1MR6A 2H8UA 1RGJA 2H5FA 4IYEA 1QKEA 3KFDI 1NORA 3PLCA 3U74U 3BT1U 1FSCA 1IK8A 2LCRA 5DO6A 1IDLA 1TXBA 1F94A 2H7ZA 3BT2U 4ZQYA 2VLWA 1CREA 1KU6B 1KXIA 2CRTA 1M9ZA 1W6BA 1KL8A 1JE9A 1HOYA 1LXHA 3NH7A 1I02A 2JQPA 1BTEA
chains in the Genus database with same CATH superfamily
2CCXA 3EVSC 1FFJA 3NDSA 1F8UB 1KTZB 4EY8B 2MJ4A 1DRSA 1COEA 2MUPA 2CDXA 1KS6A 5DU1A 2MUOA 1CDSA 1VB0A 2PJYB 5EBXA 1NYUA 2L03A 2H64B 1S4YA 2QJBC 2GOOB 1HC9B 2H62C 2QC1A 1JBDA 4DO8A 1RL5A 1JGKA 2L5SA 2ERAA 1IJCA 1IQ9A 1NEAA 2NBTA 4P7UA 1ONJA 4QTIU 2MFAA 2H62D 2OFSA 3FEVA 1CXOA 1G6MA 1FSSB 1CCQA 1CODA 2UX2A 1YWHA 1CTXA 4HQPF 2QJAC 1CRFA 2UWRA 3HH7A 2N99A 2QJ9C 1HC9A 1ERAA 4KSNA 1IKCA 1XT3A 2J8BA 5DZ5A 2K3GA 2I9BE 1ABTA 1MAHF 1QKDA 1LX5B 3QB4B 4FAOC 3VTSA 1IDHA 1HAAA 1CVOA 3ERAA 1ZADA 2ABXA 2MJYA 3LAQU 4LFTA 1V6PA 4AEAA 1TFSA 1CXNA 4UY2C 1CDTA 3U73U 2FD6U 3KFDE 1CDQA 1BXPA 4XJJA 4FAOE 2MJ0A 2BHIA 1PLOA 1NXBA 1CB9A 4BDTB 1FASA 1UG4A 2JVEA 1TGXA 2LA1A 1CHVS 3EBXA 1CDRA 1FRAA 4BIKB 1KC4A 1IDIA 3NEQA 1H0JA 4OM4A 5IMYC 2BTXA 1ES7B 1NTNA 1L4WA 2PJYC 2CTXA 2H64C 2GOOC 1NTXA 1REWC 2CRSA 1QM7A 1FF4A 2H7ZB 2X8BB 5IMTD 1KBSA 1IDGA 1LSIA 1NYSA 1KBTA 1KFHA 4OM5A 4RUDA 2HLQA 1TXAA 1KBAA 6EBXA 1LXGA 1B41B 1LJZA 1ERGA 2HLRA 2MHYA 1HAJA 1MR6A 2H8UA 1RGJA 2H5FA 4IYEA 1QKEA 3KFDI 1NORA 3PLCA 3U74U 3BT1U 1FSCA 1IK8A 2LCRA 5DO6A 1IDLA 1TXBA 1F94A 2H7ZA 3BT2U 4ZQYA 2VLWA 1CREA 1KU6B 1KXIA 2CRTA 1M9ZA 1W6BA 1KL8A 1JE9A 1HOYA 1LXHA 3NH7A 1I02A 2JQPA 1BTEA
chains in the Genus database with same CATH topology
2CCXA 3EVSC 1FFJA 3NDSA 1F8UB 1KTZB 4EY8B 2MJ4A 1DRSA 1COEA 2MUPA 2CDXA 1KS6A 5DU1A 2MUOA 1CDSA 1VB0A 2PJYB 5EBXA 1NYUA 2L03A 2H64B 1S4YA 2QJBC 2GOOB 1HC9B 2H62C 2QC1A 1JBDA 4DO8A 1RL5A 1JGKA 2L5SA 2ERAA 1IJCA 1IQ9A 1NEAA 2NBTA 4P7UA 1ONJA 4QTIU 2MFAA 2H62D 2OFSA 3FEVA 1CXOA 1G6MA 1FSSB 1CCQA 1CODA 2UX2A 1YWHA 1CTXA 4HQPF 2QJAC 1CRFA 2UWRA 3HH7A 2N99A 2QJ9C 1HC9A 1ERAA 4KSNA 1IKCA 1XT3A 2J8BA 5DZ5A 2K3GA 2I9BE 1ABTA 1MAHF 1QKDA 1LX5B 3QB4B 4FAOC 3VTSA 1IDHA 1HAAA 1CVOA 3ERAA 1ZADA 2ABXA 2MJYA 3LAQU 4LFTA 1V6PA 4AEAA 