4UYEA

Bromodomain of human brpf1 with n-1,3-dimethyl-2-oxo-6-(piperidin-1- yl)-2,3-dihydro-1h-1,3-benzodiazol-5-yl-2-methoxybenzamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEREGRIN
publication title 1,3-Dimethyl Benzimidazolones are Potent, Selective Inhibitors of the Brpf1 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uyeA00
4HXMA 2YELA 3O37A 4UIYA 3GG3A 5F36A 3UV2A 4YABA 5II2A 5I1QA 5DKHA 4QC1A 4TZ2A 4O71A 4NQMA 2DVQA 5EWCA 5DKCA 5E9YA 2I8NA 5FFYA 5ENEA 5CQ4A 4WHWA 5KU3A 5D7XA 5A5OA 2WP1A 5COIA 5CY9A 2RFJA 5KO4A 2RI7A 4QYLA 3S92A 5E74A 4Z6IA 5ENJA 5CFWA 4N4HA 3DAIA 4UYFA 4OGJA 5DLZA 2F6NA 3O36A 5E3DA 5I29A 4NS5A 4LRGA 4IORA 4NR4A 5CUDA 4N4GA 3AADA 4YC9A 3D7CA 5C85A 4LZSA 3IU6A 3UW9A 4CUSA 4IR5A 5AD3A 3UV5A 1N72A 4BW4A 5AD2A 5DBMA 1X0JA 4QEWA 5FE2A 3O35A 5FE5A 4QY4A 4NYVA 5JWMA 2L84A 3JVJA 3S91A 1ZS5A 4BJXA 4O76A 4ALHA 4QZSA 5A5RA 3U5LA 5HFRA 5D26A 4YYNA 2WP2A 4PCEA 4QSPA 4DONA 5DFDA 5LKUA 5FFVA 2YQDA 4NUEA 5DKDA 4CURA 2R0VA 4NUDA 5EWWA 5FE1A 4CUQA 4Z93A 4YATA 5F2PA 4IR6A 5ENCA 5EWHA 2N9GA 5CQTA 4Z6HA 4PS5A 4NXJA 4YYGA 5IIDA 3UVDA 5CQ8A 5IGKA 5DYAA 5DYUA 5HENA 4YYDA 4LYWA 5FE8A 3TLPA 5FB1A 5EA1A 4ALGA 4O7EA 2YW5A 4KV1A 4CFLA 4YYIA 4TT2A 4TT4A 3HMFA 5ENGA 2L5EA 3MUKA 3U5KA 5FG4A 3JVLA 2RO1A 4IR4A 5DX4A 5CQ3A 5D3RA 2DWWA 4QR4A 5HFQA 5CUGA 3JVKA 4MEOA 4LZRA 4MENA 4QSTA 3LQJA 2RNYA 4IOOA 4XUBA 4QSQA 5A81A 3FKMX 5CP5A 5D3PA 5L96A 4MEQA 4QSXA 4A9LA 3U5MA 3P1CA 5HCLA 5LJ2A 5HEMA 3SVHA 4N4FA 5D3JA 3ZYUA 3MXFA 5F63A 4NYXA 5FG5A 3NXBA 2RS9B 5DYCA 5FE7A 2YYNA 4TZ8A 5FE0A 2H60A 5ETDA 5FFWA 4XY8A 4UIUA 5EGUA 4QBMA 4CLBA 4HBWA 4A9IA 4TU4A 5FH7A 4QNSA 4CFKA 5D3HA 5EPRA 5LVRA 4PTBA 4YH4A 4TYLA 4WHUA 5I83A 5A5PA 3Q2EA 5D3NA 5D3TA 5HRVA 4Q0OA 4MR6A 4A9KA 2DVRA 5ACYA 4BW1A 3LQHA 4LC2A 4N3WA 4A9EA 4GPJA 4KCXA 4MR4A 5CS8A 4J0SA 5ENIA 4QR3A 2LSPB 4XUAA 5TCMA 5C87A 2RNXA 4HXLA 4MEPA 5DYXA 5E0RA 4CL9A 3K2JA 5BT4A 3P5OA 5CZGA 4BW3A 5HRWA 3MQMA 5HQ7A 4QSUA 3P1FA 5FE3A 4NQNA 3UVWA 4A9NA 4UYGA 4A9MA 4LZ2A 4UYDA 4YYMA 5I89A 5C4QA 4YBMA 4O7FA 5KHMA 5FG6A 4Z1QA 5G4RA 4UIVA 5CQAA 4NR5A 5A85A 5DW1A 4PCIA 5I80A 4Q0NA 4Y03A 5CUBA 4QSRA 5IGMA 4UYHA 4E96A 4BW2A 4TTEA 4HXOA 3U5PA 2L85A 5DFBA 5ETBA 2KTBB 4J3IA 4UIZA 5HJCA 2YEKA 4C67A 5E73A 4ZQLA 5L99A 1JSPB 5ENHA 5C89A 5C7NA 4ZW1A 3O34A 4XYAA 5I7YA 5II1A 5FE9A 5F1HA 2OSSA 5DLXA 5AMEA 4CUPA 5C8GA 4QUUA 4WIVA 3HMHA 5HQ6A 5F61A 5LVQA 4C66A 4O74A 4AKNA 3G0JA 2YEMA 3MB4A 5CU8A 5E9VA 5HRXA 5LKZA 5EQ1A 4O78A 4UITA 5I86A 4A9JA 3UVXA 5K29A 5BT5A 3ONIA 4TU6A 5EICA 5EK9A 4YY6A 3LQIA 5HLSA 4BHWA 4QUTA 3U5JA 4LYIA 5EWDA 3U5OA 5EISA 4QEUA 5EWVA 5IBNA 5JI8A 5D24A 5E9LA 5LUUA 4UIXA 5F25A 5EM3A 4KV4A 2D82A 5AMFA 4O72A 2E7OA 5HM0A 4O75A 1WUMA 3IU5A 5IG6A 3LXJA 3MB3A 5ENBA 2FSAA 4YBTA 4PY6A 5E9KA 2MJVB 5CPEA 5D0CA 4QSVA 4IR3A 4IOQA 4TS8A 5FE4A 5KTXA 5F5ZA 2GRCA 3LJWA 4MR5A 5A5QA 5F3AA 4QSSA 4QC3A 3HMEA 4QR5A 5DFCA 2R0YA 5CRMA 4LYSA 5H1UA 5A5SA 3QZSA 5EU1A 4YY4A 5HQ5A 2E7NA 4A9FA 4HBXA 5A82A 5D3LA 4HXKA 5LJ0A 4XY9A 2R10A 4HXRA 2OO1A 3P1EA 5FBXA 4YK0A 5E9MA 5J0DA 5F62A 4NR9A 5FDZA 5E9IA 5I7XA 5DY7A 4QB3A 4F3IA 4UIWA 3RCWA 3P1DA 5E7DA 5EI4A 5FH6A 2D9EA 2I7KA 5ENFA 5KTWA 4X2IA 5KTUA 4YBSA 4HXPA 4O70A 5CUEA 5IGLA 4NUCA 4YYHA 4Z1SA 5A7CA 1WUGA 2E3KA 3SVGA 1E6IA 5EPBA 5FE6A 2F6JA 4YYKA 3AQAA 4J0RA 4PKLA 5A5NA 4LR6A 4QYDA 3Q2FA 5L8TA 3QZTA 3QZVA 5CUAA 5EV9A 5CQ5A 2YDWA 4A9OA 5EVAA 4YYJA 5TB6A 2DVVA 5L8UA 3G0LA 4UYEA 5I88A 4NR7A 2NXBA 4YADA 3I3JA 5LKTA 5E3GA 5H1VA 5D25A 5D3SA 5LJ1A 4NR8A 2DVSA 4TT6A 2G4AA 4HBYA 4LDFA 5I40A 4ZC9A 2OUOA 3UV4A 5CQ6A 4RVRA 4YH3A 4HBVA 3JVMA 5EP7A 4J1PA 5L97A 3MULA 5CGPA 4CUTA 4YAXA 4HXSA 2R0SA 4NYWA 5F60A 5L98A 4O7AA 5FB0A 5LKXA 4HXNA 5DW2A 4NRBA 1JM4B 4O7CA 5HELA 4UYFB 2DKWA 3O33A 4QEVA 5EPSA 4A9HA 1EQFA 3DWYA 4MR3A 5FH8A 5CUCA 5CQ7A 5BT3A 4OGIA 5F1LA 5CRZA 4N4IA 3UVYA 4NRCA 4CUUA 5H85A 3SVFA 4O7BA 4NRAA 4FLPA 4QSWA 4OUFA 1F68A 5G4SA 4O77A 4TQNA 2DATA 5CTLA 3U5NA 5IGNA 5A83A 2RNWA 5H1TA 4NR6A
