4UY9A

Structure of mlk1 kinase domain with leucine zipper 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
313
structure length
313
Chain Sequence
QLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCLQDNWKHEIQEMFDQLRAKEKELRTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recurrent Mlk4 Loss-of-Function Mutations Suppress Jnk Signaling to Promote Colon Tumorigenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
total genus 95
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4uy9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4uy9A01
4KABA 4EQUA 2UW9A 3AT4A 5FTGA 3S4QA 3MN3A 2C6LA 5KE0A 4RJ4A 5CAQA 2BTRA 3R73A 3AC1A 3GEQA 4M97A 4QMMA 4B8MA 4XV1A 3F69A 5IKWA 1J1BA 5I0BA 4ZMFA 1YOJA 5DRDA 3D5XA 3G9NA 4J71A 5LMAA 4GK2A 3V8TA 4G9RA 1SVGA 2FVDA 3VULA 1GIIA 1WVYA 2BHHA 3D94A 4QP6A 3MVLA 3S1HA 4WUAA 3FC1X 3RHKA 3F5UA 4F9CA 3CJFA 4R1VA 1P2AA 3D9VA 3PY1A 1BYGA 2YIWA 4AGWA 1GAGA 4AT4A 4EOOA 3MPAA 3QXPA 4U79A 5LVLA 3UODA 2P0CA 1ND4A 4EJ7A 2F2CB 5C26A 3VJOA 5C8KA 4ITJA 4JX7A 4QP8A 3EN7A 3QF9A 1ZYLA 5E8SA 2W1GA 2HIWA 3AC8A 4IZAA 4WKQA 4A06A 3BBTB 4WBOA 5DVRA 5HO7A 4USEA 3EOCA 3MH0A 4EK4A 2NO3A 5AUZA 2WNTA 4RVTA 3UGCA 5JFSA 5J7BA 1ZRZA 3REPA 4PNKA 3KN5A 1SNUA 4M68A 5IA0A 3DKCA 4FGRA 2QQ7A 4QPAA 3FZOA 3IG7A 3EN5A 2G2FA 2RSVA 3PXFA 3MGYA 3ODYX 2XNMA 4CG9A 3NPCA 1JAMA 5AEPA 2JKMA 4EEVA 4UY9A 3SD0A 4F64A 3R83A 2J0LA 4BDEA 3HMIA 3MSSA 4EH4A 5IZFA 4E73A 4ZTHA 5KHXA 2GS6A 4AN3A 1YHSA 2CLQA 5IA5A 5GZ9A 3ZC5A 4NT4A 3ZM9A 2HXLA 2VD5A 3OUKA 4L3PA 4G16A 4KINA 3AGLA 5B0XA 1H24A 3I7BA 5IPJA 5CEQA 4GT3A 3TNWA 3ZUUA 1U54A 3R0TA 2LAVA 5J9ZA 2WB8A 3F3TA 1H00A 2CN8A 3UYTA 4IWDA 3KL8A 4EQMA 5IMEA 2QO7A 4A4LA 5E8UA 5J95A 3RZBA 5HI2A 3BIZA 2OZAA 4FTUA 4X2KA 4Y85A 3LCTA 3NRMA 3OCBA 2HENA 2OIQA 4ZY4A 2W1HA 3FV8A 2GFCA 5EHLA 4DEIA 5CS6A 2BZJA 2GQRA 1VYWA 3QD3A 4PMPA 2FSMX 2ZAZA 1PKGA 3EN4A 3S3IA 3WE4A 4UX9A 3Q6UA 3R71A 4YJSA 3SKCA 4BR3A 4QMTA 4FIJA 5BYYA 5G6VA 2C6DA 1UU8A 4QT1A 1P14A 4IX6A 4EOMA 3H4JA 3ZEPA 4FKLA 4J1RA 4ZXTA 4EI4A 1LEZA 4KB8A 1VZOA 2WTKB 4R5YA 4QMQA 5EOBA 4ZJIA 2R3GA 4EHEA 4BTJA 4Y72A 4BCJA 4U8ZA 3UNZA 3E7OA 3AGMA 3CY2A 2WKMA 3QTSA 5CXZA 4PWNA 3W2PA 4JI9A 5D10A 5I4NA 3RWQA 3WF5A 4EH9A 2OFVA 2FO0A 4M67A 4W4WA 5CSXA 3KRLA 1KOBA 4AFJA 1YXXA 4U5JA 1UNHA 3ORZA 2VWBA 3ULZA 3F2NA 3PA5A 4QTEA 3I5NA 3QRTA 4ZSEA 3GB2A 3IW6A 2JITA 4FEVA 2H34A 3GBZA 3K2LA 4CMUA 5LVPA 3TUBA 4DGLC 1OUYA 2WMSA 3PJ1A 2J2IB 3T8OA 4XJ0A 3CGFA 4LV8A 3DPKA 4X2NA 5A9UA 2IZUA 5HTBA 4KIKB 3HV5A 4BDHA 5KMMA 4KKHA 4J8MA 1H08A 5FEDA 4BCIA 4BHZA 2PZ5A 4AZTA 3N4TA 3I60A 1URCA 4OAUC 5FBNC 4X0MA 3RTPA 4QP9A 2IVVA 3QTUA 2VWVA 3R8ZA 1BI7A 2XRUA 5J9YA 2G9XA 4TWOA 5T6KA 5LJJA 4O7RA 2X9FA 3NAXA 4O0VA 2HAKA 2YITA 2I6LA 5AR8A 4EBVA 3O7LB 3RALA 3QTRA 1BLXA 3L9NA 2GNLA 4WNPA 2EVAA 4M7IA 3CTHA 3QX4A 4BTFA 1BL7A 3VS6A 4F63A 3QWJA 3A61A 5AMNA 2C6OA 3COMA 3IW5A 3OW3A 4FNZA 4YLJA 4M69A 1QPDA 3KXHA 3ZM4A 4BWPA 3PA3A 3BYOA 3F61A 4IH8A 4C2WA 4F99A 5L8LA 3N4UA 1MUOA 4UV0A 5JZJA 4X6RA 2CDZA 3WF9A 2YM7A 5CEMA 3EB0A 4BZOA 3LFAA 3BKBA 4NW6A 4K2RA 2R4BA 3QL8A 4N6ZA 2QOLA 2WTDA 4XX9A 5F9EA 3VBWA 4MCVA 4UWCA 3W2QA 3KN6A 3BLHA 4NM0A 2GMXA 2PVYA 4N0SA 5HCZA 1UWHA 2PVRA 1ZZ2A 2B53A 3H9OA 3OT3A 2VWWA 3PIXA 4E4MA 2BRGA 3FHIA 2YDIA 4NEUA 5IQIA 4NCTA 3PWYA 3VUMA 4USFA 1OL5A 3PFQA 4YZMA 3FC2A 4RJ6A 2P33A 3IS5A 3JY0A 3QZFA 4CG8A 2BR1A 2YCRA 5M4FA 3ORLA 5HD7A 4FEQA 4RRVA 4I20A 4JVGA 5T3QA 5FDPA 5IA1A 4UZHA 3B2TA 3IDCA 4G2FA 3ZLYA 3MA6A 5KUPA 4KBCA 5JFWA 1CKPA 5IG1A 2JDVA 3FZPA 3GFWA 3PXQA 5IU2A 4DFXE 5LXMA 1REKA 3SRVA 2PVKA 2QLUA 4AAAA 1H1QA 3E63A 2VTLA 4G5JA 4IB3A 2B0QA 3LQ5A 4NFNA 3EQRA 4CKIA 5BX0A 2G2HA 2XS0A 3OZ6A 3ATSA 3PVWA 4X3FB 4W9WA 2CSNA 5K5NA 4XP3A 1J91A 1ZWSA 3G6HA 3HV7A 3OY1A 4FKJA 3C4WA 3MDYA 3FLWA 3AG9A 2VO7A 4FK3A 3R1QA 2ZV8A 3G2FA 4GCJA 5M57A 1V0PA 2ZMCA 4GS6A 2Y4IB 1W0XC 4YTHA 5L4QA 5A4QA 2VWIA 4GL9A 4Z16A 4MBJA 5EW8A 3R9RA 4L44A 2OWBA 2WMBA 4YNOA 4EWQA 5HORA 5CT0A 2A0CX 3TTIA 3OBJA 2Q0BA 2QONA 3OUNB 5M53A 3C5IA 1YQJA 1H28A 4I0SA 3Q96A 4ZTLA 4C34A 3GCVA 4DLIA 3FXWA 2JIUA 4RJ5A 5AA9A 2WQMA 4E6CA 3D7ZA 4OTQA 4PY1A 4X6QC 4M69B 4U41A 5HKMA 4V04A 1PHKA 2JAVA 2YAAA 3FMJA 4G31A 5H3QA 4HCVA 4D2SA 3LXNA 2C6EA 1I44A 1O6KA 2B9HA 2CPKE 1PXJA 3ORNA 5AUWA 3S2PA 4ACCA 4EUUA 4K9YA 4IEBA 4KRCA 4NKSA 3U4UA 2VTHA 3CKXA 3ATTA 3EZVA 1SVHA 4FNWA 5IEXA 3IPHA 3UDBA 5AR7A 4UWBA 4ARKA 4DTKA 3EYGA 2VTNA 4FEUA 4MKCA 3MFSA 3DQWA 3PP1A 4GK3A 3OS3A 2GNFA 3MIAA 5AAEA 5DLSA 2QG5A 2YIYA 4PUZA 3MYGA 1OKVA 3EL7A 1NY3A 4O21A 5E1EA 4FTAA 2HZ0A 2WQNA 4KAOA 3V5QA 4EK5A 3PIYA 4PDOA 4YC6A 4ALVA 4G9CA 3E8EA 3W8QA 3PXYA 3ORKA 5JGDA 3HV3A 4FNYA 3LLTA 2YIXA 3CR0A 3LZBA 2GTMA 4HVIA 5DPVA 1FGKA 3FMDA 4K18A 4V01A 4G3CA 5IQEA 5K3YA 3NX8A 1H01A 2GHGA 5AWMA 3WE8A 5J5SA 4XG7A 5K4IA 4ASXA 1G8AA 4QMOA 1K3AA 4FL2A 1CDKA 2X8IA 1AQ1A 5CY3A 3EN9A 4RGJA 4YHJA 4C33A 2Y4PA 2JBPA 4OT5A 1ZYDA 3AC3A 3MFUA 3OMVA 3D5WA 4CD0A 2VTQA 2Z2WA 3DY7A 3FDNA 3TTJA 2RFDA 3KF4A 5EKNA 5B2MA 4YLLA 4MX9A 2XNGA 4EONA 3ZRMA 1Y57A 4FV2A 2RG6A 3UOJA 2FGIA 3A4PA 4NIFB 