4UYQA

High resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the c-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
143
Chain Sequence
b'MLQVDIGSTSGKAGSVVSVPITFTNVPKSGIYALSFRTNFDPQKVTVASIDAGSLIENASDFTTYYNNENGFASMTFEAPVDRARIIDSDGVFATINFKVSDSAKVGELYNITTNSAYTSFYYSGTDEIKNVVYNDGKIEVIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin anchoring protein C
publication title Cell-surface Attachment of Bacterial Multienzyme Complexes Involves Highly Dynamic Protein-Protein Anchors.
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
molecule tags Cell adhesion/protein binding
total genus 30
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4uyqA01
2Y3NA 5AOZA 4U3SA 4UMSA 2O4EA 4WI0A 1QZNA 3FNKA 1G1KA 4UYPA 2B59A 2XDHA 1TYJA 2W1NA 3F2LA 4IU2A 5G5DA 2ZF9A 1OHZA 2OZNA 3KCPA 4IU3A 2CCLA 3BWZA 3GHPA 1ZV9A 1ANUA 2BM3A 4WKZB 3L8QA 4UYQA 4DH2A 3KCPB 4FL4B 2VN6A 2VO8A 4FL4C 4N2OA 2JH2A 5LXVA 5K39A 2VN5A 3UL4A 1AOHA
chains in the Genus database with same CATH superfamily
4KJWD 3DO3A 4YFLF 4J3OH 2NQ3A 3WTUA 5CSGA 5BRZE 3T2PA 5D1XE 1JPTH 4ZFQA 1OIOA 1QWHA 5HI5D 3ZO9A 5BVJA 3UTTA 2Z31A 4R96A 3MROA 3KG5A 4FKHA 3DMMB 1U91A 5TDPB 3WFZA 4B9YA 2VRKA 5DC9B 5E99L 4PU2A 3PIQA 4HGWA 2Y1AA 2BCMA 35C8L 1KFAL 5A2KH 2EIKB 2ATPA 3UAJA 5C0CD 4M5TA 2YPVL 4YK4C 3F3HA 2ITDB 3HE6B 4Z7NE 3FYEB 1KTRL 4X6EB 4JRYB 1M1XB 4W4NA 4IK7A 4YSDA 4BK5C 5E5RB 2A4ZA 2MHAB 2K4AA 1K72A 4JFDA 4ZTOH 1KEGL 1NANH 3FUIA 3I02A 5E1AB 5EFIB 5GISH 2X4UA 4OZGE 1OGTA 4JFTA 3L1OL 4P05A 2B5IC 4U1JB 2NUPB 2AQSA 4JRFA 3PLYA 3K91A 2ZOKB 3QUMA 4JVUA 1NCHA 3D39B 3LIZH 2V17H 4DVBB 4E41D 4P9HC 1MCWW 1FVDB 1SJXA 2EABA 5LGHH 4DP8X 3VTMA 2VDKL 4R4BB 1AKJA 2XZCL 5CBAB 5D1XC 5TDPA 4AENB 1DHKA 1HU8A 3RVWD 3MUY1 2A2QT 2GSMB 4UBDC 2A73B 1AGFA 1T89A 3L7EA 1DBMH 1JPSH 4WEBL 1TTCA 1TTAA 4BZ2L 1UOKA 2AJXH 2HTLD 2EH7L 2ITDA 2BVYA 3HE6A 1GS8A 3SO5A 1NIDA 2GW5A 4X6EA 4JRYA 1M1XA 4TOYH 1Z0MA 5DJAB 1FO0H 1TU2A 2AZAA 1U8LB 1KCSH 3C9NA 5FAAA 3Q05A 1ET8A 2MHAA 3DHMA 4X2UA 1CJYA 2YD3A 2VDRB 2D7MA 3F84A 5IB4A 5E1AA 1TQWA 4RGMB 2PPDA 5TF1H 4GO6B 4RBPK 5D96B 5ALBH 3T77B 4NZRH 4LIQH 3ZLQC 3P11H 2IFGA 4XPGH 3EOBA 1ZA6B 3EBAA 4ELMF 3DOSA 2DYRB 4XOBA 3VX1A 4Y19B 2ZOKA 3D39A 2FVNA 2XXGA 1W91A 1AE6L 3PV6B 4DVBA 4Z6AT 1RUML 3S37L 2H7WA 1LE5B 4LSTH 2NOYA 3FC8A 1IZKA 1J1PL 1UWFA 1WHPA 2OI9C 3BT2L 3CHXA 4HIEB 4Z3HA 5CBAA 5I17B 3FUMA 3HZVA 2CJ3A 5K1VA 3VFPB 4HS8L 1T0OA 1XMWA 4N5ED 2LTQC 3E9TA 1HESA 1UHVA 3N55A 4P9HL 2IDSA 2N4IA 5E9DE 1VCBC 3SD5A 3VGDA 3RPBA 4BXSV 3LHPL 2K0RA 2DYSB 5JHBA 2DM2A 1RMFH 3C8KB 4JY5L 3WDIA 4KGLA 1U8LA 3TX4A 2EO1A 3KAAA 2I69A 3A21A 4BELD 1KJ3H 2XWJB 4JFQB 4AOFA 4BEIA 4AQ1C 2EDEA 3AABA 4V1DB 2Y9RT 2GITB 4TQIA 3T77A 4EUPB 3BGFC 2V9TA 4FCAA 3VSUA 1OHZA 1QEXA 3KYKH 1VFAB 5H94B 3QUKB 3QUZC 2ZKXA 1U8KB 5HHMD 4E68A 1ZA6A 3C2AH 3J8F7 2KDYA 3GJFB 3LVEA 5C07B 5GZNC 1OSPH 4Y19A 5G5DB 3CLFL 4F15B 4WNJA 3PV6A 1X5MA 3KPQB 5H2BB 2WTRB 1LE5A 1ZIAA 1KUMA 3IMUA 3CHPA 2OTUB 4L4TD 4ZQKB 3VX0A 3HVDA 3O0RH 1ACCA 1IE4A 4HIEA 1OGAE 3GJEB 4JM2D 1N7MH 5I17A 3WOVA 5IWLC 1P9MC 4YHMH 3BHBB 3CK0H 3FT9A 4YDKH 5B3JF 1XH3B 1X6NA 2V5SA 1YEDA 5D72H 5J56B 1J9TA 1NLDH 1CG9B 2VMCA 1PU0A 2GKIA 3K0YA 3Q8AA 3T3MB 3IFNL 3N40F 4JO2L 1HKLH 1FC1A 2F1EA 4JFOB 3MRGB 4WVRA 3P2TA 4CVXB 4EVNA 1FLRL 3DX9A 3C8KA 3II3A 1FE8H 5LDSA 3P4MB 5DMGD 1WIOA 2NY0C 3ILDA 4M3JA 2W91A 3P9WB 2XWJA 2VC2B 4KXDA 2GBUA 4NHCH 5CJQL 1W0WA 5C0DB 1MCQA 2GITA 4IRSC 4YZFF 4YBLC 4EUPA 1VFAA 3NMEA 1GGCH 4YHYC 1U8KA 4KY2A 2E46A 5I15L 3GJFA 1A3RL 5G5DA 1U6AL 2Z7ZA 2WLZA 4PWFA 5D7LD 3KPQA 5H2BA 3BAWA 2VQ4A 4ZQKA 5C0AE 2OTUA 2HX9A 1JGVL 3GJEA 4JN2A 1G4MA 3B5HA 2EJ1A 5ANME 5LN8A 2J4WL 3U2JA 3BHBA 5KYNA 1XH3A 1YO4A 3BSHA 1MNNA 1LTXA 2AEQL 4K3GA 1OGPA 4QY8B 5DD1L 1TR7A 1I85C 2ADIB 5E95B 3X2QB 3QDJE 1TJIL 4X7EC 5LWYL 3BQVA 5FM4A 1CFVL 3TJPA 4PJXE 4JFOA 3MRGA 1QZNA 3KW7A 1O5PA 5AVYB 4MBRA 3ROLB 4K94C 2J1ZA 1JI1A 1QFHA 3P4MA 1WK0A 1CBVL 3RVUD 5I66B 1X4XA 3HZ3A 4A7GF 2EXSA 2VRQA 4CN1A 3GMRB 4R83A 4ONOA 4P2RB 5D1QB 5C0DA 4KXCA 2VLJB 3MGAA 3UYOD 2HH0H 1RJZA 1KWGA 3HFML 3FBKA 4HCRA 2X6UA 1OEZW 4MNQB 1OZUA 4A2FA 4NPYB 1FZKB 3WV0A 5BZDB 4DEWA 4Y89A 2R0ZL 5AKVA 2YMXH 2ZPKL 4K7FB 4U2YA 5MHSE 5I6XB 4GI6A 3O6FB 4LT7A 3U83A 4HKBB 5E6ID 5E6SB 4I5BB 4RMRA 1SOQA 3VXSB 4PB0L 3LMJL 4BWUA 3ZMEA 3FTGB 4DKEH 3BFQG 2JI2A 3KVDD 1B6DA 3JWDH 3AXLB 1WO2A 4APQC 4I0PC 2ZCKH 4LVHB 3GMPB 2D0HA 5JPMB 5ECGA 