chains in the Genus database with same CATH superfamily
4HXMA 2YELA 3O37A 4UIYA 3GG3A 5F36A 3UV2A 4YABA 5II2A 5I1QA 5DKHA 4QC1A 4TZ2A 4O71A 4NQMA 2DVQA 5EWCA 5DKCA 5E9YA 2I8NA 5FFYA 5ENEA 5CQ4A 4WHWA 5KU3A 5D7XA 5A5OA 2WP1A 5COIA 5CY9A 2EJNA 2RFJA 5KO4A 2RI7A 4QYLA 3S92A 5E74A 4Z6IA 5ENJA 5CFWA 4N4HA 3DAIA 4UYFA 4OGJA 5DLZA 2F6NA 3O36A 5E3DA 5I29A 4NS5A 4LRGA 4IORA 4NR4A 5CUDA 4N4GA 3AADA 4YC9A 4AKGA 3D7CA 5C85A 4LZSA 3IU6A 3UW9A 4CUSA 4IR5A 5AD3A 3UV5A 1N72A 4BW4A 5AD2A 5DBMA 1X0JA 4QEWA 5FE2A 3O35A 5FE5A 4QY4A 4NYVA 5JWMA 2L84A 3JVJA 3S91A 1ZS5A 4BJXA 4O76A 4ALHA 4QZSA 5A5RA 3U5LA 5HFRA 5D26A 4YYNA 2WP2A 4PCEA 4QSPA 4DONA 5DFDA 5LKUA 5FFVA 2YQDA 4NUEA 5DKDA 4CURA 2R0VA 4NUDA 5EWWA 5FE1A 4CUQA 4Z93A 4YATA 5F2PA 4IR6A 5ENCA 5EWHA 2N9GA 5CQTA 4Z6HA 4PS5A 4NXJA 4YYGA 5IIDA 3UVDA 5CQ8A 5IGKA 5DYAA 5DYUA 5HENA 4YYDA 4LYWA 5FE8A 3TLPA 5FB1A 5EA1A 4ALGA 4O7EA 2YW5A 4KV1A 4CFLA 4YYIA 4TT2A 4TT4A 3HMFA 5ENGA 2L5EA 3MUKA 3VKHA 3U5KA 5FG4A 3JVLA 2RO1A 4IR4A 5DX4A 5CQ3A 5D3RA 2DWWA 4QR4A 5HFQA 5CUGA 3JVKA 4MEOA 4LZRA 4MENA 4QSTA 3LQJA 2RNYA 4IOOA 4XUBA 4QSQA 5A81A 3FKMX 5CP5A 5D3PA 5L96A 4MEQA 4QSXA 4A9LA 3U5MA 3P1CA 5HCLA 5LJ2A 5HEMA 3SVHA 4N4FA 5D3JA 3ZYUA 3MXFA 5F63A 4NYXA 5FG5A 3NXBA 2RS9B 5DYCA 5FE7A 2YYNA 4TZ8A 5FE0A 2H60A 5ETDA 5FFWA 4XY8A 4UIUA 5EGUA 4QBMA 4CLBA 4HBWA 4A9IA 4TU4A 5FH7A 4QNSA 4CFKA 5D3HA 5EPRA 5LVRA 4PTBA 4YH4A 4TYLA 4WHUA 5I83A 5A5PA 3Q2EA 5D3NA 5D3TA 5HRVA 4Q0OA 4MR6A 4A9KA 2DVRA 5ACYA 4BW1A 3LQHA 4LC2A 4N3WA 4A9EA 4GPJA 4KCXA 4MR4A 5CS8A 4J0SA 1ZKRA 5ENIA 4QR3A 2LSPB 4XUAA 5TCMA 5C87A 2RNXA 4HXLA 4MEPA 5DYXA 5E0RA 4CL9A 3D1DA 3K2JA 5BT4A 3P5OA 5CZGA 4BW3A 5HRWA 3MQMA 5HQ7A 4QSUA 3P1FA 5FE3A 4NQNA 3UVWA 4A9NA 4UYGA 4A9MA 4LZ2A 4UYDA 4YYMA 5I89A 5C4QA 4YBMA 4O7FA 5KHMA 5FG6A 4Z1QA 5G4RA 4UIVA 5CQAA 1PUOA 4NR5A 5A85A 5DW1A 4PCIA 5I80A 4Q0NA 4Y03A 5CUBA 4QSRA 5IGMA 4UYHA 4E96A 4BW2A 4TTEA 4HXOA 3U5PA 2L85A 5DFBA 5ETBA 2KTBB 4J3IA 4UIZA 5HJCA 2YEKA 4C67A 5E73A 4ZQLA 5L99A 1JSPB 5ENHA 5C89A 3VKGA 5C7NA 4ZW1A 3O34A 4XYAA 5I7YA 5II1A 5FE9A 5F1HA 2OSSA 5DLXA 5AMEA 4CUPA 5C8GA 4QUUA 4WIVA 3HMHA 5HQ6A 5F61A 4AKHA 4AKIA 5LVQA 4C66A 4O74A 4AKNA 3G0JA 2YEMA 3MB4A 5CU8A 5E9VA 5HRXA 5LKZA 5EQ1A 4O78A 4UITA 5I86A 4A9JA 3UVXA 5K29A 5BT5A 3ONIA 4TU6A 5EICA 5EK9A 4YY6A 3LQIA 5HLSA 4BHWA 4QUTA 3U5JA 4LYIA 5EWDA 3U5OA 5EISA 4QEUA 5EWVA 5IBNA 5JI8A 5D24A 5E9LA 5LUUA 4UIXA 5F25A 5EM3A 4KV4A 2D82A 5AMFA 4O72A 2E7OA 5HM0A 4O75A 1WUMA 3IU5A 5IG6A 3LXJA 3MB3A 5ENBA 2FSAA 4YBTA 4PY6A 5E9KA 2MJVB 5CPEA 5D0CA 4QSVA 4IR3A 4IOQA 4TS8A 5FE4A 5KTXA 5F5ZA 2GRCA 3LJWA 4MR5A 5A5QA 5F3AA 4QSSA 4QC3A 3HMEA 4QR5A 4AI6A 5DFCA 2R0YA 5CRMA 4LYSA 5H1UA 5A5SA 3QZSA 5EU1A 4YY4A 5HQ5A 2E7NA 4A9FA 4HBXA 5A82A 5D3LA 4HXKA 5LJ0A 4XY9A 2R10A 4HXRA 2OO1A 3P1EA 5FBXA 4YK0A 5E9MA 5J0DA 5F62A 4NR9A 5FDZA 5E9IA 5I7XA 5DY7A 4QB3A 4F3IA 4UIWA 3RCWA 3P1DA 5E7DA 5EI4A 5FH6A 2D9EA 2I7KA 5ENFA 5KTWA 4X2IA 5KTUA 4YBSA 4HXPA 4O70A 5CUEA 5IGLA 4NUCA 4YYHA 4Z1SA 5A7CA 1WUGA 2E3KA 