4UY9A

Structure of mlk1 kinase domain with leucine zipper 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
313
structure length
313
Chain Sequence
QLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCLQDNWKHEIQEMFDQLRAKEKELRTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
publication title Recurrent Mlk4 Loss-of-Function Mutations Suppress Jnk Signaling to Promote Colon Tumorigenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4uy9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4uy9A01
4XLIA 5DEWA 3HA6A 5GHVA 4O21A 4F1MA 4KBAA 3T9IA 4RZWA 3UMXA 3LAUA 1LUFA 3C5IA 3BYVA 4A9SA 5E8UA 2W1GA 4NIFA 5CENA 2J50A 1OL2A 3PZEA 4ANOA 3F5GA 4JG8A 3F3TA 3H9OA 4RBLA 2H8HA 5HKMA 4RC4A 3QQKA 3ATTA 3EYHA 5KCVA 4YC3A 3KA0A 4IDTA 2W1DA 2B1PA 2HCKA 3TN8A 2W1HA 4LL5A 3V5LA 3R1QA 4DTKA 3JVRA 4HVHA 1W82A 3LHJA 3FE3A 3VJNA 4M8TA 1J91A 3FL4A 4QQTA 1BMKA 4MXZA 5B2KA 3P78A 4O86A 4QYYA 1PMEA 2IVVA 2PVNA 4FL1A 4XHKB 5J79A 5KNJA 4LM5A 5DI1A 3HMPA 1T46A 2WIPA 1ZOGA 2OJGA 4EC8A 4ZXTA 1UKIA 2YM5A 4KIQA 4D9TA 1WVYA 4FV1A 4HCVA 5IISA 2JAVA 5K4JA 4KIKA 1WVWA 4DA5A 1K3AA 5ETCA 3ZFMA 5J1WA 4EOOA 2X2LA 4AUAA 5HU9A 4TL0A 4E4LA 3PIXA 4O84A 3QTXA 3THBA 3GC7A 2PUNA 1TQMA 2B9HA 2RIOA 4RT7A 2I1MA 4ASZA 4RWJA 4E93A 3FZOA 1T45A 1HOWA 4L46A 4DFUA 4IM2A 3R02A 4F6WA 1DI8A 2VWZA 1P5EA 2BPMA 4IJ9A 3UG2A 4EEVA 3LMIA 4O7NA 4MCVA 4JVGA 4I0SA 5EYCA 4FA2A 2IWIA 1CKIA 5BVNA 2ZDTA 3PPJA 5EG3A 5IUIA 4BDGA 4CVAA 2X7OA 4O7VA 3V51A 4E3CA 2UW5A 3FV8A 4FIIA 5E90A 4ERKA 4FKJA 3ANRA 5T68A 3F2RA 4ZTNA 4EZ5A 5DMZA 4PPAA 4HGSA 4OUCA 2WQBA 1Z9XA 4PDPA 4PL5A 4R7HA 5AV3A 5HBEA 3PXFA 3QD0A 5HCXA 3ATSA 4PTEA 4I4FA 4GSBA 4IX5A 1WAKA 4UMQA 4Z7GA 3NPCA 2WMUA 1B39A 3E8EA 3WF9A 2ZMDA 3U54A 1KUTA 4FEUA 2XKEA 4GT5A 4GL9A 3ID6C 2J7TA 4A9RA 5H3QA 5J7BA 3F82A 3GB2A 5H9BA 3WOWA 3OCGA 3VBXA 2Y7JA 5BX0A 2R0IA 2C3JA 2ZM1A 1U5QA 3W33A 2V55A 3BCEA 4RC3A 3CY2A 4UN0C 3E64A 4FEXA 2W9ZB 4C3RA 5CALA 3SDJA 4ID7A 4YTIA 3KULB 3VUDA 4BGGA 4YJNA 2A2AA 4RQKA 3FMNA 1OGUA 3NSZA 5IQDA 2I0YA 4OBOA 5AIKA 2QU5A 3A62A 5FBOA 3R63A 4M84A 3UQGA 3OROA 3KXNA 2YIWA 4L8MA 3ZFYA 2WU6A 3L9MA 4D4RA 4E26A 2GQSA 4FTQA 1FVRA 3L8XA 4WSYA 4AGCA 4FOCA 4I6HA 4JQEA 2IW9A 4FT0A 2YM6A 4GVAA 3F5UA 4BI1A 3NW7A 3NEWA 1E1VA 1KE7A 2ZAZA 2R3LA 5DWRA 4MYGA 1H1SA 5AUZA 4KWPA 4JNWA 2VU3A 2YCSA 4FG8A 4WD5A 4ENYA 1IRKA 2IVSA 4HGLA 4P5ZA 4BWPA 2IPXA 4KAOA 2FVDA 3KK9A 4A7CA 3PA3A 1OIUA 4EH7A 5AFVA 3A7HA 2E9VA 3TZMA 5CF4A 4XX9A 5E8SA 1ZY4A 3W2QA 3C51A 3MY5A 4USFA 2NNWB 4TYJA 5A4TA 4C62A 5JH6A 3VBTA 1SVGA 2ZM3A 4FX3A 4M0ZA 1FPUA 4L7FA 3IOKA 2RFDA 2OXDA 4DFXE 3V5WA 4WO5A 3B8QA 3ROCA 3H0YA 4V05A 1ZY5A 2XJ1A 5CVGA 4OR5A 3PA4A 4I5HA 1IA8A 3MSSA 4X2KA 5EYKA 1YHWA 2IJMA 4IZAA 1NT2A 5M4IA 3KXGA 5KUPA 3R7IA 1ZAOA 5FP5A 5EQYA 5K3YA 3GU5A 4EHZA 5EQPA 2VO7A 4TYHA 3ZHPC 3F66A 1Q3DA 5DHJA 4L52A 2IZUA 2QOIA 3O8PA 4QD6A 3HV6A 4IVDA 4LL0A 5M53A 3GU6A 4KKGA 4YJRA 3DB6A 4FTTA 4OBPA 3EKKA 4CV8A 3R7YA 3RCDA 4DTBA 3H9FA 4JQ7A 3NNXA 4N6ZA 1A9UA 2CLQA 3ZO3A 2PVMA 2J5EA 4G5JA 2G2FA 4EJ7A 3EL7A 4FT7A 4CKJA 3VQUA 4FKSA 1REKA 3BU6A 2YZLA 3R2BA 2JKMA 3F3UA 5FBNC 5HCYA 3BGZA 5CI6A 1APME 2JBPA 3JPVA 2B0QA 2Q0BA 4F99A 3IGOA 2HY0A 1PXLA 5EYMA 5L4QA 4JI9A 4F0FA 2XKDA 1ZARA 5EM5A 1PXOA 3EN4A 3UO4A 3FLNC 3EYGA 4CMOA 2OJJA 2QVSE 3G6HA 4K8AA 2J0KA 4XG4A 5AUYA 3VS6A 4EOSA 5LCJA 3FC2A 3SV0A 4QNYA 3QHWA 4N6YA 4XBUA 4BCGA 5H8GA 3DCVA 3HKOA 3DKGA 4PPBA 4BKJA 4FV8A 4IM3A 1PMUA 2VTAA 4PRJA 2GDOA 1UNLA 2ONLC 3D94A 3KF7A 5CS6A 5BVKA 1MRVA 3R8MA 3W10A 5D9HA 3S4QA 3OUKA 4EBVA 3HAMA 4XV1A 5GIOE 4JBVA 3BYUA 4UEUA 4EH6A 4ZP5A 3KB7A 3SG9A 2BHHA 5I9WA 5DT4A 5I3OA 2YM8A 2CCIA 3AD4A 5JSMA 1XHAA 3KRWA 2O3PA 2ZJWA 3PIYA 3C4WA 3UNZA 4JAIA 4PNIA 2QNJA 3DBCA 1G5SA 2CNVA 3FYJX 3Q6UA 5L8LA 3MTFA 4JT3A 4ACCA 1H01A 4I6QA 3JY0A 4R78A 4EK4A 1XH4A 2YDJA 4L3PA 4D58A 4YZNA 4WUAA 3ZH8A 4DGNA 3ZZWA 3SA0A 1JWHA 4ZJVA 3RI1A 2VNWA 2VV9A 3UBDA 2BIYA 4MWHA 5LVMA 4G3DA 3K5UA 4ALUA 4XV3A 4YURA 3S1HA 2OJ9A 4NTSA 2JEDA 2ZV9A 5CF5A 1PKGA 3D15A 3LFQA 4FG9A 4PPCA 1I09A 4FOBA 3BHYA 2GSFA 4HZRA 1MQ4A 2XS0A 4Q5HA 3FMHA 3CQWA 3LMHA 2QOQA 3HAVA 5HLNA 4IAFA 5HX8A 3Q60A 4O38A 3FBVA 3K3IA 3R2YA 3CTJA 5ETAA 2UW4A 2Q0NA 3OWJA 4NCTC 3LJ0A 4YJUA 2YIQA 3UPZA 1L3RE 3ZDUA 4O0XA 4YZ9A 3KFAA 3LCKA 4ACDA 3U6HA 3LOKA 4DTAA 5D11A 2OKRA 3CY3A 3DK6A 5GJGA 4ONAA 2P0CA 3QZGA 2GS7A 4MBJA 2YITA 3RWPA 5IDPA 2X4FA 5FEDA 4AW2A 4FV4A 3HRFA 4MXAA 2QHNA 3BLHA 5A4CA 2XIZA 4FNXA 4HZSA 1SVEA 4FTLA 3KU2A 2BTRA 3NCZA 1A06A 3PJ1A 3R6XA 1MUOA 2BRHA 4PL3A 5L6PA 5A54A 2XUUA 1Q24A 4LOPA 4FSNA 2FYSA 1ZMWA 3IDPA 5CAVA 2Y6OA 4GUBA 2Z8CA 2Y9QA 5HLWA 1BL6A 2C0OA 2Y4IC 4CG9A 3TNWA 3DXPA 3IKAA 1OECA 5JGDA 3NIZA 4X2NA 4IB3A 3W2RA 1YOJA 4AZWA 5BMSA 2VO3A 1YDRE 3PWDA 2Z7QA 2OO8X 4OBQA 4O0UA 4DFNA 2OICA 4A4XA 3FZPA 2Z7RA 1WBVA 1GZ8A 3H4JA 3LVPA 4G17A 4JQ8A 2O8YA 1Y8GA 4OTRA 4Z9LA 1XBAA 1FGKA 4C61A 5FEEA 2WAJA 3IG7A 4CV9A 2X9EA 4B0GA 4D1SA 5IZFA 3QZIA 5CAOA 3FHIA 4YC8A 2OW3A 3P1AA 4F7LA 5BNJA 5L3AA 4FT9A 4HW7A 3CSVA 4TWCA 2R3GA 5DOSA 3UOHA 5AUUA 4U7ZA 4EK6A 4G9CA 2Y8OA 4S2ZA 