4UYQA

High resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the c-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
143
Chain Sequence
MLQVDIGSTSGKAGSVVSVPITFTNVPKSGIYALSFRTNFDPQKVTVASIDAGSLIENASDFTTYYNNENGFASMTFEAPVDRARIIDSDGVFATINFKVSDSAKVGELYNITTNSAYTSFYYSGTDEIKNVVYNDGKIEVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell-surface Attachment of Bacterial Multienzyme Complexes Involves Highly Dynamic Protein-Protein Anchors.
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
molecule tags Cell adhesion/protein binding
molecule keywords Cellulosomal scaffoldin anchoring protein C
total genus 30
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4uyqA01
2Y3NA 5G5DA 1ZV9A 4UYQA 2ZF9A 5K39A 4UYPA 1ANUA 1G1KA 4FL4C 4WKZB 3L8QA 3F2LA 4IU3A 2O4EA 5AOZA 3KCPB 3GHPA 2CCLA 2OZNA 3UL4A 1TYJA 2BM3A 2VN6A 4FL4B 2VN5A 2VO8A 3BWZA 3KCPA 2JH2A 4IU2A 1AOHA 5LXVA 4UMSA 4WI0A 4N2OA 4U3SA 1OHZA 2XDHA 2B59A 1QZNA 2W1NA 4DH2A 3FNKA
chains in the Genus database with same CATH superfamily
3V4UH 1T5WA 4FCHA 4GQQA 4WJKB 4A7VA 1UD2A 1J8HD 2OXHA 2SEBA 1A6WL 5I8KH 1BQHG 1CDGA 4TUKH 1F8TH 5SV4A 2IPUK 3H9SB 1YY9C 4WUUB 5FK9A 5GQBA 5A2BA 1JF1A 2H26B 1VESA 3AG4B 3Q1EA 4P46D 4XBMA 2YA1A 4DOHB 1G9NL 5L2KE 1JZFA 3NIDE 4ANKA 2D3LA 3DBXA 5C9KA 3P73B 4GQZA 2HJLA 4FQXC 1D5IH 4GSUA 1DQKA 1QSEA 4PG2C 2UZXB 1IBGL 1R5VA 3VXRB 4UILL 4MB5A 2QPSA 2H47C 3L3GA 2IMNA 4EE2A 5EB9A 5EORH 2GTWA 1DVTA 2D9QB 2PW1B 3BT2L 3IGUA 1OSEA 4N5UA 4U7SA 5M95B 1OM9A 5ACMA 2VZSA 1ET8A 4BZ2A 4B97A 2ODHA 2OXHB 2SEBB 1GL4B 1WFOA 4IDJH 1S9XA 3NIDF 2VGLM 1KGWA 2OYPA 1NINA 2EINB 5CUSL 4WF7A 2R59A 3FO2B 5DD0L 4JK0D 3KBEA 1WITA 3VGEA 3QO1A 4ABUA 4N8PA 4XNBA 1NANH 3CZEA 3EYOB 5IFAL 1F3JA 3OMZA 4WGKA 1U93B 2DKMA 2EEAA 4ZFFB 1QYGH 1CLCA 1P5UB 3A6BL 5CEZH 3TFKD 5AVSB 3NGBB 1RJZA 3U83A 1TZHA 3SE4A 3IN2A 3SGKC 2YBGA 4DKFH 3MNWA 4UNTA 3MV9E 3T0VA 1RMFL 1P6FA 1WVZA 2NX5B 3BP6B 3IBEA 3QEQE 2VSDA 4NGHH 3QCTH 1XGQB 4OAWA 5J6GB 2K7PA 5IBTL 4YSEA 2YQGA 2A73B 4IKNA 4Z1PA 4H1LG 5FM5O 1FZKB 3C2SA 3U25A 4RX4A 2D7TL 1EX0A 5EC2B 2QQLL 3EFFB 2Y2YA 4GKNB 1GCYA 4Z3TA 1UWGL 4WWPA 5A2KH 5KJRH 2Y36L 3MXVH 4H2AA 1SRDA 4K9JA 4OFIA 3KPSA 3WEXB 5IVOA 5DD3L 2Z8WC 1YYLL 4UIKL 3B3IB 2ADYA 3BPCB 1ZE3C 1T7ZA 1J0ZA 3L8QA 4Y5VC 2AABH 3AQXA 2BWDA 4GI9A 3W0WA 3GSUB 4Y2DD 4HWEH 3AY4A 4JY6B 4YC2C 2IGFH 2FUQA 4HHGA 1DJGA 2C9XA 2N01B 2LLLA 1RPKA 2FECL 4GLRI 4ZMXA 2ZOWA 2CLRB 3X3GL 1KB3A 3S96A 4KMTL 2JQAA 4U3SA 3DX2A 1XO8A 1U91A 4N9GB 3TZVC 5KANI 4LHUG 1VADA 3ARBA 2GJ6A 5DYOA 1RL1A 3C12A 2XZAH 4R97B 5L6YL 3SKJH 4JRYB 1ZVYA 1W2KT 2VSKB 4BK4A 3DETD 5I30L 2E27L 5LJYH 1YUHA 2Z4QB 4X7EC 5EU3B 1VF5C 5DQJB 4YVNA 5I1EL 5HVWA 1N19A 5J6HB 1UA7A 2IEPA 3VXRD 4LKCA 3GGWA 1ZOXA 3QZWG 4Z3EA 9CGTA 4X7SL 3PV6A 1MG3C 1ZD6A 2IPTL 3R18A 1YC7A 1YSOA 2CUIA 4ERSH 5LBSA 3LMJH 5I74B 3OX8B 5EA0H 2E7MA 2YPKA 1XSOA 4PRPE 5DHMC 3C6SB 4APQB 3SGKA 3KBFA 2GUOB 4G8FA 4YL4A 5GGVH 1PW3A 1YC8A 2J6EH 2QADB 1E2ZA 1ASQA 4OGAC 5BV7C 2DYPA 3BFWA 2VXUL 4RFEB 4DUVA 1SVCP 4MJ2A 3CFDB 3ULUL 3REVB 1N6VA 3ELQA 1J1PH 3I9AA 1M4KA 1M7UA 4NQEE 4ADIA 5MEOA 1OANA 5J06A 3OHXB 1DO5A 4F91B 3AY2A 2A3TA 4ZFOB 1BVNP 5CP3A 2BXZA 3HLAA 5JHDB 2WD0A 4MAYC 4TNVK 3DSNB 2P26A 2WAQA 3QUYD 3JSSA 3X1GA 4NQCB 4G6AD 5TFSH 4XXDB 3PNWA 3U7YH 3QORB 1U3HB 1KPRB 2FJGA 1CL7H 3VXTB 4XPHL 5HDQH 3NVQA 3QZLA 1DZ0A 5KSUA 3MUHL 4OGQC 4PCYA 4G70B 1KLFA 5KJRL 5BVJA 2EVHA 2CRZA 1KCVH 1IAKA 3GD1C 1LO4H 1IE5A 5FS5A 4NJAL 2A38A 1IZJA 2P24A 3CXHK 4Y2DB 3TBWB 4OV5A 1XB3A 3R4DA 3L13A 3ZDYB 4D0CA 3T1FB 4QRRD 2F8VA 1DQLH 3ZL1A 2PTTB 4S1SH 3V0EA 1IAIM 3FQ4A 3QJQB 1N7MH 5D71H 4KI1A 5EBGA 1FP5A 3T65B 4CKQA 3L5JA 3PHQA 4I2XB 2KPWA 5I5JA 1DBJL 5AOJA 4XNZC 5IBUB 3UZVB 2AV7B 3S5YA 1UVQB 3I6GB 1WAEA 1OO2A 2WINB 5JPNC 3KR3H 4N0YH 1HH6A 5I24A 3BAWA 1KTLA 5DSCB 3G04A 3DOSA 3E2HC 1EDHA 1NL0L 2BIPA 2FHCA 1TJIL 4AW4A 3CHSA 5F89B 1WYJA 2XJKA 4XPAL 5E5MA 4FA7B 3SGJA 2VLJB 3NIDB 3UL4A 4F2EA 1MIEH 2HTKD 4ZFQA 5JUEH 1U36A 4HFUH 3MRGB 5F0LB 5CJQH 3DDGA 4JKMA 3FSWA 4RDQG 2H2SD 4G8FB 4ZSOB 2P80D 3GXUB 3VTTA 4LSQH 2YMTA 3GXPA 3QZBA 3B1UA 4QAMB 3RGVD 3THML 2FT7A 5JORB 4JM2F 4R7DA 4JRXD 1BZEA 1MRFL 3FHAA 3E3QC 4G71B 5EOQL 2VAAB 4M1DL 2RACA 5DJXB 3QH3B 4EZKA 3FTZA 3RRQA 4S0SD 3PJSB 2P5EE 1BG1A 2BXYA 4QTIL 3AWGA 4R7LA 5C0JA 3CVHL 3AU0A 4PS3A 4E5XB 1FSKC 3MBWB 2PCPB 5KOMC 2E6PA 4FQIH 4H8WH 5DJ8B 2JELL 3FU5A 3RWEA 2YFOA 4X0NA 1TG8A 2IBGA 5DD0H 2GIMA 1H8NA 5FUOH 3T2LA 4MJHA 3QFJA 3RVTC 2KLSA 4DKTA 1WAAF 1L3NA 1JIBA 1HHKA 1GZPB 2NXYB 3BPNB 5E95B 2P5WD 1VENA 4CILA 1JXKA 1VRSA 1HHHA 1G7MA 2CXKA 2ETWA 4GP4B 1I8KA 3IDNA 1XTLA 4M5YH 1RMFH 3HMXH 5DDHA 3GK8H 3I6KA 4AYMC 3DO7A 4LLVB 1DJWA 3SQBA 3SYPA 3TTSA 3BVNB 1MHCB 4XB7A 4JFPA 5BJTA 1MREL 1KJ3L 2ZUYA 4B9KC 4XPBL 3EW3B 4J8QA 2WCGA 4DO4A 4R5VA 4FP8L 4FFZH 2O6CA 2TRYA 1T03L 1ES0B 1UTDA 3U0WH 2FEDC 1QATA 4M7ZB 4K7PY 2EEDA 2JKSA 1X5IA 1F6AA 4KI5D 1FNLA 1JGUH 2DLGA 4R0LA 1UEMA 2CBOA 4Z6AT 1DCLA 1MI5E 4AZ8A 1BPLB 2AVFA 4FTVB 3ZZLA 3OPZL 4HIIA 2YD9A 4KMQA 3LPOA 5C97A 5J11C 2WKGA 5BZWB 3FQWA 4PJIA 3RZCD 1BVLB 4JGUA 5HHNA 5CFAA 