1RW8A 2VWZA 2CKQA 3ORXA 3KXXA 4FA2A 4F7JA 2X81A 3NYNA 4LI5A 4CKRA 4U45A 2OJIA 3VUIA 4EHZA 4KSQA 1VEBA 1YI3A 3DLSA 5BYZA 1GOLA 3EZRA 2GNGA 4BZNA 3VWAA 3ZO1A 2IPXA 4C61A 1E1XA 4G3DA 4RA4A 1W84A 3KFAA 5KNJA 1NXKA 4DFLA 4BYIA 2UW7A 5KBRA 2I0VA 4AXAA 2VNWA 4E1ZA 5A4CA 4PPCA 2JIVA 2C3JA 4BCQA 2B55A 4RFMA 3ZBXA 3BLRA 2EB3A 3OTVA 3FMLA 5KX8A 3DFCB 3KB7A 3ALNA 4YZNA 4F09A 4FSWA 5DN3A 2WD1A 4W4XA 5ETFA 1UNLA 3M42A 2Y6MA 5E8ZA 5A46A 3UPZA 3BGZA 4BCNA 5L2QA 3VS2A 2W4JA 3KXGA 3EHAA 4OBQA 4W8EA 4BBFA 4XEYA 1E9HA 3UO6A 5A6OA 3ACKA 3FPQA 5EQEA 3M1SA 3RWPA 3OHTA 2VX3A 2PYWA 4ZTQA 1AGWA 5LVNA 2QCSA 4QNYA 5AA8A 4O83A 5GINE 4BCMA 4KIPA 3I6WA 3G33A 4JS8A 4UALA 2OF2A 2RF9A 3D7TB 2GNHA 2ACXA 2UV2A 4IB1A 4U7ZA 3PPZA 5CALA 4CMTA 1FVRA 1GJOA 1Y6AA 2O2UA 4FT0A 1PMUA 5CASA 5K0XA 5AAFA 4YO4A 2F4JA 3ZTXA 4J95A 5HIEA 1Q8WA 2X8DA 3FXZA 4O7NA 2IZTA 1OI9A 4JX3A 4YPSA 5GIOE 2BKKA 2XEYA 5D7AA 4QTCA 3KCFA 1T46A 3BLQA 3QD2B 4IC8A 3PXRA 5K5XA 4JIAA 3CXWA 2J6MA 4TNBA 2ETMA 2ITVA 4FG9A 4GKIA 4O7LA 4I21A 5ANOA 3GI3A 3BCEA 4LL5A 3TJCA 3F5GA 2PZIA 2OXDA 4DINA 4DG2E 3CBLA 4XRJA 2PVMA 4MVFA 3BE2A 2QU5A 4BCKA 5C4KA 4WG3A 3E93A 5HX8A 3F3ZA 4MTAA 4O0TA 4D58A 2J4ZA 4Q9SA 3NUNA 3CY3A 5CU6A 5LOHA 4R7BA 2YABA 1W82A 2ZV2A 3NVKI 4EOKA 4IM2A 3QQHA 5LMBA 1Q97A 1DI9A 3BZ3A 5TT7A 3RAIA 4AGCA 5ANEA 1JLUE 4LUDA 3HECA 2EWAA 2R7BA 4WA9A 4TWNA 2XJ1A 2JKQA 4G6OA 4DFNA 3KA0A 4Z55A 2CGWA 3CQUA 4AZFA 4FKOA 2X0GA 4EQCA 4II5A 4EJNA 4K33A 3ANRA 2HCKA 3KGAA 1WAKA 3KRRA 3OW4A 4LRKA 5CVHA 1U5QA 4ZIMA 4WNOA 1Q62A 4FGBA 4GT5A 4IVCA 4U3YA 4HYUA 2CKOA 1FQ1B 4FG8A 3O17A 3WI6A 3U6JA 3LIJA 2OICA 3W8LA 1EH4A 4H1JA 5H8GA 4FVQA 3T9IA 3VUDA 3W10A 2W1EA 2F9GA 4FKIA 2WFYA 1JKKA 3QRKA 5F4NA 3G0EA 2PZRA 2ITNA 1Q61A 3GXLA 3KQ7A 2OIDA 5AR2A 4A9YA 4BCHA 4DG0E 5C4LA 2RFEA 2EXEA 4PP7A 2WGJA 2OSCA 3JY9A 4FOCA 4I6QA 4PL4A 4J96A 1ERKA 1YXTA 2ZVAA 4FR4A 2QD9A 4IVAA 3QCXA 3LCDA 3RPOA 4ANLA 1UV5A 2C5OA 1Z5MA 2J0JA 3CTJA 3IDPA 4XG4A 5JRQA 2RFSA 2PWLA 2Z7QA 4FVRA 4QPMA 4BN1A 5CANA 2PE0A 4D2WA 1Z57A 1YOLA 3UIUA 4CFUA 5BNJA 3RMFA 2F7ZE 5FTOA 5TR6A 3DBFA 5CU3A 2YDJA 3Q9ZA 2VTIA 4JDIA 5HOAA 3UVPA 5AUTA 2Q83A 3V5JA 1OBGA 4JBOA 3F2RA 4IAFA 3W33A 3FSKA 1OUKA 2WOUA 3W32A 2WZJA 5AUUA 1UU3A 5DR2A 2VO3A 2BRNA 2PVFA 3BBWA 2DUVA 3Q5IA 2R3OA 2JBOA 1XHAA 3FUPA 4QMPA 4F6SA 5A14A 3DBDA 3AD6A 2PUNA 5M06A 2W4KA 1JSTA 2OKRA 3BGQA 3R6XA 5BVKA 4NM3A 5CVGA 5HEZA 4KBAA 4EOSA 1RQQA 4FT3A 4TN6A 4MXCA 4WT6A 5AIKA 1M2QA 5EM5A 2CNUA 2BVAA 3TV4A 3C1XA 3RGFA 5FQDC 4EK8A 3KREA 5E91A 4A9TA 3EYHA 4OTGA 4K8AA 3DB8A 5M08A 3A7HA 3RAKA 4LFIA 3RK9A 4LRJA 2GHMA 5HG7A 3WZEA 5CQUA 4XP0A 3DXQA 3LJ1A 3VBXA 3D15A 3SOCA 4ERKA 3QHRA 1GZNA 3E7VA 4ALWA 4FUXA 5IEVA 2WQEA 3IDBA 4X2FA 3CTQA 3JPVA 5CSWA 3ZLSA 5HTIA 3BU3A 3JXWA 4MD8E 5FEQA 3TZ8A 2R3FA 4I0TA 2WIPA 2BILB 2CJMA 3IONA 3T3UA 2VTRA 4D2VA 4ZMEA 4J99A 1IR3A 1NVQA 1WZYA 2GHLA 4WRSA 4B0GA 5AR5A 4O82A 3C0HA 1OB3A 2IJMA 4FEXA 1QL6A 5C01A 4C59A 2BRHA 2YFXA 3ODZX 1X8BA 2UW8A 4G3GA 2GU8A 2W96B 3HDNA 2PUUA 4F7SA 3GT8A 4RC3A 2V22A 2V5QA 3GOPA 1F5QA 4FV8A 3GU8A 3JR1A 3QQKA 1XWSA 3BHTA 1KE6A 4OTWA 1STCE 4JOAA 4RJ3A 3ZRKA 3VN9A 2JGZA 3FMEA 2CGVA 5L6PA 2VWXA 3Q9YA 4FSNA 4OBOA 3R9DA 2W9FB 4KUJA 3HLLA 4L3LA 3VUKA 3MY0A 4IXPA 3EKNA 3HMOA 3LHJA 4LMNA 4JRVA 1PXPA 4EOIA 2R3NA 2UUEA 3EQHA 3HX4A 3CCNA 1HCLA 4I41A 2JLDA 4GKHA 4RJ7A 5CF6A 4FTNA 4YC3A 4F65A 4ZLZA 3GC8A 4BI2A 2QG7A 3DKOA 3PPJA 4FYNA 2XK7A 4FZ7A 5EM8A 3TACA 4ZJVA 4FEWA 2BZHB 4TYEA 1UKHA 4LRMA 4BC6A 3SGCA 4HNIA 3Q60A 4FX3A 3FYKX 3VS4A 4OGRA 2ITQA 3QKMA 2YM5A 2JKOA 4JAJA 4O7SA 1K2PA 1XJDA 2VWYA 4RFZA 4D1SA 3ACJA 1J3HA 1GZOA 2QO9A 2VTAA 3KEXA 4FNXA 3VNTA 2C68A 4O0SA 3FMMA 3OXIA 4LL0A 4GU9A 4YSJA 2XM8A 2H6DA 2DYLA 4K11A 4DEAA 1OKZA 2Y9QA 3EWHA 4JBPA 5J8IA 2X6EA 5EDRA 1FPUA 2LGCA 4C36A 4DCEA 3UVRA 4UMPA 2R9SA 3PWDA 5GZ8A 2BDJA 4GFGA 1BMKA 2J50A 4TYHB 5AM7A 1CMKE 3EQBA 4B7TA 1M14A 2ZM1A 5DBXA 3EQFA 4HGSA 3WARA 4TT7A 4HOKA 4NKAA 4CFNA 4NYEA 1LR4A 5EDQA 3TKIA 4JQ8A 2VZ6A 1WCCA 2XJ2A 3KVWA 2XBAA 4KIOA 2C0TA 2X2MA 2YM6A 2VGOA 1H8FA 5D9HA 4IBMA 4KNBA 4NFMA 3WZDA 3FMKA 3RAWA 4XYFA 3C4XA 1V0BA 5ACKA 3I4BA 4F7NA 2CNVA 2GQSA 1FBNA 3KULA 3GUBA 4RC2A 4DGGA 2BALA 4FICA 3PDTA 1MRUA 1PYXA 4EWHA 5GIPE 1GIJA 1OZ1A 3PJ8A 2Y7JA 4G5PA 4ACDA 4LMUA 4YJQA 3VHEA 5I5ZA 2OZOA 3WIGA 2HW6A 4X2GA 1H4LA 3LXPA 3AC2A 4CCBA 4U97A 2QURA 3IKAA 4DBXA 4FIEA 2OZAB 1DAWA 3MA3A 4DLJA 4FSRA 2FB8A 2GTNA 3NNWA 4WNKA 2PVNA 1M2PA 2IN6A 4G17A 4RFYA 4H05A 5D41A 1ZYJA 2HZ4A 4RJ8A 5LVMA 4MXOA 3E8CA 2XRWA 3HV4A 5A4EA 4F9BA 3Q6WA 5HQ0A 4PRJA 3DQXA 3MBLA 4GT4A 2XNBA 4QP3A 5LWMA 3OWPA 1WBVA 4OW8A 1UU7A 5CQWA 3QQGA 4O7TA 2OFUA 2FYSA 3F3VA 3IO7A 3S95A 4CNHA 3PTGA 2XNOA 3KMWA 4AZSA 3Q9WA 2XK4A 3GCPA 1IRKA 1SMHA 3W2SA 4V05A 2B54A 1OIUA 3UBDA 5HE3A 4FBXA 1OL1A 3DDPA 4AZEA 5H8EA 4FTIA 2UW6A 3DKGA 1U59A 4O0XA 3GU7A 2X8EA 3F5XA 4FV0A 4QD6A 4TYHA 4EH8A 3O0GA 3Q52A 3QQFA 5HG5A 3RVGA 5IH5A 4IQ6A 3VS1A 1H27A 2WTWA 3DXPA 2UZLA 2C5VA 4GW8A 2A27A 3A7JA 4QMYA 4IVBA 3DZQA 3DCVA 3P79A 4B4LA 4HYHA 4A7CA 3DU8A 3TZMA 3WZUA 3A62A 3MVHA 4GVJA 3EKKA 2RGPA 3WOWA 