4WKQA 3QFVA 4YHJA 4JG7A 2YHVA 2PE1A 4E6DA 3FEGA 2PWLA 3II5A 4WA9A 3VUIA 2W4JA 5HORA 5E92A 5D1JA 3Q53A 4W8EA 4JBOA 4RFYA 3FAAA 4TT7A 4FZ7A 3L8PA 4XG7A 2XJ0A 2W05A 5KHWA 5KMLA 1PY5A 3A7GA 2HXLA 1IASA 2B53A 2UW7A 5FQDC 2VTJA 3LXLA 4DC2A 3OOMA 3DQWA 2RF9A 2VO6A 5J9ZA 4USEA 2B54A 4F1TA 2ITXA 4FL3A 5FXRA 1ZMVA 3HP5A 3WBLA 2CGUA 5D41A 3RM7A 4EOLA 1JQHA 4DH3A 3MYGA 4GK2A 4PDYA 2ITNA 4X6RA 3DXNA 3LLAA 3LFSA 4D1XA 5E4HA 1ZZ2A 3D14A 1OL7A 4KKHA 4U5JA 2R3NA 2WTWA 4QTAA 4FTUA 4PWNA 2PHKA 4PMTA 5M56A 2WELA 3BBTB 2RSVA 1PKDA 3PVBA 1UU9A 1A48A 1Q8UA 3K54A 3Q4ZA 4HNFA 1ZRZA 1TQPA 3DDPA 2P2IA 2VRXA 3WZUA 4DGMA 1VYZA 5HO8A 3FSKA 3Q9ZA 2PYWA 2VWIA 2WQMA 3OCSA 3OTUA 4QTBA 1Y57A 4AZEA 3DFCB 5AIRA 2XCHA 3PE2A 5HU3A 2C6DA 2J6MA 5DVRA 4WG4A 4RA5A 5LMBA 1SVHA 3FXXA 5HE3A 4NK9A 3UE4A 3FLYA 3V8SA 4H3QA 2R3HA 1OVEA 4LV8A 4W9WA 3EQHA 4YP8A 3SG8A 4TWPA 4QP3A 1JSUA 3MESA 2C1AA 3C1XA 4F08A 3C4XA 4FSQA 4G3CA 4CTCA 3U6JA 2W1FA 2VWWA 4I5PA 3C0IA 3RHXA 3MBLA 4M69A 4BDFA 4XG2A 2WQEA 1YWVA 4UYNA 3RAWA 3WE8A 4X21A 2BALA 2XM9A 4XMOA 4B7TA 3MJ2A 4U97A 5CEIA 2WMBA 3GP0A 4WBOA 3IECA 4GRBA 3LFBA 4F63A 2GQRA 3QRJA 5TE0A 3PY3A 2I0EA 5KE0A 4BTMA 5IDNA 4K0YA 1CM8A 4MAOA 4RIOA 3NCGA 5AM6A 4XP0A 4EOMA 4RVLA 4WG5A 4EC9A 2BDJA 5L8JA 5M55A 1TVOA 4I6BA 4F9YA 4FZAB 3UQFA 3KCKA 2XF0A 4Y5HA 5AM7A 3V6RA 2P4IA 3VRYA 3BRBA 3PXQA 3N9XA 4D2VA 3FMKA 5IU2A 3O8UA 1YWNA 4G31A 3RBWA 2YCFA 3IW6A 4Z16A 5JFVA 4DEBA 3FY2A 3OBJA 4D2PA 3TTIA 2BFXA 4NFMA 3DBFA 4MEDA 2PVHA 3Q5ZA 3MFUA 4OTWA 2F49A 1JVPP 3QD2B 4QQJA 3MA6A 1HCLA 3OTVA 3UNJA 4EWHA 2W4KA 1PYXA 5JGAA 2Z02A 3RK7A 4JJRA 3DAEA 4NM3A 4EOPA 4H05A 4GFOA 5CAQA 1VJYA 4ZTHA 2JKOA 3QRKA 5JRQA 5C01A 5A6NA 3GCVA 3EQCA 1XBBA 4QMXA 3HDNA 3SXSA 4CFFA 3EN6A 4BBEA 5CTPA 3OY1A 3VW6A 1WBOA 2VTNA 4O0TA 4J71A 2XBJA 2ITZA 3DNDA 4FZFB 2PTKA 2YM3A 4BICA 2OF4A 4TZRA 4UZHA 4D5KA 3KXXA 4M14A 3SRVA 2ITYA 4P90A 3A4PA 4Y72A 2YABA 5JFSA 4BIEA 4HPTE 3BPRA 4OAVB 2I7QA 2W99B 3WZDA 5I5ZA 4LGDA 5GZ9A 2JFLA 5JT2A 4FNWA 5H8BA 3ORXA 3KN5A 2PPQA 3MVHA 2XK4A 3HYHA 3IPHA 4IAKA 4MVFA 3MTLA 4RVTA 3DDQA 3QUEA 3ET7A 4NZWB 3BBWA 3EFWA 4YJVA 5L2QA 4DGGA 5BVFA 1OKVA 1YVJA 4L3JA 2B4SB 4IAIA 3RVGA 4BGHA 3FI4A 3SGCA 4J8NA 2QG7A 4L9IA 4UALA 4HPUE 2W1IA 3B8RA 2WFYA 4N57A 1Q61A 4BCHA 5HVKA 3D7ZA 3NYOA 4PMPA 1SZMA 2ERZE 2A4LA 3ANQA 3PDTA 5KO1A 2AC5A 4GK4A 3NUUA 2A27A 2A0CX 2JBOA 3RAIA 4C3PA 4OLIA 3C0GA 3QTSA 3RPOA 2WQOA 4I3ZA 2JDTA 5DN3A 4DGOA 3HMIA 4JXFA 4O27B 3EWHA 5CNOA 3KF4A 2XIXA 4M97A 3PFQA 4PMSA 5AP7A 4FK3A 4U3ZA 3S95A 4K1BA 4AW5A 2V5QA 1YOLA 1Q8WA 3A99A 4YJTA 4R6VA 5HTIA 4U40A 1LR4A 1YKRA 4HJOA 3WIKA 3UO6A 3EFJA 3EFLA 4J1RA 1FOTA 5HE1A 3ZC6A 1XKKA 3OOGA 4CLIA 4DF3A 1QMZA 3QXOA 2UZBA 4ZJJA 5GNKA 3Q2MA 4RA4A 1KWPA 3O0GA 3GEQA 4I5MA 3MJ1A 5EM6A 3I0QA 1B6CB 3TACA 3GENA 5HTCA 2YWPA 3OS3A 5AP4A 2VWVA 5I4NA 2AUHA 1OKYA 3VIDA 3V3VA 3VO3A 3ZC5A 3U55A 3CQEA 4RZVA 1QL6A 4ITJA 4BDIA 3QZFA 4J7BA 3IONA 4ITIA 3KGAA 4Y73A 4B6LA 1WZYA 4GKIA 4A07A 3C7QA 3PJ3A 4X6QC 1Q99A 5AAGA 3WF6A 5IEYA 4AT5A 4ZZMA 3EJ1A 4C0TA 5E8YA 1Q62A 3D2KA 4JIKA 3UDBA 2X8IA 2IZTA 3CD8A 1H00A 1RQQA 3HEGA 4FT3A 3V5TA 3ERKA 4P2KA 3H10A 3IOPA 2W96B 4CFXA 1R1WA 1H1WA 4XRJA 5CVHA 2R3KA 3CCNA 3RHKA 2GHGA 2REIA 4FSUA 5BQ0A 3WYXA 2R4BA 2BKKA 4DITA 3EQRA 4QMWA 2BCJA 2ZV8A 3ODYX 2UZLA 4Q9SA 4YTHA 3IDCA 1H24A 3Q9YA 4N0SA 5AUVA 5JQ5A 3SLSA 5AUXA 2G15A 1CKJA 2ESMA 5F4NA 4KS7A 4RIYB 2X81A 5KMNA 1NVSA 3VHKA 5CWZA 3KRXA 2BRGA 3TIZA 2C5VA 2OBJA 1BX6A 2QURA 1W0XC 4I5CA 5IA4A 2PMNX 5BUJA 4JDIA 5F1ZA 3ELJA 3CC6A 2A1AB 2J9MA 3BGPA 2QLQA 4YO6A 1M2QA 1PMVA 3MDYA 1ZYDA 4OT5A 3MH3A 4KA3A 1SMHA 2VGOA 3NX8A 4DAWA 2HIWA 3L1SA 4IM0A 4LOQA 4Y85A 1OIRA 3ZMMA 2OSCA 3KXMA 4JRVA 3ZTXA 2C3KA 5LMKA 5FDXA 4PNKA 4F09A 3GOKA 4YPDA 4O1PA 2WMRA 5HNIX 5M08A 4IZ5A 4FGRA 1QPCA 2IZSA 4BBFA 4U80A 4KNBA 4C4GA 2OLCA 3NYNA 2YISA 2IO6A 3AC3A 3PSDA 4RJ6A 4C33A 2F4JA 1JSTA 1JKKA 3NGAA 4KS8A 3F5XA 4YO4A 2C6LA 3NLBA 4NWMA 3O7LB 3ORLA 3F61A 3UP7A 4G6OA 4YSMA 4CNHA 2FGIA 3RNYA 3C4FA 5E7RA 4QP6A 5GZ8A 2PVJA 4ASXA 4KIPA 3POOA 4DLIA 4QTCA 5I9ZA 2R7BA 2XIRA 4GS6A 4GT3A 2O64A 1BYGA 5KMOA 4FUYA 2OH4A 3QWJA 4LV5A 3UOLA 3N4UA 4TYEA 3BEGA 4ZIMA 2SRCA 3NS9A 3UJGA 4IFGA 3FMMA 4ZSEA 2W7XA 4FBXA 1H1PA 4CFNA 3A61A 3GNIB 4DCEA 2JGZA 3L9NA 2QOOA 3MI9A 4TYGA 4E1ZA 2JD5A 4C59A 2GS6A 4OTFA 5HESA 2ZMCA 4CSVA 2DS1A 2XZSA 4C4EA 5LVNA 5CEMA 2GTNA 1I44A 2JC6A 1GJOA 4QPMA 5BUEA 3HA8A 1U46A 1UNHA 4YNOA 5DBXA 2X2MA 3ZXTA 3R9RA 3HP2A 4AOTA 4IWQA 1WVXA 4ZMEA 2ZOQA 4IADA 2ZM4A 4EZ3A 5J8IA 2QHMA 3F7WA 4BWKA 1UU3A 2YLFA 4EYJA 3BGQA 2Z60A 3F88A 4QP4A 2J90A 3QF9A 3HVCA 3QCYA 2XNNA 2C5XA 1F5QA 3ZFXA 2X6DA 4BIDA 3GQIA 4NL0A 4GUEA 2OZOA 1W98A 3FJQE 4IW0A 5HVJA 4DN5A 3POZA 4JR7A 2UZTA 3R30A 5TT7A 4QMZA 4AT3A 3DPKA 4IZYA 5IA2A 4ACHA 4ZTQA 2OZAB 4WRGA 1MQBA 2HZ0A 1VR2A 1AGWA 1YXVA 4FSYA 4IFCA 5C9CA 3T3VA 4KBKA 3FQEA 3UVRA 2GCDA 1P14A 4DFBA 4FF8A 3MFTA 3CR0A 1EH4A 3VUGA 2YDIA 1Y91A 1JNKA 3D5WA 3ZU7A 4AGUA 2X9FA 4A06A 4R3RA 4M7IA 3TZ7A 5LXMA 2RG5A 4MBLA 3QX4A 2BRMA 1S9JA 2XA4A 4C02A 5E8TA 4FV3A 2W4OA 4FTKA 4MXOA 4CYJA 