2OYKA 1GZQA 1MCWW 5E8NB 3RDTB 4JJHA 2E0PA 1IGIL 1LE5B 3DNKA 4WV1B 3FBQA 5DQ9B 4RGNC 3CHOA 4OI8A 1A5FH 3KLHD 3TNNB 4PJHB 4UM8B 5AUMB 5IMOA 1J5CA 5CR8A 4MVBD 1NA8A 2HRPL 3WY1A 1DSWA 2HUEA 1K3IA 1V05A 2YXWA 5LHDA 3MX0A 4PJGA 1CG9B 5EZIL 5BZZA 1E5ZA 4BKLB 3DYMA 3LY6A 3WJJA 5C0CD 4AITA 1R5VB 2C9RA 3OR6A 3RFZC 1PU0A 1UD6A 4GI8A 3TCLB 3FT3A 1HT6A 4OZFB 4RMBA 1QFHA 3BMWA 4J6RL 3S5LB 2WPGA 2X4TB 3MKGA 2KZ1B 2AK1L 3CUPB 4B41A 2YO3A 3S96B 3C6SA 3MUUA 2DM2A 3DRQB 3UGUA 4APQA 2CLRA 3FJTA 4XH2B 1IQWL 5IROD 2I9TB 1CICC 3ZE0E 1HYSD 2XTJB 4G6FB 3QJHA 4KK8D 5DJ0A 4F3FA 1UEYA 4FNTA 4LIQL 4P46B 2F58L 2PXYA 2EE9A 5CLXA 4KXZI 4H5SA 4JE0A 3QAZB 4WI5A 2BWIA 1T1YB 2A0LC 5DHVH 1YVLA 1HXKA 4NP4L 4PJ7E 1G9MH 1KBWA 4RGOH 3UBXI 1JGDA 4D0BB 2H41A 4C56E 5IJBC 5D1QD 1UWXK 3IMWA 4XN5A 5LGYA 5IFJB 1PZ5A 2FBOJ 3FB6B 4YIQA 4CBZA 2H8PA 5GIRB 4UQ2A 2CLVA 5LWYH 3B9DA 2CSPA 5KVDE 4XE5B 3V6OC 4G7RB 1B4LA 4KHTL 1CE6B 3CZFA 5HVGB 3BUPA 2UV3A 1SMDA 3BW9B 5CGYC 4JFEB 2NYYC 3MMEB 2ZKWA 3RY6C 1H8LA 4DJMA 1QLFB 2YK1L 3O45A 4ZOAA 5KYXB 3OQRA 5B3NA 5C08D 4KK9C 3AG2B 5MENA 3VWKD 4LBEA 4MZ3A 1FYTA 3MTXA 4YHOL 2CD0A 1V7MH 2FH8A 4HH9B 4OM0H 2R2HB 1U93A 1FFRA 4GW4A 1G94A 2BSSA 1U92A 1M7DB 1PDKA 2GSMB 5IREA 2X6VA 2ITCB 3LZNA 4Q6IB 2J88L 2D2OA 3C5ZB 2B2XL 3NFNB 3ULVL 2QELA 3BKCH 4PRAB 5D93B 2YJQA 3X11A 1BQ5A 2ZSVB 3QPQD 2GT9B 2ZCHL 1HILB 1Q9OB 2X7LA 4XRCB 4ZMOA 4JO4L 4ZX6A 3AWEA 5FYJU 2EADA 3BP5B 4MCZA 4TQPA 4ZUWB 1OCRB 2DYSB 3GI8L 2NCEA 1KYFA 3TEUA 4OLYL 1AO7A 5L4IA 4CU6A 1HEJC 1YECL 3H4FA 2X6AA 3QK0A 4M7KH 2BDNL 3DX3A 2FEEI 3TJHC 4Z5RA 5JIDA 2XICA 3D9AH 3BZEA 3NK3A 1H15B 4B96A 1QFWM 2DWSA 2ODIA 1BSIA 1OD9A 4LDLB 3JTTA 3GMOB 4L4TB 4YHLH 1AQHA 2PNDA 3EBAA 4FNPA 4HLJA 4JO8A 2EYRA 1OIOA 1ZTMA 2YPKB 5CBAA 1LWRA 2BSCA 4HUXB 5F0JB 1FL3A 3B34A 5FYJD 5K9KA 5EU5B 2P80A 3CQFA 3MRHB 4WGWB 4Y7MA 5HHXL 4ANUA 5LUMA 5DMGD 4JRXA 5D7SH 5ETUA 2E3VA 2WP3T 1GGCL 2J21A 3EBHA 3HUJF 3LD8B 4QY8B 3UJJH 1SYSA 1YUHB 3O6LL 1KPVB 3QEUB 4G8IA 4UT7H 4HUWA 4EKXA 4GAGH 4HGMA 2EIZB 1DN0B 4QCIB 5I74C 4FERA 5IBLD 3UPRB 1T5XA 2K3HA 2P5EB 3ZOAA 1A21A 4FF9A 3FZUC 5ITBL 4Y9BA 1UWEH 4XI5D 1XIWD 3V0WL 1R3KA 3SCMA 5C0GB 1X7QA 4UBDC 4Y4HA 2W38A 2VUYA 2VR4A 1HTYA 1CICB 5ABZA 1T5WB 5IFHL 1LK3H 1ND0B 2AJYL 1QRKA 4P07A 4RNRB 4X6CF 4KJWD 4NRXA 1IILE 4FG0A 4L4VE 3ULAB 5E94B 4P9HL 1IKNC 4KFZC 5T3ZL 1QLEH 1U8QA 2F7IA 1A64A 1KG0B 4AIZA 3STLB 2OMZB 3BP4A 3VFWB 1RPUA 1RLWA 4M1DH 1PZBA 2BWQA 5HVHC 2DD8L 4PJ9D 1WBXA 3BKJH 2WLIB 1AGEB 4IRJB 2PTUA 3IFPB 4BCZA 4EI5A 1KJ2L 2APWA 1WGVA 5EBLB 1MUJA 2CJUL 4GG6B 2GI0A 4QLRA 4A6YL 3VWJA 3AJ7A 2OMNA 3TA4D 5CZXD 1S7QA 4U1LA 5HGAA 1MPAL 3MVSA 1AIZA 4CN6A 4YHIA 4TM9A 3RDJA 5D9SA 4TL4A 1AP2A 4XP6H 3OXRA 4G7YL 4FKKA 3QORD 4N6QA 4IDLA 4TNGA 1U3HD 3GO1L 1E90A 3EHBB 3KYKL 3QEHA 3CVCA 4UM9D 1BFVL 1MW1A 1MIMH 5LGHL 1R24B 2ATKA 3EOAB 1XF1A 4Z7QB 1FZMB 4U6YB 5GRXG 4H0IA 3KW7A 3AMLA 5CLTA 5E9DD 2V3DA 1L9PA 1A7PL 4RSYA 2MTPA 4K2UH 4LF3A 1DP0A 3K81A 2FBJL 2NY2B 1NLBL 3VXUB 5A2FA 4OUOA 3KVQA 1HSBB 3R06A 3HZVA 4CVXA 3JWDL 3PAZA 1PCSA 2FSEB 4HCRA 4L8SB 2EUVA 2F8OA 4I88A 3RL1A 3HN3A 3PABA 3EZJB 3UCRA 1UD5A 2PW1A 2VDRL 3NESA 4W9CC 3F83A 3KPRB 4YEEA 4Q9QL 4GKZB 4XVOA 4MQ7B 1FGNL 2QHLA 3EO1A 3MLTA 4WI8A 2OMUA 2C1PA 5IY5B 2EP6A 1SOSA 3POHA 1PLCA 4XTRD 2XWBB 1G7HA 2DAVA 2ZX5A 3UOAB 4X7CC 3IAGC 5H35A 4RRPG 1BYOA 5AG9A 5EWIH 3V4PA 1OZUA 4L0PB 3W39A 2J57A 4YDVA 3V4UL 1K72A 1NH6A 1S7WA 2YD6A 1NFDB 4A7UA 3B37A 1WF5A 1KLUA 1BVZA 4UYQA 1LE5A 2CR3A 4RA0C 4Z0XB 1OTSD 1ANUA 5DI8A 4A04A 2XPYA 3S2CA 5C0DA 3D6GA 3BGMA 3BD3A 4AK2A 4Z7NB 5DJCB 3HZYA 3VWKC 3DJTA 2EDOA 5D7LD 1XH3B 2WXFA 4IRSA 3NEOA 1SMOA 1E9QA 2FLBT 3HUJB 4F92B 3ARUA 1IAOA 2VLME 4PUBL 4BUQA 5JOFA 3CFJA 2XSKA 5JZ7C 1BLNB 5LWYL 3DV4B 4LHJB 4G6KL 1J9RA 2VITB 5J12B 1GRWA 3QDGA 4WHTB 4PLJC 5FKAB 3MPCA 1T1XB 2NXYC 3BPNC 3KWXA 3VD7A 1EZVX 2NZIA 5B39A 3SOBH 3LPGA 2OJZL 5E6ZA 1FZJA 1KB5A 4MDIB 2WWMD 3MA7B 1NGXA 1NGQH 3O11B 3GB7B 3MV8B 3WNJA 3GO1H 5LQBL 2XN1A 4PRNA 1EK3A 1ETB1 1RJLA 1L0XA 4NM4H 2WQRA 1FYTB 4UMSA 4CW1B 3CZUB 3EJSA 4JM2A 2XPGB 1D6VH 4NT6A 3AVEA 1HYSC 1Z0MA 1I1RA 2VISB 3RBSA 4EUPG 5IMLA 1RQ5A 2OA9A 1IEBB 3KL5A 1S5IL 2EYSB 4J4PA 4APXA 4QKXB 5L2KD 1OTUD 2AV1B 1Q9KB 1UD3A 1UXSB 3CSYA 2Z64C 2FEEL 1UKTA 2OMTA 3GSXB 4O9HH 3IRPX 1OT1A 4PPTA 5E9NA 5GIRA 4MZRA 5C1MB 5F1SA 3RWEB 4OLVH 1S7UB 2BM3A 3PL6D 5KBDA 2X0VA 3MBWA 2DM3A 1F11B 1P5VA 5J0BA 2C3VA 1JK9A 1RULL 3MZTA 4JL2A 4ZMYA 4N24A 5LVEA 3MRMB 1H9DA 1O7DC 2YK1H 1BAGA 3QWNA 4XOEA 5TK4A 2VQ1B 3IFNL 2F9BT 5DMKA 4ZQTA 1YYLH 1MF2L 5DS2A 2HCZX 4XAKD 2FE0A 1T0NA 2OMYB 3N91A 4ZAKA 1JHTA 3LHPL 4U6HA 3RVWD 2EIKB 2UVEA 2F8XC 2DF3A 4MMXA 4DO6A 4MQTB 4HEPA 3GBNH 5DR5H 1CU4H 1ODUA 4ALAH 3CIQA 3I85A 4H2CA 5EBWA 4DK5A 3BAJA 1OM3L 2BVQB 4OB5L 3DHPA 3WUWB 4L3EE 4YLCA 3VXME 4AV0A 2L7QA 4K94C 5CEYA 1KB5H 4WI7A 4JQXC 3KJ4C 5KSBB 3BVVA 4BUHA 5FKPB 5CIPH 4JO1L 1NFIA 4D9QD 4J3UA 4UNVA 5G5DA 3APNA 2HAZA 3C6LA 3T09A 4JFQA 3L48A 3VXSE 4A2LA 3RFZA 1BQLH 4D8OA 3QXUA 5CKGA 5C09D 4OLUL 4OI7A 3NPSC 3CN0A 3RZWA 3LN4B 2IPTH 4N1CA 4Q52A 3WV0A 2VZTA 5D7IE 1I8UA 1GZQB 3JWOH 4BDVA 