3SVGA 1E6IA 5EPBA 5FE6A 2F6JA 4YYKA 3AQAA 4J0RA 4PKLA 5A5NA 4LR6A 4QYDA 3Q2FA 5L8TA 3QZTA 3QZVA 5CUAA 5EV9A 5CQ5A 2YDWA 4A9OA 5EVAA 4YYJA 5TB6A 2DVVA 5L8UA 3G0LA 4UYEA 5I88A 4NR7A 2NXBA 4YADA 3I3JA 5LKTA 5E3GA 5H1VA 5D25A 5D3SA 5LJ1A 4NR8A 2DVSA 4TT6A 2G4AA 4HBYA 4LDFA 5I40A 4ZC9A 2OUOA 3UV4A 5CQ6A 4RVRA 4YH3A 4HBVA 3JVMA 5EP7A 4J1PA 5L97A 3MULA 5CGPA 4CUTA 4YAXA 4HXSA 2R0SA 4NYWA 5F60A 5L98A 4O7AA 5FB0A 5LKXA 3ERRA 4HXNA 3D1BA 5DW2A 4NRBA 1JM4B 4O7CA 5HELA 4UYFB 2DKWA 3O33A 4QEVA 5EPSA 4A9HA 1EQFA 3DWYA 4MR3A 5FH8A 5CUCA 5CQ7A 5BT3A 4OGIA 5F1LA 5CRZA 4N4IA 3UVYA 4NRCA 4CUUA 5H85A 3SVFA 4O7BA 4NRAA 4FLPA 4QSWA 4OUFA 1F68A 5G4SA 4O77A 4TQNA 2DATA 5CTLA 3U5NA 5IGNA 5A83A 2RNWA 5H1TA 4NR6A
chains in the Genus database with same CATH topology
4HXMA 2YELA 3O37A 4UIYA 3GG3A 5F36A 3UV2A 4YABA 5II2A 5I1QA 5DKHA 4QC1A 4TZ2A 4O71A 4NQMA 2DVQA 5EWCA 5DKCA 5E9YA 2I8NA 5FFYA 5ENEA 5CQ4A 4WHWA 5KU3A 5D7XA 5A5OA 2WP1A 5COIA 5CY9A 2RFJA 5KO4A 2RI7A 4QYLA 3S92A 5E74A 4Z6IA 5ENJA 5CFWA 4N4HA 3DAIA 4UYFA 4OGJA 5DLZA 2F6NA 3O36A 5E3DA 5I29A 4NS5A 4LRGA 4IORA 4NR4A 5CUDA 4N4GA 3AADA 4YC9A 3D7CA 5C85A 4LZSA 3IU6A 3UW9A 4CUSA 4IR5A 5AD3A 3UV5A 1N72A 4BW4A 5AD2A 5DBMA 1X0JA 4QEWA 5FE2A 3O35A 5FE5A 4QY4A 4NYVA 5JWMA 2L84A 3JVJA 3S91A 1ZS5A 4BJXA 4O76A 4ALHA 4QZSA 5A5RA 3U5LA 5HFRA 5D26A 4YYNA 2WP2A 4PCEA 4QSPA 4DONA 5DFDA 5LKUA 5FFVA 2YQDA 4NUEA 5DKDA 4CURA 2R0VA 4NUDA 5EWWA 5FE1A 4CUQA 4Z93A 4YATA 5F2PA 4IR6A 5ENCA 5EWHA 2N9GA 5CQTA 4Z6HA 4PS5A 4NXJA 4YYGA 5IIDA 3UVDA 5CQ8A 5IGKA 5DYAA 5DYUA 5HENA 4YYDA 4LYWA 5FE8A 3TLPA 5FB1A 5EA1A 4ALGA 4O7EA 2YW5A 4KV1A 4CFLA 4YYIA 4TT2A 4TT4A 3HMFA 5ENGA 2L5EA 3MUKA 3U5KA 5FG4A 3JVLA 2RO1A 4IR4A 5DX4A 5CQ3A 5D3RA 2DWWA 4QR4A 5HFQA 5CUGA 3JVKA 4MEOA 4LZRA 4MENA 4QSTA 3LQJA 2RNYA 4IOOA 4XUBA 4QSQA 5A81A 3FKMX 5CP5A 5D3PA 5L96A 4MEQA 4QSXA 4A9LA 3U5MA 3P1CA 5HCLA 5LJ2A 5HEMA 3SVHA 4N4FA 5D3JA 3ZYUA 3MXFA 5F63A 4NYXA 5FG5A 3NXBA 2RS9B 5DYCA 5FE7A 2YYNA 4TZ8A 5FE0A 2H60A 5ETDA 5FFWA 4XY8A 4UIUA 5EGUA 4QBMA 4CLBA 4HBWA 4A9IA 4TU4A 5FH7A 4QNSA 4CFKA 5D3HA 5EPRA 5LVRA 4PTBA 4YH4A 4TYLA 4WHUA 5I83A 5A5PA 3Q2EA 5D3NA 5D3TA 5HRVA 4Q0OA 4MR6A 4A9KA 2DVRA 5ACYA 4BW1A 3LQHA 4LC2A 4N3WA 4A9EA 4GPJA 4KCXA 4MR4A 5CS8A 4J0SA 5ENIA 4QR3A 2LSPB 4XUAA 5TCMA 5C87A 2RNXA 4HXLA 4MEPA 5DYXA 5E0RA 4CL9A 3K2JA 5BT4A 3P5OA 5CZGA 4BW3A 5HRWA 3MQMA 5HQ7A 4QSUA 3P1FA 5FE3A 4NQNA 3UVWA 4A9NA 4UYGA 4A9MA 4LZ2A 4UYDA 4YYMA 5I89A 5C4QA 4YBMA 4O7FA 5KHMA 5FG6A 4Z1QA 5G4RA 4UIVA 5CQAA 4NR5A 5A85A 5DW1A 4PCIA 5I80A 4Q0NA 4Y03A 5CUBA 4QSRA 5IGMA 4UYHA 4E96A 4BW2A 4TTEA 4HXOA 3U5PA 2L85A 5DFBA 5ETBA 2KTBB 4J3IA 4UIZA 5HJCA 2YEKA 4C67A 5E73A 4ZQLA 5L99A 1JSPB 5ENHA 5C89A 5C7NA 4ZW1A 3O34A 4XYAA 5I7YA 5II1A 5FE9A 5F1HA 2OSSA 5DLXA 5AMEA 4CUPA 5C8GA 4QUUA 4WIVA 3HMHA 5HQ6A 5F61A 5LVQA 4C66A 4O74A 4AKNA 3G0JA 2YEMA 3MB4A 5CU8A 5E9VA 5HRXA 5LKZA 5EQ1A 4O78A 4UITA 5I86A 4A9JA 3UVXA 5K29A 5BT5A 3ONIA 4TU6A 5EICA 5EK9A 4YY6A 3LQIA 5HLSA 4BHWA 4QUTA 3U5JA 4LYIA 5EWDA 3U5OA 5EISA 4QEUA 5EWVA 5IBNA 5JI8A 5D24A 5E9LA 5LUUA 4UIXA 5F25A 5EM3A 4KV4A 2D82A 5AMFA 4O72A 2E7OA 5HM0A 4O75A 1WUMA 3IU5A 5IG6A 3LXJA 3MB3A 5ENBA 2FSAA 4YBTA 4PY6A 5E9KA 2MJVB 5CPEA 5D0CA 4QSVA 4IR3A 4IOQA 4TS8A 5FE4A 5KTXA 5F5ZA 2GRCA 3LJWA 4MR5A 5A5QA 5F3AA 4QSSA 4QC3A 3HMEA 4QR5A 5DFCA 2R0YA 5CRMA 4LYSA 5H1UA 5A5SA 3QZSA 5EU1A 4YY4A 5HQ5A 2E7NA 4A9FA 4HBXA 5A82A 5D3LA 4HXKA 5LJ0A 4XY9A 2R10A 4HXRA 2OO1A 3P1EA 5FBXA 4YK0A 5E9MA 5J0DA 5F62A 4NR9A 