3CP9A 4AAAA 4ACGA 3CTQA 4BHNA 2GPHA 3ZLWA 3LFEA 5EHYA 4NIFB 5HIDA 5IH6A 3ODZX 1VZOA 2XEYA 4O83A 3SC1A 1XBCA 2YJRA 3A8WA 3G51A 3DBEA 2GFSA 4WOVA 4YZCA 4RG0A 5HG7A 3WF8A 4C57A 5J9LA 3U4WA 4OTDA 4C2WA 2CHLA 4MNEA 3BE9A 5CZHA 3LZBA 3GQLA 1WCCA 2PZYA 1ZMUA 3DKOA 3UIMA 1O6KA 3BQRA 3FY0A 3PLSA 4RLLA 3W8LA 4AGDA 1QPJA 4NM5A 3LMGA 2R64A 3SAYA 4LUEA 4M68A 4NJ3A 4YJSA 2UVXA 1YDTE 5ANEA 3G0FA 1OL1A 3KVXA 4L42A 4CFUA 2QODA 3EFKA 3LQ3A 3OCTA 3QTQA 4R3CA 5TR6A 3BELA 3EQGA 3D5UA 4IB5A 3LLTA 3ZRMA 3UQCA 4G3GA 4R7BA 2R3PA 2UW9A 2ERKA 4LGHA 3FZSA 3P08A 2ITOA 3TUBA 2B9IA 5EHLA 5IQHA 1YHSA 4QTDA 3MS9A 2QOBA 3W16A 4KIKB 2Y4IB 1YXXA 4FV7A 4IX3A 2GHMA 3UIBA 1SYKA 4L68A 3DS6A 4KKEA 5C03A 5J5SA 5C26A 3ZONA 2F9GA 4AN9A 3FZ1A 4DYMA 2R3FA 4QP2A 3LQ8A 5JKGA 3D7TA 3OC1A 3LJ1A 4YHTA 4GMYA 4TW9A 5AUTA 3VQHA 4I0RA 4JRNA 3BV2A 2WOTA 3E7OA 4L44A 3SD0A 3BU5A 4HYIA 4I23A 3NUYA 1XQZA 4IAZA 4YJOA 4A9TA 3GC0A 4AZFA 3VBWA 5AMNA 3TV4A 2XK6A 5A46A 4FVQA 1R3CA 3OXTA 2QOFA 2XBAA 2QD9A 3QKMA 4GG5A 4L53A 4PMMA 2ITQA 5BUIA 5AP2A 3G0EA 2C30A 1PYEA 1YXSA 5AEPA 3LXNA 3O7LD 1FGIA 3PRFA 2AYPA 4J98A 1J7UA 5BYLA 2BZJA 2OI4X 1Q5KA 4FYOA 3KXZA 5CU3A 4ZOGA 3CGFA 4ANNA 2JDOA 2IVUA 5CSVA 5J87A 1YHVA 4ITHA 4E6CA 1BUHA 4D55A 4FTCA 1H1QA 5T6KA 3TXOA 3QYWA 5AADA 3N4VA 3PYYA 3QQJA 2QOLA 4YBJA 4HVDA 2PMLX 2FSMX 4XLVA 4TXCA 2JFMA 4XUFA 3IO7A 3PP1A 5EDPA 1OB3A 1WBTA 4J53A 1ZWSA 4O91A 3UVQA 5K5NA 3RM6A 3OVVA 3T9TA 1UWJA 2OIDA 5HG9A 4R5YA 4EKKA 4AW0A 3BYSA 3I7BA 5I0BA 1OIQA 3AC8A 3NVKI 2CGXA 2W06A 3IS5A 4UMPA 4S33A 2CLXA 3U87A 2WMVA 2VTTA 4XYFA 2GQGA 3RZBA 5CAUA 2QG5A 3W18A 3E93A 3R04A 4CCUA 1YXTA 3O17A 2WTJA 4F9WA 3SKCA 5IA1A 5E91A 4WNPA 2ETMA 5EQEA 3PJ2A 3HV5A 4CEGA 4F7JA 5FXSA 4BZNA 1OBDA 3PSBA 4WBBB 1LEWA 2BUJA 2PVFA 3PJ8A 4AT4A 2JDSA 3FLWA 5A4EA 3NIEA 2BZHB 4CCBA 2NP8A 4Q5EA 4FKLA 4C34A 4ZSGA 3UODA 5EOLA 5HIEA 2BROA 4D1ZA 2KTYA 4P7EA 3HRBA 4YZBA 3U51A 4UX9A 1NA7A 4GYGA 3LPBA 4XV2A 2WTIA 4TTHB 3C50A 4DEAA 4PP9A 5L6OA 2XK9A 4QP8A 4FT5A 5TKDA 2IW6A 3ZRLA 3TWJA 4AG8A 3RAHA 4RQVA 1OUYA 2VO0A 4IH8A 1LEZA 3JXWA 4FV6A 2VWUA 4L43A 3TTJA 4TYHB 2I0HA 2OJFE 2QKWB 4L67A 3RGFA 3VF8A 3ORNA 3WZKA 3CTHA 4BCJA 3DZOA 3LQ5A 3D2IA 1YRPA 3UVPA 3E3PA 1M14A 4APPA 3LCDA 2J2IB 4O6EA 1J1CA 3ENMA 4BGQA 2XNOA 3QTZA 3WI6A 1GAGA 3QD3A 3AD6A 3KMUA 4C3FA 1M2RA 1JOWB 4AXAA 2Y0AA 3HRCA 2XNGA 5E8WA 3NNVA 2VWXA 5DLSA 1OPKA 3VS0A 4BF2A 4U45A 4C4IA 3EH9A 2WNTA 5ANDA 3EIDA 1VYWA 3BKBA 4XRLA 5FWKK 4DT8A 3AG9A 3TKIA 1FVVA 2UZOA 3AGLA 3K3JA 4IWOA 3UG1A 2ZDUA 4YMJA 4JR3A 4YTCA 3IGGA 3P9JA 4DHFA 4Y46A 5LVPA 4BCNA 4RJ5A 3OEZA 4O7ZA 4WNMA 3GC8A 1FMKA 4Q2AA 3FXZA 3GT8A 4QMNA 5F9EA 2C0TA 4FE2A 1MP8A 2R3QA 2XYUA 5GIPE 4HGTA 1U54A 2BFYA 4S32A 4ALVA 3F5PA 4MD7E 2PE0A 2UW3A 3FI2A 2R9SA 3FI8A 4U0IA 5E8XA 4BDBA 4MXCA 4G3FA 2PMIA 2PU8A 3HNGA 3QKKA 2UW6A 4EHGA 2WQNA 3ZM9A 3RK9A 3WILA 1YWRA 2UZVA 2VTRA 4O6LA 3TJCA 4AQCA 4UMUA 3GFEA 4RFZA 4WNOA 5KMJA 2OG8A 3GCPA 1E9HA 4BBMA 2E9UA 4E6AA 3OHTA 3HUBA 3E87A 4XJ0A 2V7AA 3UOJA 5LQFA 2ZVAA 5DEYA 4MXXA 2ITTA 2C6IA 5G6VA 1IA9A 4LQMA 5CU6A 4I22A 2BTSA 5L2WA 5LCKA 5IH5A 4MWIA 1GZKA 1SNXA 4QYFA 3Q4TA 1FBNA 5EM8A 2J4ZA 3PIZA 4F6SA 3G9NA 3LJ2A 3P5KA 3PG1A 5DIAA 5HZNA 1G8AA 2IVTA 2VAGA 3ACJA 5B0XA 5I9UA 2VTIA 3DK7A 3QC4A 4G6NA 4AP7A 3LE6A 5DT3A 5K0KA 2PK9A 2W1ZA 5ACBC 4W4WA 3VW8A 1PXMA 3WF5A 4ZZOA 1YI6A 1GIHA 4U43A 4I93A 4UZDA 2W5AA 5CZIA 2C5YA 3MVMA 4IVCA 3UIUA 3R7VA 2O0UA 4O0RA 1O6YA 2YAAA 4KIOA 4FUXA 4O1OA 4KSPA 3COHA 4PX6A 5IKWA 4UWBA 4BZOA 4EH4A 3JS2A 4J8MA 4BCQA 4EK8A 2OJIA 3DY7A 3ZSIA 1SNUA 2LGCA 4IIRA 4ZLOA 2CKQA 2PULA 4ZTRA 2YA9A 3U8WA 4CT2A 5A4QA 2VWBA 2WTKC 3I0OA 5HEZA 2CGWA 2EU9A 4EUTA 3QXPA 3EN5A 3AC2A 4IXPA 3QHRA 5BVWA 1OM1A 3R28A 1ZZLA 3N51A 4I21A 4JOAA 4K6ZA 4NKAA 1H4LA 2HZIA 3FPMA 2VWYA 3PXYA 4BCIA 1AQ1A 2GNLA 3VBYA 4C4FA 4ZS4A 2OWBA 4BC6A 3MVJA 3FPQA 1IAJA 2O65A 3M11A 1KV2A 3VRZA 2Z2WA 1PJKA 3FUPA 4WRSA 3BWFA 2VTOA 3BIZA 4LYNA 2UZUE 5HGIA 3MWUA 3DLSA 3QWKA 4Y95A 5CEQA 5ETFA 4V0GA 5E1EA 3QRIA 1V0PA 4O96A 4E5WA 4O82A 3NRMA 2YACA 4UXLA 3PVWA 3RNIA 3R7EA 4OT6A 1P4FA 3W2SA 5HX6A 3ZO2A 3CEKA 4ANLA 2CKOA 5AV4A 2WTVA 4EONA 5E1SA 5HOAA 3PA5A 3SHEA 1PMNA 2J0JA 2WMSA 3F9NA 3AMAA 3MB7A 3P86A 3PVUA 2G2IA 3AC1A 4Z55A 4NW5A 4O7WA 4S34A 5DE2A 5FTGA 3I1AA 1H27A 2JDRA 5AA9A 2VN9A 4EOKA 4E5BA 1S9IA 2Q83A 4RIWA 5IQEA 2OH0E 3AMBA 5IG1A 3AQVA 5JEBA 4R1YA 4LG4A 3NW6A 4IANA 1H26A 3GGFA 5CSPA 2J0LA 4JX7A 2Y6MA 4LUDA 5EKNA 5JK3A 4HOKA 3NMUF 2QI8A 4G9RA 4GFGA 4ANQA 5CF6A 1GIIA 4GFMA 5HI2A 3N4TA 3A7IA 4O2ZA 4R77A 4DEHA 1OKZA 2XKCA 4DFZE 5IMXA 3LCTA 4D2WA 3QQUA 5HBHA 1H0VA 4U6RA 3JY9A 3OFMA 3VAPA 3KCFA 3LIJA 2GMXA 3R1SA 4FKOA 1WBPA 4ZZNA 4EUUA 3CS9A 4F4PA 3LFFA 5AR2A 3ORMA 3CPCA 3QQLA 4V01A 4AE9A 4BZDA 4CKRA 3E8DA 3FSFA 2JAMA 3GCQA 3R9HA 3CLYA 5G1XA 4G2FA 4KD1A 2PSQA 2PY3A 3RK5A 2UZWE 1W7HA 2YN8A 4X3FA 5CVFA 3CE3A 3QX2A 4OTPA 2YM4A 3LCOA 4X3JA 2HAKA 4ANMA 5I9YA 4IWDA 4K9YA 3VUKA 5JMSA 4X0MA 4CMTA 4B8MA 2DUVA 2FH9A 3TIYA 4MTAA 4FIGA 1R39A 1YW2A 2GNIA 2ZYBA 3EKNA 3ZCLA 4GJ3A 4B4LA 3NUPA 3EMGA 3HZTA 1R0PA 4ZY5A 4MK0A 4DEDA 