3GSWA 1NFDF 2H6PB 5BZWA 2WBWB 1EHAA 4RZCB 4ZS7H 1YEHL 2LAGB 1KEGH 5I66A 3O2DA 3UZEA 4ACPA 2YKLL 2J1WA 3NN8A 2QGDA 3MRLA 5C0RH 2YPLD 5EHFA 1LO4L 5L2JB 2R15A 2R9HD 5IWLA 1DUYA 2Y1AA 2W80C 4NCC1 5MENB 1YN7B 1XCQB 3VM7A 4NKDB 3SDXA 3FONA 5AZEL 4ODHL 2AQQA 3MBXL 4L4VB 4UDTA 2KKQA 1OB0A 3AQYA 3EYSL 2CM6A 3V5DA 5BVJB 5E1AB 1T2JA 3ESVF 3D87B 3S8FB 3TJPA 4L1DA 1IARB 3E7JA 2HT2D 2Z7YA 1HN1A 3WLWD 1JPST 5D1QB 2C1OA 1YCSA 1PEZA 4NXSA 1AZCA 2WLHA 2BIIA 3LIUA 2D8KA 2J1YA 5FGBC 3MOBH 1FAKT 1CXHA 1FZOB 2KMWA 5J9PB 2DQJL 2X6CA 4Z3HA 1MFBH 1A4JB 2WBJD 3HG4A 3IJYB 5DO2D 5JQ6L 5DVKA 3PGFH 1A6AB 4IOFD 1JGLL 4R8WL 4NKDA 4Y9FA 3F7YA 4ZXBB 1DUYB 1CGUA 3WE6B 5AZUA 2C8NA 1XEDA 2ZXAA 5FM8A 2XG5A 2XC8A 1JVKA 4NERA 3LHPH 2QVKA 1U95B 4PH8A 4ZTOL 4NJ9L 4P2QB 3B9KC 1Z5HA 4BFIB 2DQDH 5DMIH 4PRIA 3L7FB 3MLXL 3HI5L 4Y16D 2ZZUT 3C6LC 4M8QB 4XN7A 4FLRA 1KCLA 2DQTL 5HYJE 5D8JH 1JL8A 2GSGA 3DPDA 3EGSA 1S8DB 4MQSB 4OD2B 4IBQA 1PY9A 5TDOB 4ZNCD 3AS0A 3EDJA 1S3KH 4DW2H 2XTLA 4EBQH 3ESMA 5JIQA 1P84J 1BFSA 1ZY9A 1KC5H 4C8XA 1IM3D 4AT6A 3J27A 2YARA 4FABH 3HLKA 4KNSA 5J1AB 4KX8A 2A6DA 4AV4A 2ZPKH 1A6AA 3S6CA 1W6LA 1U2YA 3CC5A 4IRZH 4KY1H 5JW4Q 2AV7A 2FECI 1UADC 2XIDA 5EU3A 2Y7NA 3JTSB 4U31A 2OMWA 5LCVA 4GRMA 3WMPA 3QUZA 3VFUA 5CCKH 4A7SA 5D96C 3ES6B 4YN3A 3IXAA 1NMBL 2MQ0A 3NJGA 4HK3N 2F6AA 4NN6B 4E41D 3LKNB 2HTKC 4HS3A 4K0OA 4XNMA 4F57L 3IE9A 3H7BB 2FWOB 5C0IA 4F8QA 3GRGA 3IJHB 2X6MA 3VD0A 3VXQB 4JKLA 4L5FL 3MRRA 1QSFE 5KWYC 1EHNA 3O3DB 5E4IA 4KAQH 3MBEA 1AGFB 1OOWA 2EDXA 1QUPA 2BVYA 3FN0L 3QYMA 3Q2WA 4XP9H 1D9KD 1F6FB 3K2KA 4XZUB 5A3IC 4WDIA 4C56D 1RJLB 3ZTEA 5HBBA 1D6EA 2W07B 5DVMA 4IJ3C 3IS0X 3QCVH 4PY7B 2O5NA 4ZJ9A 4OZHB 5H37H 1RHHB 2FIKA 1EMTH 2DKUA 4V1DA 1X5LA 1O5PA 3DHMA 2HYMA 2R1WA 2F7OA 4K3HA 2IOIA 4PBDA 3MHZA 3H0TA 4Y8DC 5DMYA 5I6PA 3TWCL 2OJEA 3PDDA 1M2OA 3ZDXE 4HK0A 2N0MA 2K4AA 4PJ5B 4F5CA 3MOBL 3UYOD 3A6CL 1UXLA 4WWKA 5C0ND 3IE4A 3HPJA 3DVGA 3JV6B 1AGFA 1HINH 1IE4A 3N1MC 3ARWA 1Z2KA 1XGUB 3O3DA 2GHWB 4K8RH 5IB3A 3RFZB 5IHLB 2PWHA 3C6LB 1XH3A 2K9UA 3UAJD 2DH3A 4JHVA 3IETA 3UADA 3VD9A 5F2FA 3RVVD 5EO0A 3NSCA 5FF6B 1UB6A 4NOFA 4P5TD 5F3FA 3KPSD 4IJ3B 3K80A 2R23B 4J1UA 5DUBB 5KVFH 5EG6C 5BXFB 2B15A 2X40A 3EH5B 4XNXL 4DAGH 2DQTH 3W11D 2Z8RA 2EVIA 2XWDA 1D5XB 3ARQA 1R3KB 2ENSA 2JK5B 1ZIBA 3U9PH 4NBXB 3WENA 5F7KC 4Z76B 3OZ9L 3U79A 1Q9LB 1E6JH 3D0VA 2QBWA 4O5LL 4R4NC 4BZ1L 2EEFA 3NA9H 4JRXE 4Y1AE 5IGXL 4FYSA 4NKMB 3C60B 3ZR5A 4PR5A 5D7JA 2W60A 3GNMH 3PF2A 4PLJD 1T7XA 3SZ6A 4GW1B 2ZUQB 5LKNA 2OMUB 1F90L 3V6OE 5DT1H 3TT1H 2PCYA 3SDYL 5KVFE 1P4LB 4DQOH 1AQKH 1CU4L 4WO4B 1SFHA 5ABAA 3H54A 1CLYL 3TO2A 5FO9B 3VMNA 1DFBL 2XWZA 2Z7ZA 4IMLA 2WLYA 3BUDA 4TULH 4Z7UB 4MMXC 3LEVH 1ZHNA 1KENH 3ABLB 4FLSA 4J4PC 1NMBH 4CU8A 4DEPB 4K9EH 1X5FA 2WGNB 2P4AB 1E8WA 4FQLH 1F8TL 3FT2B 5DZLA 2VDOB 5BUAA 4N5EC 2IMMA 1UA6H 4J3OF 1LDPH 4V2BA 4JFVA 3L45A 4UB0H 3DO4A 3KPRD 1QR1B 2FT8A 2YRZA 4P2CG 4CSTA 4ZTPH 3HZMB 4OCWL 3KXFE 3MLTB 2IC2A 5GRWA 4XP1H 2YOAA 4Q9RL 5DQDL 1KIRB 2N0KA 4N0UB 2FX8H 5HHQA 3SGDI 2ZIDA 4ODBD 1TZGH 1B2WL 2KL6A 2NXYD 3S88H 1DBMH 3QZMA 1R3IL 1ILSA 3DIFB 3S35H 3DBSA 3UTZA 4M00A 1LO5A 1AZRA 3X13A 4WUUE 1SUHA 1KXVA 3DX9B 3HZVB 4LGSB 3BP6A 5A3ID 3VTAA 4HWZA 4YH6A 4JFUA 4ZYKB 3QJTB 1NEPA 4UTBA 3VQ2C 1Q0EA 1IIKA 3F7VA 4KK8C 2XN9D 3CQQA 1ZCRA 3IGAB 3MRLB 2WVVB 1LXMA 4XMTA 1DEDA 3KPTA 4Y2DC 1CFMA 2O30A 4G9FA 2MCMA 4HXAL 1J0JA 1KG0A 4BK5A 4PJFA 4AM0B 5JMOC 4FJZA 4FQQB 1GTNA 4X7DC 2HFEA 3H85A 5EC2A 3UYPA 1GGIL 2VMCA 3FRUA 3QQDA 5JUEL 3VVWA 1BIIB 2CGYA 2W9DL 3C5ZC 4F37K 5L6YH 5M7QA 1S7SA 5GS2H 2Q3XA 1JZIA 1QEXA 3KGUA 2IBZY 4KTDH 3ULUE 4ZFOA 1WWBX 4L37A 2CLVB 2COVD 3L08A 2WSKA 5EOQH 5AOMA 1NKRA 4N2NA 5DJYB 4GP8B 5GXBB 3O3AA 5FW6A 5GS0D 3VD1A 4TUOB 5E51A 2QGCA 4F1ZA 2UXGA 1T4KB 4L8BB 4URTB 1WFTA 4WU5A 3UFIA 1QR1A 5DT1L 1NGYA 4PGDA 1DJHA 2YQBA 3RE0A 3MOAH 3T04D 3NMEA 2A9NH 3J07A 3RVUC 2AI0H 2H6UA 2WXOA 2B14A 2BRRH 1MHPL 4LCCB 3QZOA 1LWHA 2WGXA 2K4WA 3PHOB 2OBGA 4G5AA 2BZCA 4PRID 2HFGL 3WHXB 5EU6B 1U8MB 1TLKA 3MGAA 3O81A 1CQYA 2LABA 2VDNB 5KSAB 1D5RA 3IGFA 2VDRB 4GW5A 4CDGC 3PP4H 3BAYA 4GG8A 3BGFC 2GTWB 4K5OA 5IBLC 2IAMB 3SZKC 2FEDD 1QSVA 3BKML 5BV7H 5FYJH 1G9HA 1VPOL 5EBMB 1QBLL 2EXYD 4WU5B 4UTBH 2ZCLL 1P1ZB 4KZDL 2ZXCA 4AQ8C 5I8CA 4OCRL 4QUOA 2HLFC 3GIZH 3HNVL 3KPPB 1JYWA 1R5IA 2EDWA 5DYOB 1UM4L 4ZBJA 4E9RA 4NBYB 1GYVA 2Q3ZA 1KJ3H 3RWHA 5HYQA 4IOIB 1TZGL 5EA0L 3P4LA 3QAQA 4YSSA 4XAKE 2BP0B 4APXB 3NDYE 4PCTA 4W6XB 5AB2A 1OEZW 4R97C 4O2FB 1I1YA 4UQAA 3UX9B 4MCMA 4X4ZA 4AQZA 4BWTA 5DHVB 3BISA 4UQ3A 2WLZA 1YDPA 4MHHI 3STZA 3IM1A 2Z65C 3HHRB 4UI2A 3RTQA 3Q2LA 3IU4H 4S2SA 3FXIC 4JPWH 3DI3B 2D0HA 2EILB 3MUGB 1AP2B 4QRUB 4HDIA 1NPUA 1HKLL 1K8DA 3EYVA 4XCEB 4F7KA 5JNYA 4JNXA 2CDEB 3GSQB 3N04A 4TUKL 5FO8B 2KZKA 1V3LA 4PLKC 1L7IL 1Q38A 4ES9A 1MCJA 2MHAB 4LK4A 3BJLA 5C09B 3L9RB 5I5MA 1PX8A 3CXFA 4PV8B 5JHAA 3NIFE 1UWEL 2FDBP 1A5FL 4OLVL 4DZ8A 1JXJA 1XEUA 4RVBA 3OF6A 5DJDB 1AGEA 2E9GA 2P8MA 3Q6FB 4HV8A 4PRDA 3FU0A 5C0AD 3HVNA 4OD1H 3BVNA 2XV3A 1HINL 3IDIA 2AXHA 2XACC 1PY0A 3FDWA 1M7IB 1QFUL 5LXGH 3LQZB 3SKOA 3CNKA 5E6ID 