1TFSA 1CXNA 4UY2C 1CDTA 3U73U 2FD6U 3KFDE 1CDQA 1BXPA 4XJJA 4FAOE 2MJ0A 2BHIA 1PLOA 1NXBA 1CB9A 4BDTB 1FASA 1UG4A 2JVEA 1TGXA 2LA1A 1CHVS 3EBXA 1CDRA 1FRAA 4BIKB 1KC4A 1IDIA 3NEQA 1H0JA 4OM4A 5IMYC 2BTXA 1ES7B 1NTNA 1L4WA 2PJYC 2CTXA 2H64C 2GOOC 1NTXA 1REWC 2CRSA 1QM7A 1FF4A 2H7ZB 2X8BB 5IMTD 1KBSA 1IDGA 1LSIA 1NYSA 1KBTA 1KFHA 4OM5A 4RUDA 2HLQA 1TXAA 1KBAA 6EBXA 1LXGA 1B41B 1LJZA 1ERGA 2HLRA 2MHYA 1HAJA 1MR6A 2H8UA 1RGJA 2H5FA 4IYEA 1QKEA 3KFDI 1NORA 3PLCA 3U74U 3BT1U 1FSCA 1IK8A 2LCRA 5DO6A 1IDLA 1TXBA 1F94A 2H7ZA 3BT2U 4ZQYA 2VLWA 1CREA 1KU6B 1KXIA 2CRTA 1M9ZA 1W6BA 1KL8A 1JE9A 1HOYA 1LXHA 3NH7A 1I02A 2JQPA 1BTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCX A;  3EVS C;  1FFJ A;  3NDS A;  1F8U B;  1KTZ B;  4EY8 B;  2MJ4 A;  1DRS A;  1COE A;  2MUP A;  2CDX A;  1KS6 A;  5DU1 A;  2MUO A;  1CDS A;  1VB0 A;  2PJY B;  5EBX A;  1NYU A;  2L03 A;  2H64 B;  1S4Y A;  2QJB C;  2GOO B;  1HC9 B;  2H62 C;  2QC1 A;  1JBD A;  4DO8 A;  1RL5 A;  1JGK A;  2L5S A;  2ERA A;  1IJC A;  1IQ9 A;  1NEA A;  2NBT A;  4P7U A;  1ONJ A;  4QTI U;  2MFA A;  2H62 D;  2OFS A;  3FEV A;  1CXO A;  1G6M A;  1FSS B;  1CCQ A;  1COD A;  2UX2 A;  1YWH A;  1CTX A;  4HQP F;  2QJA C;  1CRF A;  2UWR A;  3HH7 A;  2N99 A;  2QJ9 C;  1HC9 A;  1ERA A;  1IKC A;  1XT3 A;  2J8B A;  5DZ5 A;  2K3G A;  2I9B E;  1ABT A;  1MAH F;  1QKD A;  1LX5 B;  3QB4 B;  4FAO C;  3VTS A;  1IDH A;  1HAA A;  1CVO A;  3ERA A;  1ZAD A;  2ABX A;  2MJY A;  3LAQ U;  4LFT A;  1V6P A;  4AEA A;  1TFS A;  1CXN A;  4UY2 C;  1CDT A;  3U73 U;  2FD6 U;  3KFD E;  1CDQ A;  1BXP A;  4XJJ A;  4FAO E;  2MJ0 A;  2BHI A;  1PLO A;  1NXB A;  1CB9 A;  4BDT B;  1FAS A;  1UG4 A;  2JVE A;  1TGX A;  2LA1 A;  1CHV S;  3EBX A;  1CDR A;  1FRA A;  4BIK B;  1KC4 A;  1IDI A;  3NEQ A;  1H0J A;  4OM4 A;  5IMY C;  2BTX A;  1ES7 B;  1NTN A;  1L4W A;  2PJY C;  2CTX A;  2H64 C;  2GOO C;  1NTX A;  1REW C;  2CRS A;  1QM7 A;  1FF4 A;  2H7Z B;  2X8B B;  5IMT D;  1KBS A;  1IDG A;  1LSI A;  1NYS A;  1KBT A;  1KFH A;  4OM5 A;  4RUD A;  2HLQ A;  1TXA A;  1KBA A;  6EBX A;  