1QPEA 2PUUA 2WMWA 5KMIA 4L6QA 4M3QA 1YI4A 4FEWA 4YZMA 2BZKB 3TUDA 4M69B 2VTPA 2V7OA 3MW1A 4JG6A 3FWQA 5ANIA 5IUGA 5H2UA 1CDKA 5JN2A 5M4FA 3MVLA 1RW8A 2X8DA 3GU8A 4D2SA 1IG1A 2CJMA 3I81A 4FR4A 3WIGA 3PLAE 3CXWA 4XG8A 5HO6A 1GZNA 2XM8A 3DTCA 2WPAA 3VC4A 2X0GA 3Q9WA 4QP9A 5FTQA 2R3OA 3FLZA 4QPSA 2C5NA 1Q8TA 3PPZA 4QO9A 1O9UA 5AR5A 4MD8E 2QU6A 4CLJA 1ATPE 3VF9A 4BYIA 2PZPA 3OD6X 4EOJA 5C1QB 3AOXA 5EI8A 4AE6A 2VTMA 4E20A 1ZYSA 3W2PA 2OK1A 4RJ4A 3KREA 4D2TA 3OY3A 1ZOEA 1Q4LA 4IJPA 3E63A 4H3BA 3NYXA 4FTOA 3HL7A 3HV4A 4J97A 2EXMA 2PVYA 2R3JA 4ENXA 2HELA 3FMJA 4K77A 5J5TA 3PXZA 5HO7A 1GZOA 1PXPA 1J1BA 3OW4A 3QALE 2F57A 5M57A 2BILB 3MFSA 5AA8A 4F64A 4I4EA 1O6LA 2P3GX 3BHHA 4FEQA 3VJOA 4PV0A 2EB2A 3OW3A 4MF0A 3KRLA 3UGCA 1GNGA 4BDKA 2OF2A 3E88A 4EQMA 4AA5A 2HW6A 1OIYA 2BAKA 2O63A 4RPVA 2I0VA 2VX1A 1UNGA 2QKRA 2RL5A 3D5XA 3G33A 2QOHA 2AC3A 4XP3A 3DKCA 4F9AA 2XRUA 2IZRA 5DR9A 5HG8A 3RPVA 2JIUA 3E8NA 2GHLA 2XMYA 3O2MA 3ZS5A 3NW5A 3R7GA 2CKPA 3BHTA 2CNQA 4QMVA 4FSMA 4DEEA 3R9NA 4YNEA 2W1CA 3V8WA 4DCAA 4ERWA 2YLEA 4MH7A 5JFWA 3SRVB 3WARA 1JBPE 4PY1A 1V0OA 4IE9A 4FZDB 1NW1A 2R0UA 4MQ2A 3CIKA 3OWLA 2PL0A 3NAXA 1PXNA 4FIFA 4QMYA 5CSWA 5CSXA 1WBWA 5AP6A 4O22A 3NR9A 5DNRA 5EOBA 5CF8A 2C5OA 3MH0A 2YIXA 3VNTA 3GOPA 3PY0A 2W5HA 3CBLA 4TN6A 1ZLTA 2VD5A 3KRJA 3R01A 4EHEA 4G3EA 3LFCA 4U81A 5FEQA 2NO3A 3GFWA 3QYZA 4NSTA 1F0QA 4XG9A 4L45A 3UZTA 3EZRA 2I40A 4QQ5A 3REPA 3D9VA 3RAKA 4FGBA 3R8ZA 3UYSA 4EH9A 1NVRA 2W1EA 4FV2A 4XH6A 4YU2A 5IQAA 5HD7A 1KE5A 2WTDA 4O7YA 3FMEA 3OWPA 3MFRA 4NFNA 2C6EA 2FSLX 3A8XA 3QQFA 4UWCA 3ZEWA 3BYMA 4CKIA 5C4KA 4O0YA 3BV3A 5A14A 3TKUA 2GS2A 4ALWA 1H8FA 4IZ7A 4BI2A 5TO8A 4JS8A 4ANBA 2BMCA 5AV0A 4CQEA 4MKCA 4E7WA 2WEVA 3R1YA 4HVGA 3ETAA 3RP9A 5DRDA 2PMOX 4GIHA 4N70A 1XO2B 4BDCA 3MGYA 3MH1A 2CDZA 2YERA 1H28A 4G16A 3TZ8A 5IQFA 2OU7A 3K2LA 4LRJA 3LCSA 4CZYB 3VS5A 1PF8A 4NTTA 4D9UA 2UUEA 2XJ2A 3GCSA 4E8AA 4WIHA 3Q9XA 2CN5A 3F2NA 1ZYLA 5EI2A 4QPAA 2X8EA 3SOCA 1RE8A 1R0EA 4GEOA 2QO2A 1OMWA 2ITVA 2WMAA 4FSWA 4IACA 4DG0E 5TF9A 4C35A 4CQGA 3BI6A 4EH3A 5HVYA 2XYNA 4KINA 4O2PA 2WEIA 4IVBA 4UMRA 5L2SA 4YUQA 3DBDA 4BDDA 4ZTSA 2RFSA 2LAVA 5KHXA 2X39A 4IB1A 5JRSA 4MX9A 4AZTA 1M17A 3G90X 3EQDA 4BHZA 5K4IA 2XK7A 3QZHA 5F20A 5DRBA 5GZAA 5LMAA 3W1FA 3PUPA 5IQIA 4H39A 3EN9A 4F7NA 2PUIA 1YQJA 2BHEA 1TQIA 4GCJA 3KC3A 1WBNA 1BI7A 4YLKA 4GV1A 3MH2A 4RIXA 2C6MA 2HZNA 2XIKA 4UMTA 4AFEA 5HCZA 5EYDA 2EUFB 4D4YA 1F3MC 3FMDA 4NUSA 4YJQA 2Z7LA 3NYVA 4HGEA 2CMWA 3IK3A 2H9VA 1GIJA 5HICA 3C9WA 3DGKA 1M7NA 2J51A 4W9XA 1NVQA 5GJFA 4DBXA 4EK5A 2JIIA 4EOQA 3JYAA 3UZRA 5AP3A 1UU8A 3D83A 4R1VA 5KX8A 3QTRA 2R2PA 3HECA 3QA8A 2X7GA 2QO9A 3TNQB 2IW8A 4FNZA 2RKUA 5TOZA 4DFLA 1W84A 5HE2A 4EK3A 4H58A 5JZNA 2NPQA 2WOUA 2O2UA 2UV2A 2QLUA 1U5RA 4U79A 4HYHA 5IA5A 3ZSHA 4EWQA 3NAYA 4TKSA 4YC6A 3AMYA 5HHWA 4ZLZA 2OFUA 4DH5A 4TWOA 2ONLA 4C4HA 4AFJA 2ITPA 1Z57A 2Z7SA 5EDRA 2VGPA 3DAKA 1OITA 1PXJA 2ITWA 2C47A 5E8VA 4GKHA 1H08A 1URWA 4BYJA 4H3PA 2J0IA 2DQ7X 4EOIA 1NXKA 4RGJA 4X3FC 3B2WA 3R00A 4IX6A 5GJDA 3ZSGA 4NW6A 1ZYJA 4NKSA 3ULIA 2F7XE 2ETRA 4GU9A 2XRWA 4J52A 3SW7A 4AZVA 4M67A 3ZUVA 1OKWA 3TDVA 3D4QA 3HMNA 3I6UA 3QTWA 4UWYA 5AP1A 3ZOSA 5IUHA 2E9OA 1U59A 3UIXA 4PF4A 2YJSA 3IW5A 3LFNA 2GNGA 5C8KA 4NH1A 4W4XA 3C0HA 2R3IA 3ZUUA 3I6WA 1W8CA 1AD5A 1ERKA 5AV1A 5AR7A 3ZZEA 1OL6A 4QMOA 4WUNA 1PXIA 5A9UA 2E9NA 3UZPA 3GCUA 5CXZA 1J7LA 2XCKA 3DB8A 4IVAA 3FLQA 3QUDA 3TL8A 3BHVA 3Q4UA 4NCTA 5IH4A 4L3LA 4QQCA 1Z5MA 4M66A 3GVUA 1P4OA 2HWPA 5D7AA 4F1OA 3O23A 2OIBA 3HV7A 3F2AA 3ITZA 4FL2A 4M15A 4RJ3A 4BB4A 2C0IA 4AOJA 4XOYA 1YOMA 3C13A 2BKZA 3ACKA 3Q4CA 4JDKA 4XBRA 4YPSA 5EHOA 4ARKA 1OI9A 1UA2A 3JR1A 2WO6A 5JQ8A 3TG1A 3ORZA 3MPAA 3DOGA 4I20A 2XVDA 1Q3WA 2YIYA 4QYGA 4O0VA 4HNIA 3UC3A 5AX3A 4QRCA 4FTAA 4RJ7A 4BIBA 4FODA 5KBQA 4LFIA 4KRDA 5C8NA 4CRSA 3R71A 3PY1A 5HLPA 2WXVA 1XH6A 2XH5A 3R1NA 4BCPA 4W4YA 5DFPA 4WHZA 3C4EA 3HV3A 3AT3A 3FYKX 3UYTA 2I6LA 4RRVA 2PZRA 5DT0A 2VTLA 4AA0A 5HIBA 4E5AX 4C4JA 3PXKA 3TUCA 2CNUA 3MPTA 4II5A 3CPBA 4YLJA 3GBZA 2C6OA 3QU0A 3GU7A 4HYUA 3D0EA 1DS5A 4NYEA 5CT7A 1Y6AA 3KULA 4FKGA 3RPRA 5IA3A 2QO7A 2W0JA 2E9PA 1UVRA 5AR4A 1QCFA 3DJ5A 1M7QA 1ZOHA 2CSNA 3R7OA 3U4UA 3TM0A 4CTBA 4DH7A 4BL1A 4I24A 3R8PA 2R5TA 3IW4A 3DAJA 3OUNB 4MNEB 4CXAA 3DNEA 4FEVA 3EQBA 3RCJA 3R83A 4FZ6A 3UC4A 3W8QA 2YDKA 4S31A 3H3CA 2WHBA 4RX9A 3BZ3A 3FMLA 3QCSA 3ORKA 3QD4A 4XP2A 4YHFA 5AWMA 2PVRA 3QGYA 2VX0A 5EI6A 5EW8A 3QQHA 5AP5A 5A3XA 4EL9A 3DJ6A 2WTKB 5HG5A 5IA0A 3IW8A 4IHPA 4MXYA 5JZJA 4BDEA 3TKHA 4MBIA 4MQ1A 1BL7A 3QRTA 4MNFA 3W55A 4QMUA 3RZFA 5CNNA 2BZIB 4ZTLA 5CAPA 4ZEGA 1WFCA 4QMLA 3Q6WA 3I4BA 4ZSAA 5H8EA 2FUMA 3TNHA 5IEXA 3O71A 2WKMA 4IC8A 3L8SA 4CZUA 5BVOA 1KOBA 4LOOA 2QR8A 3LW0A 3BLRA 4H36A 4D28A 4EH8A 2X2KA 3FKLA 3KMWA 1M2PA 3D7TB 1UKHA 4WT6A 1H0WA 3CKXA 3ZXZA 4FKRA 4H1MA 1L8TA 3MY1A 2EVAA 3NNWA 3OP5A 3E3BX 3NWWA 4FV5A 3QA0A 4C38A 2HY81 4FC0A 4IEBA 5LVLA 4ZSLA 4AN2A 4EYMA 5IQGA 3TT0A 4PL4A 3GUBA 3LM0A 4G6LA 3QL8A 1H25A 1BLXA 1Q41A 2H6DA 2UZNA 3BX5A 5AJQA 3OF0A 4TPTA 1H07A 4CT1A 2PUPA 