1L8TA 3QAME 3AD4A 5EHYA 3SQQA 4KWPA 5HGIA 5DYJA 2VWUA 3L9MA 2FA2A 5FTQA 2WOTA 2YM4A 5CI6A 4HW7A 4EOJA 3I1AA 2J7TA 2HZNA 3Q9XA 3OEZA 4Q5EA 2XB7A 5CZHA 4RSSA 4RZVA 2R64A 3ORPA 4O6LA 3FKLA 3K5VA 2IWIA 1NA7A 4I94A 4QQ5A 4GIIA 4CV8A 3VHKA 2BAJA 4O0YA 5CI7A 3V5WA 4O96A 5CNNA 4N57A 3UVQA 3FI4A 4YJPA 3F82A 4WD5A 4XG3A 3R01A 5HE2A 2G15A 4AT3A 3NIEA 3FI8A 2O3PA 3ZO2A 4QPSA 3BEAA 1OL7A 3FHRA 4D9TA 3P0MA 2OJ9A 2ETKA 4O22A 1DS5A 3G51A 1PMVA 2VAGA 4JDKA 1DM2A 3D83A 4AS0A 2W5AA 2PUPA 4ZK5A 1NVRA 4YUQA 1JOWB 1VR2A 5HNBA 3II5A 4PV0A 3TNIA 3MWUA 3GC7A 4FV3A 4NJDA 4QTAA 3TEIA 2BFYA 3FBVA 3QUDA 4O81A 4W4VA 4BDJA 2BZIB 2AC5A 4L3JA 3TIYA 4ASDA 4GUBA 3ZMMA 4P5QA 3NUXA 1Y8GA 2XIZA 3G9LX 4L45A 2UZVA 4J97A 3LXLA 4DH7A 3TL8A 5AP7A 4PL5A 4N4SA 5KKRC 1B39A 4RA5A 4TYGA 1QPCA 2C3KA 5KKRB 4ALUA 4E26A 3TI1A 2HK5A 2WQOA 5HU3A 2UZWE 4UMTA 4S2ZA 2XK3A 4FTJA 3LFBA 3FY2A 3RPRA 4L52A 4I22A 4AG8A 4XUFA 2XF0A 4AX8A 3RKBA 2YLFA 4IW0A 3FZSA 3PY3A 4OTHA 1YDTE 3UQCA 3VBVA 4IWQA 5KMLA 3QTZA 3PUPA 3EQCA 3R1SA 4X3JA 3CD8A 3TDWA 4H36A 5IQGA 1KV1A 4Y95A 4IJPA 3P7AA 5IDNA 3WILA 3QRIA 4FZAB 4IAAA 3BI6A 5AUXA 2XEZA 4QMLA 4IX4A 3C5UA 3DNDA 1IG1A 2Z02A 2Z60A 4FT7A 3U6HA 4O84A 1JWHA 3MIYA 4W4YA 3L9PA 4HCUA 3OT8A 4OTFA 3QYWA 3RM6A 3PG3A 2BCJA 3U6IA 5BUJA 5B2LA 4ITIA 4CYIA 4BYJA 5J1VA 4LYNA 2ZJWA 2R5TA 3AMYA 4NW5A 3ROCA 1NW1A 3CKWA 3ALOA 3QWKA 5GNKA 4DGOA 3VAPA 3TKUA 3UIBA 2WTJA 3WF8A 2R3LA 5DT4A 2YIQA 2Y4IC 3F5PA 3DTWA 4KSPA 4D2PA 3MVMA 2W99B 4PTGA 2QOBA 4M0ZA 3SLSA 4ANMA 3L8XA 3LJ0A 2YA9A 3SV0A 4QMWA 2OH4A 4BKZA 5IQHA 1QMZA 2O63A 2AYPA 2PPQA 5CF4A 3KVXA 3ZLWA 3UNJA 3PRIA 2ITZA 2Y0AA 3CJGA 5CZIA 3F3WA 4O7WA 1OECA 3OOMA 3D4QA 4Y5HA 4WG4A 5M09A 1F3MC 4LUEA 1YWNA 2WO6A 4MXXA 4EZ7A 3ETAA 4LGHA 3TM0A 5LMKA 5ANKA 4OTRA 4Q2AA 3V8WA 4EK3A 5KMIA 3PZHA 5AAGA 3F88A 3LM5A 4LGDA 2GNJA 3KKVA 4O1OA 3IGOA 2NPQA 4OUCA 4RWJA 2YN8A 4EH3A 4TY1A 3TCPA 4IAIA 1J1CA 5C9CA 4DGNA 4EHGA 1XBBA 3UQFA 1YXSA 3QRJA 2I1MA 2WMRA 3R7GA 1YDSE 3EN6A 4UN0C 3CQWA 4ENYA 4AOIA 3FQEA 5JRSA 2BKZA 3GGFA 2NRYA 2UZEA 4B8LA 2C5XA 3A4OX 2OBJA 1KV2A 3F3UA 3O50A 4XG9A 5HO6A 4C4JA 2IW9A 3UQGA 4PDYA 3MFRA 2BDFA 1OL2A 3OP5A 2C0OA 2XNPA 1MRVA 4EZ5A 4A9SA 1TVOA 2C30A 2GS7A 3ITZA 4C0TA 4Y73A 1YWVA 3PP0A 1J7LA 3E8NA 4F6UA 4EZ3A 1R78A 5CTPA 1I09A 3BHYA 1QPJA 2HY0A 2ITWA 4JNWA 2FUMA 5TKDA 3DT1A 5IQDA 1XH6A 4I23A 2PSQA 1Q99A 5E8XA 4MXYA 3SXFA 4EOLA 2A2AA 3ROYA 4TYJA 4FVPA 1H0WA 3PIZA 3FLNC 2WEIA 2QKWB 4S34A 4APCA 4O38A 5JGBA 4BDBA 2YM3A 5ANJA 3MTLA 3BPRA 3P1AA 3R1YA 4S30A 3ELJA 3V6RA 4AE9A 3R7VA 4BBEA 2XBJA 3RNYA 2W06A 3NUYA 5KZIA 2QHNA 2V55A 2J9MA 4BCOA 3PLSA 4Z9LA 2I40A 2F7EE 1V0OA 5J87A 3TZ9A 4AUAA 2VTOA 4U6RA 1URWA 3C51A 1OBDA 4F0GA 4CZTA 2VX1A 2YHVA 4R7IA 1H26A 3LMHA 2C69A 4NCTC 3OCSA 4JG6A 3GCSA 4L46A 4I5PA 2BIYA 2UZDA 3ZS5A 1SYKA 4NSTA 2VUWA 2YDKA 4JR3A 2OJJA 4C4HA 4CT2A 3U9CA 2EUFB 4E4NA 3TN8A 3CE3A 3OFMA 3QBNA 4FTRA 3PVBA 4H39A 3QU0A 3P7BA 4YJVA 4L6QA 4D55A 2RFNA 3N9XA 4UZDA 3PJ2A 3LPBA 3QKLA 3LVPA 3T9TA 1U5RA 3OC1A 2J0IA 5F95A 2XYNA 2C6MA 5AP1A 3AMBA 2WMVA 3U54A 3UJGA 3CC6A 4F6WA 1KE5A 3ZFYA 5ANIA 4XV3A 4EC9A 3AC5A 4A9RA 4APPA 5HLWA 4WG5A 4I6FA 3UNKA 1IA8A 3HV6A 3MJ2A 2AUHA 5CX9A 4UMRA 4ZS4A 3QTXA 2ZB0A 1GY3A 5AIRA 5EYCA 4O91A 3FQHA 1XR1A 4RIXA 3TNPC 4ACMA 4AW1A 4YJOA 4HGEA 5HICA 4FZFB 4FT5A 4LOOA 5KHWA 2XKDA 2XCKA 4IZ7A 4L8MA 5D11A 4XG2A 5EQPA 4H3PA 1BUHA 1ZXEA 3QA0A 4YJNA 3HA6A 3ZO4A 4YURA 1Y8YA 3G5DA 4BBMA 1XH8A 4XNEA 1MRYA 5HNGA 4TWCA 4B99A 5DOSA 4RIWA 5J5TA 1PRYA 2QOCA 1R0PA 4PX6A 2Y8OA 1ZOGA 5E4HA 4RIWB 3TV6A 3ZLXA 4EOQA 5CU0A 4C38A 3PPKA 2BROA 4I92A 2R3PA 4JDJA 5FRIA 3W1FA 3QALE 2XNEA 4MK0A 3FSFA 3VW8A 4DFBA 3RPSA 3CSVA 4WUNA 3HUCA 3RPYA 3GOKA 4FV5A 4K77A 4A07A 5FEEA 4YMJA 4TNDA 3RCJA 3TNHA 2WTCA 2I0HA 3SW7A 2WU6A 4UXQA 4BGGA 3M11A 4CV9A 4I0RA 3HKOA 5IQCA 4TXCA 2VGPA 2YWPA 1YXUA 3VVHA 2W05A 2DWBA 4DGMA 4O86A 1OIQA 4ZSGA 1OPKA 4IZ5A 1JVPP 4ZZOA 3PG1A 4NM7A 2PU8A 1H25A 4L01A 4YBKA 4CRSA 4FSQA 3ZC6A 4BVUA 2WAJA 3DKFA 3QQUA 3Q2JA 3FE3A 1ZY5A 2C3LA 3QFVA 3UZPA 2PMOX 2W1IA 4RG0A 3G0FA 4RX5A 2O64A 4M15A 2QU6A 3ZXZA 2C6KA 1ZYCA 5D1JA 4X21A 5AP4A 5AV1A 4I1ZA 3R8PA 5K4JA 3MV5A 2H96A 2BPMA 1S9JA 2V7OA 5LMKC 4I6HA 4QYEA 4OTDA 5EG3A 4Z3VA 2B9IA 2OG8A 2E2BA 2QOIA 4PL3A 4QRCA 3NEWA 4ZTRA 4GFOA 4O2ZA 1VJYA 3UO4A 4GIHA 4C4GA 4ZS0A 2WMWA 4FSZA 4N70A 2OI4X 4EK6A 4UYNA 3TUCA 4DH1A 2BMCA 3A99A 5FXSA 2HOGA 2SRCA 4I4FA 3SXSA 4ZJJA 3WIKA 3WYYA 4CGAA 5M07A 3LCOA 3NR9A 2XYUA 3BQCA 4PDSA 5HX6A 5EKOA 3UPXA 3GQIA 1Q8TA 5AM6A 2GDOA 2BZKB 3GU6A 3PE2A 2QNJA 1PKDA 2X7GA 2ZV9A 4FIFA 4GMYA 4D1ZA 1ZMWA 4YTCA 3P86A 4YJRA 2JDSA 4AACA 3OXZA 4C57A 5IMXA 1SM2A 2I7QA 3GP0A 4G34A 4DEGA 3JVSA 3SHEA 3B8RA 3R28A 4CYJA 3F9NA 4FTTA 4MQ2A 4RQVA 3CIKA 3BU6A 2B4SB 2DS1A 3OBGA 4FTLA 4ITHA 3GNIB 5LWNA 5F20A 1ZOHA 3BWFA 4YZBA 3WYXA 1WBNA 3NDMA 2VTJA 5BMMA 2RG5A 1Q8UA 2BDWA 2G01A 4TRLA 3C4EA 2XP2A 3LM0A 2QOFA 3Q4UA 4JDHA 2X9EA 3DB6A 4K1BA 5AP3A 2XJ0A 4FF8A 5GJFA 4IACA 3FAAA 4UMQA 4BFMA 3VS5A 3LMGA 1Q24A 4V0GA 3NYXA 5JKGA 5IQFA 3SRVB 3UIMA 5I3RA 1BL6A 2F2UA 3EL8A 3RPVA 3FPMA 3KMUA 