2ZX9A 3W5NA 2DY2A 2MFNA 1D7DA 2W0FA 4YFEA 4BK4A 15C8H 4KXAA 4GRLD 1ZAGA 1Y6MR 3HNTL 1BZ7B 3L4UA 4K7PY 4WQOA 5KVDL 4BQCA 5I66A 4J2QA 3B2UD 1NFDA 2EP6A 5K93A 1UFUA 3KDPB 3MZGB 3RZCC 4P2RA 4U6XA 2CO4A 4K5PA 5D1QA 3GKZA 1BD2B 1MKFA 1U8MB 2J8HA 2VLJA 4ZS7H 1N8ZA 5ERWB 3EJRA 4ZDHB 2AFNA 1J8SA 4NPYA 5BZDA 4K7FA 1AZZC 3CSYA 3HC3L 3TBSB 3IBOA 3ZTCC 2OZ4L 4FULA 3D85D 3Q6FA 4HKBA 5SV4A 3S36H 3SODB 4JAMB 3VD9A 1LWJA 1IM3B 5LB1A 3VXOB 3VXSA 1ZXQA 3FTGA 3NSYA 1OZTG 5E4OA 1RZIB 4L18A 2H1PH 1U8IB 5CILH 1MFUA 2P8LB 3AXLA 1X4YA 2B1OA 1NH6A 5FYLL 5EBMB 4HD9A 2RR3A 1F6FB 2J72A 5EHFA 1E4HA 1R3JB 3FULA 4HPOH 3UMTA 3V6OA 3II1A 3WCYA 3OAYH 5I5MA 2B2XH 4FTVD 12E8L 1BZ7A 1N70A 1YJDL 3DXAD 1UZ6E 2F8XC 2Q20A 3QQDB 4IKLA 5D1ZB 3UTSB 2BINA 4JQIA 3VD3A 3OKNB 3C12A 4QJ3B 1F4WL 5HYSB 4GSDL 3S98A 4AIZB 2YUVA 1KXQE 1QPPA 5FCUH 4CNIB 5BJTA 2YXFA 2IPTH 4Y4HA 3QEGH 4FKEA 4QGTA 4ZXBB 4JLRB 2HUHA 4U0RC 1PX4A 1MCHA 3IGAB 3N3EA 3N6YA 1HCVA 4FYTA 2IQ9L 1DSFH 5FO8B 1LM8V 3SQRA 5D7IE 2R39A 3TBSA 5C9JB 2V33A 1U2HA 3CH1A 3KEDA 3NTCL 3CFBB 1IM3A 4MYWB 2Z91A 3PABB 4NP4L 3UABA 3VXOA 2VDOB 5LNGA 1GIGL 1C12B 4MZ3A 1YY8A 2OYPA 3PDGA 1YMME 1A1MB 1PZ3A 3EBGA 3HI5L 3EFOB 5KBDA 2ADYA 1U8IA 1A64A 2P8LA 2XN0A 4JJOA 5TE6H 3NIDE 1EPFA 5EBMA 4LLDA 3SO3C 1ZANL 4WWNA 2YS4A 3T8VA 3TN0B 3K81A 1OHQA 3ZZ1A 4IM8A 2QPDB 1RAMA 1I7TB 3MV9D 3QQDA 5D1ZA 3QFJB 3UTSA 5KUKA 2YXVA 1OXYA 3OKNA 3HFFA 3N44F 4Z7VB 5HYSA 1WCBB 4PB9L 2DWYA 4KKPA 3FO2B 3S3BB 3T0EC 5GGTH 4CNIA 2A4EA 4YE4H 3RA7L 5IQMA 4D7BA 4JO1H 1UWEL 1DO6A 2BW4A 3CN4A 3L4YA 3ARGD 3G5WA 4JGJA 2J8UE 3KPSE 4PJGA 2R4SL 2CDEB 3OMIB 2BZDA 2DTSA 4NDMA 1QFWH 3RX7A 4O02H 2CHXA 3QEUA 4UU9A 4GBXB 1DFBH 4JZJC 2X05A 3CSTA 3CFBA 1PLGH 3RDTC 4Z7OB 3PABA 1C12A 4HWZB 1HJCA 1TIUA 3EFOA 5D93C 1TZAA 5IVXA 4IDLA 3FL7A 1G0XA 3UZQB 2FD6H 1Z9LA 4GH7B 5IOKA 1OSZB 3CFUA 4WO4C 3RWFB 4NOFA 1A5FH 3FCUB 3UH8A 2MOGA 2LE9A 2AXJA 1NKRA 4WLCA 1NGWB 1RQ5A 1I7TA 1MWOA 3QFJA 4PJ7B 1WP6A 3SKMB 3VVVA 1XR9B 3MV8E 2NNCA 2RFXB 2PXYD 1WCBA 2PTVA 3T09A 4KZCA 2CLRB 4HEPA 4D9QD 4G6ML 4FQQB 3V0EA 5GQBA 1WZ1L 1AIZA 3FO2A 4QHMA 1UZGA 1NOLA 4H5SB 4J4PC 5ESAB 4DNLA 3BRGC 2DQCH 5C7XL 5L6YL 2A77H 2CDEA 3QZWB 4ODWB 4XNAA 5C08B 2Y1VA 2VR6A 4MJ2A 3U9UB 1YAZA 4GBXA 2BY1A 5FGBC 3QJZA 1JHKH 4HWZA 4GS7B 3BN9D 4XB3A 2FECL 4R84A 4Q2ZA 2R9HD 1DVFB 3OSKA 2YA1A 2J71A 1NEZG 4UTCA 4HDIB 4FI7A 4AL8C 1T1XB 2WNGA 3HZYB 3N85L 2E59A 3UZQA 1BX2B 3NJFA 1NUNB 1MJ7L 1OSZA 4KX7A 4NM4H 1J0IA 3RWFA 4YHZL 5I0ZA 3QHTC 4UANA 3G9AB 4M7LH 3QG7H 2YPLA 5J7CC 4A55A 1TYJA 5KANG 3AB0C 1NGWA 4FNLH 5IHZB 2KHAA 3LXBA 4G80B 4PJ7A 4QXUH 3SKMA 1E2WA 2A9NL 3N0AA 3VNZA 1XR9A 2RFXA 4JHZA 2R0LH 2EUZA 2CLRA 3ZT5A 5T3ZE 3GBLA 3NRFA 2AMGA 1MQKH 4L0ZA 1GS6X 1S5IL 1X7SA 5KYYB 4H5SA 1Q72L 4KO9A 1CLYH 5ESAA 3ZDXB 1RVFH 4UT6L 5KSVA 3RJQB 4XNXL 5DQJB 1GGBH 3RKPA 1SM3L 4WTQA 3BOVA 3AWFA 3RURA 1IBZA 1F3RB 1KC5H 4UIMB 3KJ4B 2X3BA 1H8LA 1H6TA 3QZWA 4ANXA 4QEGA 3TZVB 1CL7I 1GGIH 3B3BA 2X4PA 2XXMB 3A6BL 4HJJL 3FO0H 5IQ7H 4JPKH 5JQ6H 4M6OH 1BAFL 1DVFA 3QHZH 5DUPH 5KS9B 1FFPB 2NXYD 3HB3B 1HIMH 4HDIA 4NYLA 3L08A 1OD9A 4FLSA 1T1XA 2A6JB 2P5WB 4KKBD 4N9GB 2TRHA 5KYUB 1BX2A 3FOLB 4I2XE 4PS7A 3UTPD 3IF1B 5CD3A 3K4ZA 2HRPH 4NKIH 4PJCF 2V2WB 2YGNA 5IHZA 1KXTB 1XTMA 2OW6A 4ZFFA 4R7DB 2XOTA 5GGVL 1E8XA 3IKKA 4N1HB 1MXDA 1JMZA 2JJTC 3IKCB 3CMOL 4RFNC 3FFCE 4ABVA 2Y7LA 4XP5L 3H3PH 5CIPA 3T1FB 5KYYA 4MA3B 2CRMA 3TO4C 2WJ5A 2JJVA 2EUXA 2BIHA 5DQJA 4UT9A 3CZFB 4M5YL 5GIRB 5FR3A 1AD0B 2P8MB 4JQVA 3BD5A 4NQTA 4UIMA 2ZWYA 1UURA 3ZE0E 4NB7A 3KEHA 2XQYK 3QUMH 2HTKD 4AI7A 2CD0A 3STLB 3IWVA 3CCHA 1CFBA 2AEPL 3DETC 4K8RH 4X9YA 4E36A 1CXIA 3V4PB 1R0AL 1J5HA 2X6MA 5B39G 2DQGH 4NCDA 2Z35B 3DIDA 3VJ6B 1FZOB 1CTMA 3CQPA 5K9QI 5KS9A 1A6TA 1IB5A 3HPLB 3BAEL 4K07A 1I4FB 4P59L 3WBDA 3QNZB 3K4AA 4N9GA 5KYUA 4IHOB 4E2OA 4N2CA 3FOLA 3ZQ9A 4ZOBA 4RAUB 5F3BB 5CJXA 1L7IL 5M94B 4P2OD 3D2TA 1CDUA 2B1HH 2YUZA 2V2WA 5E99H 3DX6B 3RVXD 2EH8L 3TU6A 3B7UX 4B5EA 4JY6A 4EMZA 4R7DA 4ATWA 2YPVH 4D8PB 4KMTH 1NCCH 1R3IH 3T1FA 5BV7B 4X5RA 4JO4L 1ZHNB 1N0XL 3TNMA 4NNXB 4BQ8A 4KRPC 3NSXA 4UCFA 3K3QA 5GIRA 4M02A 4G8IB 4XCNB 5DJ8B 4CKVX 1AD0A 4NQCB 1MFVA 2BP5M 5F1IB 1AQKH 4YAQB 3BZEA 2ESVB 5DFVD 2WKLA 2WGXA 2E86A 4PP2A 1SMDA 3EYSH 4O00A 5E5MB 4HU2A 1NJ9B 2YLHA 3L4WA 1PAMA 4ANKA 3VJ6A 4BINA 1GYUA 1TO5A 1FZOA 1AO7E 3NAAL 1U3HC 1RJLA 3GTTA 2GC4C 3HPLA 4OZGF 1A7NL 3QNZA 1F8TL 3VI4F 3LZFL 4IHOA 4PTTB 3X1GA 2BVQB 