4BCFA 4IAYA 4YTFA 5FTOA 4EJNA 4RLKA 2YIRA 5FG8A 1HCKA 1UV5A 2P55A 3LXKA 3NUSA 2DYLA 4NEUA 1KE8A 4LMUA 4AU8A 5LJJA 3OWKA 3HDMA 3MA3A 4IB0A 4L7SA 4ZSJA 5ACKA 3R9OA 1PRYA 2R3MA 4XG6A 2CN8A 2XNBA 3V5JA 4D4SA 5J9YA 1ZXEA 4K33A 2XEZA 4U3YA 4RMZA 3F3ZA 3ZDIA 3PSCA 4BDJA 4RFMA 1KOAA 4O0SA 3P7AA 1U4DA 1K9AA 3VS1A 3DKFA 1ND4A 1XR1A 2WMQA 3P0MA 2FSOX 5CQWA 3CGOA 4DEIA 1FVTA 3G9LX 3CD3A 4I1ZA 4XG3A 1UU7A 3NUAA 1G3NA 3Q04A 3KK8A 3ZYAA 2CPKE 3QKLA 4QOXA 3WZEA 4C7TA 1VEBA 3ZBFA 5IF1A 3Q3BA 4GU6A 3TZ9A 3SVVA 5LMKC 5DGZA 3S00A 3I79A 3R0TA 2YZAA 4IWPA 5C8MA 3UO5A 3SXRA 5CXHA 4ZJIA 1KV1A 3ZO1A 5ANJA 2XK8A 4E4MA 4F0GA 3NVMB 5M07A 1UWHA 3UP2A 3OZ6A 1Q97A 3F3WA 3LXPA 4NT4A 5DYJA 4FSZA 1PHKA 4K18A 4EQCA 2W17A 5FDPA 2IN6A 2G9XA 2VTQA 4U9AA 3P23A 3ZLSA 4ZTMA 1JKLA 1LPUA 3RPYA 1IR3A 5I9XA 4GVJA 1P2AA 3A7JA 3VHEA 3TDWA 5I3RA 3WE4A 3EB0A 2F7ZE 4PTCA 3PPKA 3FL5A 1RJBA 3DK3A 3JUHA 4FVPA 3Q32A 4CYIA 5IPJA 3TV7A 2WU7A 1URCA 4B9DA 2JLDA 4JBPA 3RJCA 4IAAA 5EW3A 4BY9E 3L9PA 3FZTA 3JVSA 4I41A 2F2CB 4AGWA 4F65A 2BRNA 5AR3A 4FIHA 2B55A 1TKIA 4FKQA 4EHVA 5IMEA 3VS3A 4BCMA 1YI3A 1DAYA 2W9FB 3COKA 4ZK5A 2C1BA 1JKSA 2CKEA 4RC2A 4GK3A 4Z7HA 5ANKA 4QMPA 2OXYA 4BKZA 4AZSA 3OG7A 3O96A 4QMSA 5CU2A 2QR7A 2WMTA 4KUJA 5HNBA 4FYNA 4BR3A 4IBMA 4X2GA 5DR2A 3T3UA 4DG3E 4GYIA 5ETIA 4A4OA 4F0IA 3M42A 3QLGA 4OGRA 4X7QA 3NUXA 4KABA 3OXIA 4BI0A 3DFAA 2B9JA 1XH9A 5T3QA 4WSQA 4BCOA 3VS7A 2C3IB 4LRKA 2G1TA 4WG3A 3PWYA 4CD0A 4Y8DA 3I5NA 3UMWA 3LM5A 2CGVA 4ZS0A 3ZLYA 1OBGA 2P33A 3V5PA 3KKVA 4BVUA 1NY3A 5E8ZA 4OW8A 3AGMA 5BVEA 1JSVA 2XP2A 3BHUA 3R73A 4XEYA 1J3HA 1DM2A 2XNPA 4I0TA 5CX9A 5DH3A 3Q2JA 2V0DA 4O7TA 1KSWA 4QMMA 1XH7A 3E92A 2GU8A 4M0YA 3VS4A 4O81A 2F7EE 1WBSA 3FQHA 4C36A 3Q5IA 5C27A 2RGPA 4CGAA 5JGBA 3V8TA 3MIYA 3TNIA 3ENHA 3K5VA 4YZDA 1U54B 3SOAA 3WZJA 4YR8A 2C4GA 4RSSA 3GU4A 4PQNA 4DINA 3F6XA 4CFMA 1GY3A 3OEFX 3KN6A 3VBVA 5ANOA 4FKTA 1LP4A 5ICPA 4DH8A 4QMQA 4P4CA 4JIAA 2UVYA 4FNYA 3GXLA 4DGLC 3C4ZA 3ROYA 3R8LA 1PXKA 2BVAA 4TWNA 5J1VA 3BEAA 4XCUA 4AS0A 3TJDA 2Y4PA 4AF3A 4IC7A 4CZTA 3RWQA 3BE2A 4UXQA 4FSTA 4NU1A 5LARA 3A2CA 4V04A 3R8VA 4RJ8A 2C69A 3F7ZA 5F95A 5FRIA 4BTFA 4C58A 4PP7A 4H1JA 3AT4A 1XH8A 3MY0A 5BYZA 4DH1A 5D10A 3I5ZA 1XJDA 3AC4A 3PE1A 2X6EA 5CI7A 4I6FA 4JL9A 5CEOA 2QOCA 3MN3A 3QGWA 3EQIA 4EH2A 4U42A 5FD2A 5LWNA 5KKRB 4O7LA 2OFVA 5D12A 4MD9E 1XWSA 4J99A 1STCE 2BDFA 3BLQA 5HBJA 2UZEA 3NNUA 4W8DA 3EZVA 3UTOA 2B7AA 5CY3A 3U6IA 1ZYCA 4UYAA 5B7VA 3DTWA 5L8KA 5BYYA 3TV6A 4EI4A 3D5VA 2JIVA 2WD1A 4FV9A 4Q9ZA 2X1NA 4FV0A 3HMMA 4WNKA 3ORTA 3S3IA 4EH5A 2V62A 3ALOA 2YAKA 3F3VA 2G2HA 4OTHA 4JX3A 3QBNA 5HE0A 5ANGA 4JAJA 5CEPA 4FTRA 3MPMA 4D0WA 4ORKA 1OPJA 3DQXA 4YSJA 5KZ0A 4DE4A 3G15A 3L9LA 3UPXA 4G34A 5HNGA 4B8LA 2IG7A 2RG6A 3E5AA 5FUTA 3EOCA 3ZBXA 3QLFA 3ZLXA 3PP0A 4RVMA 4AA4A 2HW7A 4JDHA 4G1WA 3DU8A 4QT1A 5CYIA 4M13A 4PTGA 3EN7A 2HK5A 4GIIA 3SX9A 2KULA 4Y5QA 2UW0A 4U44A 3FC1X 4GT4A 3ZM4A 4OTGA 1CSNA 3KXHA 4F70A 4R3PA 3SQQA 1RDQE 4MHAA 4O0WA 1FINA 4V0GB 5AAFA 3DV3A 3NZ0A 3TI1A 3I7CA 2FA2A 1JKTA 1FMOE 4OTQA 5BPYA 2BRBA 5DR6A 3PJCA 2OGVA 3HLLA 3EHAA 3R21A 4U41A 3VULA 3EL8A 2WB8A 5HTBA 2JKKA 3VUMA 2GNHA 3QCQA 4K2RA 4L00A 2GNFA 3O50A 4FTJA 3PVGA 3P79A 3CJGA 5CU4A 3VWAA 2XNMA 3Q52A 1CKPA 5CLPA 2YCQA 3PZHA 4R5SA 4PDOA 4CMUA 4O7SA 4JLCA 4RIWB 4BWXA 4RVKA 2JDVA 4AW1A 4LGGA 5D7VA 4I92A 1KE6A 3AXWA 4K11A 1BI8A 2HYYA 4X2FA 1OUKA 3KRRA 2QC6A 3IQ7A 2H34A 1Q8YA 3G6GA 4BN1A 4BTJA 4OAUC 5FP6A 3G2FA 3MB6A 1YDSE 2R3RA 2ZB0A 4F7SA 4IX4A 4IDVA 3C5UA 3CJFA 2X4ZA 4FVRA 3TEIA 3UOKA 2WZJA 5M4UA 4QMTA 4GG7A 3QC9A 4ZAUA 4BRXA 5K5XA 4Z3VA 3H30A 4D0XA 1WMKA 4ZMFA 3ORPA 2OXXA 5BVDA 2YCRA 4JDJA 3MV5A 2C6KA 3FDNA 3FQSA 2JKQA 3R22A 4KSQA 2WMXA 3HX4A 1XH5A 3AD5A 1IEPA 4NM7A 5AUWA 5DPVA 1Y6BA 4UB7A 3KMMA 2RFEA 2HWOA 3DA6A 1JLUE 3DBQA 3DJ7A 3H9RA 4EKLA 2A19B 3DLZA 4R8QA 4X3FB 3LFDA 5M51A 5A4LA 3EQPA 4UV0A 3DXQA 3NDMA 3ULZA 3GC9A 2E2BA 3FHRA 3P7BA 4TY1A 3QCXA 1X8BA 1YXUA 3COIA 3QTUA 4FIEA 4R7IA 3W2OA 3O8TA 4TNDA 5EKOA 4DBNA 2J5FA 1KE9A 3KY2A 3HMOA 4KB8A 5DA3A 3VN9A 4ANSA 1GOLA 3ZUTA 5HQ0A 5CEKA 2C3LA 2FSTX 5CSHA 3B2TA 3NUNA 4CFVA 5EFQA 3CKWA 2XK3A 1FQ1B 3PRIA 1BKXA 3V01A 4FKPA 4HCTA 1MRYA 2BAQA 3C4CA 2QOKA 2X7FA 2ZV2A 3QRUA 4ASDA 4HVSA 2XNEA 3R8UA 3DT1A 3VS2A 1B38A 4KRCA 4A9YA 4BFMA 4LRMA 1DI9A 2F2UA 5CQUA 5EM7A 3VVHA 2H96A 2UVZA 1DAWA 4A9UA 5CASA 2BIKB 2HXQA 2YFXA 2EB3A 4RWIA 4QP1A 3ZRKA 2PE2A 2UW8A 3S0OA 4ASEA 3IW7A 2HZ4A 4FG7A 4LI5A 3RTPA 4TRLA 5GINE 2B9FA 3A7FA 4L01A 4XV9A 2P2HA 5L6WL 2PVLA 2QONA 1Q8ZA 3A60A 4RX7A 3OBGA 4YGAA 3V04A 5B2MA 2W5BA 2WIHA 5CT0A 4C8BA 4FSRA 3HUCA 3LKMA 5EK7A 2OIQA 4DT9A 3IDBA 2ZB1A 2NRUA 3RPSA 1V1KA 3WYYA 1V0BA 2R7IA 3P4KA 4E73A 4UBAA 4RWLA 3RMFA 5FM3A 4FMQA 3R9DA 4EBWA 4F9BA 1E1XA 2ACXA 1R78A 3DZQA 2ZV7A 3QAME 4P5QA 4NJDA 4XOZA 5KZIA 2XB7A 2B52A 5M06A 1OL5A 3OT8A 4QTEA 4D5HA 4IQ6A 4XS2A 5FLFA 3ZEPA 3HGKA 2BR1A 5AX9A 5LWMA 5E9EA 2VZ6A 4TYIA 3RALA 3SW4A 3BU3A 3U9CA 3MIAA 5KKRC 4M12A 1CTPE 3BYOA 4DEGA 5KBRA 3KVWA 5KMKA 5LVOA 1G8SA 2PZIA 4F9CA 5F94A 5J7HA 4ZY6A 4E4NA 3OXZA 2YM7A 4O7RA 