5FDZA 5E9IA 5I7XA 5DY7A 4QB3A 4F3IA 4UIWA 3RCWA 3P1DA 5E7DA 5EI4A 5FH6A 2D9EA 2I7KA 5ENFA 5KTWA 4X2IA 5KTUA 4YBSA 4HXPA 4O70A 5CUEA 5IGLA 4NUCA 4YYHA 4Z1SA 5A7CA 1WUGA 2E3KA 3SVGA 1E6IA 5EPBA 5FE6A 2F6JA 4YYKA 3AQAA 4J0RA 4PKLA 5A5NA 4LR6A 4QYDA 3Q2FA 5L8TA 3QZTA 3QZVA 5CUAA 5EV9A 5CQ5A 2YDWA 4A9OA 5EVAA 4YYJA 5TB6A 2DVVA 5L8UA 3G0LA 4UYEA 5I88A 4NR7A 2NXBA 4YADA 3I3JA 5LKTA 5E3GA 5H1VA 5D25A 5D3SA 5LJ1A 4NR8A 2DVSA 4TT6A 2G4AA 4HBYA 4LDFA 5I40A 4ZC9A 2OUOA 3UV4A 5CQ6A 4RVRA 4YH3A 4HBVA 3JVMA 5EP7A 4J1PA 5L97A 3MULA 5CGPA 4CUTA 4YAXA 4HXSA 2R0SA 4NYWA 5F60A 5L98A 4O7AA 5FB0A 5LKXA 4HXNA 5DW2A 4NRBA 1JM4B 4O7CA 5HELA 4UYFB 2DKWA 3O33A 4QEVA 5EPSA 4A9HA 1EQFA 3DWYA 4MR3A 5FH8A 5CUCA 5CQ7A 5BT3A 4OGIA 5F1LA 5CRZA 4N4IA 3UVYA 4NRCA 4CUUA 5H85A 3SVFA 4O7BA 4NRAA 4FLPA 4QSWA 4OUFA 1F68A 5G4SA 4O77A 4TQNA 2DATA 5CTLA 3U5NA 5IGNA 5A83A 2RNWA 5H1TA 4NR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXM A;  2YEL A;  3O37 A;  4UIY A;  3GG3 A;  5F36 A;  3UV2 A;  4YAB A;  5II2 A;  5I1Q A;  5DKH A;  4QC1 A;  4TZ2 A;  4O71 A;  4NQM A;  2DVQ A;  5EWC A;  5DKC A;  5E9Y A;  2I8N A;  5FFY A;  5ENE A;  5CQ4 A;  4WHW A;  5KU3 A;  5D7X A;  5A5O A;  2WP1 A;  5COI A;  5CY9 A;  2RFJ A;  5KO4 A;  2RI7 A;  4QYL A;  3S92 A;  5E74 A;  4Z6I A;  5ENJ A;  5CFW A;  4N4H A;  3DAI A;  4UYF A;  4OGJ A;  5DLZ A;  2F6N A;  3O36 A;  5E3D A;  5I29 A;  4NS5 A;  4LRG A;  4IOR A;  4NR4 A;  5CUD A;  4N4G A;  3AAD A;  4YC9 A;  3D7C A;  5C85 A;  4LZS A;  3IU6 A;  3UW9 A;  4CUS A;  4IR5 A;  5AD3 A;  3UV5 A;  1N72 A;  4BW4 A;  5AD2 A;  5DBM A;  1X0J A;  4QEW A;  5FE2 A;  3O35 A;  5FE5 A;  4QY4 A;  4NYV A;  5JWM A;  2L84 A;  3JVJ A;  3S91 A;  1ZS5 A;  4BJX A;  4O76 A;  4ALH A;  4QZS A;  5A5R A;  3U5L A;  5HFR A;  5D26 A;  4YYN A;  2WP2 A;  4PCE A;  4QSP A;  4DON A;  5DFD A;  5LKU A;  5FFV A;  2YQD A;  4NUE A;  5DKD A;  4CUR A;  2R0V A;  4NUD A;  5EWW A;  5FE1 A;  4CUQ A;  4Z93 A;  4YAT A;  5F2P A;  4IR6 A;  5ENC A;  5EWH A;  2N9G A;  5CQT A;  4Z6H A;  4PS5 A;  4NXJ A;  4YYG A;  5IID A;  3UVD A;  5CQ8 A;  5IGK A;  5DYA A;  5DYU A;  5HEN A;  4YYD A;  4LYW A;  5FE8 A;  3TLP A;  5FB1 A;  5EA1 A;  4ALG A;  4O7E A;  2YW5 A;  4KV1 A;  4CFL A;  4YYI A;  4TT2 A;  4TT4 A;  3HMF A;  5ENG A;  2L5E A;  3MUK A;  3U5K A;  5FG4 A;  3JVL A;  2RO1 A;  4IR4 A;  5DX4 A;  5CQ3 A;  5D3R A;  2DWW A;  4QR4 A;  5HFQ A;  5CUG A;  3JVK A;  4MEO A;  4LZR A;  4MEN A;  4QST A;  3LQJ A;  2RNY A;  4IOO A;  4XUB A;  4QSQ A;  5A81 A;  3FKM X;  5CP5 A;  5D3P A;  5L96 A;  4MEQ A;  4QSX A;  4A9L A;  3U5M A;  3P1C A;  5HCL A;  5LJ2 A;  5HEM A;  3SVH A;  4N4F A;  5D3J A;  3ZYU A;  3MXF A;  5F63 A;  4NYX A;  5FG5 A;  3NXB A;  2RS9 B;  5DYC A;  5FE7 A;  2YYN A;  4TZ8 A;  5FE0 A;  2H60 A;  5ETD A;  5FFW A;  4XY8 A;  4UIU A;  5EGU A;  4QBM A;  4CLB A;  4HBW A;  4A9I A;  4TU4 A;  5FH7 A;  4QNS A;  4CFK A;  5D3H A;  5EPR A;  5LVR A;  4PTB A;  4YH4 A;  4TYL A;  4WHU A;  5I83 A;  5A5P A;  3Q2E A;  5D3N A;  5D3T A;  5HRV A;  4Q0O A;  4MR6 A;  4A9K A;  2DVR A;  5ACY A;  4BW1 A;  3LQH A;  4LC2 A;  4N3W A;  4A9E A;  4GPJ A;  4KCX A;  4MR4 A;  5CS8 A;  4J0S A;  5ENI A;  4QR3 A;  2LSP B;  4XUA A;  5TCM A;  5C87 A;  2RNX A;  4HXL A;  4MEP A;  5DYX A;  5E0R A;  4CL9 A;  3K2J A;  5BT4 A;  3P5O A;  5CZG A;  4BW3 A;  5HRW A;  3MQM A;  5HQ7 A;  4QSU A;  3P1F A;  5FE3 A;  4NQN A;  3UVW A;  4A9N A;  4UYG A;  4A9M A;  4LZ2 A;  4UYD A;  4YYM A;  5I89 A;  5C4Q A;  4YBM A;  4O7F A;  5KHM