5AW9B 2VDKH 1TJHL 1ZD6A 4HUMB 5HYJD 4OCRL 5F3BA 1KBBA 4OCNC 2RHEA 3V6FB 1AH1A 2B4CH 4L23A 3MGOB 3IFOA 1YN6A 3VU2A 4ZMPA 2UZIH 2GAZB 4GRWE 1J9QA 3DGDA 4KY1H 1DQQA 1HH6B 2MNJB 2UYLB 4CJ0A 3NDZE 1MREL 1MFEL 1WZKA 4D8PA 1F13A 2XBZA 3MRMB 2EH7H 2KS0A 4WV1B 2I5YL 2VDRH 5EZPA 2FIRT 2NY4C 1WFNA 4HGMA 1LJMA 4JVWA 4WUKL 4JRWA 2CM5A 2OMBA 2JF1A 2Z31D 3EYQC 1BFOB 1HOEA 2W9DH 3HTLX 2IMMA 4BRVA 4XCNA 4G8IA 3FSVA 2GJ6E 4L05A 5DJ8A 1EHLL 4NQCA 3TCLB 1SGKA 5F1IA 1DEDA 1JVOA 3V6BR 2HN7B 3IDYC 4YAQA 3O2DL 2JXMB 2ESVA 3W81A 4OGZA 3TBYB 1BMGA 1UH4A 2RIKA 3JWNH 4ETQA 1V05A 4F7PB 3FUEA 1GCFA 2JJSC 5E5MA 1CE1L 5IQ9A 1NJ9A 1JS4A 1JK9A 4HSAC 4TL5A 2KLRA 2XJLA 2ZUQC 1K5WA 1Z32X 2NQDA 5DEFA 1J12A 3O3AB 4F33A 3FS9A 1AE6H 2A6DB 4N26A 4LMQI 1LP9F 4PTTA 5DHMC 4FA7B 2HRGA 3BVXA 2BVQA 3G6JB 1QOKA 2ZSWB 3QORD 4OI7A 1J1PH 1ZS2A 3D5OF 3PPSA 4U6VH 4TUOB 4Z3GA 5CGTA 3MGOA 3QARA 4HS8H 5EN3A 3BPCB 4GUCA 3C09C 2Y07H 2GAZA 5DHVB 3GSRB 1ZEAL 1PZAA 1WVZA 1IGIL 3DBXB 2IADA 5HHXL 2FHCA 1QR1B 2CKBL 3MRMA 4WTZA 1G94A 1FSKB 3B9EA 3LHPH 4AWJC 2OXGA 4Z7WE 2DWXA 4I85A 4OCLC 3DMMD 1BFOA 3RL1B 2HJFB 4EUPH 3QCTH 1MIML 2MQ0A 4NUGH 1E5UI 4NPJA 1BAGA 2JI1A 2HKHL 4AYGA 4N2BA 2YZ1A 2JXMA 4NN6B 3QJQB 3ZHLA 3TBYA 4PIRF 2DQIL 4UILL 4YHNB 4FXGC 1SDYA 4G3YL 3HE6D 4IIZA 4FA8A 1FAIH 3FQXB 3V52L 3WAJA 4JRYD 3C5JA 2XIIA 1MHEB 4K3JH 1Q9LB 5J89A 5T5NG 4E9RA 3O3AA 3Q5OA 4TPRL 2NZIA 3G6AB 3LRLA 2ZSWA 4BFNA 3B9DA 2YGQA 4TUOA 2D4FA 3BVUA 3BZDA 3BPCA 2XWXA 2XVGA 5DHVA 2RBLA 1P7QB 3GSRA 2YUXA 3V0HA 1VDGA 1AI1L 1SMOA 1X9RA 3DBXA 4CGUB 3D39D 4N2IA 1QR1A 3MLZL 4PY8I 4GQPH 2QQLL 4QRPB 2BO0A 5DC4B 3ZRCC 3TFKD 1BF2A 1IV8A 1DLHB 4K5LA 3WUZA 1ECYA 1CK0H 2DLFH 2G2PA 5LAXB 4XZUB 4ZMOA 2W0KA 1S8DB 2HJFA 4HCRH 3RL1A 1CU4H 1PL3A 1TZGH 4IRJB 4E9VA 4RRPG 5CJQH 2IXQA 5DJCA 3C6EA 1SFHA 3X1BA 4Z3JA 4H1LA 4LQFL 3FQXA 3DURB 4YHKL 3MLUH 5BOPA 3CBJB 4WI6A 7PAZA 1MHEA 3SIKA 1Q9LA 2LHAA 2GEQA 3KLDA 1A3RH 1LEGB 4IU2B 2BSED 3QRGL 2F1BA 5HSFA 2F5BH 3G6AA 4F58L 4P3DB 2LAAA 3IFPB 1WWBX 1BEYH 2Y7SA 4U31A 3MBEA 2JKWA 5DJ0B 3T0WA 5C6TH 1T83C 5IK3B 4HCFA 1P7QA 2AEQH 1E4XL 3VRJA 4Y19D 2X5PA 3CDZB 1KN4L 5K9JL 1TJIH 1FNHA 1T0NA 2BVEA 3FFDA 5M95B 3CNKA 3UO1L 3V6ZB 5T1LB 4HV8B 1I1RA 1I9JL 1XD0A 2ZG3A 2ADFH 5CN2A 1S8DA 3AG1B 1QSEB 6FABL 3VFRB 4C54A 4YEFA 1XIWB 3BUPA 4V2BA 1K6QH 1NOAA 3A3YB 4IRJA 5H35B 4RDQG 1JZ5A 2XVBA 2H2PC 1T5WB 1A6AB 2R0WL 3ARXA 4UB0H 2O6CA 1S7RA 2YD4A 3F01A 4F3FB 1M2VA 1GW0A 4P57A 4BWWA 5JHLL 3ARDB 3P02A 2EDBA 1R3KA 1ZJAA 2R29A 4LHQB 4IU2A 3MJ8A 4M1CD 5E2JA 4P3DA 3ULUD 3IFPA 1FHNA 4PP1D 4X6CE 4V1DD 1XFPA 2X89A 4V33A 2DBJA 5AAMC 3GXUB 2VH5L 2A74A 5DJ0A 4NN5B 2K45A 4OY9A 5IK3A 4EIBA 2IBZY 5C07D 3KH4A 4XZ4A 4AJ0A 4LL1A 4PG9B 3ZYJA 1EWHA 3CDZA 2YBRA 5JYMA 2HLEB 3NJMA 3QIUB 4JFVA 5JYLA 5DUML 1KY7A 4C56E 3GBNL 5SX4I 4K55A 4RGOH 5T1LA 3BSZL 3MRNB 1S7VB 4X4ZA 5KVDH 3CAFA 2C1PA 2IG2H 3VFRA 2X9WA 4HFUH 5C71A 4J12A 5H35A 3TOPA 4BFRA 1NGQH 1N5AB 4R90L 4HH9B 2A4CA 2V37A 4C4KT 4A37A 1A6AA 1INQB 2J21A 2UWEB 3J27A 4WZ9A 3VACA 4MMYA 1FG2B 5I6OA 4F3FA 1QLRB 3M46A 2XBDA 1BYNA 1MW1A 1AGDB 3ARDA 4QRSB 1A3QA 4BD4A 3GHEL 1K4CB 2GPZA 3PGDB 2TSBA 2X0WA 1BP3B 4ACPA 3QRLA 5D70L 5I74C 1UA3A 2WBJB 4D0BA 2A0LC 4WEEA 2BOLA 4HEME 2OZ4H 4G9FA 1E9PB 3FQUB 4Y2DC 1XR8A 4Y16C 4I18C 1OTUC 4JE4B 1ASPA 4NO0B 3SDAD 2PCFB 3NJJA 4KUCD 3IDMB 5A7EA 3E0GA 5I73C 1NCBH 4JHVA 4OKVA 4XC1H 3WUWG 5FYLH 5KVEE 4KI1A 3R19A 5PAZA 3QIUA 5JDSA 3LD8C 2AXHA 2I9TA 5DRWB 1NDMB 3ZYZA 4LLVA 2CQVA 4M3HA 12E8H 1NIBA 2HLAB 1YJDH 1N2RB 3L5WA 1S7VA 3MRNA 1W0VB 2ZUSA 5IHLB 4DZBA 5C0NC 5I2IB 2KT6A 1F4WH 5F7LB 4WFHD 5I1JH 4EPSA 3IXTA 4YDZA 1BZ8A 3HRZA 4OZHA 1UZ6F 1XB6A 3DC0A 1B4JL 1P4BL 3HZKA 1INQA 4BSVB 2UWEA 3VE0B 4P3CH 3VB9A 1XBRA 1D2PA 4FHJA 1FG2A 1CURA 3APFA 1EJOL 1QLRA 3RUGF 4XXCA 3D50A 1AGDA 4QRSA 4WKZB 1BFSA 1WD9A 1K4CA 3GGWB 3CVCA 3O4OC 2Q9OA 2WBJA 3SN6N 3VSQA 5IFJB 5CZRA 1WEJH 3FQUA 5IW1B 1MI5B 5CR1A 2M8XA 3PXJA 4UTAA 2PCFA 2JJWA 3VMNA 2AGJL 4QHUB 4IBZA 1UM6H 3OBAA 3T4AB 4MNQD 1X5GA 1JIBA 3D1MC 3E2HC 4X5LA 1I1YB 2IH9A 3DX4A 2G9HB 2YRPA 2IAMC 3GJFK 2VDMH 1WSST 1ZANH 4UTBL 4RZCB 3EFFA 3O6FD 5DRWA 4LP8A 3QG6B 2EDWA 1V3LA 2Q7AA 3FH7A 2KZKA 1EHKB 1KIPA 1YDPB 4I88A 3VXSD 2F7IA 3K2UL 2C9XA 4IMLB 5DRZB 3WFCH 3A4DA 2QHRL 5MP6L 4NGHL 1CYGA 3OQRA 4PB9H 4POUB 5BW7A 2C9PA 1B2WH 5DZ9A 2V7NB 3AS1A 3PJSB 1A1OB 3VE0A 3RKDD 2WVUA 4JR9L 4WF7A 4YDVB 3VFSB 6PCYA 3BW9B 2J1YA 1U33A 2OTWB 3FRPB 4DQAA 1BLNB 