2VTSA 4E4XA 4ZY4A 3FZRA 4USDA 4OTIA 2DWBA 3FI3A 3UNKA 3E8CA 3R7UA 4FKUA 3U9NA 3E7VA 4B99A 5M44A 3LFAA 1H1RA 4EORA 4X2JA 2J0MB 4RIYA 2C6TA 4KBCA 2WTCA 3L8VA 3QQGA 2PVKA 3H0ZA 4W4VA 5A6OA 4F6UA 2CCHA 3RINA 5M09A 4YJPA 4APCA 3TNPC 4A4LA 4FIJA 2RFNA 2XIYA 4FICA 4FKVA 3ZO4A 4DFYA 3O51A 1CMKE 4LMNA 2GTMA 3RKBA 2BAJA 2JITA 3E62A 4RX8A 4G5PA 3GI3A 2FB8A 3S2PA 3COMA 4AN3A 3TCPA 4DG2E 4N4SA 2VUWA 2ITUA 4C37A 4ZLYA 5JFXA 1Y8YA 4QYEA 4XNEA 3OCBA 5AR8A 3V6SA 4GH2A 1J7IA 4GW8A 3VBQA 4CFWA 3ORIA 3FKNA 4JBQA 4PUZA 1PW2A 4EQUA 5M4CA 4DLJA 2NRYA 4C2VA 4D4VA 4RWKA 4J96A 4U8ZA 2VNYA 2VX3A 5FM2A 5AV2A 3V5QA 5AAEA 5BMMA 1IAHA 3M2WA 4FTNA 2EWAA 4TNBA 5EW9A 4FKIA 2HENA 1K2PA 2G01A 1REJA 4UY9A 1QPDA 2WGJA 3A4OX 4EZ7A 3OMVA 4QNAA 2YEXA 1MRUA 4PDSA 2O5KA 3VUTA 4QP7A 3I60A 3AT2A 5J95A 2QQ7A 2BDWA 5IQCA 3SXFA 3FXWA 4BTKA 3BWJA 5K0XA 3ALNA 1OZ1A 3QTIA 4Y83A 1M52A 5KMMA 4RX5A 1JAMA 4CG8A 3KL8A 2EXEA 2YWVA 4D2RA 4FTIA 1W83A 1OPLA 3PTGA 3FLSA 4AX8A 2PZ5A 4BKYA 4HYSA 3BQCA 5FXQA 4HCUA 3QUPA 3AC5A 2EXCX 5ITAA 4J95A 5EDQA 5L2TA 3Q96A 5IQBA 3W2CA 5DG5A 5C4LA 3M1SA 4IMYA 5EH0A 3WF7A 5FGKA 3EQFA 2HOGA 4RIXB 4S30A 1JPAA 3PG3A 2ETKA 4FTMA 4MF1A 3KEXA 5CANA 3G5DA 4ACMA 4AOIA 4NM0A 4FKWA 4QYHA 4YLLA 2GNJA 3W32A 5CU0A 5I9VA 4HVIA 4CRLA 5IEVA 4YBKA 5AP0A 4FK6A 4AACA 2OZAA 2QCSA 4GJ2A 2GFCA 3KQ7A 2C68A 5L2IA 3P7CA 3OT3A 1SM2A 4BDAA 2XKFA 2VTHA 2FO0A 4AWIA 4E6QA 4FI1A 4BCKA 3FKOA 2V22A 2UZDA 4BDHA 3VUHA 5B2LA 3PXRA 5HD4A 3F69A 3CQUA 5LOHA 3T8OA 4I94A 5K9IA
chains in the Genus database with same CATH superfamily
4XLIA 5DEWA 3HA6A 5GHVA 3BL9A 4O21A 4F1MA 4KBAA 3T9IA 4RZWA 3UMXA 3LAUA 1LUFA 3C5IA 3BYVA 4A9SA 5E8UA 2W1GA 4NIFA 5CENA 2J50A 1OL2A 3PZEA 4ANOA 3F5GA 4JG8A 3F3TA 3H9OA 4RBLA 2H8HA 5HKMA 4RC4A 3QQKA 2NYAA 3EYHA 5KCVA 3ATTA 4YC3A 3KA0A 4IDTA 2W1DA 2B1PA 2HCKA 3TN8A 2W1HA 4LL5A 3V5LA 3R1QA 4DTKA 3JVRA 4HVHA 1W82A 3LHJA 3FE3A 3VJNA 4M8TA 1J91A 3FL4A 4QQTA 1BMKA 4MXZA 5B2KA 3P78A 4O86A 4QYYA 1PMEA 2IVVA 2PVNA 4FL1A 4XHKB 5J79A 5KNJA 4LM5A 5DI1A 3HMPA 1T46A 2WIPA 1ZOGA 2OJGA 4EC8A 4ZXTA 1UKIA 2YM5A 4KIQA 4D9TA 1WVYA 4FV1A 4HCVA 5IISA 2JAVA 5K4JA 4KIKA 1WVWA 4DA5A 1K3AA 5ETCA 3ZFMA 5J1WA 4EOOA 2X2LA 4AUAA 5HU9A 4TL0A 4E4LA 3PIXA 4O84A 3QTXA 3THBA 3GC7A 2PUNA 1TQMA 2B9HA 2RIOA 4RT7A 2I1MA 4ASZA 4RWJA 4E93A 3FZOA 1T45A 1HOWA 4L46A 4DFUA 4IM2A 3R02A 4F6WA 1DI8A 2VWZA 1P5EA 2BPMA 4IJ9A 3UG2A 4EEVA 3LMIA 4O7NA 2XAOA 4MCVA 4JVGA 4I0SA 5EYCA 4FA2A 2IWIA 1CKIA 5BVNA 2ZDTA 3PPJA 5EG3A 5IUIA 4BDGA 4CVAA 2X7OA 4O7VA 3V51A 4E3CA 2UW5A 3FV8A 4FIIA 4MUQA 5E90A 4ERKA 4FKJA 3ANRA 5T68A 3F2RA 4ZTNA 4EZ5A 5DMZA 4PPAA 4HGSA 4OUCA 2WQBA 1Z9XA 4PDPA 4PL5A 4R7HA 5AV3A 5HBEA 3PXFA 3QD0A 5HCXA 3ATSA 4PTEA 4I4FA 4GSBA 4IX5A 1WAKA 4UMQA 4Z7GA 3NPCA 2WMUA 1B39A 3E8EA 3WF9A 2ZMDA 3U54A 1KUTA 4FEUA 2XKEA 4GT5A 4GL9A 3ID6C 2J7TA 4A9RA 5H3QA 5J7BA 3F82A 3GB2A 5H9BA 3WOWA 3OCGA 3VBXA 2Y7JA 5BX0A 2R0IA 2C3JA 2ZM1A 1U5QA 3W33A 2V55A 3BCEA 4RC3A 3CY2A 4UN0C 3E64A 4FEXA 2W9ZB 4C3RA 5CALA 3SDJA 4ID7A 4YTIA 3KULB 3VUDA 4BGGA 4YJNA 2A2AA 4RQKA 3FMNA 1OGUA 3NSZA 5IQDA 2I0YA 4OBOA 5AIKA 2QU5A 3A62A 5FBOA 3R63A 3UDTA 4M84A 3UQGA 3OROA 3KXNA 2YIWA 4L8MA 3ZFYA 2WU6A 3L9MA 4D4RA 4E26A 2GQSA 4FTQA 1FVRA 3L8XA 4WSYA 4AGCA 4FOCA 4I6HA 4JQEA 2IW9A 4FT0A 2YM6A 4GVAA 3F5UA 4BI1A 3NW7A 3NEWA 1E1VA 1KE7A 2ZAZA 2R3LA 5DWRA 4MYGA 1H1SA 5AUZA 4KWPA 1OGYA 4JNWA 2VU3A 2YCSA 4FG8A 4WD5A 4ENYA 1IRKA 2IVSA 4HGLA 4P5ZA 4BWPA 2IPXA 4AQKA 4KAOA 2FVDA 3KK9A 4A7CA 3PA3A 1OIUA 4EH7A 5AFVA 3A7HA 3W0OA 2E9VA 3TZMA 5CF4A 4XX9A 5E8SA 1ZY4A 3W2QA 3C51A 3MY5A 4USFA 2NNWB 4TYJA 5A4TA 4C62A 5JH6A 3VBTA 1SVGA 2ZM3A 4FX3A 4M0ZA 1FPUA 4L7FA 3IOKA 2RFDA 2OXDA 4DFXE 3V5WA 4WO5A 3B8QA 3ROCA 3H0YA 4V05A 1ZY5A 2XJ1A 5CVGA 4OR5A 3PA4A 4I5HA 1IA8A 3MSSA 4X2KA 5EYKA 1YHWA 2IJMA 4IZAA 1NT2A 5M4IA 3KXGA 5KUPA 3R7IA 1ZAOA 5FP5A 5EQYA 5K3YA 3GU5A 4EHZA 5EQPA 2VO7A 4TYHA 3ZHPC 3F66A 1Q3DA 5DHJA 4L52A 2IZUA 2QOIA 3O8PA 4QD6A 3HV6A 4IVDA 4LL0A 5M53A 3GU6A 4KKGA 4YJRA 3NFGB 3DB6A 4FTTA 4OBPA 3EKKA 4CV8A 3R7YA 3RCDA 4DTBA 3H9FA 4JQ7A 3NNXA 4N6ZA 1A9UA 2CLQA 3ZO3A 2PVMA 2J5EA 4G5JA 2G2FA 4EJ7A 3EL7A 4FT7A 4CKJA 3VQUA 4FKSA 1REKA 3BU6A 2YZLA 3R2BA 2JKMA 3F3UA 5FBNC 5HCYA 3BGZA 5CI6A 1APME 2JBPA 3JPVA 2B0QA 2Q0BA 4F99A 3IGOA 4DHZA 2HY0A 1PXLA 5EYMA 5L4QA 4JI9A 4AXCA 4F0FA 2XKDA 1ZARA 5EM5A 1PXOA 3EN4A 3UO4A 3FLNC 3EYGA 4CMOA 2OJJA 2QVSE 3G6HA 4K8AA 2J0KA 4XG4A 5AUYA 3VS6A 4EOSA 5LCJA 3FC2A 3SV0A 4QNYA 3QHWA 4N6YA 4XBUA 4BCGA 5H8GA 3DCVA 3HKOA 3DKGA 4PPBA 4BKJA 4AXFA 4FV8A 4IM3A 1PMUA 2VTAA 4PRJA 2GDOA 1UNLA 2ONLC 3D94A 3KF7A 5CS6A 5BVKA 1MRVA 3R8MA 3W10A 5D9HA 3S4QA 3OUKA 4EBVA 3HAMA 4XV1A 4AXEA 5GIOE 4JBVA 3BYUA 4UEUA 4EH6A 4ZP5A 3KB7A 3SG9A 2BHHA 5I9WA 5DT4A 5I3OA 2YM8A 2CCIA 3AD4A 5JSMA 1XHAA 3KRWA 2O3PA 2X0OA 2ZJWA 3C4WA 3PIYA 4JAIA 4PNIA 3UNZA 2QNJA 3DBCA 1G5SA 2CNVA 3FYJX 3Q6UA 5L8LA 3MTFA 4JT3A 4ACCA 1H01A 4I6QA 3JY0A 4R78A 4EK4A 1XH4A 2YDJA 4L3PA 4D58A 4YZNA 4WUAA 3ZH8A 4DGNA 3ZZWA 3SA0A 1JWHA 4ZJVA 3RI1A 2VNWA 2VV9A 3UBDA 2BIYA 4MWHA 5LVMA 4G3DA 3K5UA 