A;  5FG6 A;  4Z1Q A;  5G4R A;  4UIV A;  5CQA A;  4NR5 A;  5A85 A;  5DW1 A;  4PCI A;  5I80 A;  4Q0N A;  4Y03 A;  5CUB A;  4QSR A;  5IGM A;  4UYH A;  4E96 A;  4BW2 A;  4TTE A;  4HXO A;  3U5P A;  2L85 A;  5DFB A;  5ETB A;  2KTB B;  4J3I A;  4UIZ A;  5HJC A;  2YEK A;  4C67 A;  5E73 A;  4ZQL A;  5L99 A;  1JSP B;  5ENH A;  5C89 A;  5C7N A;  4ZW1 A;  3O34 A;  4XYA A;  5I7Y A;  5II1 A;  5FE9 A;  5F1H A;  2OSS A;  5DLX A;  5AME A;  4CUP A;  5C8G A;  4QUU A;  4WIV A;  3HMH A;  5HQ6 A;  5F61 A;  5LVQ A;  4C66 A;  4O74 A;  4AKN A;  3G0J A;  2YEM A;  3MB4 A;  5CU8 A;  5E9V A;  5HRX A;  5LKZ A;  5EQ1 A;  4O78 A;  4UIT A;  5I86 A;  4A9J A;  3UVX A;  5K29 A;  5BT5 A;  3ONI A;  4TU6 A;  5EIC A;  5EK9 A;  4YY6 A;  3LQI A;  5HLS A;  4BHW A;  4QUT A;  3U5J A;  4LYI A;  5EWD A;  3U5O A;  5EIS A;  4QEU A;  5EWV A;  5IBN A;  5JI8 A;  5D24 A;  5E9L A;  5LUU A;  4UIX A;  5F25 A;  5EM3 A;  4KV4 A;  2D82 A;  5AMF A;  4O72 A;  2E7O A;  5HM0 A;  4O75 A;  1WUM A;  3IU5 A;  5IG6 A;  3LXJ A;  3MB3 A;  5ENB A;  2FSA A;  4YBT A;  4PY6 A;  5E9K A;  2MJV B;  5CPE A;  5D0C A;  4QSV A;  4IR3 A;  4IOQ A;  4TS8 A;  5FE4 A;  5KTX A;  5F5Z A;  2GRC A;  3LJW A;  4MR5 A;  5A5Q A;  5F3A A;  4QSS A;  4QC3 A;  3HME A;  4QR5 A;  5DFC A;  2R0Y A;  5CRM A;  4LYS A;  5H1U A;  5A5S A;  3QZS A;  5EU1 A;  4YY4 A;  5HQ5 A;  2E7N A;  4A9F A;  4HBX A;  5A82 A;  5D3L A;  4HXK A;  5LJ0 A;  4XY9 A;  2R10 A;  4HXR A;  2OO1 A;  3P1E A;  5FBX A;  4YK0 A;  5E9M A;  5J0D A;  5F62 A;  4NR9 A;  5FDZ A;  5E9I A;  5I7X A;  5DY7 A;  4QB3 A;  4F3I A;  4UIW A;  3RCW A;  3P1D A;  5E7D A;  5EI4 A;  5FH6 A;  2D9E A;  2I7K A;  5ENF A;  5KTW A;  4X2I A;  5KTU A;  4YBS A;  4HXP A;  4O70 A;  5CUE A;  5IGL A;  4NUC A;  4YYH A;  4Z1S A;  5A7C A;  1WUG A;  2E3K A;  3SVG A;  1E6I A;  5EPB A;  5FE6 A;  2F6J A;  4YYK A;  3AQA A;  4J0R A;  4PKL A;  5A5N A;  4LR6 A;  4QYD A;  3Q2F A;  5L8T A;  3QZT A;  3QZV A;  5CUA A;  5EV9 A;  5CQ5 A;  2YDW A;  4A9O A;  5EVA A;  4YYJ A;  5TB6 A;  2DVV A;  5L8U A;  3G0L A;  4UYE A;  5I88 A;  4NR7 A;  2NXB A;  4YAD A;  3I3J A;  5LKT A;  5E3G A;  5H1V A;  5D25 A;  5D3S A;  5LJ1 A;  4NR8 A;  2DVS A;  4TT6 A;  2G4A A;  4HBY A;  4LDF A;  5I40 A;  4ZC9 A;  2OUO A;  3UV4 A;  5CQ6 A;  4RVR A;  4YH3 A;  4HBV A;  3JVM A;  5EP7 A;  4J1P A;  5L97 A;  3MUL A;  5CGP A;  4CUT A;  4YAX A;  4HXS A;  2R0S A;  4NYW A;  5F60 A;  5L98 A;  4O7A A;  5FB0 A;  5LKX A;  4HXN A;  5DW2 A;  4NRB A;  1JM4 B;  4O7C A;  5HEL A;  4UYF B;  2DKW A;  3O33 A;  4QEV A;  5EPS A;  4A9H A;  1EQF A;  3DWY A;  4MR3 A;  5FH8 A;  5CUC A;  5CQ7 A;  5BT3 A;  4OGI A;  5F1L A;  5CRZ A;  4N4I A;  3UVY A;  4NRC A;  4CUU A;  5H85 A;  3SVF A;  4O7B A;  4NRA A;  4FLP A;  4QSW A;  4OUF A;  1F68 A;  5G4S A;  4O77 A;  4TQN A;  2DAT A;  5CTL A;  3U5N A;  5IGN A;  5A83 A;  2RNW A;  5H1T A;  4NR6 A; 
#chains in the Genus database with same CATH topology
 4HXM A;  2YEL A;  3O37 A;  4UIY A;  3GG3 A;  5F36 A;  3UV2 A;  4YAB A;  5II2 A;  5I1Q A;  5DKH A;  4QC1 A;  4TZ2 A;  4O71 A;  4NQM A;  2DVQ A;  5EWC A;  5DKC A;  5E9Y A;  2I8N A;  5FFY A;  5ENE A;  5CQ4 A;  4WHW A;  5KU3 A;  5D7X A;  5A5O A;  2WP1 A;  5COI A;  5CY9 A;  2EJN A;  2RFJ A;  5KO4 A;  2RI7 A;  4QYL A;  3S92 A;  5E74 A;  4Z6I A;  5ENJ A;  5CFW A;  4N4H A;  3DAI A;  4UYF A;  4OGJ A;  5DLZ A;  2F6N A;  3O36 A;  5E3D A;  5I29 A;  4NS5 A;  4LRG A;  4IOR A;  4NR4 A;  5CUD A;  4N4G A;  3AAD A;  4YC9 A;  4AKG A;  3D7C A;  5C85 A;  4LZS