3R30A 3I0OA 3C0GA 4ZOGA 3VC4A 3LCKA 2YIRA 4AZVA 4IIRA 4XOZA 3R02A 2QR8A 1IASA 4U0IA 3GQLA 4DFZE 1YI4A 3P08A 3EQPA 4CFFA 4BIDA 4O7VA 3MB7A 1WBOA 2BHEA 1UWJA 1XO2B 2Z8CA 3LJ2A 4OTPA 1WMKA 2O0UA 4FK6A 4CVAA 2Z7SA 5A4LA 2IW6A 3PVGA 4FMQA 1PXIA 5JFXA 4YZCA 5FLFA 2W1FA 3WZJA 4CFVA 4FKPA 1MQBA 4D5HA 4PMTA 1PJKA 1PXNA 5A54A 4D0XA 4GJ3A 3FLZA 4JRNA 4P7EA 4BKJA 4O0WA 5JH6A 2XIYA 2JFLA 3NYVA 5BVFA 4RWKA 4EORA 4XRLA 3ORIA 4XBRA 4EYJA 3D0EA 3KU2A 4U44A 3FLSA 5HNIX 5D7VA 1OPLA 5L2TA 2VRXA 2QR7A 3LXKA 5CAVA 3E62A 3D2KA 1U46A 4RLLA 5I3OA 3TWJA 4ENXA 4TW9A 5A3XA 4F4PA 3EQDA 2J51A 3UC3A 4KKEA 1UKIA 3LW0A 4HYSA 1YI6A 3MTFA 3BQRA 3ZCLA 3UYSA 5I9VA 3EFWA 4MWIA 5AX3A 4FIIA 5TF9A 1VYZA 5KMOA 3CPCA 3O2MA 4IE9A 1XH9A 3VBTA 3I6UA 2QOQA 3ET7A 4OBPA 4MYGA 5DFPA 1XH4A 4U81A 3SOAA 3ZH8A 4M14A 3OXTA 3NUSA 5L2WA 1YW2A 1H1RA 2GSFA 2OK1A 3I5ZA 4IZYA 3FYJX 3EH9A 4C35A 3NIZA 1YDRE 3BGPA 4E6AA 2C1BA 1CKJA 2PUIA 3LAUA 3MY5A 3W2CA 2J0MB 4BL1A 4YZDA 4YP8A 4L7FA 5DT0A 3ENHA 5AV3A 4DC2A 2WU7A 4F1TA 4FTOA 3JYAA 4AQCA 5I9ZA 2B52A 2FSOX 1OVEA 2W1ZA 3DK3A 3IQ7A 3RZFA 4KS8A 5KO1A 4RIXB 5FM3A 4Z7GA 2OIBA 1JBPE 4QQJA 2GQGA 5CF5A 5ANGA 1SVEA 4H1MA 4HYIA 5JGAA 5DNRA 3RCDA 4DT8A 5IA4A 3ID6C 2EXCX 3O23A 3V3VA 3NCGA 4E4LA 3TJDA 5FP5A 5ITAA 5DT3A 4EUTA 5ETAA 4FV7A 4F1MA 2PMIA 3FLQA 3KK9A 4M8TA 4UWYA 3RK5A 2YZLA 3O8TA 3MI9A 3SG9A 3C13A 1Q8ZA 2O65A 2WMTA 2Z7RA 1LP4A 2X2LA 4WSQA 5E8YA 5H2UA 4CFMA 5M4IA 4TPTA 2QC6A 3QCYA 5DIAA 4XV2A 3DLZA 4FTMA 4FKRA 4C58A 3DBCA 2WEVA 3F66A 3UOHA 4QYYA 5I9XA 4WO5A 2PE2A 4BDAA 4QMXA 1R39A 3OVVA 5AR3A 4M66A 2QODA 3HMMA 2ITTA 4UXLA 3CLYA 4FT9A 4JBVA 4AZWA 2QHMA 4EC8A 5BUIA 3FI3A 2A4LA 2PMNX 2PZYA 2WXVA 3COKA 3ZEWA 4E4XA 3PSBA 3V04A 4RVLA 5DE2A 4BI0A 4O7YA 1XBAA 3V6SA 4QOXA 4MF0A 4UEUA 5BQ0A 2VN9A 1GZKA 1RE8A 3CGOA 3VUTA 4ASEA 3QD0A 1FGIA 5IUIA 4IFCA 4FV6A 4GSBA 4G3FA 3SA0A 2YEXA 4GH2A 5CEIA 3SXRA 2W5HA 3ZZWA 2YAKA 3K3JA 4MWHA 4MAOA 3RK7A 1U54B 3VQUA 5IA2A 3B2WA 1KUTA 2X2KA 3PSDA 5LQFA 3NMUF 3FKOA 4QP2A 2FSTX 1CTPE 4QMVA 4XS2A 3U8WA 4AE6A 3D7TA 1M52A 3QLFA 3V8SA 2ERKA 3KRWA 4NZWB 4FE2A 3U55A 5A4TA 5KMNA 5AFVA 4ZZNA 4DTAA 2NNWB 3NCZA 3NWWA 5AX9A 4R3PA 4RX7A 5JT2A 5C27A 4A4XA 1YOMA 5JSMA 4U80A 3EIDA 3PXKA 5DG5A 4AA4A 2FH9A 2XH5A 3R21A 2X4ZA 3UG2A 5JFVA 3BYSA 4FG7A 3R9HA 3NUUA 4YPDA 3U9NA 5GJGA 4FV4A 1E1VA 3DOGA 3ORMA 4LG4A 2UZOA 3C9WA 3DFAA 4F9YA 4H58A 4JLCA 4U43A 4XBUA 3MH3A 4QO9A 4DN5A 2WQBA 4KS7A 4DEEA 3FEGA 4FI1A 3IW7A 5B2KA 3ZUVA 4CXAA 4JR7A 3COHA 5HE1A 3E3BX 5HO8A 4HVGA 5EK7A 4D4VA 4C3PA 4I93A 3OY3A 3QTIA 3KXNA 1YHVA 4CQEA 3AOXA 4DH5A 4EL9A 4JJRA 4E6QA 5BMSA 2CCIA 4PPBA 3C7QA 3C50A 1PYEA 2WHBA 3NNVA 4UYAA 5L6OA 4GUEA 4QMSA 4QP7A 3LFQA 1ATPE 3NW5A 2C47A 4XLIA 3WF6A 1JSUA 2UVZA 4JQEA 4L53A 5CAPA 3PXZA 4O1PA 4GRBA 3RI1A 2P55A 4P4CA 1TKIA 4IAZA 2H9VA 2ZV7A 3UIXA 4AOJA 1QCFA 1JPAA 2PTKA 4MXAA 3SC1A 1P5EA 5BYLA 4ZTNA 3H0ZA 5J1WA 5EI8A 5HD4A 3EMGA 1YKRA 4A4OA 3ZFXA 2Z7LA 3RP9A 2WMQA 5HG9A 3VIDA 1WFCA 4ANBA 3UG1A 4D2TA 4IC7A 4GVAA 4KRDA 4BRXA 2WIHA 4MXZA 1IAHA 1O6YA 3F2AA 4R77A 2IVUA 4BWXA 4J53A 4IHPA 3BRBA 3E5AA 4GJ2A 4QNAA 1FVTA 3R1NA 5J7HA 3O8PA 2C5YA 1OM1A 1MQ4A 2F49A 2CNQA 5B7VA 5E7RA 4B6LA 3QC4A 1QPEA 3DK7A 1R1WA 4RBLA 2QO2A 3QC9A 2JIIA 1ZLTA 2A1AB 3TT0A 2W5BA 3OG7A 2HELA 2ZM3A 3FI2A 2YISA 3M2WA 3HUBA 4FSMA 2CKPA 1KSWA 3GC9A 3HRCA 1Q8YA 2GS2A 3GFEA 3KC3A 4IMYA 4J8NA 2PE1A 5KBQA 3BYVA 4FODA 3MH2A 4BCFA 2XA4A 3AT2A 2W9ZB 3HZTA 5CEKA 4R6VA 4R78A 4ANOA 5E90A 5HVYA 3R7OA 2OXYA 3ZHPC 2J0KA 2YACA 2IO6A 3R7EA 3O96A 2E9UA 3A2CA 4R8QA 4XMOA 3SW4A 4A9UA 4R3CA 4LM5A 2QVSE 4PPAA 5BVOA 4OTIA 2XIXA 1TQPA 3VQHA 5FXQA 4IX5A 5DI1A 4CLJA 3BHUA 3QRUA 3P5KA 1Q3DA 3AMAA 3Q32A 4AGUA 3A60A 2XKCA 2OW3A 3DS6A 4MNEB 3PYYA 3GC0A 5C03A 3Q3BA 3D14A 2GFSA 3E64A 4I24A 4IX3A 5E8VA 3KY2A 2OGVA 2X7OA 5L6WL 5FP6A 3OOGA 4IVDA 4E20A 5JN2A 2VTMA 1A48A 1IAJA 3HYHA 4MH7A 2P2HA 4RVMA 4F08A 2F57A 3EFLA 4YHFA 3L1SA 2XNNA 3LOKA 1W7HA 3P78A 5EFQA 4BIBA 4CZYB 4RMZA 4DAWA 3HL7A 5IH4A 4O0RA 2BFXA 3OCGA 5FBOA 2JDRA 1V1KA 5ANDA 1M17A 1A9UA 2IVTA 3BV3A 3DXNA 3KXZA 4DYMA 4O0UA 2UW3A 1Y91A 4L7SA 2WTVA 3NGAA 4AFEA 1KE8A 1Z9XA 3LFEA 4IJ9A 4D4RA 3LQ8A 3H3CA 4QQTA 3TDVA 2OO8X 3L9LA 3IOPA 4NU1A 1XH7A 3UO5A 3BELA 4FZDB 3HA8A 4FC0A 4QMUA 2YJSA 4BZDA 2WMAA 4F7LA 3P7CA 3IW8A 4NJ3A 5C8MA 2IG7A 4JG7A 2CGUA 3NNUA 4QP1A 2V62A 4ZSJA 4F9AA 2JAMA 2GNIA 5E1SA 3EQGA 2HWOA 3ANQA 1NT2A 1H07A 3A7FA 4IDTA 1G8SA 2BRMA 4YO6A 2YWVA 3VS3A 2ONLC 2YCSA 4YNEA 4TL0A 4BGQA 4O6EA 5BPYA 4JT3A 3K3IA 4FTCA 1AD5A 2ITUA 2NRUA 3OTUA 4YLKA 1NVSA 3MFTA 4ACGA 3IECA 5IQBA 3D5VA 2ZB1A 2RKUA 4DFUA 5JQ5A 4HCTA 4C37A 1P4OA 5M51A 5AP5A 4O7ZA 4EH6A 3AQVA 3OROA 3Q4ZA 3P9JA 3ULIA 3LFDA 4WOVA 5HLPA 3UP2A 1OL6A 2YCFA 3TUDA 1KE9A 1ZARA 2YJRA 4LOQA 3RJCA 4S33A 2UZNA 4E3CA 3A7IA 5EM6A 3HP2A 4K6ZA 2EB2A 2UW4A 4FKWA 1APME 3GCQA 4GU6A 4QYHA 2AC3A 4ZY5A 5JK3A 1ZYSA 2X39A 4EYMA 3HAVA 2C6IA 1WBSA 3SG8A 3DTCA 2VU3A 3QGYA 4G6LA 4MBLA 4E5AX 4YSMA 2I0YA 4MHAA 3FMNA 5DH3A 1OMWA 3QHWA 4FIGA 2IZSA 3RAHA 1P4FA 4NK9A 1JKTA 1JKLA 2XM9A 3HRFA 4M84A 4I5HA 4R5SA 3P23A 5G1XA 