4GUCA 4HJUA 4U6XA 1CLZH 2R83A 4XZUA 1CLOH 1KTKE 5ITFA 4WRLA 5J11B 2JTDA 1IIIA 4BZ1A 1JWSB 2DD8H 5CJQL 3DUUB 2NY5H 4PV9A 2AKRA 3ILDA 4X9YA 3LV3B 3QWOB 1ETJA 3L54A 1KGXA 4X4YA 5JPMC 1N9PA 4DIXA 1DYZA 1E4WL 3DIVA 3FTGB 5KVDL 5I1HL 4L3CB 3QNZB 1PPIA 5AVQB 3UP6A 2OTWA 1UJ3B 4N2HA 4RFNC 5MERA 4NLHA 4AE0A 5DFVC 3ROLB 1U30A 5BZDB 3D05A 4XMPH 4Y2LA 1RD6A 5D7JB 4M1GL 4TSAL 5EEWA 2F19L 1UJTA 4JRYE 4YDLB 1EA9C 3D3VB 5E23A 3GMNA 4ZS6D 3T2NH 2DOCA 4F3FB 1RK1B 2EEBA 2H26A 4MB3A 2KBGA 1WAAA 4HKXB 4NQED 4KZEL 3T3MF 2AJUL 4LT7A 3E9TA 3JYCA 4U1IA 4CRPA 2V9TA 4PWEA 3QPQC 2X4NA 3UBXG 2XOTA 1ZHNB 4FQLL 4NZ8A 1NOAA 3ZE2F 3D50A 3FQWB 5CP7A 1S9VA 2R0ZL 5C07D 1L5GB 3UTPD 3TT3H 3LNIA 3VD5A 4FXGC 1A3RH 3DTXB 3WS3A 3RKPA 1CZ8H 1WZ1L 5LNEA 3F04A 5T3XD 2Y2TA 1U8NA 1JZHA 2IGFL 3MROB 1XGUA 3C60A 5IB4B 1U4EA 2J56A 3F7YB 4JPWL 3HC3L 3LEYH 2IXQB 3ZJAA 2NUTA 2VR5A 3BH9B 3QDJA 3V10A 3P30H 3S3DB 5A6MA 2G30A 2NY2D 3U1SH 5HYIA 5EUOF 4CADA 2VM4A 4X6BB 4Z7VF 2A0LD 1Q94B 1JE6A 1I75A 4OLEA 4FQ2L 4UOW0 3RBGA 1E5CA 4Q97A 4L8CB 3ESUF 1KCUH 2VYRE 1F4WH 1L6ZA 1PG7X 5F7YC 4AKOA 4ABQA 3ECBB 3K0WA 3VI4A 1U6AH 1FE8L 1YZZA 4KQ4H 4HUKB 4NRXB 4N0FB 4QRPD 4MNQA 2Y6SD 3N9GL 3T6VA 4G9FD 5EO1B 3F6LA 3GK8L 2Z93A 1AD0B 1C5BL 3MR9B 3WIFA 3ZHFA 2CHNA 1DQQB 3GDCA 3MN8A 2X2IA 2IH1A 4KK5C 4Z7UA 1JSYA 1U0QA 3GSNA 3PIQB 1T5XB 4JCMA 2DQIL 2DICA 4FFVC 3IFLH 5DURD 2OL3A 5KYWA 2FCBA 4KOBA 4HBCL 4UAOC 5CJ5A 3LKRA 3NJNA 4ZO7A 3KE0A 2FB4H 3EBGA 3S98A 2XUWA 3PPSA 1OL0A 3QQNA 5ICYA 4JPIA 43CAB 1RK0B 1KACB 4XXWC 2CK0L 3BWUC 1UXMA 2R0LL 1OKEA 3GS0A 3EIFA 2RFXB 3WTVA 4EN3A 2EDJA 3VA2C 2F5BL 5I1DB 5E8DH 5G5DB 2DTMH 1LM8V 4OB5H 4NQEB 4B0MM 2BVEA 4P23A 5T1JA 1GH7A 5SWSE 5ID0A 5TH2A 4CGUB 1TVBA 4FJYA 1J88A 5HI4C 1C12A 4MXQD 5BXFA 3FL7A 4N2IA 4OFQA 4PJIE 2ESVB 2PO6B 3O6FB 1XXDC 3N1QC 5EH1A 4AEFA 3CLFL 1ONQB 3EYQC 4POYA 5E5MB 4KTDL 2G2PA 3Q8FA 4IBLT 4P4RA 1T5KA 1YEFL 1Q4NX 4ALAC 5DJYA 4DF9A 3QDMD 1DBAL 2WWOA 3P02A 2B1AH 1HHGA 3S8WA 1KPUA 5HI5C 4Y5YB 4YE4H 4G1MB 3PWLB 4PM1A 3SPJA 3FRPG 2Q2LA 5EDSA 2PKDA 2Y3NA 3QUMH 3JVGA 4K5LA 4N2EA 4XT1C 2O61A 2JCCB 4HZAA 3VFVA 4AOFA 4CA4A 1MDTA 2D7TH 3H53A 3GBNL 4JRYA 4B95C 1WBZA 2J44A 4I0PC 5LNDA 1G84A 2DMBA 3PAVA 4Z7OB 4DKEL 4EO5A 5ENWA 3HE7D 3UXFA 1C7TA 2HP4A 2R23A 3BPOB 3E6HA 4XP6L 2YR3A 1KYUA 1RZFH 5IJVB 2ZX7A 3IKKA 4QT5A 1Y07A 3HFFA 4HG4K 1XSJA 1XAUA 4UT6H 4LCWE 2COQA 2H2SC 3CPLA 5F9JB 2YAQA 2C9SA 4K8RC 1QUNA 4XN9A 3D0LA 1J8HA 3NH7H 4HHAA 1U6AL 1QBML 2BP3A 2G2NA 3K3QA 5FYJL 4MA3A 3UTTD 4U1MA 5BS0B 1OAZH 2AQ3A 2MQGA 1UOKA 5DTFB 3VGHA 4IW4C 2HVKA 1JV2B 1K4DB 3BRDA 4DGWC 4JFED 4OUUA 3EDFA 4I3RH 2O5YH 1OTTD 5IQ9B 1SBSL 1BZQK 2G75A 3N0AA 1BVKB 4FZ8L 4UTAA 4YFLI 1MFBL 2X1OA 3DLQR 1XF4A 4W6WB 3VDCA 1PQZB 2DZEA 4FFTA 3U6XA 3RNQB 3QJUB 3AB0B 3RKDC 5JPMA 3PFQA 4F7TA 1VCAA 4KK6C 4D0DB 1KIPA 3OB8A 3VXOB 4OF5A 3HJEA 3B2PA 4KKLD 4EN2A 4GO9A 2QR0A 3HMWL 4JZNA 2EC9T 1YEEH 3NN8B 1EUUA 4PJAA 4XH2A 3ZYJA 3EYSH 3M88A 4OLXL 4YAQB 2PTVA 4HWEL 3D12B 1NC2B 2UY7B 1AHWC 1M1XA 2D7NA 3LIZA 2B5IC 4RQQB 4OJFH 5TH2B 4Y4KC 1R3LB 4OCLC 5BRZE 3NCEB 4BFIA 2OMWB 1S9WA 2C9PA 1YEGH 4OSUL 4U1NA 2C7FA 3PJNA 3RJDA 1XR9B 3ZKXB 5JPNA 5JHDA 3T4AB 3MRCA 1EXUB 4R3SA 1MFNA 2D03L 3FYIB 1HS6A 4Z9KB 4OVUA 1KIUB 3NYKA 3QIUC 2X6UA 5EDXA 4X7TB 5I19L 3Q44A 1MNUH 4QJ4B 5A16B 3T77A 2DMCA 2R4SH 3DURB 3JV4A 1U3YA 2NY6D 3VH8G 2P3YA 1TTAA 1X5HA 4RFEA 5I6LA 3UEZA 2WQWA 3CDGA 1VADB 1IEHA 2H2PD 4PJBE 2J6EL 5I0WA 2UYLB 3MJ6A 4DKEH 4R9HA 1AHWB 3CZKA 2L8AA 4Y1TA 1ID2A 1W0WA 3MLWH 4P2QA 4M61A 2HKAA 1P9MA 5EZJA 1AMXA 2ADIB 5KBPA 1FO0H 4FXGA 2JI1A 1QFWI 4Y2DA 4AJVA 4AJWA 1PLBA 4Z78A 2GTZB 3D51A 3SDDC 5HGHB 4AIOA 1VZHA 2K8QA 1YYMH 1QSFD 3BKJL 2GJJA 3W0WD 5I75B 1E4XI 1MJ8H 1T22B 1RJCA 4NBZB 2XZCL 1OGAD 5CSZB 1NGXB 4F1SA 3N41F 2EDFA 4UF7C 5GGRY 5HYSG 1Q8MA 5HDBB 1A9BB 3P9LA 1IJNA 4N2GA 4PW9A 4WSJA 1CFNB 2X3AA 4N2MA 1PF3A 3V2AR 2JCCF 4OZFH 1DSYA 4URKA 3W9EA 2XXFA 2J1KA 2YWYA 3Q6GL 4BV1A 4CGTA 3N50A 1JCVA 1JNNL 3EGXB 4JDZA 5IVXB 2BCKA 1KNOA 4M4RA 4DHLA 3D4GA 3L5XH 3NSFA 1FAIL 4F8TA 1AQDB 1MIML 3DVIA 1HHHB 2VR7A 5LGHH 5CLZA 5EIIA 1JZ4A 4NI3A 1HL4A 3FUFA 4TUUA 4JANB 4U1SA 4BSVB 2A9DA 3AAZA 3FU7B 5DD1H 4D9LH 3PGCA 3O9WA 2R1XA 3CDCA 1CDIA 1KJMA 1RIUH 1XGYL 3ABKB 2B20A 3IJHA 4GRLB 2LFEA 5F1OB 3VFPA 3B8YA 3NCYP 3BEWB 5AYUH 4YK4B 1QFPA 2FJGB 5FO7A 2A77L 1M9WA 5FB8B 1K5NB 5F72S 2HFGH 2G2RB 2IBZX 8PAZA 1XH2A 4Q9QH 4KI5E 2UWEF 3VCLB 2R1YA 1CXLA 1QWNA 2BP0A 4WY7L 4F7MB 1C08B 2FD6L 4NZTH 3IDJA 4OFVA 5IZ7A 1UB5A 4OIBA 4GXUM 2IH8A 2P5EA 1M56B 1PLGL 4Y16B 3DJ9A 4DP4X 4ONHA 1DDHB 4N0YL 3EYFA 4CVZB 1SBBA 3K6SA 5LDSA 3IEAA 2DLHA 5D6CB 5B3SB 5T1KD 5I19H 3S97C 3D06A 3L7EB 4IEFB 3T3PB 1I8IB 2MKWA 1YPZF 3G5YA 3DROB 2V2XA 3IS1X 4PJAE 1JI1A 2ORBL 2UUDK 3TF4A 3HC0A 2PYEA 4KJYA 1U95A 5IBUG 4IOSA 3WKML 1W0VA 1NEZB 3PHOA 5BQ7A 3RTQC 2JIXA 2VDPL 3G04B 5SV3A 2VISA 1HWGB 2NY0D 2VIRA 3EYUH 3LRSB 1OOAA 3APMA 4JAMB 4YHYB 2Y5QA 1EQWA 3KYNB 4WFED 2ZX6A 1HQ4A 3X3FL 3CBRA 5SWQB 2V5YA 2HXAA 2I07A 4QRPE 5B8CA 4M9OA 4R83A 4PTTB 3MRKA 1Z1WA 2FX8L 1I9IH 1UGNA 2KT6A 2VQ4A 5ECJE 3OC8A 1NGZA 4X99B 3FQXA 1AQKL 3RWIA 