A;  3IU6 A;  3UW9 A;  4CUS A;  4IR5 A;  5AD3 A;  3UV5 A;  1N72 A;  4BW4 A;  5AD2 A;  5DBM A;  1X0J A;  4QEW A;  5FE2 A;  3O35 A;  5FE5 A;  4QY4 A;  4NYV A;  5JWM A;  2L84 A;  3JVJ A;  3S91 A;  1ZS5 A;  4BJX A;  4O76 A;  4ALH A;  4QZS A;  5A5R A;  3U5L A;  5HFR A;  5D26 A;  4YYN A;  2WP2 A;  4PCE A;  4QSP A;  4DON A;  5DFD A;  5LKU A;  5FFV A;  2YQD A;  4NUE A;  5DKD A;  4CUR A;  2R0V A;  4NUD A;  5EWW A;  5FE1 A;  4CUQ A;  4Z93 A;  4YAT A;  5F2P A;  4IR6 A;  5ENC A;  5EWH A;  2N9G A;  5CQT A;  4Z6H A;  4PS5 A;  4NXJ A;  4YYG A;  5IID A;  3UVD A;  5CQ8 A;  5IGK A;  5DYA A;  5DYU A;  5HEN A;  4YYD A;  4LYW A;  5FE8 A;  3TLP A;  5FB1 A;  5EA1 A;  4ALG A;  4O7E A;  2YW5 A;  4KV1 A;  4CFL A;  4YYI A;  4TT2 A;  4TT4 A;  3HMF A;  5ENG A;  2L5E A;  3MUK A;  3VKH A;  3U5K A;  5FG4 A;  3JVL A;  2RO1 A;  4IR4 A;  5DX4 A;  5CQ3 A;  5D3R A;  2DWW A;  4QR4 A;  5HFQ A;  5CUG A;  3JVK A;  4MEO A;  4LZR A;  4MEN A;  4QST A;  3LQJ A;  2RNY A;  4IOO A;  4XUB A;  4QSQ A;  5A81 A;  3FKM X;  5CP5 A;  5D3P A;  5L96 A;  4MEQ A;  4QSX A;  4A9L A;  3U5M A;  3P1C A;  5HCL A;  5LJ2 A;  5HEM A;  3SVH A;  4N4F A;  5D3J A;  3ZYU A;  3MXF A;  5F63 A;  4NYX A;  5FG5 A;  3NXB A;  2RS9 B;  5DYC A;  5FE7 A;  2YYN A;  4TZ8 A;  5FE0 A;  2H60 A;  5ETD A;  5FFW A;  4XY8 A;  4UIU A;  5EGU A;  4QBM A;  4CLB A;  4HBW A;  4A9I A;  4TU4 A;  5FH7 A;  4QNS A;  4CFK A;  5D3H A;  5EPR A;  5LVR A;  4PTB A;  4YH4 A;  4TYL A;  4WHU A;  5I83 A;  5A5P A;  3Q2E A;  5D3N A;  5D3T A;  5HRV A;  4Q0O A;  4MR6 A;  4A9K A;  2DVR A;  5ACY A;  4BW1 A;  3LQH A;  4LC2 A;  4N3W A;  4A9E A;  4GPJ A;  4KCX A;  4MR4 A;  5CS8 A;  4J0S A;  1ZKR A;  5ENI A;  4QR3 A;  2LSP B;  4XUA A;  5TCM A;  5C87 A;  2RNX A;  4HXL A;  4MEP A;  5DYX A;  5E0R A;  4CL9 A;  3D1D A;  3K2J A;  5BT4 A;  3P5O A;  5CZG A;  4BW3 A;  5HRW A;  3MQM A;  5HQ7 A;  4QSU A;  3P1F A;  5FE3 A;  4NQN A;  3UVW A;  4A9N A;  4UYG A;  4A9M A;  4LZ2 A;  4UYD A;  4YYM A;  5I89 A;  5C4Q A;  4YBM A;  4O7F A;  5KHM A;  5FG6 A;  4Z1Q A;  5G4R A;  4UIV A;  5CQA A;  1PUO A;  4NR5 A;  5A85 A;  5DW1 A;  4PCI A;  5I80 A;  4Q0N A;  4Y03 A;  5CUB A;  4QSR A;  5IGM A;  4UYH A;  4E96 A;  4BW2 A;  4TTE A;  4HXO A;  3U5P A;  2L85 A;  5DFB A;  5ETB A;  2KTB B;  4J3I A;  4UIZ A;  5HJC A;  2YEK A;  4C67 A;  5E73 A;  4ZQL A;  5L99 A;  1JSP B;  5ENH A;  5C89 A;  3VKG A;  5C7N A;  4ZW1 A;  3O34 A;  4XYA A;  5I7Y A;  5II1 A;  5FE9 A;  5F1H A;  2OSS A;  5DLX A;  5AME A;  4CUP A;  5C8G A;  4QUU A;  4WIV A;  3HMH A;  5HQ6 A;  5F61 A;  4AKH A;  4AKI A;  5LVQ A;  4C66 A;  4O74 A;  4AKN A;  3G0J A;  2YEM A;  3MB4 A;  5CU8 A;  5E9V A;  5HRX A;  5LKZ A;  5EQ1 A;  4O78 A;  4UIT A;  5I86 A;  4A9J A;  3UVX A;  5K29 A;  5BT5 A;  3ONI A;  4TU6 A;  5EIC A;  5EK9 A;  4YY6 A;  3LQI A;  5HLS A;  4BHW A;  4QUT A;  3U5J A;  4LYI A;  5EWD A;  3U5O A;  5EIS A;  4QEU A;  5EWV A;  5IBN A;  5JI8 A;  5D24 A;  5E9L A;  5LUU A;  4UIX A;  5F25 A;  5EM3 A;  4KV4 A;  2D82 A;  5AMF A;  4O72 A;  2E7O A;  5HM0 A;  4O75 A;  1WUM A;  3IU5 A;  5IG6 A;  3LXJ A;  3MB3 A;  5ENB A;  2FSA A;  4YBT A;  4PY6 A;  5E9K A;  2MJV B;  5CPE A;  5D0C A;  4QSV A;  4IR3 A;  4IOQ A;  4TS8 A;  5FE4 A;  5KTX A;  5F5Z A;  2GRC A;  3LJW A;  4MR5 A;  5A5Q A;  5F3A A;  4QSS A;  4QC3 A;  3HME A;  4QR5 A;  4AI6 A;  5DFC A;  2R0Y A;  5CRM A;  4LYS A;  5H1U A;  5A5S A;  3QZS A;  5EU1 A;  4YY4 A;  5HQ5 A;  2E7N A;  4A9F A;  4HBX A;  5A82 A;  5D3L A;  4HXK A;  5LJ0 A;  4XY9 