2R27A 4WKZA 4UM9A 3GGWA 5FW7A 4RWYL 3WEBA 4FC3E 2QQQA 1IM9B 5F7BA 4OI9A 1BD2D 1JDCA 1WC7B 4M93C 2V8MA 4TTDD 2ZXAA 1CF8L 2NY7L 3OLGA 4MXVE 4XMTA 3O6ML 4EI5C 1KTDB 3BD4A 4Z9KB 3T4AA 2B9BA 3KBFA 2G9HA 4LVEA 3DX7B 1OWRM 4RMQA 2FJSA 3BP4B 1NPJA 3QG6A 2XACC 3MRHA 3PL6B 3P9LB 3VRLE 2VXSL 4CAGA 1IM3D 5C86A 1YDPA 4ZAKA 2VM9A 3SKOB 4IMLA 4PRIE 5DRZA 3BKML 3QAQA 4G6MH 1WZ1H 1KLGB 3GBDA 4J39A 3PJSA 4F37K 3C5ZB 5DMIH 2J57A 4YBQC 1HN1A 1C7SA 1N12A 1WA0X 3BW9A 4KAQH 4YDVA 4HUUB 2C9VA 1DJSA 3FRPA 4QRRB 1BLNA 1CPUA 3QZLA 5I1GL 1EAPA 4QXGH 3UTSD 3VYNA 1HL9A 1UYWL 3AQZA 4GO8A 2E7HA 5C0CE 3K4DA 3GZQA 3OG4B 3QWNA 1TTFA 4JKWA 1T7WA 5F96L 1KOAA 5I0YA 1WC7A 3OJDA 4A7GA 4A2DA 2NR6A 1OAKL 1VCAA 3DUUB 4K0OA 3GXIA 1OALA 1KTDA 1XQ4A 4ZXBD 3QWRA 4ZFGH 4GFXA 3LPWA 3PWPB 4KNUA 2QZQA 1NIAA 4LSPL 2V5RA 3S8FB 1XT5A 4LPUA 4X98A 2GUOB 4NQEB 3BP4A 1MJ7H 2DLTA 1YEJH 1SVBA 4HISA 2LGNA 3VGEA 5JTWA 3DV6B 3PL6A 3P9LA 5CIPH 5GS0D 2ICWB 3BP7B 4LMQE 4BQBA 4UT9H 1U8HB 3SKOA 4EBQH 2A9NH 2PYED 2VT0A 5J9PA 4AQ8C 4B0MM 1A8JH 4OI8A 5K33A 3QCUL 4WENB 2ZQKA 4KJWC 1JF6A 1BEXA 1FL3B 1PZBA 1S5IH 3F7LA 4UDUA 3T0AA 4GP4B 3C5ZA 3TN0D 4XNXH 2HT2D 5EZOL 2MRYA 4ZSOB 4PD4K 1UXMA 1LK3H 3NIGE 4XVTL 5BUPA 3A4AA 4ZG1A 3QFJD 4XVUC 5DO2C 1D5MA 2B59A 4RCAA 3TNNA 1H3TA 3D69A 4W9JC 1U93B 2VL5A 3CDCA 1E2ZA 1TZHB 1ZK9A 3CHSA 4D0CB 4AK1A 5EEVA 3DUUA 3OR7A 1NMAL 4JB9L 1BAFH 5EC2B 1UWYA 3PWPA 4NPKA 4YXKH 4CADB 3OPUA 4PVLA 1V3KA 4S1RH 2NT1A 3GSVB 2GUOA 4NQEA 2GI0A 3D09A 4YHOL 3T3PE 4KHTH 4GBXD 1A0QL 3DV6A 3KHOA 4OT1H 2PCYA 4UQEA 1IVTA 2ICWA 2VW7A 3BP7A 4FP8H 4K2UL 1G7JA 5BVPH 1C8PA 1SJMA 5ICXA 3V8OA 3D52A 3B2VL 3HG5A 4X5XB 4N4YB 2I60H 2ZUYA 4YDJB 1SBSL 3BH9B 2HX8A 3B9KA 1JGLL 1FL3A 4XP5H 3BAJA 4PJDB 3H7BB 5IVZA 2Y2WA 3H9SB 5KSUB 1XO8A 4HKZB 1SFDA 4ORGB 3VWJC 1R5VB 2BDNL 4AEHH 1RLWA 5C1MB 5AOMA 1QW9A 3HC4H 3K7UA 5I5RA 4B9IA 1GCYA 2WLHA 4Z3TA 2Q6WB 4KVPA 3UJJL 1P7HL 2YFNA 1CD8A 1KYFA 4Q56A 2PP9A 1TZHA 3U4AA 1AKPA 1PLAA 1XZ0A 4KI5D 4QRQB 4WFEE 3UMNA 3ZE0F 3U7WH 3O6LH 4KH2A 3MYJA 4CADA 1SUJA 3UACA 4MJHA 2ARWA 3V8CA 3GSVA 1BZEA 5C08D 3QH3A 4ORZC 2FT6A 2AJYL 3O9WD 2QT6A 1NPUA 2CO7B 4S1QL 4MMXB 1F58H 1X4ZA 1QASA 5DJ2B 1QLEB 3EOYG 1DVFD 5HHME 2WIMA 1SXZA 1IBDA 4U6TA 3ISWA 2K7QA 3C87A 3LXAA 3BH9A 4P06A 4WI8A 2Y7QA 2OR9H 4JO4H 3MSPA 1N0XH 4PJDA 3H7BA 1XB8A 4NKQB 5KSUA 3RWHB 3UFIA 4ORGA 4KO5A 2TSAA 2ZSVA 5CZVL 1R5VA 2DWTA 4AT6B 4LKXB 4L3FA 3VWKB 3WMPA 2OPCA 4Y0GA 4BFFA 3F64A 3GB7A 4EN3B 4Z78B 3BIAX 1YHPA 4XAWL 5AG9A 2FX7H 4QRQA 1CXEA 3L3IB 3SPIA 3G7TA 5CNHA 4QLWA 2FWSA 1Y6KR 3QR1A 4GNKB 3NAAH 3K1KC 4R4NC 3WMQA 5J0BA 2N56A 1ORQB 4TULL 3LZFH 1F0LA 1AG6A 3EH4B 3TZVD 2MH4A 4ODBD 2J3SA 2CO7A 1MFNA 4HZLB 5SX5H 4MMXA 4L8BB 3FZUD 4XP4L 4L0YA 1ZLVK 2AQNA 2VAJA 1CMOA 1MREH 1MFEH 1QSVA 4MTMA 2F9BT 2Y36H 3OAWA 1CB4A 4URKA 2P5WD 5B4MC 1S7QA 3E1ZA 3HN5A 3X3FL 1I9IH 5KSBE 4LASL 4WUKH 2APVA 1EA9C 1TJXA 1GOGA 4HUKB 3RWHA 4R0LB 1A4KB 1KIQB 4PWJA 4UUJB 4PJEE 2EIMB 4AT6A 4LKXA 4TQEH 2IOIA 4WTXA 2M26A 3VWKA 1D6VH 4R5XA 1R3HB 2X38A 4KDTA 4EN3A 4Z78A 1DBBH 2IFFH 1JZEA 4UNTA 5CGMA 3KLHD 4BGDA 2NX5E 4FNQA 3S34L 1EANA 2E27L 3L3IA 4IGBC 3NJXA 1UCBH 1BAWA 3WIFB 1LO4L 5DHVH 1VAHA 4X8JB 4IJTA 4RFOH 5C09E 4LCWD 2CUIA 3GXMA 2X40A 2G5BA 1AOZA 1MAML 1ZPUA 4FN0A 4I77L 1ES0B 4L8BA 5E23A 3DIFB 4TUJB 5IIEB 1IGIH 3IGUA 1QWUA 4EJ1C 5D7KD 5HHXH 3QVAA 1BJMA 1CGTA 1X7TA 2YXMA 4GG8B 5SWSB 4ODVL 3RGHA 4XMZA 2Y6SC 1NC2B 1HI6A 4GYBA 4H1LH 3MUJA 3RAJH 4FKKA 2WINB 5TGBB 1BQHB 3Q2CA 4LDLB 1HE8A 2IDTA 4EZKA 1IU1A 3CSFA 4Z7WF 2HT4D 2DQIH 3EJZC 4PJCB 4WFFD 4G3YH 1VZIA 1BF5A 3JV0A 1S9VB 4ODSL 2NW2B 2YJQA 4ZMLA 2D7OA 3MLVL 4JFFA 4B3EA 3KPMB 4UYQA 5CMAB 4YK4B 2EO7A 3WIFA 4DGUA 2DAVA 4XX5A 3LQAH 4X8JA 4GQQA 1OP5K 4F2ME 1CFTA 1A7RL 2ESVD 3VXNB 5BO0D 4X4MA 4YH6A 1YNTB 3QJFB 4ZZKA 1BBJB 1HOCB 4CMMA 5IBLD 1Q38A 2Z92A 1BZDA 1ES0A 2KZBA 2ZF9A 3OB8A 3QC5X 5C8JA 4TUJA 4K3HA 5E2WH 5IEHA 4NOBA 5IIEA 2X09A 4LE8A 2EKSA 1BDYA 1L9OA 2ZKWA 1YEEH 3ULVD 3PAZA 3PP3H 3SE4A 2B5IB 3UBGA 1T1YB 4GG8A 3WLBB 5EU6A 4DZ8B 5B1CA 3WJJC 1HCFX 1Z66A 1NC2A 3TV3H 2LABA 5CUSH 5F8QC 1JI2A 1BQHA 4OJFL 1LNUB 5BUAA 3T6QC 4DOHE 5I19L 2IH8A 1J18A 2HVKA 5AW3B 4A68A 4XNZC 2R29H 5BRZB 2AK1L 5D1XB 5J1AA 3RX9A 5KWYC 3OKMB 5ETUB 3CVHL 4FNSA 1RFDL 1S9VA 3KPRD 1OSEA 1BJ1H 3VCLB 5DI8A 1G9EA 4MMZC 3VTAA 1WRFA 3KPMA 4JPIB 2ZOWA 1UADC 2QPSA 5ICYB 5AQ0A 3DXAE 1H3WM 3S4SB 3D05A 1RULL 5IHHA 1ILSA 3WXVL 4RRPA 3TJHC 1YNTA 