1RZIA 4Q56A 5L0QB 1BAFL 1EEQA 1HFUA 1SDYA 3A21A 1YEIL 1SXCA 1A4KA 2CO3A 3GC3A 1NAKH 1RFDH 2ICWI 2DQFA 3QWOA 4WNQA 4X4YB 3G6JB 7FABH 3B2DC 1A1MA 3P69A 4PV9B 5FFGA 4HS8L 1T0OA 2UX6A 3D2TA 1GYUA 4JN1L 4M7KL 4NM4L 5JW3L 2ROXA 3ISRA 4NHCH 1CR9L 4HF5L 3ISYA 2W9LA 3RZCC 4PGZA 1RJZB 1NCTA 5LBGA 4IRZA 1SOXA 1QBMH 1C1EH 3QFJE 4IU3A 3VRJB 2AS5M 3WFCH 2CJ3A 3G08B 1E7UA 3QXDB 5IOPA 2GITA 4LEXL 2BVOB 4NDMB 2VR6A 1RIUL 1MLBA 4AGQA 4GRLD 3CPUA 1JZJA 3TIDB 1MY7A 1GGBL 3OSKA 4QHPA 4H0LC 1DVYA 1ND0A 1QLFA 2P7TA 1SHMA 4JFEA 1FYHB 2XWXA 5GJTL 3RDTC 4PP2A 2WZPA 3H3BC 3QUZC 1M42A 5IVZA 1IGFH 2W59A 3RWHB 4I0KA 5CCJA 2XQBL 3WXWH 2A9AA 2BY0A 3FF7A 4L5FE 1JGVL 1RU9H 1TF4A 1QTPA 3PP3H 2DS4A 4PJEF 4B0MB 2H1PL 4A67A 3HMWH 3CH8A 3CK0L 3BUYA 1CDCA 3NH7L 4UQ3B 2AI0L 2WB7A 1D5MB 2R2BB 1WAAE 3K6DA 2VDMB 4RNRA 1JPGA 1JF1B 4FFZA 1A6UH 1R3HB 3B43A 1I3GL 2WXNA 3BE1H 3OKEB 1OZTG 2AJYH 2FO8A 3BD4A 5TE7H 2FO1A 3BUBA 2AHIA 1OT2A 4JHAL 4U6HB 2FL5A 1IGJA 1KULA 1DEEA 2YSTA 2WXQA 2Z31B 3ZMNA 3Q5TA 1B4RA 2Q2EB 2WTPA 1E3XA 3GIVA 4WNSA 4WK2B 1QW9A 1G9NH 2K6WA 3DX4A 3KYMB 3LSOA 3QULB 4UV7H 4LLDA 1OP3H 2B4CL 2JMRA 3NRQA 4S10A 4HYTB 2F61A 4QMEA 4V1DE 3DXAD 1N5YH 1DDHA 4Y19B 1U3ZA 3GBDA 3RDTD 1CF1A 2OV0A 1B4TA 4QRRE 2I27N 5F9WB 4PTUB 3WMQA 2R69A 4A6YH 4OBSA 4MCZB 5T3ZD 3MXWL 4KV5F 2YQ2A 4WKZB 4QXTA 3H9SA 3CFCH 4AGOA 4OD3H 3L3OB 1XZWA 4J28A 1CI3M 3E8VA 1IFHL 2XN9E 5MEQB 1NCIA 3U2SA 1JHLL 1MWAH 3TTYA 4I48A 4YHZL 1R5WB 1YY8B 2BHZA 5CUSH 4JFXA 4ANWA 3F3HA 4G8AC 4L1LA 2ESVD 2PO6D 1WWWX 1LP9B 3P3TA 5DJZB 1C1EL 3HI1A 5TF0A 1RZKL 3WNIA 4RGOL 2A6JA 5GHWH 3EOYG 5CN1A 2KUTA 4G7VH 2DN7A 4MS6A 3WCYA 5KBLA 5K9JH 4OKVB 3MBED 2KLTA 3LKPB 5IB2B 3BW9A 2XTJD 1IAII 4C56A 4ACTA 1G87A 2DH2A 2YFNA 4Z7WE 1OAQH 4M5SA 3TV3L 2KDGA 2FX9L 1YECH 2EDYA 2CDEA 3GSQA 1UCBH 3HRPA 4MQXC 4LAJH 3SKNB 2I60L 4IRSB 3F62A 1AKPA 3NJKA 4BFEA 1ZVSA 4YHKH 5TPWL 2OR8A 1YJDC 4LIQE 4AGLA 2YC1A 2O93L 4GQ9L 1T3FB 1QRNB 1IAIL 2Y6SC 1E28B 2VMFA 5DHVA 4N1HB 4ONOA 1DFBH 4BFKA 4OM0L 1CICA 4UQEA 3BJ91 4NPYA 1HKLH 4OZGA 3GI9L 5HGBA 2Y6TE 4WFGD 3ARTA 3CWGA 3NSYA 4ODHH 1DVQA 1O5DT 4QXTB 4KUZH 5I0VA 2ERJB 5TE7L 4M48L 4U6VH 1U58B 3GXFA 3FFCE 4BA0A 3HHSB 1LO2H 2X70A 3K8KA 1U8CB 2XWBA 4XNYL 3KBPA 1AGCB 2D7QA 2E7CA 3DX8A 2MRYA 3E6FB 2DBLH 4AYGA 3CD4A 3QQXA 4N8CH 4RLDA 3KPOA 4JDVA 5IMKA 5I28A 4G83A 2O5ZL 1GJWA 4IRZL 5T5FH 2LW3A 3JTBA 3N1GC 5CBEA 1RUAL 4H44C 3KYMA 3QULA 4R8WH 1UOVA 2NQDA 1HQ4B 3T2NL 3DXAB 4S1QH 1AAJA 3UTSD 4M56A 4ZMAT 3ESOA 3V8CA 3QCUL 3K4ZA 4QXWA 2GFBA 1OAYL 2DLIA 4E5XG 2F68X 4DVRH 1TETL 3ML9A 4ERSL 3OPUA 2QSCH 1RUQH 4JFDA 2YD3A 4H0GA 3T0EE 4AYSA 5K9OB 1DTUA 5F1IA 4HAFA 4KI5F 2V2XB 3RGVA 1JDDA 3KHOA 4TUJA 5MI0C 1WZMA 3TIEB 4JY4B 3VI3F 3EYUL 4H4NA 2F5AH 3WN5C 4MXWH 4YHZH 4V11A 5B1JC 4PV1C 1AGDB 4NZDA 5AVYB 5IUSA 3Q13A 5C0AB 5DA0B 4JBSA 4MBOA 5DVPA 4X5WB 5JYMA 2QTEA 2KYIA 4WWOA 5JPMB 5JXAL 1MCFA 3FCSB 4JFHE 3NJHA 4GG6F 1CE6A 4JZOB 3LPPA 2NX5D 1NCUA 4AE1A 4R5TA 5DRNB 3HR5B 3IJ9A 1CS6A 1AO7D 1WISA 3L3OC 1FN4A 3QJFB 4U7KA 4WSKA 3T65A 3V7MA 1IX2A 5HI3C 2XQYK 3JZ7A 2DWXA 4WEBH 43C9A 2HFEB 2GAZB 3D5OF 2HFTA 3A4FA 4OZHA 5ABDE 4RRPM 2I60H 3PU7A 1BQHA 4C47A 3LZOA 2FR4A 2UXTA 1Q9WA 3L3DB 4KGLA 1QNIA 1VFBB 5CJOL 3S3PA 3BIAX 2FQDA 3SJVE 1GS7A 3HS8A 3ZL4L 2CPUA 3JXAA 5DR5L 2X1XR 2XXMB 4HWZB 4JJ5A 1A7OH 3X14B 4QRSA 3X12B 4BFJA 4XNZB 3TZVB 1A4BA 5IEHA 4L9LB 1T6VN 4BFGA 5J13C 2FO4B 5GRYA 5IG7A 2I85A 2VWEC 4HU8A 3LH2H 4YSQA 3OZLA 1KPRA 5E6IB 3RWIB 2AXJA 3BAEH 4MYWB 3US9A 4A2GA 3L9EA 4GAJL 5L8JB 4C55A 3EH3B 1KSRA 1EMTL 2WNGA 3TO4A 1UKSA 2YS4A 4B9CA 5D1ZD 5DFTA 5GSRB 2J71A 4O2CA 2OMVA 4NRYA 4UQDA 3ZQ9A 2EZ0D 2PF6A 5BV7L 3W5MA 1CFSB 4BKLA 4AMXA 5MHSD 3QZNA 3OAZH 1XCTB 1HXMA 3TV8A 4XNAA 4MD5B 4WLCA 3V6FB 2OYLA 1OQXA 3UCQA 1I9RH 4HJSA 3HS0B 4KU1A 4Z95L 2XG4B 3KJ6H 5HHOE 1MCCA 3FO9A 5FYKH 5C0IB 1Q1JH 2QQKL 2EYRB 5C0FB 3IDMA 4W9IC 4Q2ZA 4FQJL 1D5ZB 4WUUD 5D2LE 1JZ3A 2DQUH 3CVIH 1NC2A 2KQMA 2UY7A 4FXTA 4JQVA 2CU9A 3KPQA 4A37A 1LDPL 1MFMA 4WO4A 3TO2B 4YAQA 5K9QI 1E5UI 3OAUL 2GBVA 3DJRA 5CZVH 5D7LB 3IFLL 5EUKB 1JWMB 4UB0L 1F4YH 4ZMWA 1W72A 3L4YA 3CFTA 3PJSA 3GXMA 2B1AL 4LVEA 3VFOB 5EU7C 3VXUD 4OT1H 1NMAH 2EDHA 2X2HA 3V6FA 2NXZC 5GGRA 3QG6B 1MCKA 1LEIB 5J6HA 1SQMA 5HHMB 3NBNA 3K2UL 4PI0A 3LKRB 1YA5A 3ZT6A 4BHUA 3CFQA 2XHNA 3O2DL 4PJGE 2DQHL 5I18H 3RWFA 5LG1A 3RFRA 3COOA 3NCJH 1INQA 3KWWA 1U8JA 4LCIL 3SDCA 2HMID 1XBDA 4OUUB 3G6AA 5DGQA 4JFDE 2OULB 4DP8X 5CCGE 1N6UA 1BWMA 1E9PA 2Q86A 3EH1A 4PB0H 2XG5B 3U4KA 3ZTJG 5I1IH 5IMLB 3IGKA 2VERA 3VGGA 1K8IA 5C2UB 5JW4M 3CFEB 1KTLB 5DSCA 4JN2A 4MWFA 1LQBC 4X5RA 4GUPB 1WIPA 4I4WA 1S9KC 4KQ0A 4E9SA 1VERA 5FUCC 4M6MH 3UBGA 4MJID 5HJDA 2QQQA 4F9PA 2EKJA 1EWHA 2YXVA 2X0WA 4Q6YA 2DQMA 3NFSL 5AFAA 1BF8A 3NRFA 1PKQB 2IDCA 2NTSP 4J3OH 3S35L 3RWFB 1ACZA 3MLRH 3PNWB 3L1FA 5BMFL 5IIEB 1FN4B 2WJ5A 5EZPA 3DX7B 1IO4C 4GAJH 4N0CC 4AQEA 4XCCL 1BIHA 2O61B 5F6IC 3KVPA 3D4CA 2IOMA 4PMEA 3OGOE 4OLWL 4PRPA 4OLZH 1G4MA 4LOFA 1QO3A 3US1A 1RZ7L 5JMRA 4LSDA 5LAXA 1T1WB 3VH8B 5C0AA 2AK4A 4FXGB 1AOHA 3HB3D 4H1LB 4Y4FD 1KWKA 2EH8L 4GNKB 3ZHDA 1P7QD 3MCLH 3TCXA 4TQEL 