1LXG A;  1B41 B;  1LJZ A;  1ERG A;  2HLR A;  2MHY A;  1HAJ A;  1MR6 A;  2H8U A;  1RGJ A;  2H5F A;  4IYE A;  1QKE A;  3KFD I;  1NOR A;  3PLC A;  3U74 U;  3BT1 U;  1FSC A;  1IK8 A;  2LCR A;  5DO6 A;  1IDL A;  1TXB A;  1F94 A;  2H7Z A;  3BT2 U;  4ZQY A;  2VLW A;  1CRE A;  1KU6 B;  1KXI A;  2CRT A;  1M9Z A;  1W6B A;  1KL8 A;  1JE9 A;  1HOY A;  1LXH A;  3NH7 A;  1I02 A;  2JQP A;  1BTE A; 
#chains in the Genus database with same CATH topology
 2CCX A;  3EVS C;  1FFJ A;  3NDS A;  1F8U B;  1KTZ B;  4EY8 B;  2MJ4 A;  1DRS A;  1COE A;  2MUP A;  2CDX A;  1KS6 A;  5DU1 A;  2MUO A;  1CDS A;  1VB0 A;  2PJY B;  5EBX A;  1NYU A;  2L03 A;  2H64 B;  1S4Y A;  2QJB C;  2GOO B;  1HC9 B;  2H62 C;  2QC1 A;  1JBD A;  4DO8 A;  1RL5 A;  1JGK A;  2L5S A;  2ERA A;  1IJC A;  1IQ9 A;  1NEA A;  2NBT A;  4P7U A;  1ONJ A;  4QTI U;  2MFA A;  2H62 D;  2OFS A;  3FEV A;  1CXO A;  1G6M A;  1FSS B;  1CCQ A;  1COD A;  2UX2 A;  1YWH A;  1CTX A;  4HQP F;  2QJA C;  1CRF A;  2UWR A;  3HH7 A;  2N99 A;  2QJ9 C;  1HC9 A;  1ERA A;  4KSN A;  1IKC A;  1XT3 A;  2J8B A;  5DZ5 A;  2K3G A;  2I9B E;  1ABT A;  1MAH F;  1QKD A;  1LX5 B;  3QB4 B;  4FAO C;  3VTS A;  1IDH A;  1HAA A;  1CVO A;  3ERA A;  1ZAD A;  2ABX A;  2MJY A;  3LAQ U;  4LFT A;  1V6P A;  4AEA A;  1TFS A;  1CXN A;  4UY2 C;  1CDT A;  3U73 U;  2FD6 U;  3KFD E;  1CDQ A;  1BXP A;  4XJJ A;  4FAO E;  2MJ0 A;  2BHI A;  1PLO A;  1NXB A;  1CB9 A;  4BDT B;  1FAS A;  1UG4 A;  2JVE A;  1TGX A;  2LA1 A;  1CHV S;  3EBX A;  1CDR A;  1FRA A;  4BIK B;  1KC4 A;  1IDI A;  3NEQ A;  1H0J A;  4OM4 A;  5IMY C;  2BTX A;  1ES7 B;  1NTN A;  1L4W A;  2PJY C;  2CTX A;  2H64 C;  2GOO C;  1NTX A;  1REW C;  2CRS A;  1QM7 A;  1FF4 A;  2H7Z B;  2X8B B;  5IMT D;  1KBS A;  1IDG A;  1LSI A;  1NYS A;  1KBT A;  1KFH A;  4OM5 A;  4RUD A;  2HLQ A;  1TXA A;  1KBA A;  6EBX A;  1LXG A;  1B41 B;  1LJZ A;  1ERG A;  2HLR A;  2MHY A;  1HAJ A;  1MR6 A;  2H8U A;  1RGJ A;  2H5F A;  4IYE A;  1QKE A;  3KFD I;  1NOR A;  3PLC A;  3U74 U;  3BT1 U;  1FSC A;  1IK8 A;  2LCR A;  5DO6 A;  1IDL A;  1TXB A;  1F94 A;  2H7Z A;  3BT2 U;  4ZQY A;  2VLW A;  1CRE A;  1KU6 B;  1KXI A;  2CRT A;  1M9Z A;  1W6B A;  1KL8 A;  1JE9 A;  1HOY A;  1LXH A;  3NH7 A;  1I02 A;  2JQP A;  1BTE A; 