3QJFA 4BK5A 1BBJA 2HZHA 4QXWA 1HOCA 3L4CA 5DVLA 4KKZA 4Z7NB 4MA7L 1HVXA 2CDGB 1BIIB 1TVHB 1ZE3H 2ENJA 3MX0B 4JDEB 4RNRA 4WWKC 4W93A 4YQXH 3H54A 4N8PA 1ESOA 4FQLH 3RI5F 1WA2X 4PTUB 3PWJA 3GSOB 2MKLC 3RQ3A 4Y88A 3TEZA 3UC0L 4ZUSB 3IEAA 1YQ2A 3MRQB 4KBPA 3L6FA 3BKCH 3SE9H 1MRDL 1T1YA 3WLBA 2R69L 5T3XD 4DSYA 4DZ8A 4X4XB 1I9JH 3P3SA 4GY4A 4OZGB 5EZIH 2FZ3B 2E7BA 2KPWA 4MHHI 5TE4L 1ZT7A 5DVKA 1LNUA 2WNKA 3QJTB 5T1DL 5L9DH 3HG0A 3B3IA 2OI9B 3AM8C 4EEEA 4M48H 2VDPL 3SE3C 4YOKA 1FORL 1WFJA 3MLXL 3VXTB 4LHJB 5EU5B 4NKDB 5I1HL 2LTQB 5DT1L 1UD3A 2CDFB 1ZLEA 4XB7A 5ICYA 2ZAGA 2E76C 4AQZA 2YRZA 5LG6A 1UASA 25C8H 3MV9E 4K15A 4EZJA 3KWVA 1G9MH 3VM7A 3FSWA 1RZ7H 1MDTA 3IGKA 3LEYL 3FTWA 4Z7UA 2BW5A 1RZKC 3IFLL 2R8SL 1MG3C 1CFSB 5BMFL 2CDGA 1TVHA 3MX0A 1KCVL 4M6AA 4AQ1B 3N1FC 4PQXA 5KW9H 5LJYH 1NCDL 3GSOA 5IW6B 3V4UL 1MFBH 2AQ1A 2YLKA 3U25A 2WWMD 3SQBB 3MRQA 3BGFB 1PG7H 4QKXB 1TYRA 3QUZB 2EE9A 1RP9A 4UQCA 3COOA 3WKNA 2A3TA 4OZGA 1GAFL 2FZ3A 4PRPE 4E5XB 3IRCA 5DQDL 3RL2A 3HC2A 2H45A 3NZ8B 3TT1H 1DQVA 4GXUM 1P7QD 5AW0B 5JW5B 4GLRI 3ZT7A 2Z8RA 4J23A 1NSNL 1KPRB 4QRPD 3TPKA 5F9OH 4RSYA 5KTEL 3W9EA 3VXTA 5EU5A 4NKDA 4UTAH 2AEIT 1BVZA 2CDFA 5FHBH 5KJRH 3GHEH 3D2UB 3INUL 1Q4NX 5E6UB 5B8CC 3FQ2A 4M8RA 2DIBA 1G5GA 1OL0A 2MTPA 5E9DB 3O3EB 3CU1A 4H8WC 3ZGIA 3MA9H 5HVFB 1QBMH 3G3LA 5DJXB 2X2YA 2NY0B 3QDGA 1CFSA 3MI6A 1LO5B 1FBIH 5D7EA 2VDLL 3FU3A 3WU1A 4AQ1A 2C4XA 4YIQB 3VU1A 5IW6A 4BFGA 3RFZC 4Q0XL 3CZSA 4IRSB 5L88H 4LF3B 3GLAA 4YBLB 4QAMB 1J0ZA 3NK4A 5IHUL 3GSUB 3QUZA 3ARGC 4YHYB 4M1DL 3IJ7A 3GKWL 5CGYC 3TO2B 3R7QA 2YD9A 3ATBA 3QXWA 4ES8A 5K9OA 1HZLA 1IMHC 1MCFA 3NZ8A 2EIBA 4M8VA 4PW9A 3WUWA 3H2QA 5GJTH 3EYOA 4MJIA 4RH4A 1XXDC 4LOFA 1P6FA 3ASOB 3D08A 3S2CA 2BNRA 1YC8A 5A6LA 2K78A 5T1LD 1AFVL 1OGAB 3O2VH 1QSED 2OQJB 1RXLA 1XTLA 1XIWD 4WNSA 4I3RL 1Q0YL 2VUOA 5JOFB 5H8DA 5F6HI 5EBWB 5E9DA 5EO0A 2DQDH 5A2JH 5DJXA 2VLLB 1EAQA 4ZUWA 5B21A 1PJ9A 1S7TB 1LO5A 3F7KA 4WRLA 2XYBA 2JQMA 4QLRA 3LH8A 1I3VA 1YNLL 1OF2B 2E7CA 4YIQA 1MOEA 1IAMA 5AAWC 4LARL 3F7YA 3WJLA 4HH8A 1WBXB 4LF3A 4LSDA 2J56A 1MFAL 2H32B 3GEFA 1QFPA 5CWSB 4KZDH 3P4LA 2QKIC 2XX1A 3SDXF 4I9WD 1J10A 3NT0A 3AADB 3MBWA 4NGHH 2XG5B 3TT3L 5HGBB 1GC1H 4DAGH 4QGYA 5LCVL 2BPBA 3QIUD 5HDLA 3BN9C 2QADC 1S6NA 2WIIB 4PM1A 1RD6A 1LYQA 5C0AB 4JR9H 4IOIA 2Q2EB 3RY6C 1OGAA 2C7UB 1F2QA 4APQB 1DBKL 1PZ5B 4I0PB 1FFRA 1NL0H 4XP6L 2OQJA 1DUYB 4HJTA 5ANMB 4LLUB 3RNKA 4G7YH 4EOWL 1FYTE 2QGBA 5DURB 4KJQC 4HKXB 3QDJB 4TL4A 1HDMB 2WWKO 3DROB 2VLLA 4PJXB 3BWUF 1CF8H 1PZSA 2NY7H 1S7TA 4M61B 3A23A 2VYRE 5EUOF 3RZCB 3N43F 1OF2A 1RIUH 2XG4B 3O0LA 1WBXA 5ICUA 2NCMA 1X5LA 4P2AA 2JB6B 3UPRA 2H32A 1UWGH 1G6RL 4NO0D 1J88A 2X3AA 5DHDA 1IARB 5CEYB 4BFIB 5HYEA 2HKFL 2ZONA 2JKJA 2XG5A 4KKLD 4HUWB 4FNTA 5EEXA 1FVCB 3A6CH 3VRLF 2V2TB 5FKAB 1CGSH 4J6RH 3W38A 3ECUA 4KOCA 4YLCA 2WBKA 5C0AA 1NAMB 3C6SB 3MRIB 3ZKQD 1WUZA 1MHPL 4H8HA 1LEKA 4Q6IC 3KJ6L 1GW6A 1PZ5A 4I0PA 5ANMA 4K3DL 4APQA 3SGJA 1DUYA 4LLUA 1NINA 2GJZB 4QHNA 4PW3A 1FGNL 1NDTA 2JTDA 3NGBC 1IX2A 3QDJA 5F96H 3T08A 1E4JA 3ZTEA 1CICD 1HDMA 2J73A 4PJXA 2F8IA 4NCC1 5DYOB 1ZMYA 5JW3H 3BAYA 3HMXA 4M61A 2HT3D 3QISA 3SKNB 2QEJA 4G6KH 1M42A 2CAKA 3IRZA 1VKXA 2LU5A 3ECWA 3IU3B 4LSPH 4B9PA 3AZUA 2WC7A 4C4BA 3BQUC 3Q8CA 2JTYA 2N7BA 1JXJA 2WQRA 5F7AA 3LVTA 2YA0A 4FFYL 1EXHA 1G7HA 2JB6A 2ZUXA 1MI5D 1IZJA 3T9WA 3MFFB 4U0RB 3EJUA 1TTRA 2F58L 4AUJA 3ZL2A 5IB1B 5CEYA 4ALAH 4BFIA 4ZUUA 2IVFC 1XMEB 2EDTA 4XP9L 2PR4H 4LCVA 1FVCA 2V2TA 1KXHA 2XFXA 1KGJA 3OTTA 3QCUH 5DFWH 4JY4B 2FR4B 4P4KD 4N87A 4Y9EA 2JLLA 3C60A 1CFNA 1MWAL 2VN5A 1NAMA 3C6SA 3KD4A 4UV4L 2NSQA 3FN9A 1HNGA 5GGQL 1GTFA 1O6TA 1G9NL 2IBBA 3SO3B 4QD2E 2NRDA 3GF8A 4X0NA 3ZMNA 1ND0A 4OJDH 4PSPA 3WNPA 2BERA 2C34A 2CBMA 2WXPA 5DWUH 5ITBL 4QOKA 2C3WA 3EH2A 3NIGF 4FFZA 5D71L 4HS3B 4BHUA 3PAUA 3SKNA 4JB9H 3QRBA 3P4OB 4HUXB 4DESA 5CP7A 3QFGA 3V4VL 4BE5A 3D8MA 3IU3A 1LO3H 5JZ7D 3T0EB 2V3EA 3WEXA 1IM9D 3ABMB 4FQXA 2QR0A 3ALPA 3MFFA 3WLWC 2CO3A 3ATAA 3CV5A 1A66A 2O6EA 5IB1A 1IGMH 3T3PF 4JZJB 3ASNB 3LHAA 2UXTA 4G59C 4I89A 3RDTB 2FR4A 4JY4A 5D7IB 1MRFH 1R9FA 5DS8B 1QQDB 4IKJA 3BKJL 3PL6D 5D93B 1EHAA 3OAZH 1T80A 3IMTA 2WPGA 3NACL 4W9EC 1MY7A 3RP1A 3O41B 3KLSA 1VESA 1YMMB 2I7OA 5CZXC 5DLMH 2OSWA 4OBSA 4WO4B 3NIDB 5K39B 4KQ4L 5ID0A 2ROXA 3UJJH 4DO6A 3V0FA 5EOTB 4UOQA 2XLLA 3K5RA 2YR3A 4F9LC 4CVWA 1M6UA 3C5ZD 2ZT9C 2CKNA 4RETB 5HTSA 4O9HL 2FATL 3KVPA 3P4OA 3S3SA 2E6QA 