2V9RA 1SF5A 1R34A 3KJ6L 5ERWB 2RQEA 1L9SA 1XT5A 5F3BB 2AZAA 1LJMA 1KCRL 1SGKA 2X4OB 4U3XA 1TXKA 5DXWA 2K3TA 4PJCB 3ZVVA 4XVJL 4FTDA 4W9ZA 4F15C 4QWWC 5D4HA 3RX5A 1FVDB 2H7WA 2F15A 2GUOA 4HUVA 4KTEL 3T77B 5B1AB 4PN6A 3GMLB 4DCQB 2GJ6D 1NCNA 3WJLA 1CZ8L 1NCHA 1WZ1H 1LNUB 1CG9A 3SDDB 2APVA 2H32B 3LXBA 3NGBC 4N68A 2X05A 5AVZB 5CR1A 4AMKL 1MCOL 3BQUD 3QDJE 5FW7A 3WJMB 4HIJA 2MOQA 4JFYB 5DS1A 5GRJL 4AYBA 2Q87A 3QPXH 1IAIH 3DA0A 4ISVA 5MERB 2GSGB 2D7OA 1ZEAH 1ZLSL 15C8H 4KRNA 4G6MH 2IAMD 1KV3A 4NQTA 1OPOA 1YEIH 3HTLX 2VERN 3SGEI 1LILA 4G80B 2MIZA 5IG7B 5AL0A 3K74B 3MRDB 4LLMB 5L4MA 5D1ZI 4ZW8A 5F3HB 1BMGA 2CIKA 4M1CD 4MNQE 5AZEH 2BLFA 4BJLA 2CKBL 4NPKA 3G5VB 1FG9C 4Y89A 4LASL 3BSZL 5L2KA 4PWHA 5DJAB 5FUZL 3U4EA 4G11A 4LIQH 4H8QA 4KK9D 4NKIH 2OAAA 4P2RB 3VGDA 4JEGB 1TLMA 2R39A 3EFDL 5HDWA 3UP1A 5CZKA 2ZCLH 4H25B 3OKOB 3NJFA 3QIWC 1XX9C 5LG6A 2PPEA 4EJ1C 2OZ4H 2X87A 3RB5A 5DO8A 3R7RA 4HAKA 4LLYB 5FYLH 4GSQA 2J6EA 1RKRA 2QVFB 3MGTB 3PGFL 3EAKA 1R19A 5CEXB 3IDXH 2V5MA 5GGSB 3FONB 1EHXA 2BIOA 4PVNA 2UZYA 2VABA 1IMHC 3HG1E 1ZLVK 1CGYA 2AC0A 2E56A 5SWSD 3SDYH 1OGSA 3GWJA 4MKMA 4TLTA 2VR3A 4KI5C 3LXCA 4JG0H 4QT5B 5E5RB 2R8SL 1DANT 2X4QA 5IJVA 2L04A 1YLBB 4WI2A 1L5GA 1MW3A 2B2XH 1MG2C 1USZA 2CUHA 3LS4H 1N18A 5I1HH 1MCRA 4P06A 2F53D 5A2LH 3EDKA 3GDBA 3L3OA 1JPFB 3VM5A 1WT5C 5C07E 2FATH 2FX7L 5FW8A 1TEFA 3GT6A 3KYAA 4M6OH 1K4CA 1F41A 1SFDA 3BZ4A 4MNGE 3WFDH 4P3DA 4ZTPL 1MQ8A 5AVRB 1DBAH 1W72B 3BO8B 4JFFD 4HXBL 4BYHA 1P7HL 3QHTC 5DD1L 2DIEA 4YXKL 4D9LL 3U0PB 4DGUA 1QSEB 2Z6FA 1MRDL 2IANB 1E3ZA 2OR9L 3BH8A 1FNHA 4NZRH 1UJ3A 2A74B 1C5DB 1NBVH 3ARFD 4R2GC 3U7WL 4IBUA 12E8L 4FFWC 1P7BA 2DM4A 4PRIE 3G3LA 1IV8A 1KLUB 4R96B 1UH3A 2AJSH 5JLZB 1N59A 3C09C 1MRCL 3DWTA 3GS4A 3IRZA 4YDZA 4IBSA 2NY1C 4PJCF 3MLXH 1FVEA 5GGTL 3R0MA 3ATEA 1FNEB 2FJHB 4XP9L 3OAYH 3OG4B 3C9NB 4HX1B 5DMKB 5K69A 3S37X 3UJJL 3EOBB 1SJHA 2WBJC 3C8KB 4TF4A 3J2PA 1VFMA 2PYFB 4X98A 5IVXE 5KAQF 4JGNA 3O3UN 4KZ0A 3ASWA 4KRPB 1L0QA 4ZUSA 5E24E 4JCLA 5HHVH 2JI2A 3HHMA 4PHZA 3ROOB 3RU8L 1XB8A 3OKMA 3LYRA 5DRZA 4N2BA 5BCAA 2F19H 1JXDA 4PGEA 3PABB 5EEYA 4PJBA 2IFFL 2MCG1 4F57H 1JCKA 2WCSA 3P4OA 4HJ1A 3VSTA 3O4LB 4ELMA 2JF1A 4QRUA 5ITFB 2BNQD 1N3NA 2MPAH 5C08B 1I7ZB 2VZUA 3RVTD 3BP4B 3HG5A 3KPSB 3WEXA 4GW4B 3MLPA 1F3JB 4HUMB 2MWCA 4ZFOL 2ARJA 2ZT9C 2H3KA 3CX5K 3ARYA 2PPDA 1A3RL 4NO2A 3I3BA 2CKBB 3QIWB 4WTZG 2PXYC 2HSIA 1CVRA 2HTLD 3F05A 4JANA 5D7IB 2VR9A 4BSVA 4PRDB 1ZS2A 3CFNA 3CFKB 5AOLA 4F58L 3V0FA 2GIXA 3EJYD 4X6DB 1ZSDB 4WV1C 4RMUA 5IB2A 2AXFA 2FB4L 4AXWA 4EMZA 2BOBA 3NCJL 2OCCB 3P0YL 4HCGA 2VZOA 4HDIB 3I2CL 3MUGA 3Q05A 4HOWA 4F80A 3WDIA 4MCNA 3CG8A 1AFVH 2VQTA 4HUWB 2CA3A 1UWYA 3VDAA 1UZGA 4QGYA 1OTTC 4X98B 4ICWA 3UAFA 1BFVH 1J0HA 4XE0A 3QHFL 5FDYA 2AK4D 3DRTA 3SJVB 5HGHA 1YNLL 1QACA 4GKLA 1UG9A 2ARWA 5KYUA 3FQUA 4NUJA 1LLAA 4Y4HB 2I9LA 5H8DA 2OSLB 2ZYRA 3K8MA 3W1ZA 4OIAA 2GBUA 3P77A 5I1LA 4BQ6A 1T1ZA 3H3PH 3J7HA 4Y88A 3D48R 2E7LA 3WL9B 3AT8A 4RETB 3GM0A 5FV2A 4PJBF 4LSQL 1AXIB 3HKZA 1R9FA 3PP3K 1KEML 3QQ3B 4HJ0D 3GRWL 3RX9A 3WTUA 2JV6A 3KWTA 4Z5RB 2E76C 2JJSC 3C8KA 4MJJA 1ASOA 5AD0A 4QOKA 3ABMB 4LO9A 2ID5A 5EWIL 4Q14A 3VSQA 2F5BH 3S5LG 5DEZA 1EXUA 5DJ2B 3OV6A 2OX5A 3FHEA 5C0BD 2HT2C 3U82B 5IKCB 4GYBA 1IUZA 4QJ5B 1LE9B 3W38A 3QPKA 1NAMB 5KS9E 4HU2A 5EOCL 4NUJB 1XIWB 4AKPA 1KCRH 2BZDA 1NM9A 2MFNA 3IXTB 4R96A 4MFHA 4IMKC 5D2LF 2CHWA 3L5XL 1UM5H 5CD5D 1L9TA 4UT9L 4PJCA 5J1TC 1E27A 2BS9A 2QPDB 4Z0BH 4PJ8D 3VGAC 5B1BB 3RGHA 2DJSA 4N2CA 1QFOA 3SDXF 2PR9A 5F88B 3NTCH 5FOBA 4JKPH 1JGEB 3RIFK 2WWMC 1G0DA 1FJ1B 2B7DT 5D5MA 4G7VL 5IR1B 3X2QB 1MCWM 1GMIA 5J5EA 3HKFA 3R4RA 1JPSH 3PLYA 2VLKE 4J27A 1TT6A 3OJDA 2BHUA 1MW0A 4G6KH 1JZDC 5E5LA 4EAEA 1H0DB 4ZAKC 1JN6B 2XV2A 2YSSA 1AD9B 1IEAA 1JMZA 1CB4A 4XPFH 3RUGE 4FI7A 3FB8A 1KDIA 3B9KA 3SPGA 3K5SA 4PWGA 5KSVB 1CYXA 4FCAA 2EO9A 4LBAA 4M93B 1IC1A 2H0JA 4R90H 5CGTA 1B3JA 1SYVA 2ED7A 4NXKA 3DO3A 1OGTB 4AC4A 4JDTH 3EOTL 2XBZA 4FNQA 2YA2A 2HB0A 4DUWA 3HZMA 1QEWB 4M7LL 5JHLL 1D6EB 5KVMC 1K5WA 4UOJA 1U8QB 1A65A 3TPUB 5A2JH 3AW5A 5C08A 2PXYB 5I5IA 1QRNE 4CVWA 1TFHA 2BS71 4J5VA 5HHOA 1ZLVH 4Z78B 2Y3AA 4O2FA 4LARH 3QQ4B 1WCBB 1SQ2N 3SGEH 2ZWLT 1D2OA 3M17A 5KG9B 1JZ5A 5LCVH 3A4DA 4XNMB 3X17A 2Z9TA 1X5AA 3HFML 5EN3A 2VUKA 3AGVA 1I8IA 3TT3L 1WC7A 1E9OA 3L81A 4NAQA 1OAXL 3HCVB 5FO2A 2DQ6A 3IVKA 1RZGB 3WO4B 3SGJC 3G9VA 3DOIA 3GIZL 3HNVH 2GB2A 4WK4B 1MHHA 4P5SA 5DYFA 5LGKA 3TVMD 2F8IA 3CC5B 3MJGX 1FRGH 4MAUL 5TE6H 2IV9A 2Z31A 3E2HB 1E4XH 4HWUA 3LRSA 5D6DA 3M7FB 4IKIA 2V17L 5JPNB 1B4JL 2A83A 4IK6A 4HULB 2J43A 2FSDA 3MUY1 2CWRA 1S8DA 4OD2A 4GH7B 4MASA 4MD0A 2R2BA 3D18A 3MRGA 4LSRL 1CXFA 1D5ZA 1OSYA 3HBGA 1JUFA 4QHMA 4X8JA 1TPXB 5C0NC 4AQ8A 5FIEA 3SY0A 4XNYH 4LESA 4L8BA 3MJ8A 2ZWKA 3KM2A 2X41A 2NTFB 4IOSD 1WD9A 3L3JB 4XCFH 4U4IA 3TH2T 3IBOA 4XP5L 5KBNC 1QYGL 3A6BH 3NZ8A 4HQQH 4KZDH 4PS4H 3GXIA 3MX0B 4LCUA 4PJGB 4UMGA 2J8UE 1UB5B 1J12A 2C3GA 4K9EC 3GHBH 4X6EB 1C08A 4GKSB 1XF4B 1MVUB 2DEYX 1CYWA 1RCYA 4AJ0A 5FHBL 1GMEA 1A4AA 4PRAA 1WIOA 2H0EA 3TIDA 2I24N 1U8HA 2PO6C 4ZNEE 4AVJA 3Q8EA 3NJJA 2HT4D 