4ALUA 4XV3A 4YURA 3S1HA 2OJ9A 4NTSA 2JEDA 2ZV9A 5CF5A 1PKGA 3D15A 3LFQA 4FG9A 4PPCA 1I09A 4FOBA 3BHYA 2GSFA 4HZRA 1MQ4A 2XS0A 4Q5HA 1VLRA 3FMHA 3CQWA 3LMHA 2QOQA 3HAVA 5HLNA 4IAFA 5HX8A 3Q60A 4O38A 3FBVA 3K3IA 3R2YA 3CTJA 5ETAA 2UW4A 2Q0NA 3OWJA 4NCTC 3LJ0A 4YJUA 2YIQA 3UPZA 1L3RE 3ZDUA 4O0XA 4YZ9A 3KFAA 3LCKA 4ACDA 3U6HA 3LOKA 4DTAA 5D11A 2OKRA 3CY3A 3DK6A 5GJGA 4ONAA 2P0CA 3QZGA 2GS7A 4MBJA 2YITA 3RWPA 5IDPA 2X4FA 5FEDA 4AW2A 4FV4A 3W0NA 3HRFA 4MXAA 2QHNA 3BLHA 5A4CA 2XIZA 4FNXA 4HZSA 1SVEA 4FTLA 3KU2A 2BTRA 3NCZA 1A06A 3PJ1A 3R6XA 1MUOA 2BRHA 4PL3A 5L6PA 5A54A 2XUUA 1Q24A 4LOPA 4FSNA 2FYSA 1ZMWA 3IDPA 5CAVA 2Y6OA 4GUBA 2Z8CA 2Y9QA 5HLWA 1BL6A 2C0OA 2Y4IC 4CG9A 3TNWA 3DXPA 3IKAA 1OECA 5JGDA 3NIZA 4X2NA 4IB3A 3W2RA 1YOJA 4AZWA 5BMSA 2VO3A 1YDRE 3PWDA 2Z7QA 2OO8X 4OBQA 4O0UA 4DFNA 2OICA 4A4XA 3FZPA 2Z7RA 1WBVA 1GZ8A 3H4JA 3LVPA 4G17A 4JQ8A 2O8YA 1Y8GA 4OTRA 4Z9LA 1XBAA 1FGKA 4C61A 5FEEA 2WAJA 3IG7A 4CV9A 2X9EA 4B0GA 4D1SA 5IZFA 3QZIA 5CAOA 3FHIA 4YC8A 2OW3A 3P1AA 4F7LA 5BNJA 5L3AA 4FT9A 4HW7A 3TYKA 3CSVA 4TWCA 2R3GA 5DOSA 3UOHA 5AUUA 4U7ZA 4EK6A 4G9CA 2Y8OA 4S2ZA 4WKQA 3QFVA 4YHJA 4JG7A 2YHVA 2PE1A 4E6DA 3FEGA 5BV3A 2PWLA 3II5A 4WA9A 3VUIA 2W4JA 5HORA 5E92A 5D1JA 3Q53A 4W8EA 4JBOA 4RFYA 3FAAA 4TT7A 4FZ7A 3L8PA 4XG7A 2XJ0A 2W05A 5KHWA 5KMLA 1PY5A 3A7GA 2HXLA 1IASA 2B53A 2UW7A 5FQDC 2VTJA 3LXLA 4DC2A 3OOMA 3DQWA 2RF9A 2VO6A 5J9ZA 4USEA 2B54A 4F1TA 2ITXA 4FL3A 5FXRA 1ZMVA 3HP5A 3WBLA 2CGUA 5D41A 3RM7A 4EOLA 1JQHA 4DH3A 3MYGA 4GK2A 4PDYA 2ITNA 4X6RA 3DXNA 3LLAA 3LFSA 4D1XA 5E4HA 1ZZ2A 3D14A 1OL7A 4KKHA 4U5JA 4JMQA 2R3NA 2WTWA 4QTAA 4FTUA 4PWNA 2PHKA 4PMTA 5M56A 2WELA 3BBTB 2RSVA 1PKDA 3PVBA 1UU9A 1A48A 1Q8UA 3K54A 3Q4ZA 4HNFA 1ZRZA 1TQPA 3DDPA 2P2IA 2VRXA 3WZUA 4DGMA 1VYZA 5HO8A 3FSKA 3Q9ZA 2PYWA 2VWIA 2WQMA 3OCSA 3OTUA 4QTBA 1Y57A 4AZEA 3DFCB 1XMLA 5AIRA 2XCHA 3PE2A 5HU3A 2C6DA 2J6MA 5DVRA 4WG4A 4RA5A 5LMBA 1SVHA 3FXXA 5HE3A 4NK9A 3UE4A 3FLYA 3V8SA 4H3QA 2R3HA 1OVEA 4LV8A 4W9WA 3EQHA 4YP8A 3SG8A 4TWPA 4QP3A 1JSUA 3MESA 2C1AA 3C1XA 4F08A 3C4XA 4FSQA 4G3CA 4CTCA 3U6JA 2W1FA 2VWWA 4I5PA 2XANA 3C0IA 3RHXA 3MBLA 4M69A 4BDFA 4XG2A 2WQEA 1YWVA 4UYNA 3RAWA 3WE8A 4X21A 2BALA 2XM9A 4XMOA 4B7TA 3MJ2A 4U97A 5CEIA 2WMBA 3GP0A 4WBOA 3IECA 4GRBA 3LFBA 4F63A 2GQRA 3QRJA 5TE0A 3PY3A 2I0EA 5KE0A 4BTMA 5IDNA 4K0YA 1CM8A 4MAOA 4RIOA 3NCGA 5AM6A 4XP0A 4EOMA 4RVLA 4WG5A 4EC9A 2BDJA 5L8JA 5M55A 1TVOA 4I6BA 4F9YA 4FZAB 3UQFA 3KCKA 2XF0A 4Y5HA 5AM7A 3V6RA 2P4IA 3VRYA 3BRBA 3PXQA 3N9XA 4D2VA 3FMKA 5IU2A 3O8UA 1YWNA 4G31A 3RBWA 2YCFA 3IW6A 4Z16A 5JFVA 4DEBA 3FY2A 3OBJA 4D2PA 3TTIA 2BFXA 4NFMA 3DBFA 4MEDA 2PVHA 3Q5ZA 3MFUA 4OTWA 2F49A 1JVPP 3QD2B 4QQJA 3MA6A 1HCLA 3OTVA 3UNJA 4EWHA 2W4KA 1PYXA 5JGAA 2Z02A 3RK7A 4JJRA 3DAEA 4NM3A 4EOPA 4H05A 4GFOA 5CAQA 3PUFC 1VJYA 4ZTHA 2JKOA 3QRKA 5JRQA 5C01A 5A6NA 3GCVA 3EQCA 1XBBA 4QMXA 3HDNA 3SXSA 4CFFA 3EN6A 4BBEA 5CTPA 3OY1A 3VW6A 1WBOA 2VTNA 4O0TA 4J71A 2XBJA 2ITZA 3DNDA 4FZFB 2PTKA 2YM3A 4BICA 2OF4A 4TZRA 4UZHA 4D5KA 3KXXA 4M14A 3SRVA 2ITYA 4P90A 3A4PA 4Y72A 2YABA 5JFSA 4BIEA 4HPTE 3BPRA 4OAVB 2I7QA 2W99B 3WZDA 5I5ZA 4LGDA 5GZ9A 2JFLA 5JT2A 4FNWA 5H8BA 3ORXA 3KN5A 2PPQA 3MVHA 2XK4A 3HYHA 3IPHA 4IAKA 4MVFA 3MTLA 4RVTA 3DDQA 4FRFA 3QUEA 3ET7A 4NZWB 3BBWA 3EFWA 4YJVA 5L2QA 4DGGA 5BVFA 1OKVA 1YVJA 4L3JA 2B4SB 4IAIA 3RVGA 4BGHA 3FI4A 3SGCA 4J8NA 2QG7A 4L9IA 4UALA 4HPUE 2W1IA 3B8RA 2WFYA 4N57A 1Q61A 4BCHA 5HVKA 3D7ZA 3NYOA 4PMPA 1SZMA 2ERZE 2A4LA 3ANQA 3PDTA 5KO1A 2AC5A 4GK4A 3NUUA 2A27A 2A0CX 2JBOA 3RAIA 4C3PA 4OLIA 3C0GA 3QTSA 3RPOA 2WQOA 4I3ZA 2JDTA 5DN3A 4DGOA 3HMIA 4JXFA 4O27B 3EWHA 5CNOA 3KF4A 2XIXA 4M97A 3PFQA 4PMSA 5AP7A 4FK3A 4U3ZA 3S95A 4QEBA 4K1BA 4AW5A 2V5QA 1YOLA 1Q8WA 3A99A 4YJTA 4R6VA 5HTIA 4U40A 1LR4A 1YKRA 4HJOA 3WIKA 3UO6A 3EFJA 3EFLA 4J1RA 1FOTA 5HE1A 3ZC6A 1XKKA 3OOGA 4CLIA 4DF3A 1QMZA 3QXOA 2UZBA 4ZJJA 5GNKA 3Q2MA 4RA4A 1KWPA 3O0GA 3GEQA 4I5MA 3MJ1A 5EM6A 3I0QA 1B6CB 3TACA 3GENA 5HTCA 2YWPA 3OS3A 5AP4A 2VWVA 5I4NA 2AUHA 1OKYA 3VIDA 3V3VA 3VO3A 3ZC5A 3U55A 3CQEA 4RZVA 1QL6A 4ITJA 4BDIA 3QZFA 4J7BA 3IONA 4ITIA 3KGAA 4Y73A 4B6LA 1WZYA 4GKIA 4A07A 3C7QA 3PJ3A 4X6QC 1Q99A 5AAGA 3WF6A 5IEYA 4AT5A 4ZZMA 3EJ1A 4C0TA 5E8YA 1Q62A 3D2KA 2AQXA 4JIKA 3UDBA 2X8IA 2IZTA 3CD8A 1H00A 1RQQA 3HEGA 4FT3A 3V5TA 3ERKA 4P2KA 3H10A 3IOPA 2W96B 4CFXA 1R1WA 1H1WA 4XRJA 5CVHA 2R3KA 3CCNA 3RHKA 2GHGA 2REIA 4FSUA 5BQ0A 3WYXA 2R4BA 2BKKA 4DITA 3EQRA 4QMWA 2BCJA 2ZV8A 3ODYX 2UZLA 4O4CA 4Q9SA 3IDCA 1H24A 3Q9YA 4N0SA 4YTHA 5AUVA 3SLSA 5JQ5A 5AUXA 2G15A 1CKJA 2ESMA 5F4NA 4KS7A 4RIYB 2X81A 5KMNA 1NVSA 3VHKA 5CWZA 3KRXA 2BRGA 3TIZA 2C5VA 2OBJA 1BX6A 2QURA 1W0XC 4I5CA 5IA4A 2PMNX 5BUJA 4JDIA 5F1ZA 3ELJA 3CC6A 4BJJB 2A1AB 2J9MA 3BGPA 2QLQA 4YO6A 1M2QA 1PMVA 3MDYA 1ZYDA 4OT5A 3MH3A 4KA3A 1SMHA 2VGOA 3NX8A 4DAWA 2HIWA 3L1SA 4IM0A 4LOQA 4Y85A 1OIRA 3ZMMA 2OSCA 3KXMA 4JRVA 3ZTXA 2C3KA 5LMKA 5FDXA 4PNKA 4F09A 3GOKA 4YPDA 4O1PA 2WMRA 5HNIX 5M08A 4IZ5A 4FGRA 1QPCA 2IZSA 4BBFA 4U80A 4KNBA 4C4GA 2OLCA 3NYNA 2YISA 2IO6A 3AC3A 3PSDA 4RJ6A 