5HE0A 3RM7A 3UMWA 3VUHA 5GJDA 2XK6A 4CMOA 4E6DA 4ZLYA 2B9FA 2XVDA 5CAUA 3Q5ZA 4M0YA 1HCKA 5HLNA 4X2JA 4LQMA 4RX9A 1Q3WA 4LOPA 4XP2A 5DA3A 2PZPA 2QLQA 5BVEA 1DI8A 5DR6A 3RBWA 4WIHA 2ZM4A 4PDPA 2ITYA 5F1ZA 2FSLX 4C4FA 1RDQE 3A8WA 4RT7A 3HMPA 4N6YA 4M13A 2OXXA 3CD3A 4NIFA 4Y46A 5IF1A 2R3MA 3FY0A 2H8HA 3DA6A 1KOAA 3QTQA 4IAKA 4YBJA 2ZDUA 3NVMB 2REIA 1KWPA 1OIYA 1LPUA 1RJBA 4IM3A 2CCHA 4BKYA 4L00A 2BUJA 1H1PA 3U87A 3ZZEA 4C4EA 1SZMA 3FMHA 5IUGA 2WTKC 4NUSA 4I5CA 2W1CA 3MW1A 3ZYAA 2X1NA 3QUEA 3G15A 4C3RA 3QCQA 2G1TA 1WVXA 2HW7A 1JQHA 4P90A 4BICA 5A6NA 4BDDA 2YLEA 4CTBA 3DNEA 2R3QA 1YRPA 2PVJA 4CZUA 2OLCA 2ESMA 1Y6BA 4ANNA 2F7XE 2A19B 5CU2A 1OGUA 1JNKA 2R3IA 3VUGA 4FSYA 4WSYA 3O8UA 4XG8A 2UW0A 4RIYB 2XZSA 5CEPA 4TZRA 3IK3A 5J9LA 5C8NA 4FSTA 2UZUE 1B38A 1UNGA 3CEKA 3GU4A 3E92A 3OWLA 4GK4A 3TNQB 5BVNA 4BGHA 5HU9A 1WBPA 2C3IB 3A8XA 4FL1A 3QLGA 4GV1A 5EOLA 1FMOE 4C4IA 2ITXA 4UMUA 5BUEA 1L3RE 3OCTA 3FKNA 4RPVA 2OJGA 3DAKA 3NUPA 3OEFX 3RINA 5EQYA 5KZ0A 5C1QB 3ZRLA 3NZ0A 5I9YA 4XG6A 5AV4A 1K9AA 2QOKA 1HOWA 3NAYA 5E92A 4DT9A 2E9PA 3O51A 4RZWA 1JSVA 3QGWA 5IEYA 5TE0A 5EI2A 1OITA 4QYFA 4NTSA 5IA3A 4QQCA 1OKWA 2JD5A 2VX0A 2R3HA 5LCKA 3H10A 3DBEA 4PNIA 5LCJA 1REJA 3UOKA 4BHNA 3FZRA 1S9IA 1YXVA 3A7GA 3NW7A 1CKIA 5LVOA 2NP8A 5FWKK 5L8JA 5M55A 4CRLA 5FGKA 3DAEA 3HP5A 5HTCA 3ZONA 3DBQA 3OD6X 4RIOA 4ZTSA 5HBJA 3FZTA 5ACBC 3C0IA 3MH1A 1M7QA 4HPTE 3R8LA 3S0OA 5DGZA 3VS0A 1DAYA 3D2IA 1Q41A 2VO6A 4DE4A 1UVRA 5HVJA 2R3RA 2HWPA 3ZFMA 1PXKA 5CWZA 2ERZE 2W1DA 4QTDA 3HEGA 1PXOA 3HDMA 3H9RA 3E87A 3G90X 4AP7A 4E7WA 3MB6A 4ZTMA 2KTYA 3BYUA 3QZIA 4IANA 4DCAA 5M4CA 2IVSA 3EFKA 4BDIA 3UZRA 1UA2A 4AU8A 2UW5A 3E88A 4X3FA 5T68A 3ENMA 3FLYA 4I3ZA 3BX5A 3KRJA 2JEDA 5K9IA 1CSNA 2XIKA 5CVFA 1ZMUA 5KMJA 1WVWA 3ZDIA 1ZZLA 2HYYA 3LFSA 5CU4A 2JC6A 4FTKA 4L9IA 4YHTA 4ZP5A 3CS9A 4FV1A 3SDJA 5HCXA 3IW4A 3UC4A 5L8KA 3IOKA 4CTCA 2ITPA 4DEBA 5EDPA 3LFCA 2G2IA 3VBQA 1GZ8A 2O5KA 1SNXA 3GCUA 4I6BA 3TV7A 4KBKA 1CM8A 4XHKB 5CXHA 2PVLA 4CFWA 2UZBA 4AT5A 3TKHA 2CLXA 3GENA 3VRYA 4OR5A 4MEDA 3PSCA 4WHZA 4BDCA 4NWMA 3U4WA 2P3GX 3DK6A 2VTPA 3ZDUA 4BI1A 4V0GB 4C02A 4EOPA 3QTWA 4YC8A 4YU2A 5HZNA 3LKMA 4JL9A 3NNXA 4BF2A 1OPJA 1PMEA 4DG3E 5DEYA 3UMXA 4ORKA 2E9OA 1LEWA 3FWQA 2XMYA 1PY5A 5AV2A 1FOTA 2ZOQA 5H9BA 3R7IA 5DR9A 3FL4A 4BTMA 3OF0A 3NSZA 5DEWA 4D1XA 4E93A 3FZ1A 2WTIA 3PE1A 4HGTA 4JBQA 5ICPA 2PULA 5IUHA 2J5EA 2V7AA 3HMNA 4BCGA 3AC4A 4D28A 3WF7A 4TKSA 2VTSA 2X7FA 4BY9E 3R22A 3I7CA 2QI8A 3TG1A 1BKXA 4C62A 4F70A 5BVDA 3W18A 4RLKA 5EHOA 4AW5A 2IZRA 4U40A 2BIKB 1KE7A 2XK8A 5FDXA 2UVXA 3DAJA 3BU5A 4HJOA 4IFGA 1R0EA 3DJ7A 4J98A 3ZO3A 4I5MA 2WMUA 2C5NA 4MNEA 2BAKA 4XH6A 3DDQA 5FD2A 4H3QA 4M12A 3PRFA 4PMMA 3R00A 5IISA 5D12A 3VO3A 4GYGA 5AP2A 3VBYA 2QOOA 4ZLOA 2J5FA 3QXOA 4J52A 3SVVA 4FUYA 2CMWA 2CN5A 4RX8A 4NH1A 4IB0A 2VTTA 2V0DA 4XOYA 5TO8A 2WMXA 3P4KA 3QKKA 4IDVA 4UB7A 3ORTA 5HG8A 4YJUA 3OWKA 4HVHA 4PTCA 4DBNA 1TQIA 4IADA 2PY3A 5HBHA 5GZAA 2PK9A 4ONAA 3DGKA 3LMIA 1M2RA 3MY1A 4EH2A 4PQNA 3NW6A 4IB5A 4W9XA 3QZGA 4HVDA 5ETCA 1PF8A 4JAIA 2ZMDA 4ID7A 3KK8A 2B7AA 4X3FC 4XCUA 1F0QA 3V5TA 1IA9A 4KKGA 4ZSAA 3BE9A 5FM2A 3Q4CA 4O27B 4OT6A 4C8BA 4OLIA 4G3EA 4GEOA 3UE4A 1YWRA 3QUPA 2YZAA 4PMSA 3CPBA 2JDTA 5CLPA 2E9NA 4GYIA 4MD7E 3NUAA 3HRBA 4GG7A 4BB4A 3R8MA 3LLAA 5JEBA 5AR4A 5HIDA 2YCQA 4EH5A 4C2VA 4NL0A 1O9UA 4J7BA 5JMSA 3BYMA 4JXFA 1ZAOA 4QYGA 3F6XA 1UU9A 3R8UA 1H1WA 4AF3A 2BTSA 1YVJA 2JFMA 4HPUE 5CEOA 2OF4A 5AV0A 3RNIA 2P2IA 2CKEA 3NS9A 4MBIA 4R1YA 4AWIA 3PA4A 4DH8A 4QMNA 4M3QA 2GPHA 5I9WA 2BRBA 2O8YA 2XUUA 3FXXA 3I79A 3UOLA 4CQGA 1R3CA 5KCVA 2HY81 3NYOA 4RWIA 3O71A 1PMNA 4PF4A 5EH0A 4FKVA 3VJNA 4MQ1A 4C3FA 5DRBA 3NLBA 4CCUA 1M7NA 5E8TA 3FQSA 4HGLA 3THBA 3B8QA 3K5UA 1LUFA 5AP6A 4TYIA 4GG5A 1B6CB 2R7IA 3PVUA 4P5ZA 4DTBA 5AADA 4RVKA 2ONLA 3C4FA 4EH7A 1GIHA 3EQIA 4KD1A 3JUHA 3QQJA 3U51A 4D2RA 4L43A 4NTTA 2YM8A 3SAYA 4D4SA 3S00A 3DJ5A 2IW8A 2P4IA 5L3AA 3N51A 4GFMA 2ETRA 2QKRA 4TWPA 3CQEA 4E5WA 4MD9E 4K0YA 4XV9A 5H8BA 4IAYA 1G5SA 3LFFA 3EJ1A 3KULB 5M4UA 5K0KA 4EKKA 5BVWA 2ZDTA 5JQ8A 2PMLX 1WBTA 1IEPA 4LV5A 2B1PA 1W83A 4UBAA 1BX6A 1W8CA 3GVUA 4ERWA 4MF1A 2R2PA 4XLVA 4DITA 2RIOA 2XIRA 5TOZA 1J7IA 4YGAA 1XKKA 5IDPA 3ZU7A 2E9VA 3E3PA 3I0QA 3Q04A 4EKLA 4FSUA 4YJTA 3E8DA 4TTHB 3R04A 3VF8A 4CKJA 3O7LD 4BDFA 2OU7A 2QOHA 3DZOA 3QZHA 4Q9ZA 5F94A 2BAQA 4ANSA 4OAVB 4FKQA 3H0YA 4H3BA 4AA0A 4HVSA 2XK9A 4RWLA 1PXMA 4L68A 4AN2A 5DWRA 5DHJA 4JIKA 3IGGA 4CFXA 3VF9A 4FOBA 5LARA 4KA3A 4E8AA 3H9FA 3HVCA 3FL5A 4O2PA 4IWOA 2XCHA 3OWJA 4U3ZA 4MNFA 2HZIA 3KCKA 4IM0A 1H0VA 4NM5A 2J90A 5AP0A 3UZTA 3L8PA 3V5PA 5CF8A 2XKFA 4Y5QA 3VRZA 2GCDA 3VS7A 3BHVA 4CLIA 2C6TA 3W55A 3DJ6A 3BV2A 3R8VA 1XBCA 4F0IA 1ZMVA 5CSHA 2X4FA 4QP4A 2DQ7X 4S32A 4U9AA 4Q5HA 1ZY4A 2UVYA 4USDA 5EW9A 3KMMA 3W2RA 5L2IA 5DMZA 2ITOA 4YR8A 3UP7A 5E8WA 5AUVA 3R7YA 2C4GA 3UTOA 2R3JA 3AD5A 5M44A 4KIKA 3LCSA 3MPMA 4AW0A 3PY0A 4BTKA 2PVHA 4QTBA 1Q5KA 1G3NA 4FV9A 4ZEGA 3AT3A 2W7XA 4B9DA 4KIQA 5FG8A 1BI8A 5HESA 3R7UA 3VW6A 3MESA 4ZSLA 3QQLA 3ZSIA 4FTQA 4FYOA 4WBBB 3D5UA 5EI6A 3QX2A 