#chains in the Genus database with same CATH homology
 2CCX A;  3EVS C;  1FFJ A;  3NDS A;  1F8U B;  1KTZ B;  4EY8 B;  2MJ4 A;  1DRS A;  1COE A;  2MUP A;  2CDX A;  1KS6 A;  5DU1 A;  2MUO A;  1CDS A;  1VB0 A;  2PJY B;  5EBX A;  1NYU A;  2L03 A;  2H64 B;  1S4Y A;  2QJB C;  2GOO B;  1HC9 B;  2H62 C;  2QC1 A;  1JBD A;  4DO8 A;  1RL5 A;  1JGK A;  2L5S A;  2ERA A;  1IJC A;  1IQ9 A;  1NEA A;  2NBT A;  4P7U A;  1ONJ A;  4QTI U;  2MFA A;  2H62 D;  2OFS A;  3FEV A;  1CXO A;  1G6M A;  1FSS B;  1CCQ A;  1COD A;  2UX2 A;  1YWH A;  1CTX A;  4HQP F;  2QJA C;  1CRF A;  2UWR A;  3HH7 A;  2N99 A;  2QJ9 C;  1HC9 A;  1ERA A;  4KSN A;  1IKC A;  1XT3 A;  2J8B A;  5DZ5 A;  2K3G A;  2I9B E;  1ABT A;  1MAH F;  1QKD A;  1LX5 B;  3QB4 B;  4FAO C;  3VTS A;  1IDH A;  1HAA A;  1CVO A;  3ERA A;  1ZAD A;  2ABX A;  2MJY A;  3LAQ U;  4LFT A;  1V6P A;  4AEA A;  1TFS A;  1CXN A;  4UY2 C;  1CDT A;  3U73 U;  2FD6 U;  3KFD E;  1CDQ A;  1BXP A;  4XJJ A;  4FAO E;  2MJ0 A;  2BHI A;  1PLO A;  1NXB A;  1CB9 A;  4BDT B;  1FAS A;  1UG4 A;  2JVE A;  1TGX A;  2LA1 A;  1CHV S;  3EBX A;  1CDR A;  1FRA A;  4BIK B;  1KC4 A;  1IDI A;  3NEQ A;  1H0J A;  4OM4 A;  5IMY C;  2BTX A;  1ES7 B;  1NTN A;  1L4W A;  2PJY C;  2CTX A;  2H64 C;  2GOO C;  1NTX A;  1REW C;  2CRS A;  1QM7 A;  1FF4 A;  2H7Z B;  2X8B B;  5IMT D;  1KBS A;  1IDG A;  1LSI A;  1NYS A;  1KBT A;  1KFH A;  4OM5 A;  4RUD A;  2HLQ A;  1TXA A;  1KBA A;  6EBX A;  1LXG A;  1B41 B;  1LJZ A;  1ERG A;  2HLR A;  2MHY A;  1HAJ A;  1MR6 A;  2H8U A;  1RGJ A;  2H5F A;  4IYE A;  1QKE A;  3KFD I;  1NOR A;  3PLC A;  3U74 U;  3BT1 U;  1FSC A;  1IK8 A;  2LCR A;  5DO6 A;  1IDL A;  1TXB A;  1F94 A;  2H7Z A;  3BT2 U;  4ZQY A;  2VLW A;  1CRE A;  1KU6 B;  1KXI A;  2CRT A;  1M9Z A;  1W6B A;  1KL8 A;  1JE9 A;  1HOY A;  1LXH A;  3NH7 A;  1I02 A;  2JQP A;  1BTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...