A;  2R10 A;  4HXR A;  2OO1 A;  3P1E A;  5FBX A;  4YK0 A;  5E9M A;  5J0D A;  5F62 A;  4NR9 A;  5FDZ A;  5E9I A;  5I7X A;  5DY7 A;  4QB3 A;  4F3I A;  4UIW A;  3RCW A;  3P1D A;  5E7D A;  5EI4 A;  5FH6 A;  2D9E A;  2I7K A;  5ENF A;  5KTW A;  4X2I A;  5KTU A;  4YBS A;  4HXP A;  4O70 A;  5CUE A;  5IGL A;  4NUC A;  4YYH A;  4Z1S A;  5A7C A;  1WUG A;  2E3K A;  3SVG A;  1E6I A;  5EPB A;  5FE6 A;  2F6J A;  4YYK A;  3AQA A;  4J0R A;  4PKL A;  5A5N A;  4LR6 A;  4QYD A;  3Q2F A;  5L8T A;  3QZT A;  3QZV A;  5CUA A;  5EV9 A;  5CQ5 A;  2YDW A;  4A9O A;  5EVA A;  4YYJ A;  5TB6 A;  2DVV A;  5L8U A;  3G0L A;  4UYE A;  5I88 A;  4NR7 A;  2NXB A;  4YAD A;  3I3J A;  5LKT A;  5E3G A;  5H1V A;  5D25 A;  5D3S A;  5LJ1 A;  4NR8 A;  2DVS A;  4TT6 A;  2G4A A;  4HBY A;  4LDF A;  5I40 A;  4ZC9 A;  2OUO A;  3UV4 A;  5CQ6 A;  4RVR A;  4YH3 A;  4HBV A;  3JVM A;  5EP7 A;  4J1P A;  5L97 A;  3MUL A;  5CGP A;  4CUT A;  4YAX A;  4HXS A;  2R0S A;  4NYW A;  5F60 A;  5L98 A;  4O7A A;  5FB0 A;  5LKX A;  3ERR A;  4HXN A;  3D1B A;  5DW2 A;  4NRB A;  1JM4 B;  4O7C A;  5HEL A;  4UYF B;  2DKW A;  3O33 A;  4QEV A;  5EPS A;  4A9H A;  1EQF A;  3DWY A;  4MR3 A;  5FH8 A;  5CUC A;  5CQ7 A;  5BT3 A;  4OGI A;  5F1L A;  5CRZ A;  4N4I A;  3UVY A;  4NRC A;  4CUU A;  5H85 A;  3SVF A;  4O7B A;  4NRA A;  4FLP A;  4QSW A;  4OUF A;  1F68 A;  5G4S A;  4O77 A;  4TQN A;  2DAT A;  5CTL A;  3U5N A;  5IGN A;  5A83 A;  2RNW A;  5H1T A;  4NR6 A; 
#chains in the Genus database with same CATH homology
 4HXM A;  2YEL A;  3O37 A;  4UIY A;  3GG3 A;  5F36 A;  3UV2 A;  4YAB A;  5II2 A;  5I1Q A;  5DKH A;  4QC1 A;  4TZ2 A;  4O71 A;  4NQM A;  2DVQ A;  5EWC A;  5DKC A;  5E9Y A;  2I8N A;  5FFY A;  5ENE A;  5CQ4 A;  4WHW A;  5KU3 A;  5D7X A;  5A5O A;  2WP1 A;  5COI A;  5CY9 A;  2RFJ A;  5KO4 A;  2RI7 A;  4QYL A;  3S92 A;  5E74 A;  4Z6I A;  5ENJ A;  5CFW A;  4N4H A;  3DAI A;  4UYF A;  4OGJ A;  5DLZ A;  2F6N A;  3O36 A;  5E3D A;  5I29 A;  4NS5 A;  4LRG A;  4IOR A;  4NR4 A;  5CUD A;  4N4G A;  3AAD A;  4YC9 A;  3D7C A;  5C85 A;  4LZS A;  3IU6 A;  3UW9 A;  4CUS A;  4IR5 A;  5AD3 A;  3UV5 A;  1N72 A;  4BW4 A;  5AD2 A;  5DBM A;  1X0J A;  4QEW A;  5FE2 A;  3O35 A;  5FE5 A;  4QY4 A;  4NYV A;  5JWM A;  2L84 A;  3JVJ A;  3S91 A;  1ZS5 A;  4BJX A;  4O76 A;  4ALH A;  4QZS A;  5A5R A;  3U5L A;  5HFR A;  5D26 A;  4YYN A;  2WP2 A;  4PCE A;  4QSP A;  4DON A;  5DFD A;  5LKU A;  5FFV A;  2YQD A;  4NUE A;  5DKD A;  4CUR A;  2R0V A;  4NUD A;  5EWW A;  5FE1 A;  4CUQ A;  4Z93 A;  4YAT A;  5F2P A;  4IR6 A;  5ENC A;  5EWH A;  2N9G A;  5CQT A;  4Z6H A;  4PS5 A;  4NXJ A;  4YYG A;  5IID A;  3UVD A;  5CQ8 A;  5IGK A;  5DYA A;  5DYU A;  5HEN A;  4YYD A;  4LYW A;  5FE8 A;  3TLP A;  5FB1 A;  5EA1 A;  4ALG A;  4O7E A;  2YW5 A;  4KV1 A;  4CFL A;  4YYI A;  4TT2 A;  4TT4 A;  3HMF A;  5ENG A;  2L5E A;  3MUK A;  3U5K A;  5FG4 A;  3JVL A;  2RO1 A;  4IR4 A;  5DX4 A;  5CQ3 A;  5D3R A;  2DWW A;  4QR4 A;  5HFQ A;  5CUG A;  3JVK A;  4MEO A;  4LZR A;  4MEN A;  4QST A;  3LQJ A;  2RNY A;  4IOO A;  4XUB A;  4QSQ A;  5A81 A;  3FKM X;  5CP5 A;  5D3P A;  5L96 A;  4MEQ A;  4QSX A;  4A9L A;  3U5M A;  3P1C A;  5HCL A;  5LJ2 A;  5HEM A;  3SVH A;  4N4F A;  5D3J A;  3ZYU A;  3MXF A;  5F63 A;  4NYX A;  5FG5 A;  3NXB A;  2RS9 B;  5DYC A;  5FE7 A;  2YYN A;  4TZ8 A;  5FE0 A;  2H60 A;  5ETD A;  5FFW A;  4XY8 A;  4UIU A;  5EGU A;  4QBM A;  4CLB A;  4HBW A;  4A9I A;  4TU4 A;  5FH7 A;  4QNS A;  4CFK A;  5D3H A;  5EPR A;  5LVR