4C33A 2F4JA 1TZDA 1JSTA 1JKKA 3NGAA 4KS8A 3F5XA 4YO4A 2C6LA 3NLBA 4NWMA 3O7LB 3ORLA 3F61A 3UP7A 4G6OA 4YSMA 4CNHA 2FGIA 3RNYA 3C4FA 5E7RA 4QP6A 5GZ8A 2PVJA 4ASXA 4KIPA 3POOA 4DLIA 4QTCA 5I9ZA 2R7BA 2XIRA 4GS6A 4GT3A 2O64A 1BYGA 5KMOA 4FUYA 2OH4A 3QWJA 4LV5A 3UOLA 3N4UA 4TYEA 3BEGA 4ZIMA 2SRCA 3NS9A 3UJGA 4IFGA 3FMMA 4ZSEA 2W7XA 4FBXA 1H1PA 4CFNA 3A61A 3GNIB 4DCEA 2JGZA 3L9NA 2QOOA 3MI9A 4TYGA 4E1ZA 2JD5A 4C59A 2GS6A 4OTFA 5HESA 2ZMCA 4CSVA 2DS1A 2XZSA 4C4EA 5LVNA 5CEMA 2GTNA 1I44A 2JC6A 1GJOA 4QPMA 5BUEA 3HA8A 1U46A 1UNHA 4YNOA 5DBXA 2X2MA 3ZXTA 3R9RA 3HP2A 4AOTA 4IWQA 1WVXA 4ZMEA 2ZOQA 4IADA 2ZM4A 4EZ3A 5J8IA 2QHMA 3F7WA 4BWKA 1UU3A 2YLFA 4EYJA 3BGQA 2Z60A 3F88A 4QP4A 2J90A 3QF9A 3HVCA 3QCYA 2XNNA 2C5XA 1F5QA 3ZFXA 2X6DA 4BIDA 4DDGA 3GQIA 4NL0A 1TFFA 4GUEA 2OZOA 1W98A 3FJQE 4IW0A 5HVJA 4DN5A 3POZA 4JR7A 2UZTA 3R30A 5TT7A 4QMZA 4AT3A 3DPKA 4IZYA 5IA2A 4ACHA 4ZTQA 4FJVA 2OZAB 4WRGA 1MQBA 2HZ0A 1VR2A 1AGWA 1YXVA 4FSYA 4IFCA 5C9CA 3T3VA 4KBKA 3FQEA 3UVRA 2GCDA 1P14A 4DFBA 4FF8A 3MFTA 3CR0A 1EH4A 3VUGA 2YDIA 1Y91A 1JNKA 3D5WA 3ZU7A 4AGUA 2X9FA 4A06A 4R3RA 4M7IA 3TZ7A 5LXMA 2RG5A 4MBLA 3QX4A 2BRMA 1S9JA 2XA4A 4C02A 5E8TA 4FV3A 2W4OA 4FTKA 4MXOA 4CYJA 3CP9A 4AAAA 4ACGA 3CTQA 4BHNA 2GPHA 3ZLWA 3LFEA 5EHYA 4NIFB 5HIDA 5IH6A 3ODZX 1VZOA 2XEYA 4O83A 4AXDA 3SC1A 1XBCA 2YJRA 3A8WA 3G51A 3DBEA 2GFSA 4WOVA 4YZCA 4RG0A 5HG7A 3WF8A 4C57A 5J9LA 3U4WA 4OTDA 4C2WA 2CHLA 4MNEA 3BE9A 5CZHA 3LZBA 3GQLA 1WCCA 2PZYA 1ZMUA 3DKOA 3UIMA 1O6KA 3BQRA 3FY0A 3PLSA 4RLLA 3W8LA 4AGDA 1QPJA 4NM5A 3LMGA 2R64A 3SAYA 4LUEA 4M68A 4NJ3A 4YJSA 2UVXA 1YDTE 5ANEA 3G0FA 1OL1A 3KVXA 4L42A 4CFUA 2QODA 3EFKA 3LQ3A 3OCTA 3QTQA 4R3CA 5TR6A 3BELA 3EQGA 3D5UA 4IB5A 3LLTA 3ZRMA 3UQCA 4G3GA 4R7BA 2R3PA 2UW9A 2ERKA 4LGHA 3FZSA 3P08A 2ITOA 3TUBA 2B9IA 5EHLA 5IQHA 1YHSA 4QTDA 3MS9A 2QOBA 3W16A 4KIKB 2Y4IB 1YXXA 4FV7A 4IX3A 2GHMA 3UIBA 1SYKA 4L68A 3DS6A 4KKEA 5C03A 5J5SA 5C26A 4DHIB 3ZONA 2F9GA 4AN9A 3FZ1A 4DYMA 2R3FA 4QP2A 3LQ8A 5JKGA 3D7TA 3OC1A 3LJ1A 4YHTA 4GMYA 4TW9A 5AUTA 3VQHA 4I0RA 4JRNA 3BV2A 2WOTA 3E7OA 4L44A 3SD0A 3BU5A 4HYIA 4I23A 3NUYA 1XQZA 4IAZA 4YJOA 4A9TA 3GC0A 4AZFA 3VBWA 5AMNA 3TV4A 2XK6A 5A46A 4FVQA 1R3CA 3OXTA 2QOFA 2XBAA 2QD9A 3QKMA 4GG5A 4L53A 4PMMA 2ITQA 5BUIA 5AP2A 3G0EA 2C30A 1PYEA 1YXSA 5AEPA 3LXNA 3O7LD 1FGIA 3PRFA 2AYPA 4J98A 1J7UA 5BYLA 2BZJA 2OI4X 1Q5KA 4FYOA 3KXZA 5CU3A 4ZOGA 3CGFA 4ANNA 2JDOA 2IVUA 5CSVA 5J87A 1YHVA 4ITHA 4E6CA 1BUHA 4D55A 4FTCA 1H1QA 5T6KA 3TXOA 3QYWA 5AADA 3N4VA 3PYYA 3QQJA 2QOLA 4YBJA 4HVDA 2PMLX 1G8JA 2FSMX 4XLVA 4TXCA 2JFMA 4XUFA 3P5JC 3IO7A 3PP1A 5EDPA 1OB3A 1WBTA 4J53A 3O5AA 1ZWSA 4O91A 3UVQA 5K5NA 3RM6A 3OVVA 3T9TA 1UWJA 2OIDA 5HG9A 4R5YA 4EKKA 4AW0A 3BYSA 3I7BA 5I0BA 1OIQA 3AC8A 3NVKI 2CGXA 2W06A 3IS5A 4UMPA 4S33A 2CLXA 3U87A 2WMVA 2VTTA 4XYFA 2GQGA 3RZBA 5CAUA 2QG5A 3W18A 3E93A 3R04A 4CCUA 1YXTA 3O17A 2AEGA 2WTJA 4F9WA 3SKCA 5IA1A 5E91A 4WNPA 2ETMA 5EQEA 3PJ2A 3HV5A 4CEGA 4F7JA 5FXSA 4BZNA 1OBDA 3PSBA 4WBBB 4LV7A 1LEWA 2BUJA 2PVFA 3PJ8A 4AT4A 2JDSA 3FLWA 5A4EA 3NIEA 2BZHB 4CCBA 2NP8A 4Q5EA 4FKLA 2IF8A 4C34A 4ZSGA 3UODA 5EOLA 5HIEA 2BROA 4D1ZA 2KTYA 4P7EA 3HRBA 4YZBA 3U51A 4UX9A 1NA7A 4GYGA 3LPBA 4XV2A 2WTIA 4TTHB 3C50A 4DEAA 4PP9A 5L6OA 2XK9A 4QP8A 4FT5A 5TKDA 2IW6A 3ZRLA 3TWJA 4AG8A 3RAHA 4RQVA 1OUYA 2VO0A 4IH8A 1LEZA 3JXWA 4FV6A 2VWUA 4L43A 3TTJA 4TYHB 2I0HA 2OJFE 2QKWB 4L67A 3RGFA 3VF8A 3ORNA 3WZKA 3CTHA 4BCJA 3DZOA 3LQ5A 3D2IA 1YRPA 3UVPA 3E3PA 1M14A 4APPA 3LCDA 2J2IB 4O6EA 1J1CA 3ENMA 4BGQA 2XNOA 3QTZA 3WI6A 1GAGA 3QD3A 3AD6A 3KMUA 4C3FA 1M2RA 1JOWB 4AXAA 2Y0AA 3HRCA 2XNGA 5E8WA 3NNVA 2VWXA 5DLSA 1OPKA 3VS0A 4BF2A 4U45A 4C4IA 3EH9A 2WNTA 5ANDA 3EIDA 3TMOA 1VYWA 3BKBA 4XRLA 5FWKK 4DT8A 3AG9A 3TKIA 1FVVA 2UZOA 3AGLA 3K3JA 4IWOA 3UG1A 2ZDUA 4YMJA 4JR3A 4YTCA 3IGGA 3P9JA 4DHFA 4Y46A 5LVPA 4BCNA 4RJ5A 3OEZA 4O7ZA 4WNMA 3GC8A 1FMKA 4Q2AA 3FXZA 3W0PA 3GT8A 4QMNA 5F9EA 2C0TA 4FE2A 1MP8A 2R3QA 2XYUA 5GIPE 4HGTA 1U54A 2BFYA 4S32A 4ALVA 3F5PA 4MD7E 2PE0A 2UW3A 3FI2A 2R9SA 3FI8A 4U0IA 5E8XA 4BDBA 4MXCA 4G3FA 2PMIA 2PU8A 3HNGA 3QKKA 2UW6A 4EHGA 2WQNA 3ZM9A 3RK9A 3WILA 1YWRA 2UZVA 2VTRA 4O6LA 3TJCA 4AQCA 4UMUA 3GFEA 4RFZA 4WNOA 5KMJA 2OG8A 3GCPA 1E9HA 4BBMA 2E9UA 4E6AA 3OHTA 3HUBA 3E87A 4XJ0A 2V7AA 3UOJA 5LQFA 2ZVAA 5DEYA 4MXXA 2ITTA 2C6IA 5G6VA 1IA9A 4LQMA 5CU6A 4I22A 2BTSA 5L2WA 5LCKA 5IH5A 4MWIA 1GZKA 1SNXA 4QYFA 3Q4TA 1FBNA 5EM8A 2J4ZA 3PIZA 4F6SA 3G9NA 3LJ2A 3P5KA 3PG1A 5DIAA 5HZNA 1G8AA 2IVTA 2VAGA 3ACJA 5B0XA 5I9UA 2VTIA 3DK7A 3QC4A 4G6NA 4AP7A 3LE6A 5DT3A 5K0KA 2PK9A 2W1ZA 5ACBC 4W4WA 3VW8A 1PXMA 3WF5A 4ZZOA 1YI6A 1GIHA 4U43A 4I93A 4UZDA 2W5AA 5CZIA 2C5YA 3MVMA 4IVCA 3UIUA 3R7VA 2O0UA 4O0RA 1O6YA 2YAAA 4KIOA 4FUXA 4O1OA 4KSPA 3COHA 4PX6A 5IKWA 4UWBA 4BZOA 4EH4A 3JS2A 4J8MA 4BCQA 4EK8A 2OJIA 3DY7A 4LDTA 3ZSIA 1SNUA 2LGCA 4IIRA 4ZLOA 2CKQA 2PULA 4ZTRA 2YA9A 3U8WA 4CT2A 5A4QA 2VWBA 2WTKC 3I0OA 5HEZA 2CGWA 2EU9A 4EUTA 3QXPA 3EN5A 3AC2A 4IXPA 1ST0A 3QHRA 5BVWA 1OM1A 3R28A 1ZZLA 3N51A 4I21A 4JOAA 4K6ZA 4NKAA 1H4LA 2HZIA 3FPMA