3FTSA 4QRRD 4P23A 1OP4A 4FLQA 4PRNB 1FL5A 3KL5A 1ILUA 1D7FA 1QLEH 1YEGH 4PD4J 3BD3A 3NH7H 4AE1A 1RK1B 3IYLW 4MCZB 4X8XA 1IAIM 2AJYH 2UVEA 3P3UA 5CXPA 4E42B 3ZMRA 4S1QH 3R18A 3NZHH 2Y0SA 4LHUB 5DSCB 3F65A 1E6OH 1S9XB 4FRWA 4H88L 4R5TA 3CC1A 2J8UB 5E70A 1TSRA 4JZJA 3PWPD 3KPSB 1QHOA 1S7XA 3RDTA 3WIHA 1J8KA 2BH0A 5D7IA 1KTLB 4NQED 4OQ1A 5CD5D 5JIPA 1JWMA 3R7RA 1QQDA 1RI8A 3QDME 4JDVB 2I9LB 4GUOA 5CZVH 5B1JC 2E4TA 5E1IA 5T1JA 2HVBA 4UM8B 3HC0B 1EMTH 2JKNA 3QORC 3IETB 2AJVL 2P24A 3UX9B 4O2CB 5L8KB 4XXWA 3MNDA 3BLKA 5E2UL 2JNZA 5K39A 1CGUA 1E27B 3FDWA 4AYEC 1ZVYA 3I3BA 2XZAH 3AB0B 3N5AA 4KJPD 4GT7A 5L2JB 1F90H 4P07A 5IG7B 2CG9X 4CC4C 3BH4A 3OKYA 2JCCA 1JVKA 4MQXD 4PRNA 3MCLH 1KSRA 3HE7C 2NZ9D 3MV8B 5FM5O 4J4PA 5E0FA 1RK1A 5F97E 3UO8B 4AC4A 2ICEC 1E2VA 3D3VE 3OHXC 3WS6C 4ONGH 5E51A 3UYPB 2A6IB 3MOBL 5I30H 2HWZH 1HWWA 3VXMB 4F8QA 4XP4H 4U3HA 3OF6D 2M83A 1ZLWH 5CCKL 1OT2A 5DSCA 1S9XA 1FNSH 5ID1B 2J8UA 2GFBB 2ZP9A 8CGTA 4H4NA 2FO4B 3KPSA 2P45B 1YEKH 1F00I 1S9KC 1KTLA 4XI5C 5DD6A 5F7MC 2VOTA 3IJYB 1N10A 4JDVA 3TEUA 2EEXA 3QI9C 5FPIA 4KZ0A 2APSA 4TLKA 1E3XA 1SRDA 1N6QL 1LDPL 3OJMB 2FGZA 1UZ8B 2J1KA 4KZEH 2OR7A 3IETA 1Z5HA 5F71A 5FLVA 4L1DA 5DEZA 1E27A 3N1PC 3QWOB 1F6LL 2WZAA 4ZTPL 5LXVA 2COVD 5L2JA 1XEUA 3H9SD 4YN3A 2E27H 5IJKC 5DMYA 4B9GA 1ETJA 1G1KA 3HBZA 4RFNB 3MAWA 2WXFA 4N25A 4F1ZA 3LNDA 1BVNP 1C5DA 3TO4B 1J9SA 4R9HA 1RERA 4MASA 2WQUA 3SDCC 1KTBA 1QHQA 3UYPA 4BH8B 2A6IA 3L1EA 2PO6A 4KRMB 4Z76B 2ZKMX 3LRHA 4O4YL 2IGFL 2MSPA 4OJCA 4ZFZA 5LO7A 4AG4L 3TURA 3ZK0A 5ID1A 2OJEA 2GFBA 4XNUL 2VN6A 5IBUB 4BYHA 2ADGB 1WH0A 3UTZB 4FFVC 1X5YA 2A9AA 1JFQL 2E9WA 2O4EA 4ODVH 4AIXA 3ULUE 3IJYA 4Z7IA 4NQSA 2ID5A 3TBBA 2P26A 5EG6C 5DJ6B 1WICA 4Z77A 2MPAH 1UFGA 1XAKA 2XQBL 3KR3L 3TVMC 1UZ8A 5E8PB 4ZMYA 3HS0C 3V5DA 2IDCA 2XPZA 3V7MA 5FV2A 5C07E 3QWOA 3KS0J 5EWIH 3WENA 1DLFH 4UDTB 3MRKB 4I2XB 4ODSH 1U9KA 2QQKL 1U8PB 1IAII 2NY5C 1UACH 2VXVH 4FJ6A 4BFKA 3VAEA 3O3DB 3IPEA 2WZPA 3ZTNH 2MJWA 2X0UA 3J7HA 2P7TB 4GQZA 1J5OL 1EGJA 1J7VR 3TO4A 1A7RH 3LN4A 3TTYA 4L3AA 3HZMB 4KRPB 4EN3D 4LCCC 3FFCB 3FO9B 1M7XA 4H13C 1T0PB 2OZNA 3K2MC 5FYJE 4BH8A 1OW0C 1NBZB 4NNYB 3FH8A 2GCYB 2OFQA 3PXHA 4Z76A 1D9KD 4XWOC 1T2QH 2XQ0A 1WDAA 4P99A 3EJPA 1PFCA 5DJDB 3CFCL 4TLSA 3D4GA 3ZE0B 3I50H 3UTZA 2WUBL 2WZ0A 1UOWA 3EGSB 3G5XB 3Q8FA 4YWGL 1CN4A 4YX2L 3WI9A 5T5FA 1U3HB 2EXWD 4OJFH 5DJ6A 1AC6A 1G9HA 2ED8A 1PD6A 4JGUA 4X5WA 2H6PB 3ULUC 3DDGA 3SZKC 4NUPA 5E8PA 5J57B 3FT3B 3ELQA 5I5JA 2XBTA 4QTFA 4XPBH 3W39A 3ZHNA 2EUVA 4XC3L 3CX2A 1DVQA 1D5XB 4JPVH 1BWMA 2FQFA 2X1XR 3L3HB 1RFDH 4NFBA 5EUKA 1Q1PA 3MRKA 4MQ7A 3H2WA 4I2XA 4UDTA 1KCBA 3MRLB 3M8OL 3WKPA 1U8PA 3E6FB 3W82A 1G7IA 2H3NB 3O3DA 5DUBB 5FX3A 4EXKA 5D7JC 2LU3A 2NY4B 3GS4A 4WK0B 3VFVB 3HZMA 3WKQA 3IU4H 2NY5L 2R4RL 3FFCA 3FO9A 4WJG3 4G9DB 1VFOA 2K9UA 1NBZA 3QNYB 4NNYA 3CN1A 4DK6A 2GCYA 4P8QA 4ANWA 1NICA 3IDYB 4MS6A 4LSQL 5J6GB 3LQZB 3ZBMA 1T5KA 1RHHB 3JBG7 4U1NA 2R15A 1CDJA 1BXVA 5DJDA 4PJIE 3HUJE 3D6GA 3DJTA 2EEDA 3P73B 3LEXB 2F7RA 4BH7B 4EN2A 1NCNA 1IC7L 3EGSA 3THML 1KULA 4LESA 1NBQA 4LEXH 3G5XA 3MLWL 2ZUQB 2G3XA 4PGDB 5DVMA 1G6VK 2Z34A 5EORH 5TE4H 4L8DB 1F4XH 1X9QA 1KCUL 2ZOOA 1VB9A 3OC8A 1OK0A 4P5TC 1AO7B 3SDAC 2QFRA 3LH2L 1EDQA 3L7FB 4MZIA 4C59B 5L4FA 1D5XA 1W8OA 3L3HA 4TSBH 5FYKL 4I9XA 4OFIA 3C09B 5SWSD 3MRLA 4WTWA 5LBVA 1H5BC 5I1HH 3BVDB 3ARRA 1NC2D 3H9YA 5DC2A 4F8NA 2H3NA 1DL7H 4U3XA 4PJ8C 5DUBA 3CFJB 4GRWB 4KC3B 3VMPA 4XPTL 2OXHB 3QUYA 1HAWA 3QXAA 5ENWA 2WNWA 4H25A 4FABH 3TF7C 3F7VB 5HVWA 2Q5BA 3LZPA 4XBMA 3VFVA 2KQNA 2RD0A 3BKYH 3NABL 2IANE 4G9DA 5BMFH 4WDIA 2W07A 3K6SB 2XTJD 4Z1PA 1VZHA 2IDUA 5HGAA 5IQLA 4DEUA 3LQZA 1IEAA 1RHHA 4DWHA 5LGYA 4QRTA 3ARFC 4FXGB 4HS6B 4HJEA 4B97A 1AR1C 1DVYA 1YN7B 2AJSL 1GZPB 2JJSA 2Z93B 3LEXA 4ELDA 4BH7A 4XNQB 2ROYA 1L0PA 1Q90A 4KMQA 2ZWKA 1JGEB 2E8YA 4NBZB 1A1NB 1GYCA 4XVJH 4PGDA 3C2SA 5DQDH 3V0GA 4AW7A 4L8DA 2VMJA 3Q1SH 5EOCL 2UXVA 1N68A 4MGXA 3V7AE 5HDQL 3ESUF 4A04A 4UT7L 1EZSA 3ABLB 5E8DH 2Z3FA 1PTZA 3UTQB 1E40A 1BPLB 1RURL 4S10A 3CPLB 4W9FC 3GMQB 5F1NB 1INEL 1OV8A 2YQ2A 3F2LA 3BEWB 4PJAF 5IFHL 1NCIA 2AK4E 2OXHA 5I0XA 4OGAC 2Q3XA 3QUHA 5JDJA 3F7VA 3FQ4A 5A16B 5BRZD 3T8XB 5D1XD 1TFPA 4IRZL 2QTVA 3Q13A 4D3CL 5IROA 1YLBB 1IQWH 1E9QB 1TLKA 3CSBA 4HJ1A 4X50A 3ML8A 4YDIH 3MCKA 3L5IA 4Z7WB 4UBDD 1HNYA 5KYXB 3O81A 1OCZB 1VFBA 2GJ6A 4FXGA 5DEGB 4HS6A 1IQDB 1XSOA 1YN7A 3B2PA 1GZPA 1H6UA 2Z93A 1O6SB 