3B6SA 2BVTA 3OGCA 5AW1B 4P05A 4X5PA 3OKLB 1HHJB 2DI8A 1ZLWK 1VGEH 4FJ6A 3U6RB 4L4VA 4NUQA 1RZ7H 4LBEB 3SDXB 4LSSL 5D1XE 1EAPA 1PJ9A 3CFEA 2Z8SA 4HJEA 4YBQD 1WBYB 4ZW5A 1Q9WB 3L3DA 3EJQA 4M4RB 1XCWA 1A6UL 1I1FB 3UTZB 1QLEB 1JWUA 4I5BB 4PJ7A 2R1WB 2H6PA 3ATDA 5DRZB 3LNFA 1HOCA 1OGAE 3D39E 5I30H 2WO3B 5GSVB 4BE6A 4KROD 3ZL2A 2QHRH 3FUKA 4ZFGL 4ZS6C 1OAJA 1NANI 5E8PB 1ZXKA 5HJ3A 4HJ0C 1OAUH 4UM9B 2NUTB 5AZ2H 1NIDA 3VO0A 2AEOA 2BCMA 4P57A 4AMKH 2FWSA 1R17A 4IYKA 2ICEA 5CJOH 3G5VA 3NIFF 3MV7B 2VAAA 4XMXA 3ZSTA 5MHSE 1XGYH 2OSWA 1NBZB 4HWBH 4P59L 1SJMA 3VG9C 1EEZA 3GMQB 1VAHA 2GK0B 4WNJA 3UTSE 3ETBF 3LTVA 2R2EA 4Z7UF 3ZYZA 5K33A 1S9VB 3LKNA 3QNYA 1HQRA 5ID1A 2VDPH 1UT9A 3RJOA 1GHFH 1NGWA 2X4TA 2X4OA 1ZLUK 2OR7A 5HYEA 3FO0L 5DF0A 4IEFA 5AOZA 5JW4N 3RWDA 2DQGH 5C0FA 2F1AA 5KJ4A 1NC4B 3KL3A 4DGYL 5I1DA 1DVFD 3GRWH 4TSCH 4ZXBA 1XD1A 4NN7B 3FCTB 4CNIA 1YEJH 5ICZA 3OTTA 3DMMA 3SDDA 1YMHB 4GT7A 4P57B 4HIEA 3O6LH 1JJUA 2IDSA 1J1XH 3Q8CA 1USQA 4I3RL 3CH1A 2O6EA 2XVBA 3P0VH 5ICUA 1HH9A 5EUOA 3EJRA 2OL3B 1E42A 4BSWA 4L8DB 3T0EA 2QL1A 3TV3H 4D3CL 5FYLL 4WO4C 2B39A 1LK3L 3N06B 2OJ1A 1HQRB 4LNRB 4FQJH 4UT9H 5ID1B 3CC1A 3NFPA 3IDMB 5T8IA 3O6KH 5SX5K 2HVKB 1CFTA 4WW1A 5GZOC 3RTLA 5IB3B 3LNDA 3IMUA 1XCQA 3NCWA 3NEXA 4P9HH 4LHUB 1HHIA 2CDGA 2YAOA 4X9GA 5AW9B 2WQAA 3QRGL 2ZOKA 3LEYL 3OAZK 3RLSA 4UIMA 2FR4B 4OF8A 1UM6H 3APFA 3N43B 3HC4H 2JQMA 2R29H 2ARJQ 3QUXD 2BNRA 3JQOB 4H13C 4MSWB 1RZ8A 5TDPA 4B53A 1MSPA 2X38A 4PJ7B 4MJ5B 5F1KC 1TZIA 4HEPG 2A6IB 2VLJD 7FABL 2EO1A 3ULSB 1JHKH 1JV2A 1K4DA 2WUBH 1DBBH 2RALA 4GSRA 5DTFA 3FFCB 2GIYA 4KITB 1I3RA 2X89D 4QXGH 4AC2A 2EXYC 3FOMB 3D2UD 4GB9A 3ARDB 4FS0A 4EOWL 5CP3H 3MRJA 2ZJSH 2JLLA 3FSVA 1JGEA 3D0AA 5EUKA 1IT9L 2Y7LA 1DBKH 3ETSA 2KZBA 1NDGA 1PVHA 5IQ7L 1ZPLA 3SPVA 1JERA 3K6OA 1QLRB 1CK0H 3O41B 4MNHA 2CMRL 2Q76A 4QNPF 4XMKL 2Q8AL 5AKRA 2DTSA 4JLRA 4BSWB 2YZ1A 2W9EL 4MGXA 3VSVA 2UX7A 4FZEH 5TE4H 4G5ZL 4JZOA 5FOJA 1NBQA 1UYWL 4X7TA 3UH8A 2BY3A 4U0RC 4ZX5A 3RPKA 4Y5YA 4QRPB 3UACA 1Y0LA 5CCHE 5E8OA 1N5YL 3GMNB 4DK3A 5DEGB 2QDWA 4OLWH 5E2VL 2LU3A 1AS6A 2WLLA 3FQYA 5EU4A 1IFRA 1NMCC 4OLZL 5GJSH 4WHDA 4FRWA 2VW7A 3FAXA 1JWMA 1B0WA 2FH6A 1A6TA 2IBBA 4O2CB 3M07A 3QJXA 4N4YB 2E8YA 3IKCB 5E6YA 5ILTL 3BUTA 4A7QA 4Y4HC 3HE7B 2YPVL 3VYNA 3TEXA 2OQJB 3QNZA 4FNSA 3QXWA 3F01A 4XWOD 2YLHA 3UTSA 4IS6B 1Q9KA 1SVZA 4JPSA 5K39A 5T1LD 4G3YL 3FO9B 4N28A 2H32H 1I31A 4M43H 4HLZH 1P4BL 4LHQB 1RIHH 5FGCE 2B0SH 2L3BA 3U7AA 3FB7A 1IC0A 3MUZ1 5E00B 4XR8C 2ICCA 1BD2A 3P1VA 4L1HA 3VI4F 3K1KC 3LEXA 1QEWA 2DY2A 4LSUL 1MFDH 5I8OL 2A77H 4XN1A 2CALA 4P9HC 3TJHD 1H8OA 4U1HA 1N0LA 5CSBA 3O6FD 4DEWA 5BOZG 4CADB 1JPEA 2CR6A 3TBSB 1AS8A 1GS8A 4QEGA 1FBIL 2Z8VC 3DV6A 5T33H 5A1AA 4OZIE 3QDGB 3FMGL 4WHTA 3DKHA 5T1MA 3S35X 4Z7AA 1XGRA 1LEKA 4L9LA 1YEDA 4FP8H 3RZCB 3ESNA 5K5YA 4HA1A 3QDMB 3LKPA 1QHOA 4MA3B 1DJZA 1P0SE 3WNKA 5C70A 1VGEL 3L4ZA 3Q2NA 1HVXA 1WD8A 3WNOA 4F8PA 4PD4J 1FI8C 3OPZH 4R4FH 4S2SB 4L9LC 5HYJA 5IB1B 3PUUA 1OAZL 4L4VD 5EOCJ 4B9IA 3IDGB 3G6AB 4OGYL 2QSQA 2WOBA 5CU9A 1OF2A 3OKKB 1N3NB 4P48A 5DWPA 2Y25A 3U9UB 3SKNA 3ZW3A 5C0CB 3BPLC 5HHPA 2RH0A 3FPYA 4U1KA 5DJDA 1CBJA 1THAA 1N6QH 2QV2A 1HZHL 3FFDA 4XWGL 1LE9A 2ALAA 5KVEH 2B5IB 4HJJH 1CFBA 1OD7A 3B2VL 4PGEB 3WI9A 4NNPH 5FGRA 4OF3A 1Z66A 2WBJB 2BHFA 2ALWA 1ZAGA 1CL7L 1D5IL 3QHZH 3ZDXF 1DUZA 1N2RA 2ADJA 3CDZB 4X0KA 2V7NB 3FN3A 1IM9A 2QPUA 2AK4E 4UUJA 1M3JA 5F88A 5FOBB 1IC5H 2B08A 3BKYL 5FYJE 3T6ZA 3DX8B 3ZZ1A 3VJ6A 4QWWD 4TYUA 3T0BA 1CWVA 2PMZA 1DEEB 3LNEA 3E0GA 1PX3A 5DK2A 2XV6B 2ILLA 2FJSA 3TH3T 5KSAA 4IKJA 2BW5A 1S7WB 5GZNC 4NKQB 5E7BA 2FSEA 1NBCA 4M6NL 1UM5L 4QXUL 4NC1E 3CVBA 3GI9H 4Z0BL 4KDWA 4NO0B 1ROWA 1M6OA 1P4BH 1D5MA 1MCDA 4PJHF 1C8QA 1TMCB 1OSPH 3CBKB 4WW2B 2VDOL 5LBSH 3DK2A 4OFYD 3WEBA 5GPRA 3BHBB 4CVUA 2NW3B 2P5PA 2NR6C 2QQNL 3PNRB 3WAKA 4EUPB 3ULUC 2YAHA 1AANA 2X70B 1MFEH 2EXSA 3AZUA 4XBEL 2P43B 2X4RB 1U8MA 4A39A 1YO4A 1N0XH 3CFUA 5H94B 3FSOA 3AWFA 1PNDA 5F9OH 3TYFB 4LE8A 2YKLH 4BRJA 4O02A 1TTRA 3C5JB 2F5AL 1OCOB 1EVUA 4HIHB 4E9VA 3MLWL 3F6IA 4UQBA 1F5WA 3ECQA 3QA3B 3I02A 3CK0H 3QXAA 5C6TH 2A74C 1FO0L 2WAHA 4LL1A 1LGVA 3NSDA 4B50A 2F08A 3PV7A 3VRIA 3ARGA 5E5UB 1TEYA 3HAEH 4F7CB 1AIFA 3GBEA 2P8LB 43C9B 5GS0H 4PJEA 2V4LA 1KBGH 3S0PA 2EECA 4WY7H 4L1BA 1AQDA 1KJVB 4NNYA 4NM8L 3ULVH 2ICWJ 5DHDA 1S7SB 3CVHH 1VFUA 3KH4A 4WHYG 2ZCHH 1HESA 4GG6A 3DIFA 5IOKA 1JXGA 3ESPA 4LSPL 3ARSA 3SBPA 3F7RA 2IO5A 4KRLB 5IQMA 3MAWA 3BRGC 5F96H 1E50A 1CFQB 1CGSH 2L7JA 1TZOA 4KKPA 1A9EB 4NRZA 5FPIA 3BIKA 3HE6B 2PCFB 4WW2A 2ZOUA 3BLKA 2JH2A 3I02B 4BQ8A 5ETUB 1BD2B 1E4XL 3VFRA 1PMYA 3QXVA 5FGCB 1CIDA 5CWSB 1OHZA 5GGVL 4ZRGA 3WXVH 2IWGA 1IGJB 1H3PL 2J1ZA 3KEHA 2ZUSA 4UNIA 3T6WA 4N8VA 3SDAA 5HYSB 4BK5C 5JW4R 5I1AB 4JPVL 1U2CA 2ZAGA 2X4RA 1SJXA 1PL3A 1IB5A 3VD2A 1EJOH 3FTXA 1A6PA 2R0WH 4H8PA 3MLUH 2AJZB 5ANHA 4IRSC 3ARFC 5I6XC 2HG0A 2VN5A 2ICEC 4G6AC 4MNGA 3L7EA 4LASH 3HPLA 1I9IL 4APQD 1KELL 3D33A 3DSFH 1Z3RA 5CU5A 1P1ZA 1SXNA 3VX1A 1A22B 2V2WA 3SKJL 3D30A 3SEPA 4R4ND 5FECA 3KW8A 3ZPDA 1WFIA 1JDAA 4GAYB 1JPTL 4DKAA 5I17B 1AMYA 2ADJB 2CJTA 