4DEDA 4G1WA 2OH0E 4WNMA 3QA8A 4D4YA 5HHWA 4FKTA 2C0IA 4JQ7A 3L8SA 5CSPA 1PW2A 5E9EA 2EXMA 5FUTA 3LFNA 3EFJA 1PXLA 1FINA 3TIZA 3MVJA 4D0WA 2HXQA 2CHLA 2CGXA 3MJ1A 3MS9A 4RC4A 3ZSGA 4RQKA 1OKYA 4U42A 4DA5A 2W17A 2VV9A 2VNYA 3F7WA 3Q4TA 4I4EA 4YTFA 3TXOA 2JKKA 4X7QA 3PJCA 4PTEA 3AXWA 1WBWA 4BDGA 3W16A 4Z7HA 5I9UA 3MPTA 2PL0A 4EHVA 3HNGA 5CT7A 5EYDA 4E5BA 4HZRA 3Q2MA 4HNFA 3QCSA 4YZ9A 4HZSA 4F1OA 4CT1A 2OJFE 5CENA 5HVKA 2UZTA 5EYKA 3PZEA 1H1SA 4FZ6A 4R7HA 2R0IA 5ETIA 5AUYA 4IWPA 3T3VA 4FL3A 4ASZA 3POZA 4FKGA 1J7UA 2WELA 4ANQA 4LGGA 1TQMA 2R3KA 4CSVA 4D5KA 2R0UA 2RL5A 2EU9A 3JS2A 3KRXA 3R2BA 5GHVA 2C1AA 3SX9A 5CYIA 3PJ3A 2WPAA 5CNOA 4F9WA 3C4CA 4BIEA 3FJQE 4R3RA 4G6NA 4JG8A 3V01A 4ZY6A 2PHKA 2W0JA 5FXRA 5L2SA 3HGKA 4DF3A 1XH5A 3QD4A 3BWJA 2W4OA 3TZ7A 3L8VA 1XQZA 3C4ZA 2Y6OA 2XKEA 3ERKA 3I81A 1Q4LA 3F7ZA 3G6GA 3R2YA 3ZUTA 3LQ3A 3WBLA 3JVRA 3WZKA 5CAOA 3COIA 4PP9A 5J79A 4EBWA 2YERA 5HCYA 4WRGA 4DH3A 4P2KA 5EYMA 4DFYA 5EM7A 4FKSA 5KMKA 4AA5A 1FMKA 3N4VA 3KF7A 3PLAE 2Q0NA 3KXMA 4CEGA 1O6LA 4W8DA 5CSVA 1W98A 4DHFA 2X6DA 2KULA 3GU5A 4AGDA 5HIBA 5IQAA 5EW3A 3LE6A 4L67A 1U4DA 2VO0A 3BHHA 4AOTA 2I0EA 3H30A 1JKSA 3BEGA 3POOA 5HBEA 1GNGA 3ZOSA 1MP8A 1YHWA 4S31A 3W2OA 1T45A 4FIHA 4BCPA 3ZSHA 1FVVA 5IH6A 1OIRA 4C7TA 3ZBFA 3ZXTA 3R9OA 4ZAUA 3HAMA 3K54A 4AN9A 1A06A 4BDKA 4F0FA 5JZNA 2B9JA 4Y8DA 4RIYA 4DEHA 4BWKA 3Q53A 4FKUA 3QYZA 3RHXA 4QMZA 2JDOA 5AJQA 4AW2A 3CP9A 4Y83A 3V5LA 4ACHA 5M56A 1ZOEA 4L42A 2ZYBA 4ZZMA 3R9NA 4D9UA 3DV3A 4YTIA 3V51A 3R63A
chains in the Genus database with same CATH superfamily
4KABA 4EQUA 2UW9A 3AT4A 5FTGA 4AXCA 3S4QA 3MN3A 2C6LA 5KE0A 4RJ4A 5CAQA 2BTRA 3R73A 3AC1A 3GEQA 4M97A 4QMMA 4B8MA 4XV1A 3F69A 5IKWA 1J1BA 5I0BA 4ZMFA 1YOJA 5DRDA 3D5XA 3G9NA 4J71A 5LMAA 4GK2A 3V8TA 4G9RA 1SVGA 2FVDA 3VULA 1GIIA 1WVYA 2BHHA 3D94A 4QP6A 3MVLA 3S1HA 4WUAA 3FC1X 3RHKA 3F5UA 4F9CA 3CJFA 4R1VA 1P2AA 3D9VA 3PY1A 1BYGA 2YIWA 4AGWA 1GAGA 4AT4A 4EOOA 3MPAA 3QXPA 4U79A 5LVLA 3UODA 2P0CA 1ND4A 4EJ7A 2F2CB 5C26A 3VJOA 5C8KA 4ITJA 4JX7A 4QP8A 3EN7A 3QF9A 1ZYLA 5E8SA 2W1GA 2HIWA 3AC8A 4IZAA 4WKQA 4A06A 3BBTB 4WBOA 5DVRA 5HO7A 1OGYA 4USEA 3EOCA 3MH0A 4EK4A 2NO3A 5AUZA 2WNTA 4RVTA 3UGCA 5JFSA 5J7BA 1ZRZA 3REPA 4PNKA 3KN5A 1SNUA 4M68A 5IA0A 3DKCA 4FGRA 2QQ7A 4QPAA 3FZOA 3IG7A 3EN5A 2G2FA 2RSVA 3UDZA 3PXFA 3MGYA 3ODYX 2XNMA 4CG9A 3NPCA 1JAMA 5AEPA 2JKMA 4EEVA 4UY9A 3SD0A 4F64A 3W0MA 3R83A 2J0LA 4BDEA 3HMIA 3MSSA 4EH4A 5IZFA 4E73A 4ZTHA 5KHXA 2GS6A 4AN3A 1YHSA 2CLQA 5IA5A 5GZ9A 3ZC5A 4NT4A 3ZM9A 2HXLA 2VD5A 3OUKA 4L3PA 4G16A 4KINA 3AGLA 5B0XA 1H24A 3I7BA 5IPJA 5CEQA 4GT3A 3TNWA 3ZUUA 1U54A 3R0TA 2LAVA 5J9ZA 2WB8A 3F3TA 1H00A 2CN8A 3UYTA 4IWDA 3KL8A 4EQMA 5IMEA 2QO7A 4A4LA 5E8UA 5J95A 3RZBA 5HI2A 3BIZA 2OZAA 4FTUA 4X2KA 4Y85A 3LCTA 3NRMA 3OCBA 2HENA 2OIQA 4ZY4A 2W1HA 3FV8A 2GFCA 5EHLA 4DEIA 5CS6A 2BZJA 2GQRA 1VYWA 3QD3A 4PMPA 2FSMX 2ZAZA 1PKGA 3EN4A 3S3IA 3WE4A 4UX9A 3Q6UA 3R71A 4YJSA 3SKCA 4BR3A 4QMTA 4FIJA 5BYYA 5G6VA 2C6DA 1UU8A 4QT1A 1P14A 4IX6A 4EOMA 3H4JA 3ZEPA 4FKLA 4J1RA 4ZXTA 4EI4A 1LEZA 4KB8A 1VZOA 2WTKB 4R5YA 4QMQA 5EOBA 4ZJIA 2R3GA 4EHEA 4BTJA 4Y72A 4BCJA 4U8ZA 3UNZA 3E7OA 3AGMA 3CY2A 2WKMA 3QTSA 5CXZA 4PWNA 3W2PA 4JI9A 5D10A 5I4NA 3RWQA 3WF5A 4EH9A 2OFVA 2FO0A 4M67A 4W4WA 5CSXA 3KRLA 1KOBA 4AFJA 1YXXA 4U5JA 1UNHA 3ORZA 4I6LA 2VWBA 3ULZA 3F2NA 3PA5A 4QTEA 3I5NA 3QRTA 4ZSEA 3GB2A 2IEWA 3IW6A 2JITA 4FEVA 2H34A 3GBZA 3KIOC 3K2LA 4CMUA 5LVPA 3TUBA 4DGLC 1OUYA 2WMSA 3PJ1A 2J2IB 3T8OA 4XJ0A 3CGFA 4LV8A 3DPKA 4X2NA 5A9UA 2IZUA 5HTBA 4KIKB 3HV5A 4BDHA 5KMMA 4KKHA 4J8MA 1H08A 5FEDA 4BCIA 4BHZA 2PZ5A 4AZTA 3N4TA 3I60A 1URCA 4OAUC 5FBNC 4X0MA 3RTPA 4QP9A 2IVVA 3QTUA 2VWVA 3R8ZA 1BI7A 2XRUA 5J9YA 2G9XA 4TWOA 5T6KA 5LJJA 4O7RA 2X9FA 3NAXA 4O0VA 2HAKA 2YITA 2I6LA 5AR8A 4EBVA 3O7LB 3RALA 3QTRA 1BLXA 3L9NA 2GNLA 4WNPA 3W0QA 2EVAA 4M7IA 3CTHA 3QX4A 4BTFA 1BL7A 3VS6A 4F63A 3QWJA 3A61A 5AMNA 2C6OA 3COMA 3IW5A 3OW3A 4FNZA 4YLJA 4M69A 1QPDA 3KXHA 3ZM4A 4BWPA 3PA3A 3BYOA 3F61A 4IH8A 4C2WA 4F99A 5L8LA 3N4UA 1MUOA 4UV0A 5JZJA 4X6RA 2CDZA 3WF9A 2YM7A 5CEMA 3EB0A 4BZOA 3LFAA 3BKBA 4NW6A 4K2RA 2R4BA 3QL8A 4N6ZA 2QOLA 1TZDA 2WTDA 4XX9A 5F9EA 3VBWA 4MCVA 4UWCA 3W2QA 3KN6A 3BLHA 4NM0A 2GMXA 2PVYA 4N0SA 5HCZA 1UWHA 2PVRA 1ZZ2A 2B53A 3H9OA 3OT3A 2VWWA 3PIXA 4E4MA 2BRGA 3FHIA 2YDIA 4NEUA 5IQIA 4NCTA 3PWYA 3VUMA 4USFA 1OL5A 3PFQA 4YZMA 3FC2A 4RJ6A 2P33A 3IS5A 3JY0A 3QZFA 4CG8A 2BR1A 2YCRA 5M4FA 3ORLA 5HD7A 4FEQA 4RRVA 4I20A 4JVGA 5T3QA 5FDPA 5IA1A 4UZHA 3B2TA 3IDCA 4G2FA 3ZLYA 3MA6A 5KUPA 4KBCA 5JFWA 1CKPA 5IG1A 2JDVA 3FZPA 3GFWA 3PXQA 5IU2A 4DFXE 5LXMA 1REKA 3SRVA 2PVKA 2QLUA 4AAAA 1H1QA 3E63A 2VTLA 4G5JA 4IB3A 2B0QA 3LQ5A 4NFNA 3EQRA 4CKIA 5BX0A 2G2HA 2XS0A 3OZ6A 3ATSA 3PVWA 4X3FB 4W9WA 2CSNA 5K5NA 4XP3A 1J91A 1ZWSA 3G6HA 3HV7A 3OY1A 4FKJA 3C4WA 3MDYA 3FLWA 3AG9A 2VO7A 4FK3A 3R1QA 2ZV8A 3G2FA 4GCJA 5M57A 1V0PA 2ZMCA 4GS6A 2Y4IB 1W0XC 4YTHA 5L4QA 5A4QA 2VWIA 4GL9A 2X0OA 4Z16A 4MBJA 5EW8A 3R9RA 4L44A 2OWBA 2WMBA 4YNOA 4EWQA 5HORA 5CT0A 2A0CX 3TTIA 3OBJA 2Q0BA 2QONA 3OUNB 