5HGDA 4XNQA 1TFHA 1WZLA 4CKQA 1JGEA 3EHBC 3IRPX 1A1NA 3W37A 3WD5L 3D07A 3Q1EA 5AOIA 3NFPA 4G7SB 3UYRH 1ORSB 2DLHA 4W9IC 1D3CA 2EC8A 4PHXA 3U7YL 1GGYA 3RVVC 4WSKA 4HMCA 4LU5L 3ZN6A 1S5HB 1Z3RA 4FNUA 5DK2B 4A7UA 1B90A 4PRHE 4K94H 1FNEB 2CUAA 3SJVD 3OXRB 3FU6A 3GMQA 1NAKL 1AYRA 2CXGA 3GI8L 1MHHB 3BEWA 3P30H 2XYCA 2RGSA 4I3RH 3BFOA 3Q5YA 3GYRA 2J2ZB 2PYEE 4GKSB 2BSDA 5A16A 2CH8A 1JOIA 4YFLI 1E43A 2CBOA 2W81C 4HIQA 5F7HA 1NFKA 5BOZG 2OMNA 1E9QA 1TG8A 4JHAH 2OX5A 3LRSB 5FO2A 4Z7WA 5MEPB 2H32H 1VFMA 1YNLH 1AD9A 3PAVA 4JJHA 4IRZA 2VN3A 1O6SA 3ECQA 5EIIB 4DUXA 1DBJL 5DO8A 3RPIB 3X3GL 3WNNA 1IGCL 5FGSA 2D9QB 1PX8A 2Q8BL 3PWVA 4UMSA 4MVBC 3GT6A 3DJSA 1YVLA 4OV5B 2LOEA 2Y1YA 5JMRA 1ORSA 3MMEB 2P43B 5D2NE 3BUBA 4F8OA 3QWQB 1A4CA 5BPPA 5IHBA 1QBLL 4WU5B 4N0UA 1OPGH 2ZX7A 5DK2A 1VGKA 2CJUL 1FRGL 4NZUH 4O58H 1U8NA 5AL8A 1FNEA 3QUZD 3IT8D 5I28A 2X53A 5GZND 3HMXH 1FFNB 1MHHA 1MEXH 1QA9A 2JVUA 2XZQL 4XP6H 1MRCH 1F4AA 3QO1B 3JV6A 4U1SB 5IW3A 2Q3AA 1XV8A 1TENA 4GKSA 3DI2B 3B7TA 4PWGA 3ZTJG 1SEQL 3NCYP 1WIUA 4NC0B 3LRSA 4H8VA 1B4TA 3WGUB 1U58A 5JHMA 3ZE2E 3I75A 2QSVA 4NNPL 2EAEA 1GYAA 3D2UD 1IAOB 3GC3A 1BXAA 4XH2A 1A14H 4PYHA 5E9DD 4B95C 5C70A 2NCEA 5FDWA 5DMKB 1THAA 4G6AC 3SOBH 5J06A 2H9GA 2D3LA 4TUUA 2BY2A 2NY0D 1NAMH 4LLYB 4ENEC 5J5EA 1SN0A 4KI5E 5I74B 4PGJA 5E9NA 5T33L 4MYPA 3DSFL 1M3JA 3QEQE 4Y2DB 5KJ7E 4Y16B 4I18B 1AACA 4PMEA 2WXGA 2BP0B 4IRSD 4WU5A 4Y2OB 5FK9A 1J5CA 4X80L 5D2NC 3G5YB 3FYIB 4QRAA 2XV6B 4WI0B 1KTCA 4X6CB 5I73B 2QJDA 5FV1L 1MCIA 2XV0A 3ARYA 1FFNA 3KJ6H 1AJ7H 2C3VB 4U1SA 3QO1A 3RY4A 3LD8B 3P77B 1OAUL 3CZJA 1FHGA 3SQOH 3ESOA 4GFTB 1AXTH 3AITA 4F1SA 1U41A 3BIBX 4XCFL 4C56B 1LWHA 1UD6A 2EDJA 2XHNA 3B43A 3SD2A 3RBSA 3NCFB 1KTJA 2BS9A 1HWHB 3ZL4H 3SCMC 1OGAD 5BO1H 2K6WA 1IAOA 1T6BX 4NFCA 2XTLA 4HWBL 2BFVL 2XWBA 1KJ2L 1BCIA 5G55A 3V0VB 2G3MA 1FH5H 2K3TA 5DMKA 4PCKA 3D51A 4X6DE 5IMMA 2EICA 3U2SB 2B77A 3O4OB 1EJ8A 1ZXKA 4XP9H 1P4IH 2NNXA 4P49A 1VGEL 3EW3B 1J1OH 1VA9A 3H6JA 4Y16A 4I18A 5IOPB 4YC2C 1I8UA 4KI5C 2BP0A 4Y2OA 2DQHL 1Z7JA 1BBDH 3G5YA 4WI0A 4XBEH 4E9QA 3OB0K 4X6CA 1WYJA 3TJEH 3E2HB 3ZJAA 4Y4KA 5GGQH 3NEEA 2C3VA 2IAMB 4JFZH 5IP4A 1TTGA 3RGBA 3O9WC 4OZIE 3QQ3B 5AWNH 1NWPA 3D30A 5ITBH 2MNWA 3GWJA 4BDVB 4UIKL 4XMPL 1QFWM 5D71H 1C1EL 2EYSB 2VGLM 5C0AD 3IDNB 5HP5A 2MTAA 2L8AA 4XPHL 5ESQB 3V4VH 8FABB 4APQD 3CZLA 3VFTB 1TUPA 3OAUH 4WI3A 1RUQL 2WBWB 2OULB 2GT9B 5EDSA 4HBCL 1FJ1B 1H3PL 3E38A 2UUDH 4FQ1H 3WIHH 3QDJD 5IB2B 4Y9GA 5EZLB 3L4TA 2AABL 3U2SA 5B1BB 2CO6A 4LOUC 4FJZA 4L5FL 4AQAB 3RZCD 5F9AC 4HIXL 5LBSL 3GHPA 2ISDA 2J12B 3CFMA 4B50A 3FT0A 3QGVA 4GAGL 1U42A 4M93B 4A2MA 1ZHKA 3VW3H 1LQSR 4APXB 2GIMA 1NC4A 3L45A 4J8RB 4BGLA 2ZWNA 3BKJH 3NCMA 4EI5B 3IJSA 4LCWE 3UBXG 3JVFC 3NACH 2C3XA 4W9CC 2IAMA 2AITA 1Z5YD 1T3FB 1FA4A 3BZ4B 3QQ3A 1KB5L 3OSVA 4FQCL 3TA3C 2X4OB 4PRAB 4E5XA 3CIAA 3U1QA 1A6WL 4BDVA 4AYMC 4ZW7A 1PY0A 4UZSA 3RNQB 1SY6A 2FATH 3IDNA 5F7FA 4QXTA 4WI4A 2IWGA 3VFTA 4NSKA 2Q10A 2H3KA 4OD1L 2GT9A 3ZYIA 5CEZH 1FJ1A 2BOBB 5F7UA 3VVWA 3V0WL 5LQBH 5IB2A 4WFFE 5EZLA 4KHXH 3AQXA 1GSKA 2YD7A 2OMVB 4AL8H 1ZHBA 4DPCX 4IBUA 1G1YA 1N3NA 2BC4B 4L29A 5IREA 3D12B 3E3QE 3OPZH 4KU1A 4YHLH 1OY3B 3WHE0 3N43B 3QUXC 3BP6B 2YRBA 3MU3A 1JCVA 3B6SA 3ZIYA 1T3FA 4PUBL 1MVYA 2YD5A 1SN5A 3BZ4A 3ZPDA 4EF3A 3WO4C 1SXNA 3BT0A 4P2QD 4MJ4A 1OTTC 3V9CA 2X4OA 3I9GL 4PRAA 3NA9L 4X8GA 1TETL 3ULVE 5HY9A 3RNQA 3Q6GH 4TVPE 1HL4A 3BUYA 4GMSL 2XFGB 2E74C 3BISA 1W72L 4JUSA 4HOMA 4XHJC 2WSPA 3UJIL 4ZD3L 4PRIB 3MUUA 4OLUH 1ZPLA 2FAUA 3CD4A 3ORJA 2BOBA 4K71C 1O7SA 3OKDA 5D4IA 3PGCB 4G1MB 1M9SA 3UCQA 3MOBH 1CT8B 4Y5XA 1YYLH 2Z4TA 3KPRE 3MQIA 2HJKB 5EV7A 4ZRGA 2OMVA 2ED9A 3KBPA 2M1KA 5FUCE 2BC4A 1IL1B 1CGYA 4CJ1A 3P69A 1ID5I 4M5ZH 3T0ED 1KCRH 3EDKA 2QL1A 1YPZA 3LPPA 1KENL 4LVOC 1PEWA 3BP6A 4R2GC 3E3QC 2CZNA 3DGGA 1CDCA 1QFWI 3GM0A 1LDPH 3JV4B 1QUPA 5DVOA 3U79A 1XF5B 4P5KB 1EGJH 3LZLA 3RDTD 2V2XB 1N26A 1EH9A 3BPOC 3SEPA 2BWQA 2D3VA 3AREC 3F05A 5T3ZH 4OF0A 4KVCL 5T3XE 3G5VB 5CSBA 4UYPA 3MLTB 2O5ZL 3WN5C 1FUNA 3ULVC 2O26U 2J20A 3PWLB 3S3DB 1IT9L 1YMMD 4PRIA 4WK2B 2X44D 1BZOA 1A3ZA 2BVPA 4WO4D 2CMRL 3VWJB 3PGCA 1RY7B 5D7SL 4PIBA 5DQ9A 4J3OC 4LSVL 3ETBF 3IXAA 2HJKA 4YDNA 5T5FH 3ME0B 1AANA 1RUPL 1RJYB 1KELH 2A9ML 3NIGB 5JIMA 1IL1A 1EAJA 2XTSA 1FF5A 3L3GB 4J4PD 1JFQH 1KGWA 2BXZA 2WP3O 5C0CA 5FUCC 4YSUA 2X4TB 1HHIB 1UEYA 3APNA 1BVOA 2E4FA 3DX1A 3G04B 4JUTA 5HHNB 1RSFA 2ZXCA 2F5AL 2FEDC 