A;  4PTB A;  4YH4 A;  4TYL A;  4WHU A;  5I83 A;  5A5P A;  3Q2E A;  5D3N A;  5D3T A;  5HRV A;  4Q0O A;  4MR6 A;  4A9K A;  2DVR A;  5ACY A;  4BW1 A;  3LQH A;  4LC2 A;  4N3W A;  4A9E A;  4GPJ A;  4KCX A;  4MR4 A;  5CS8 A;  4J0S A;  5ENI A;  4QR3 A;  2LSP B;  4XUA A;  5TCM A;  5C87 A;  2RNX A;  4HXL A;  4MEP A;  5DYX A;  5E0R A;  4CL9 A;  3K2J A;  5BT4 A;  3P5O A;  5CZG A;  4BW3 A;  5HRW A;  3MQM A;  5HQ7 A;  4QSU A;  3P1F A;  5FE3 A;  4NQN A;  3UVW A;  4A9N A;  4UYG A;  4A9M A;  4LZ2 A;  4UYD A;  4YYM A;  5I89 A;  5C4Q A;  4YBM A;  4O7F A;  5KHM A;  5FG6 A;  4Z1Q A;  5G4R A;  4UIV A;  5CQA A;  4NR5 A;  5A85 A;  5DW1 A;  4PCI A;  5I80 A;  4Q0N A;  4Y03 A;  5CUB A;  4QSR A;  5IGM A;  4UYH A;  4E96 A;  4BW2 A;  4TTE A;  4HXO A;  3U5P A;  2L85 A;  5DFB A;  5ETB A;  2KTB B;  4J3I A;  4UIZ A;  5HJC A;  2YEK A;  4C67 A;  5E73 A;  4ZQL A;  5L99 A;  1JSP B;  5ENH A;  5C89 A;  5C7N A;  4ZW1 A;  3O34 A;  4XYA A;  5I7Y A;  5II1 A;  5FE9 A;  5F1H A;  2OSS A;  5DLX A;  5AME A;  4CUP A;  5C8G A;  4QUU A;  4WIV A;  3HMH A;  5HQ6 A;  5F61 A;  5LVQ A;  4C66 A;  4O74 A;  4AKN A;  3G0J A;  2YEM A;  3MB4 A;  5CU8 A;  5E9V A;  5HRX A;  5LKZ A;  5EQ1 A;  4O78 A;  4UIT A;  5I86 A;  4A9J A;  3UVX A;  5K29 A;  5BT5 A;  3ONI A;  4TU6 A;  5EIC A;  5EK9 A;  4YY6 A;  3LQI A;  5HLS A;  4BHW A;  4QUT A;  3U5J A;  4LYI A;  5EWD A;  3U5O A;  5EIS A;  4QEU A;  5EWV A;  5IBN A;  5JI8 A;  5D24 A;  5E9L A;  5LUU A;  4UIX A;  5F25 A;  5EM3 A;  4KV4 A;  2D82 A;  5AMF A;  4O72 A;  2E7O A;  5HM0 A;  4O75 A;  1WUM A;  3IU5 A;  5IG6 A;  3LXJ A;  3MB3 A;  5ENB A;  2FSA A;  4YBT A;  4PY6 A;  5E9K A;  2MJV B;  5CPE A;  5D0C A;  4QSV A;  4IR3 A;  4IOQ A;  4TS8 A;  5FE4 A;  5KTX A;  5F5Z A;  2GRC A;  3LJW A;  4MR5 A;  5A5Q A;  5F3A A;  4QSS A;  4QC3 A;  3HME A;  4QR5 A;  5DFC A;  2R0Y A;  5CRM A;  4LYS A;  5H1U A;  5A5S A;  3QZS A;  5EU1 A;  4YY4 A;  5HQ5 A;  2E7N A;  4A9F A;  4HBX A;  5A82 A;  5D3L A;  4HXK A;  5LJ0 A;  4XY9 A;  2R10 A;  4HXR A;  2OO1 A;  3P1E A;  5FBX A;  4YK0 A;  5E9M A;  5J0D A;  5F62 A;  4NR9 A;  5FDZ A;  5E9I A;  5I7X A;  5DY7 A;  4QB3 A;  4F3I A;  4UIW A;  3RCW A;  3P1D A;  5E7D A;  5EI4 A;  5FH6 A;  2D9E A;  2I7K A;  5ENF A;  5KTW A;  4X2I A;  5KTU A;  4YBS A;  4HXP A;  4O70 A;  5CUE A;  5IGL A;  4NUC A;  4YYH A;  4Z1S A;  5A7C A;  1WUG A;  2E3K A;  3SVG A;  1E6I A;  5EPB A;  5FE6 A;  2F6J A;  4YYK A;  3AQA A;  4J0R A;  4PKL A;  5A5N A;  4LR6 A;  4QYD A;  3Q2F A;  5L8T A;  3QZT A;  3QZV A;  5CUA A;  5EV9 A;  5CQ5 A;  2YDW A;  4A9O A;  5EVA A;  4YYJ A;  5TB6 A;  2DVV A;  5L8U A;  3G0L A;  4UYE A;  5I88 A;  4NR7 A;  2NXB A;  4YAD A;  3I3J A;  5LKT A;  5E3G A;  5H1V A;  5D25 A;  5D3S A;  5LJ1 A;  4NR8 A;  2DVS A;  4TT6 A;  2G4A A;  4HBY A;  4LDF A;  5I40 A;  4ZC9 A;  2OUO A;  3UV4 A;  5CQ6 A;  4RVR A;  4YH3 A;  4HBV A;  3JVM A;  5EP7 A;  4J1P A;  5L97 A;  3MUL A;  5CGP A;  4CUT A;  4YAX A;  4HXS A;  2R0S A;  4NYW A;  5F60 A;  5L98 A;  4O7A A;  5FB0 A;  5LKX A;  4HXN A;  5DW2 A;  4NRB A;  1JM4 B;  4O7C A;  5HEL A;  4UYF B;  2DKW A;  3O33 A;  4QEV A;  5EPS A;  4A9H A;  1EQF A;  3DWY A;  4MR3 A;  5FH8 A;  5CUC A;  5CQ7 A;  5BT3 A;  4OGI A;  5F1L A;  5CRZ A;  4N4I A;  3UVY A;  4NRC A;  4CUU A;  5H85 A;  3SVF A;  4O7B A;  4NRA A;  4FLP A;  4QSW A;  4OUF A;  1F68 A;  5G4S A;  4O77 A;  4TQN A;  2DAT A;  5CTL A;  3U5N A;  5IGN A;  5A83 A;  2RNW A;  5H1T A;  4NR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...