5M53A 3C5IA 1YQJA 1H28A 4I0SA 3Q96A 4ZTLA 4C34A 3GCVA 4DLIA 3FXWA 2JIUA 4RJ5A 5AA9A 2WQMA 4E6CA 3D7ZA 4OTQA 4PY1A 4X6QC 4M69B 4U41A 5HKMA 4V04A 1PHKA 2JAVA 2YAAA 3FMJA 4G31A 5H3QA 4HCVA 4D2SA 3LXNA 2C6EA 1I44A 1O6KA 2B9HA 2CPKE 1PXJA 3ORNA 5AUWA 3S2PA 4ACCA 4EUUA 4K9YA 4IEBA 4KRCA 4NKSA 3U4UA 2VTHA 3CKXA 3ATTA 3EZVA 1SVHA 4FNWA 5IEXA 3IPHA 3UDBA 5AR7A 4UWBA 4ARKA 4DTKA 3EYGA 2VTNA 4FEUA 4MKCA 3MFSA 3DQWA 3PP1A 4GK3A 3OS3A 2GNFA 3MIAA 5AAEA 5DLSA 2QG5A 2YIYA 4PUZA 3MYGA 1OKVA 3EL7A 1NY3A 4O21A 5E1EA 4FTAA 2HZ0A 2WQNA 4KAOA 3V5QA 4EK5A 3PIYA 4PDOA 4YC6A 4ALVA 4G9CA 3E8EA 3W8QA 3PXYA 3ORKA 5JGDA 3HV3A 4FNYA 3LLTA 2YIXA 3CR0A 3LZBA 2GTMA 4HVIA 5DPVA 1FGKA 3FMDA 4K18A 4V01A 4G3CA 5IQEA 5K3YA 3NX8A 1H01A 2GHGA 5AWMA 3WE8A 5J5SA 4XG7A 5K4IA 4ASXA 1G8AA 4QMOA 1K3AA 4FL2A 1CDKA 2X8IA 1AQ1A 5CY3A 3EN9A 4RGJA 4YHJA 4C33A 2Y4PA 2JBPA 4OT5A 1ZYDA 3AC3A 3MFUA 3OMVA 3D5WA 4CD0A 2VTQA 2Z2WA 3DY7A 3FDNA 3TTJA 2RFDA 3KF4A 5EKNA 5B2MA 4YLLA 4MX9A 2XNGA 4EONA 3ZRMA 1Y57A 4FV2A 2RG6A 3UOJA 2FGIA 3A4PA 4NIFB 1RW8A 2VWZA 2CKQA 3ORXA 3KXXA 4FA2A 4F7JA 2X81A 3NYNA 4LI5A 4CKRA 4U45A 2OJIA 3VUIA 4EHZA 4KSQA 3W0SA 1VEBA 1YI3A 3DLSA 5BYZA 1GOLA 3EZRA 2GNGA 4BZNA 3VWAA 1XMLA 3ZO1A 2IPXA 4C61A 1E1XA 4G3DA 4RA4A 1W84A 2ZFYA 3KFAA 5KNJA 1NXKA 4DFLA 4BYIA 2UW7A 5KBRA 2I0VA 4AXAA 2VNWA 4E1ZA 5A4CA 4PPCA 2JIVA 2C3JA 4BCQA 2B55A 4RFMA 3ZBXA 3BLRA 2EB3A 3OTVA 3FMLA 5KX8A 3DFCB 3KB7A 3ALNA 4YZNA 4F09A 4FSWA 5DN3A 2WD1A 4W4XA 5ETFA 1UNLA 3M42A 2Y6MA 5E8ZA 5A46A 3UPZA 3BGZA 4BCNA 5L2QA 3VS2A 2W4JA 3KXGA 3EHAA 4OBQA 4W8EA 4BBFA 4XEYA 1E9HA 3UO6A 5A6OA 3ACKA 3FPQA 5EQEA 3M1SA 3RWPA 3OHTA 2VX3A 2PYWA 4ZTQA 1AGWA 5LVNA 2QCSA 4QNYA 5AA8A 4O83A 5GINE 4BCMA 4KIPA 3I6WA 3G33A 4JS8A 4UALA 2OF2A 2RF9A 3D7TB 2GNHA 2ACXA 2UV2A 4IB1A 2XALA 4U7ZA 3PPZA 5CALA 4CMTA 1FVRA 1GJOA 1Y6AA 2O2UA 4FT0A 4BJJB 1PMUA 5CASA 5K0XA 5AAFA 4YO4A 2F4JA 3ZTXA 4J95A 5HIEA 1Q8WA 2X8DA 3FXZA 4O7NA 2IZTA 1OI9A 4JX3A 4YPSA 5GIOE 2BKKA 2XEYA 5D7AA 4QTCA 3KCFA 1T46A 3BLQA 3QD2B 4IC8A 3PXRA 5K5XA 4JIAA 3CXWA 2J6MA 4TNBA 2ETMA 2ITVA 4FG9A 2X0PA 4GKIA 4I21A 5ANOA 3GI3A 4O7LA 3BCEA 4LL5A 3TJCA 3F5GA 2PZIA 2OXDA 4DINA 4DG2E 3CBLA 4XRJA 2PVMA 4MVFA 3BE2A 2QU5A 4BCKA 4JMQA 4WG3A 5C4KA 3E93A 5HX8A 3F3ZA 4MTAA 4O0TA 4D58A 2J4ZA 4Q9SA 3NUNA 3CY3A 5CU6A 5LOHA 4R7BA 2YABA 1W82A 2ZV2A 3NVKI 4EOKA 4IM2A 3QQHA 5LMBA 1Q97A 1DI9A 3BZ3A 5TT7A 3RAIA 4AGCA 5ANEA 1JLUE 4LUDA 3HECA 2EWAA 2R7BA 4WA9A 4TWNA 2XJ1A 2JKQA 4G6OA 4DFNA 3KA0A 4Z55A 2CGWA 3CQUA 4AZFA 4FKOA 2X0GA 4EQCA 4II5A 4EJNA 4K33A 3ANRA 2HCKA 3KGAA 1WAKA 3KRRA 3OW4A 4LRKA 5CVHA 1U5QA 4ZIMA 4WNOA 1Q62A 4FGBA 4GT5A 4IVCA 4U3YA 4HYUA 2CKOA 1FQ1B 4FG8A 3O17A 3WI6A 3U6JA 3LIJA 2OICA 3W8LA 1EH4A 4H1JA 5H8GA 4FVQA 3T9IA 3VUDA 3W10A 2W1EA 2F9GA 4FKIA 2WFYA 1JKKA 3QRKA 5F4NA 3G0EA 2PZRA 2ITNA 1Q61A 3GXLA 3KQ7A 2OIDA 5AR2A 4A9YA 4BCHA 4DG0E 5C4LA 2RFEA 2EXEA 4PP7A 2WGJA 2OSCA 3JY9A 4FOCA 4I6QA 4PL4A 4J96A 1ERKA 1YXTA 2ZVAA 4FR4A 2QD9A 4IVAA 3QCXA 3LCDA 3RPOA 4ANLA 1UV5A 2C5OA 1Z5MA 2J0JA 3CTJA 3IDPA 4XG4A 5JRQA 2RFSA 2PWLA 2Z7QA 4FVRA 4QPMA 4BN1A 5CANA 2PE0A 4D2WA 1Z57A 1YOLA 3UIUA 4CFUA 5BNJA 3RMFA 2F7ZE 5FTOA 5TR6A 3DBFA 5CU3A 2YDJA 3Q9ZA 2VTIA 4JDIA 5HOAA 3UVPA 5AUTA 2Q83A 1XMMA 3V5JA 1OBGA 4JBOA 3F2RA 4AXEA 4IAFA 3W33A 3FSKA 1OUKA 2WOUA 3W32A 2WZJA 5AUUA 1UU3A 5DR2A 2VO3A 2BRNA 2PVFA 3BBWA 2DUVA 3Q5IA 2R3OA 2JBOA 1XHAA 3FUPA 4QMPA 4F6SA 5A14A 3DBDA 3AD6A 2PUNA 5M06A 2W4KA 1JSTA 2OKRA 3BGQA 3R6XA 5BVKA 4NM3A 5CVGA 5HEZA 4KBAA 4EOSA 1RQQA 4FT3A 4TN6A 4MXCA 4WT6A 5AIKA 1M2QA 5EM5A 2CNUA 2BVAA 3TV4A 3C1XA 3RGFA 5FQDC 4EK8A 3KREA 5E91A 4A9TA 3EYHA 4OTGA 4K8AA 3DB8A 5M08A 3A7HA 3RAKA 4LFIA 3RK9A 4LRJA 2GHMA 5HG7A 3WZEA 5CQUA 4XP0A 3DXQA 3LJ1A 3VBXA 3D15A 3SOCA 4ERKA 3QHRA 1GZNA 3E7VA 4ALWA 4FUXA 5IEVA 2WQEA 3IDBA 4X2FA 3CTQA 3JPVA 5CSWA 3ZLSA 5HTIA 3BU3A 3JXWA 4MD8E 5FEQA 3TZ8A 2R3FA 4I0TA 2WIPA 2BILB 2CJMA 3IONA 3T3UA 2VTRA 4D2VA 4ZMEA 4J99A 1IR3A 1NVQA 1WZYA 2GHLA 4WRSA 4B0GA 5AR5A 4O82A 3C0HA 1OB3A 2IJMA 4FEXA 1QL6A 5C01A 2AQXA 4C59A 2BRHA 2YFXA 3ODZX 1X8BA 2UW8A 4G3GA 2GU8A 2W96B 3HDNA 2PUUA 4F7SA 3GT8A 4RC3A 2V22A 2V5QA 3GOPA 1F5QA 4FV8A 3GU8A 3JR1A 3QQKA 1XWSA 3BHTA 1KE6A 4OTWA 1STCE 4JOAA 4RJ3A 3ZRKA 3VN9A 2JGZA 3FMEA 2CGVA 5L6PA 2VWXA 3Q9YA 4FSNA 4OBOA 3R9DA 2W9FB 4KUJA 3HLLA 4L3LA 3VUKA 3MY0A 4IXPA 3EKNA 3HMOA 3LHJA 4LMNA 4JRVA 1PXPA 4EOIA 2R3NA 2UUEA 3EQHA 3HX4A 3CCNA 1HCLA 4I41A 2JLDA 4GKHA 4RJ7A 5CF6A 4FTNA 4YC3A 4F65A 4ZLZA 3GC8A 4BI2A 2QG7A 3DKOA 3PPJA 4FYNA 2XK7A 4FZ7A 5EM8A 3TACA 4ZJVA 4FEWA 2BZHB 4TYEA 1UKHA 4LRMA 4BC6A 3SGCA 4HNIA 3Q60A 4FX3A 3FYKX 3VS4A 4OGRA 2ITQA 3QKMA 3W0RA 2YM5A 2JKOA 4JAJA 4O7SA 1K2PA 1XJDA 2VWYA 4RFZA 4D1SA 3ACJA 1J3HA 1GZOA 2QO9A 2VTAA 3KEXA 4FNXA 3VNTA 2C68A 4O0SA 3FMMA 3OXIA 4LL0A 4GU9A 4YSJA 2XM8A 2H6DA 2DYLA 4K11A 4DEAA 1OKZA 2Y9QA 3EWHA 4JBPA 5J8IA 2X6EA 5EDRA 1FPUA 2LGCA 4C36A 4DCEA 3UVRA 4UMPA 2R9SA 3PWDA 5GZ8A 2BDJA 4GFGA 1BMKA 2J50A 4TYHB 4O4BB 5AM7A 1CMKE 3EQBA 4B7TA 1M14A 2ZM1A 5DBXA 3EQFA 4HGSA 3WARA 4TT7A 4DHJA 4HOKA 4NKAA 