4XN4A 3SD2A 4OCMC 2OLDA 3UPCA 4F7PB 3KDPB 1BM7A 2BNQB 1NCGA 3C9NA 3O4OC 3FT4A 4CU7A 3FSAA 5AAWA 2OZ4L 3EUUA 2QQKH 1H5BA 3JT0A 2HX7A 4HT1L 3I6SA 3B7TA 4J3XA 3VCLA 4AEEA 5I1AA 4I13B 3PWPE 4TQ8A 2AAAA 4GMTL 1S9WB 3UO1H 5FEBA 1W72H 1N0XL 4NX0A 4B9PA 1KTJA 4CBPA 1MJUH 2V5TA 3BWZA 5F9OL 1MCBA 4OJAA 3P4MA 3ATBA 2AVGA 1YNTA 1NCCH 4AQAB 2XZQL 4B27A 4KXAA 4OJEH 5D6CA 1G9EA 2HRPH 4Z7WB 4GXVH 4JUSA 3WGVB 4PRHB 3HE7C 3A24A 1FL5A 1LK2B 1UFGA 2ZKHL 3HRZB 1GSKA 3O45B 3EO0B 5F8RC 2AITA 1ZA6B 3NT0A 5D4IA 3WEMA 1SM3L 1QPXA 3VDBA 3ILEA 4U6VL 4ZO8A 3QIUB 3Q2CA 1UZ8B 1NPJA 1PIFA 4OBRA 4U1KB 1GJIA 2FATL 2XY1A 3AU1A 1E65A 1X4ZA 3H6JA 4IU2B 4MSWA 5D1QA 4CMHB 5D2NC 5ITBH 1F4WL 4H25A 5JW3H 2QVIA 4ZPTA 4YDKL 2WQ8A 1CLVA 1TIUA 3QRLA 5EN2B 2WXIA 2VXQA 5D1XD 3SDCC 5DUPL 1RIHL 3T6XA 5E00A 4PVBA 1WQVT 4YSCA 1NL0H 3JWDH 1MFUA 2E6QA 1P6AB 1GZPA 4XCNA 1TTGA 3C87A 1GY1A 1A1OB 2VDQL 2ZG1A 3RY4A 1IC4H 1UACH 3NFSH 3QQ9C 1KTRL 1YPZE 2C3HA 2VTFA 3HFMH 4XWGH 5I8EA 1FNFA 3F5WA 3X1FA 4N1EA 5IB5B 3RPIB 2D0FA 4YSTA 2WO4A 5IHWA 5IFJA 4BZ1H 3SJVD 3OKOA 4TNFA 3ZGHA 2XQBH 3Q9QA 2YGVA 1RI8A 1MAJA 4P4KA 3U6XS 5AVXB 4O5LH 2Y36H 3MXVL 2I26N 1BJMA 1T22A 2V5SA 1AGBA 1KPUB 4M7LH 5JHLH 1EEUA 5L8LB 3AUVA 1QP1A 3QDAA 1XAKA 3ZO9A 1AY1H 3RX8A 1BXAA 5F9WC 9PCYA 1WHOA 3KCWA 3LZFL 5FUCE 3W57A 1W0VB 3LKOA 5EC1A 4G8GD 1L7TH 3IN0A 3R19A 3BDYH 4K3JL 1ASPA 3FRPB 3O0RH 4YHPB 5ANMA 4BH8B 3TEYA 4LCCA 2I7OA 4QNPE 3H3KA 5DK2B 4XWOC 2OSXA 4TXVB 2OXGB 1IGCL 1Q72H 1I1AD 3Q5YA 4W6YB 2VLRB 1CURA 1L9RA 5E1HB 2EDNA 1C5DA 1N6QL 4OZFA 1T0MB 3FU3A 5EBWB 2VLKA 3NA4A 1AR1D 2WHVA 4LSTH 3RY5A 3QEQA 2E6JA 4YQXL 3UZQA 5JW5B 2XG4A 1JV5B 2XZQH 4PJDF 4YJZL 2XKNB 4DPAX 2JQZA 3F7PC 1TMQA 5DQDH 4I7ZC 1L9OA 2CUMA 4I3GA 5BW7A 2GBTA 4UV7L 3MODL 4O2EA 4YMPA 1GPOL 2CNZA 1UM6L 4PJDA 3OAYK 1G1YA 2BIQA 2DIBA 3MLYH 1NCBH 1MCOH 2Y5TB 3QPXL 1WS8A 5C0EB 3D7PA 3KG5A 4FFZL 2ZICA 3R1GL 2FNWA 2ROYA 1FPTH 3CFCL 3U30B 4F9LC 4NO3A 2RBLA 3SPCA 1J5HA 3TYGL 4KHXL 3SPVB 5KEZA 2OMTB 3GSXA 3D34A 3QI9C 1MI5A 1QRND 3TNMB 4IU3B 2QMKA 3VRJA 5IEHB 1EO8H 3PGCB 3SCMD 1AYRA 1FFPB 4HP5A 2LR4A 5D1XB 3PL6B 4OTXL 2BSRB 4H40A 5JQHC 4PJAF 3OMAB 3MMEA 4B9FA 2VMDA 1OP5K 3UC0L 3OKLA 4NAMA 5BOJA 2FQGA 5I8KL 5B3JF 3MLVH 4GRWH 4ODUB 5L7XH 1BGXL 3CVIL 3JWNC 2UYLA 5G4OA 1HL9A 3B5GA 4K7PX 1BVKA 2G9HB 2HJKA 5K9JL 1CGTA 1TCRA 4WTXA 1BJ8A 2VO8A 3TBTA 3AM8C 4FZEL 3HJ0A 1CFVH 1A8JH 3SE8H 5EEZA 3WTYA 4DPRA 4XPBH 2NXZD 1MAKA 1OAQL 1NIEA 5IFHH 2NUPA 4UOQA 4N2FA 2ZP9A 3QCUH 4NCDA 3GKWH 4XOBA 4KJPD 1KGCE 2B9BA 5F7BA 3SYQA 5ALBH 2CGZA 1UURA 4IIQB 1PAZA 4U4BA 4WO0A 3QISA 4YWGL 3EH4B 3CV5A 4K8RD 3REVA 3P9WB 4Q0XL 4FAAB 5EMYA 3W37A 2A9NL 3ZE0F 2OK0L 4IGBB 1KBGL 1KB5L 5DK3A 4IMLB 3WFBH 4ZG1A 4TVUA 1QX1A 5B1JA 5DRWB 1ZJAA 3SCMC 5GRVK 1SXBA 3B83A 5KTEL 2P1YA 3OR6B 4ZFGH 1XSIA 4J3TA 4O9HL 3PP4L 2BO0A 4YDVB 4CVZA 2VXQL 1G9ML 4XXCC 1OQOA 5DC4B 4YQXH 1KIPB 3CHXA 4NZFA 1Q0XL 5E2WL 2DBLL 1QBBA 5K1JA 3WIIL 3Q01A 4ZODA 3KM1A 3HBPA 4N8VG 1N70A 5SWZD 1I85A 4UILH 4BQ9A 1JK9B 1Z3GL 3MO1B 3RWGB 3SQOL 3MRQA 1DDTA 2GVYA 4EKJA 4BXSV 1MNUL 3N40P 5TQ2H 2CCWA 3HN5A 3VNYA 1LEGB 3HHSA 2YAMA 1O7VA 2DYRB 3KVDD 2FRGP 5DJ6A 1IC7H 4HIIB 4FFWD 4AZ8B 3G6DH 4H1LA 4OV5B 4HSAC 4QRSB 3EADA 4G9FE 3TBWA 3X12A 4JY6A 3VXOA 5C0RL 2VSMB 4AW7A 4HHAB 4P2OB 1MJ8L 2R51A 1O75A 2R4RH 3ARDC 3DVGB 3JV6A 4NO0D 4FG6D 2XYBA 1XCXA 3ZO0A 3TA3B 3BKCL 2ICES 1F42A 5BS0D 4D8PA 3ELAT 3GB7A 1J10A 1TCMA 1NUNB 2NR6A 5HDBE 4KKZA 3FU9A 4NP4H 3LAFA 5DGRA 4CUCA 3KPLB 1A1NB 1ADWA 4OLUH 4Q9CA 3RUGB 1D2PA 2FIRT 1XF5B 4BH7A 1WFMA 4IM8A 4AG4L 5EF2A 1DJXA 1I7RB 1MFAH 4HALA 1X7SA 1LP9E 3VQLA 2P24B 4R4BB 5INDB 1IU1A 4GFTB 5DUPH 2WKLA 1UH2A 1Z9OA 5J4MA 5IV2B 4NZUH 3QIBD 4ZTOH 2QEJA 4N2KA 5D1XA 1JV5A 1CYGA 1IC5L 1VGKA 3BKYH 4LPCA 5DD3H 3KAAA 2B77A 1DSFL 4OCNC 1DVUA 3SY0B 3OGCB 1OB1A 4D9RE 3MA7A 1H6EA 2VWEE 3IU3A 4XMKH 4KKNA 3UZEC 2PW2B 2ZKHH 5A40E 2CO6A 3D85D 3PWPD 4UOZA 2TSBA 3ILPB 1KJ2B 2N3JA 3H6AA 3W9DA 1NDMA 4JJOA 3VFUB 3A5VA 3DMMC 3FRPA 4XZ4A 4X2UA 3V4LA 4J3OG 4RH4A 3WSQH 4Z7VA 2NNCA 2EXWD 5H94A 4DP7X 2ZAHA 1BLNA 5F7HA 2J5LB 2HT4C 3HZ3A 2EDEA 3SYAA 3PV6B 1CXKA 4L48A 4FE9A 1DBBL 4XO8A 2AF2A 1AJ7L 2G3XA 4GP5B 4IK7A 5E4AA 3FOLB 1JTPA 5BZDA 1VEPA 5DLLA 2DV6A 4A7TA 3ZE1F 5KSBA 4POZD 5CN3A 3L1OL 1MAMH 4MQ7A 2D3VA 3M46A 4J3OD 4UZGA 4U3CA 4JY4A 1F3RB 4X4XB 1M1XB 2EIEA 4WFHD 1ZWIB 1HSAA 3Q3GB 4D7PA 4PS7A 4ZUUB 2F54D 1TQVA 1PAMA 3OBAA 1CVSC 4JO5A 1F56A 1UT1A 3VE0A 3X1BA 1DQQA 1HNGA 4WJ5A 1ICTA 3V4PB 1QI5A 3DOSB 4AENA 5C3IA 3FN0H 3IAQA 3KLAA 3FB5A 4FQPA 3GSUA 2MCPL 3S5ZA 2JB6A 3QUMB 3EGDB 4KUCF 3DXAA 4QHLA 1A3LH 4JFZL 1PY4A 1H9VA 1U8LA 1S3KL 3BUYB 1CUOA 1KYDA 2WNWA 3GLAA 5E08L 4EZJA 4KV5E 3HE6A 5FLVA 3RYMA 4CSZA 2JLPA 3LS4L 3IVKB 1KB5B 4MDIA 3VYPA 7PCYA 1DUZB 1R33A 1OWRM 1TENA 3QWQB 1AY1L 1T20A 3BZDA 3MYZA 4UQCA 5IQ9A 2MOGA 5B38B 1NUDA 3C09B 3A6CH 2QVTA 4PV8A 5TFSL 1S7TA 4GIPD 4WKXA 3ZK0A 2CXGA 3IFPA 4DP6X 3PQYE 1I4FB 2VO5A 2YD7A 5HHPB 3CFIC 3GZQA 1ZPUA 5HHMD 3WN5B 3DVNA 4LCIH 4YZWA 3WKQA 1QRNA 4QKTA 1KYOJ 4IIZA 3NSXA 3DUSB 1X4XA 1LMKA 4PWFA 4XPTL 2DJ4A 4JPKL 1A0QH 12E8H 4XNQB 4I77H