4CFNA 4NYEA 1LR4A 5EDQA 3TKIA 4JQ8A 2VZ6A 1WCCA 2XJ2A 3KVWA 2XBAA 4KIOA 2C0TA 2X2MA 2YM6A 2VGOA 1H8FA 5D9HA 4IBMA 4LV7A 4KNBA 4NFMA 3WZDA 3FMKA 3RAWA 4XYFA 3C4XA 1V0BA 5ACKA 3I4BA 4F7NA 2CNVA 2GQSA 1FBNA 3KULA 3GUBA 4RC2A 4DGGA 2BALA 4FICA 3PDTA 1MRUA 1PYXA 4EWHA 5GIPE 1GIJA 1OZ1A 3PJ8A 2Y7JA 4G5PA 4ACDA 4LMUA 4YJQA 3VHEA 5I5ZA 2OZOA 3WIGA 3W0OA 2HW6A 4X2GA 1H4LA 2XARA 3LXPA 3AC2A 4CCBA 4U97A 2QURA 3IKAA 4DBXA 4FIEA 2OZAB 1DAWA 3MA3A 4DLJA 4FSRA 2FB8A 2GTNA 3NNWA 4WNKA 2PVNA 1M2PA 2IN6A 4G17A 4RFYA 4H05A 5D41A 1ZYJA 2HZ4A 4RJ8A 5LVMA 4MXOA 3E8CA 2XRWA 3HV4A 5A4EA 4F9BA 3Q6WA 5HQ0A 4PRJA 3DQXA 3MBLA 4GT4A 2XNBA 4QP3A 5LWMA 4BJJA 3OWPA 1WBVA 4OW8A 1UU7A 5CQWA 3QQGA 4O7TA 2OFUA 2FYSA 3F3VA 3IO7A 3S95A 4CNHA 3PTGA 2XNOA 3KMWA 4AZSA 3Q9WA 2XK4A 3GCPA 1IRKA 1SMHA 3W2SA 4V05A 2B54A 1OIUA 3UBDA 5HE3A 4FBXA 1OL1A 3DDPA 4AZEA 5H8EA 4FTIA 2UW6A 3DKGA 1U59A 4O0XA 3GU7A 2X8EA 3F5XA 4FV0A 4QD6A 4TYHA 4EH8A 3O0GA 3Q52A 3QQFA 5HG5A 3RVGA 5IH5A 4IQ6A 3VS1A 1H27A 2WTWA 3DXPA 2UZLA 2C5VA 4GW8A 2A27A 3A7JA 4QMYA 4IVBA 3DZQA 3DCVA 3P79A 4B4LA 4HYHA 4A7CA 3DU8A 3TZMA 3WZUA 3A62A 3MVHA 4GVJA 3EKKA 2RGPA 3WOWA 1L8TA 3QAME 3AD4A 5EHYA 3SQQA 4KWPA 5HGIA 5DYJA 2VWUA 3L9MA 2FA2A 5FTQA 2WOTA 2YM4A 5CI6A 4HW7A 4EOJA 3I1AA 2J7TA 2HZNA 3Q9XA 3OEZA 4Q5EA 2XB7A 5CZHA 4RSSA 4RZVA 2R64A 3ORPA 4O6LA 3FKLA 3K5VA 2IWIA 1NA7A 4I94A 4QQ5A 4GIIA 4CV8A 3VHKA 2BAJA 4O0YA 5CI7A 3V5WA 4O96A 5CNNA 4N57A 3UVQA 3FI4A 4YJPA 3F82A 4WD5A 4XG3A 3R01A 5HE2A 2G15A 4AT3A 3NIEA 3FI8A 2O3PA 3ZO2A 4QPSA 3BEAA 1OL7A 3FHRA 4D9TA 3P0MA 2OJ9A 2ETKA 4O22A 1DS5A 3G51A 1PMVA 2VAGA 4JDKA 1DM2A 3D83A 4AS0A 2W5AA 2PUPA 4ZK5A 1NVRA 4YUQA 1JOWB 1VR2A 5HNBA 3II5A 4PV0A 3TNIA 3MWUA 3GC7A 4FV3A 4NJDA 4QTAA 3TEIA 2BFYA 3FBVA 3QUDA 4O81A 4W4VA 4BDJA 2BZIB 2AC5A 4L3JA 3TIYA 4ASDA 4GUBA 3ZMMA 4P5QA 3NUXA 1Y8GA 2XIZA 3G9LX 4L45A 2UZVA 4J97A 3LXLA 4DH7A 3TL8A 5AP7A 4PL5A 4N4SA 5KKRC 1B39A 4RA5A 4TYGA 1QPCA 2C3KA 5KKRB 4ALUA 4E26A 3TI1A 2HK5A 2WQOA 5HU3A 2UZWE 4UMTA 4S2ZA 2XK3A 4FTJA 3LFBA 3FY2A 3RPRA 4L52A 4I22A 4AG8A 4XUFA 2XF0A 4AX8A 3RKBA 2YLFA 4IW0A 3FZSA 3PY3A 4OTHA 1YDTE 3UQCA 3VBVA 4IWQA 5KMLA 3QTZA 3PUPA 3EQCA 3R1SA 4X3JA 3CD8A 3O5AA 3TDWA 4H36A 5IQGA 1KV1A 4Y95A 4IJPA 2A98A 3P7AA 3WILA 5IDNA 3QRIA 4FZAB 4IAAA 3BI6A 5AUXA 2XEZA 4QMLA 4IX4A 3C5UA 3DNDA 1IG1A 2Z02A 2Z60A 1ST4A 4FT7A 3U6HA 4O84A 1JWHA 3MIYA 4W4YA 3L9PA 4HCUA 3OT8A 4OTFA 3QYWA 3RM6A 2AEGA 3PG3A 2BCJA 3U6IA 5BUJA 5B2LA 4ITIA 4CYIA 4BYJA 5J1VA 4LYNA 2ZJWA 2R5TA 3AMYA 4NW5A 3ROCA 1NW1A 3CKWA 3ALOA 3QWKA 5GNKA 4DGOA 3VAPA 3TKUA 3UIBA 2WTJA 3WF8A 2R3LA 5DT4A 2YIQA 2Y4IC 3F5PA 3DTWA 4KSPA 4D2PA 3MVMA 3UDSA 2W99B 4PTGA 2QOBA 4M0ZA 3SLSA 4ANMA 3L8XA 3LJ0A 2YA9A 3SV0A 4QMWA 2OH4A 4BKZA 5IQHA 1QMZA 2O63A 2AYPA 2PPQA 5CF4A 3KVXA 3ZLWA 3UNJA 3PRIA 2ITZA 2Y0AA 3CJGA 5CZIA 3F3WA 4O7WA 1OECA 3OOMA 3D4QA 4Y5HA 4WG4A 1G8JA 5M09A 1F3MC 4AAYA 4LUEA 1YWNA 2WO6A 4MXXA 4EZ7A 3ETAA 4LGHA 3TM0A 5LMKA 5ANKA 4OTRA 4Q2AA 3V8WA 4EK3A 5KMIA 3PZHA 5AAGA 3F88A 3LM5A 4LGDA 2GNJA 3KKVA 4O1OA 3IGOA 2NPQA 4OUCA 4RWJA 2YN8A 4EH3A 4TY1A 3TCPA 4IAIA 1J1CA 5C9CA 4DGNA 4EHGA 1XBBA 3UQFA 1YXSA 3QRJA 2I1MA 2WMRA 3R7GA 1ST0A 1YDSE 3EN6A 4UN0C 3CQWA 4ENYA 4AOIA 3FQEA 5JRSA 2BKZA 3GGFA 2NRYA 2UZEA 4B8LA 2C5XA 3A4OX 2OBJA 1KV2A 3F3UA 3O50A 4XG9A 5HO6A 4C4JA 2IW9A 3UQGA 4PDYA 3MFRA 2BDFA 1OL2A 3OP5A 2C0OA 2XNPA 1MRVA 4EZ5A 4A9SA 1TVOA 2C30A 2GS7A 3ITZA 4C0TA 4Y73A 1YWVA 3PP0A 1J7LA 3E8NA 4F6UA 4EZ3A 1R78A 5CTPA 1I09A 3BHYA 1QPJA 2HY0A 2ITWA 4JNWA 2FUMA 5TKDA 3DT1A 5IQDA 1XH6A 4I23A 2PSQA 1Q99A 5E8XA 4MXYA 3SXFA 4EOLA 2A2AA 3ROYA 4TYJA 4FVPA 1H0WA 3PIZA 3FLNC 2WEIA 2QKWB 4S34A 4APCA 4O38A 5JGBA 4BDBA 2YM3A 5ANJA 3MTLA 3BPRA 3P1AA 3R1YA 4S30A 3ELJA 3V6RA 4AE9A 3R7VA 4BBEA 2XBJA 3RNYA 2W06A 3NUYA 5KZIA 2QHNA 2V55A 2J9MA 4BCOA 3PLSA 4Z9LA 2I40A 5BV3A 2F7EE 1V0OA 5J87A 3TZ9A 4AUAA 2VTOA 4U6RA 1URWA 3C51A 1OBDA 4F0GA 4CZTA 2VX1A 2YHVA 4R7IA 1H26A 3BL9A 3LMHA 2C69A 4NCTC 3OCSA 4JG6A 3GCSA 4L46A 4I5PA 2BIYA 2UZDA 3ZS5A 1SYKA 4NSTA 2VUWA 2YDKA 4JR3A 2OJJA 4C4HA 4CT2A 3U9CA 2EUFB 4E4NA 3TN8A 3CE3A 3OFMA 3QBNA 4FTRA 3PVBA 4H39A 3QU0A 3P7BA 4YJVA 4L6QA 4D55A 2RFNA 3N9XA 4UZDA 3PJ2A 3LPBA 3QKLA 3LVPA 3T9TA 1U5RA 3OC1A 2J0IA 5F95A 2XYNA 2C6MA 5AP1A 3AMBA 2WMVA 3U54A 3UJGA 3CC6A 4F6WA 1KE5A 3ZFYA 5ANIA 4XV3A 4EC9A 3AC5A 4A9RA 4APPA 5HLWA 4WG5A 4I6FA 3UNKA 1IA8A 3HV6A 3MJ2A 2AUHA 5CX9A 4UMRA 4QDEA 3QTXA 4ZS4A 2ZB0A 1GY3A 5AIRA 5EYCA 4O91A 3FQHA 1XR1A 4RIXA 3TNPC 4ACMA 4AW1A 4O4FA 4YJOA 4HGEA 5HICA 4FZFB 4FT5A 4LOOA 3ML1A 5KHWA 2XKDA 2XCKA 4IZ7A 4L8MA 5D11A 4XG2A 5EQPA 4H3PA 1BUHA 1ZXEA 3QA0A 4YJNA 3HA6A 3ZO4A 4YURA 1Y8YA 3G5DA 4BBMA 1XH8A 4XNEA 1MRYA 5HNGA 4TWCA 4B99A 5DOSA 4RIWA 5J5TA 1PRYA 2QOCA 4FRFA 1R0PA 4PX6A 2Y8OA 1ZOGA 5E4HA 4RIWB 3TV6A 3ZLXA 4EOQA 5CU0A 4C38A 3PPKA 2BROA 4I92A 2R3PA 4JDJA 5FRIA 3W1FA 4QDVA 3QALE 2XNEA 4MK0A 3FSFA 3VW8A 4DFBA 3RPSA 3CSVA 4WUNA 3HUCA 3RPYA 3GOKA 4FV5A 4K77A 4A07A 5FEEA 4YMJA 4TNDA 3RCJA 3TNHA 2WTCA 2I0HA 3SW7A 2WU6A 4UXQA 4BGGA 3M11A 4CV9A 4I0RA 3HKOA 5IQCA