2XQBH 3JV4A 4FQ2H 4LHUD 2DYPB 2FQEA 1VFUA 4OM0L 4P5KA 3DSNB 4Q6KA 3KPSD 5C0RL 4JFWA 1L0YA 2V2XA 3EF7A 1U4EA 3T3PB 5HPOA 1WZMA 2FE0A 2XT1B 1P5UC 2QQKH 4BCXA 3GDCA 2HJLB 4U1HB 4WW2C 5CLWA 3MLTA 3NEOA 2V9QA 3PWLA 4YUEH 3VXUE 2N1TE 4N24A 2WB1A 3VWJA 5FO7B 1PW3A 1BQLL 5LBGA 3P2DA 3MGTA 1ZTXL 3TC9A 2XWRA 3L95B 1I9EA 4HJSA 4YGVB 4OLZL 3VGAC 3A4FA 3CFCH 3JTTB 5B1KA 4HLZH 5T8IA 5I1IH 2UZYB 2DL9A 2BVUA 1SHMA 3MV8D 2PWFA 3LKOB 4GINA 1KJMB 1E4WH 2ZG1A 3OMNB 4YR6B 3WY3A 1GVIA 1JPTL 4R4FH 1NA8A 3JQOB 4MNHB 1HHIA 1D5ZB 2CGRH 3G04A 5HHNA 2AI0L 4U7KA 2DYPA 4P04A 3S36X 1DQMH 1JFHA 3DSNA 2Z64C 2XIBA 3DO7B 4OLVH 3D0AA 9CGTA 3M8OH 3BZ5A 1BA9A 4XX1G 2HJLA 1DJYA 4U1HA 3CE1A 3L2MA 5E2TL 1HK6A 3IDUA 5HHMB 3FQRB 4UOW1 5MI0C 3UDWA 3ERXA 2Q7NA 4ZUTB 5L4MA 3W0WE 4BK8A 2HXAA 2R4RH 1IILE 3LEVH 5E8OB 5FO7A 2JI3A 1AZNA 1V54B 1UJTA 1Z2KA 3KPOA 3PRZA 2VUYA 2EDDA 3D48R 2WANA 4DP5X 4GQ9H 4UAHA 5F88B 1KG0A 2G5UA 3JTTA 2UZYA 4PJBA 3LKOA 3TO4D 2AKRB 3THMH 4CA4A 3GNMH 1KJMA 1W16A 4H8PA 5FF6B 1UGKA 2XIDA 5T3ZD 4IGBB 2V17L 4UZGA 2KH2B 3GSQB 3RWDB 3SBRA 4YSSA 4WHYH 4DGVH 5HYFA 5LGHL 1D5ZA 1KCUH 3LY6A 5BXFB 4N0FB 3FQWB 4GRWH 1GSMA 1LK2B 4A2EA 2HFEA 1DCEA 4FMKA 3DO7A 3DETD 2R1WB 4DO4A 1JPGB 1JPSL 3F6LA 4A2LA 2X1PA 2AJXL 1WWWX 4XOAA 3HG1E 3A0OA 4XPTH 3EOAB 4TOYL 4I9WE 4BQ9A 3FQRA 1KCSL 3CVHB 4B6ZA 4HT1H 1SHSA 4XNBA 4JPWL 4YSPA 5KSBB 5E8OA 3EJYC 2WXMA 2QDWA 2VO5A 3ASWA 2L0DA 3OGOE 3FU7B 4FMFA 3N41F 5TF1L 3UOAB 4ELME 4B9ZA 4CILA 1M3IA 4PJEB 3WTWA 2EUWA 2DICA 3KZ8A 4KQ0A 4NZRL 1JGIA 3NCEB 4LIQL 1NMBL 3CBKB 4X42A 4NERA 3N50A 4WHCA 2AKRA 3DTUB 4B53A 2BIIA 1LE9B 4IGBA 1R6VA 2X10A 3FFCD 4OU3A 4AMKH 2H5UA 5GRUL 3GSQA 4HLEA 2NX5B 2VZ3A 4LSTL 2UY7A 5BXFA 4Q89A 2P48B 4N0FA 2R7EB 3FQWA 3EYFA 5DEJA 2GTZB 3SY0B 4K4KA 2R1WA 3CWGA 2G0KA 5C09B 2WLIA 4F7KA 4JQXC 3VFOB 2GTQA 4GG6F 1XCWA 4AZ8B 2ZJSH 1ZLSH 1U3HD 2DMCA 5K1JA 3AGWA 4X5QA 2GK0A 3R06B 3EOAA 4NCC2 5F2FA 3F6IA 3L3DB 3VMOA 1WE5A 2Y7NA 4HWEH 4IRZH 4Z3IA 1DZ0A 1KJ3L 5KSBA 5D7LA 4X4KA 3HNVH 4I8DA 3FU7A 2N7AA 4X4YB 4XNZB 4PJEA 4UAOC 1PZCA 3A4EA 4N2AA 4YSOA 3IDJA 5FA3B 3T0XA 3RHWF 5FFOA 2NY4D 3QQ4B 3C2AL 4X8CA 1WWAX 3EYQD 3H0TA 4MMZB 1LE9A 3MO1B 1G7MA 1DQJB 4O51A 3MRCB 4JCWA 4L4VE 3C6LD 5B3JE 3CPUA 5CFHA 3Q9QA 1XWVA 3HAEB 3L9RA 3U7YH 5KVFH 4PI0A 1GOHA 2C9SA 3RPKA 1V7NH 2GTZA 3SY0A 4YHML 5GJSH 5LKNA 3CK0L 1HCZA 2NT0A 4WHTB 4YDKL 1KXVC 5C09A 4WWKB 4F2MB 4LEBA 1NLDL 1PKOA 3UL4A 3VFOA 5E8NA 4AZ8A 4NHUA 1HKLL 2EVHA 4EUPG 3PXLA 2G60H 1SN2A 4DW2L 4AKPA 3D87B 1JWUB 4WNQB 2Y24A 1FE8L 3L48A 1AO7D 1DDTA 3L3DA 3WJJA 1AGBB 1N19A 3GXTA 5E6RB 2UVFA 4JKPH 5D55A 3RIAF 5E6IA 4X4YA 1RL1A 2QVTA 1JZIA 2B20A 3F12B 2WO2B 1FV1B 4MJ6B 1ZGLA 3AS0A 4DOHB 2E8ZA 3KXFE 4GSQA 3JVGA 1GGCL 2N0MA 5IEKA 5HI4C 3QQ4A 1DBJH 5JNYB 1EEZB 3X3GH 1E4KC 4MMZA 4OH2A 3MO1A 4ONHA 4ERSH 1DQJA 3JWDC 2Q8BH 3B2XA 3FUNA 3MRCA 2VITB 3MV7E 1CZ8H 4OJAA 3DTXB 4OGXH 5EMYA 2ADJB 2ITEA 1CLZH 2QV4A 4IDJL 4A67A 1CICC 3JWOC 3DXAB 4U6HB 2CK2A 3CIQA 2VKXA 4OCYH 1UM5L 1WFMA 1DTUA 2CJUH 4F2MA 1JBJA 3D18B 4WWKA 1OT1A 1ROCA 3KBHE 4JBSA 3UROR 1DN2A 2YKLH 5HYQB 3DECA 3R1GH 3P9MA 4L9LC 4H26A 1R5WB 5AOJA 4K5MA 4XCYB 4AJWA 4AH2B 3D0LB 4OKDA 3LN9A 2OMWB 1Y18B 2ZXBA 1SEQH 2VR4A 5LG1A 5GZOC 3PAYA 4P46C 3WE6B 1QUNB 2EDYA 2DIJA 1MNUH 5DCCA 5I1KL 5DZNA 2XY1A 5JHDE 2J6EL 3F12A 2HH0L 3AM8A 4MJ6A 4P4KC 3TP4A 2QSCH 3ABGA 4K5OA 3SE3A 1FIEA 1XH2A 3JTBA 4GIAA 3MRJB 5JNYA 3AY4A 5FGCE 5H37A 5I1LB 3ZE2F 5D5MF 2WYZA 2YMXL 3P0VL 5CSZA 4J3XA 1YYMH 1UKQA 3I6SA 3RPIA 2VITA 4RDBA 5B8CB 3IDIB 2ADJA 3FU0A 5GSVB 1MDAA 3K0WA 3DSFH 4FTVA 4S1SL 5F7NC 1OB1B 3CFDA 3MV01 4MA1C 1DN0B 3DXAA 3QJXA 4U6HA 4N2HA 3RE0A 4TLTA 3MV9B 2E6JA 2OR8A 3BMVA 1Y6NR 4X80H 4TNFA 3D18A 5D6DC 3IJEA 3JT0A 2JK5B 5HYQA 1FZMA 3RFZB 1R5WA 2JMRA 2YC1B 1NBYA 5B22A 15C8L 4AH2A 3RDJA 3ARGB 2ZAHA 2OMWA 5FM5M 4C83B 4XCFH 1ED3B 5E6YA 5CCHE 2C4FT 5FCSH 2MNUA 4CN6A 32C2B 3WE6A 1MG2C 1QUNA 2CO2A 3I3DA 2ZOTA 3K74B 4FI8A 2X2UA 3IGFA 4URTB 4OF7A 4U3SB 4PRPB 4ZS7L 5TFSH 2I32A 2KZWA 2XN9E 4JFHE 4TNEA 2CLZB 4RMTA 2Z9TA 3GHBL 3MRJA 3AG4B 3SPCA 4N28A 4OIIH 4AVHA 3PHSA 5I1LA 1JVLA 3QIWC 5L4JA 3NJGA 2R1XB 1HQ4B 4KK5C 3NOIA 1YYCA 2AERT 4M6MH 4WUUE 3BH8A 1OB1A 1HILA 1VGEH 2BNQB 1SNRA 2B15A 1DN0A 2Y3NA 3PUUA 4FZEH 4N2FA 2MKWA 4X6DF 2H2PD 3MV9A 2DQHH 1RK7A 2DRUA 3IWUA 4ICWA 2H1PL 5KVEH 2DM3A 1OAYH 1NBVH 2VLRB 1IEBA 4F8TA 2AVGA 2JK5A 3MODH 2KL6A 3OL2A 1HSAB 4LEOB 4HPOL 1BFTA 2VLKD 3KPPA 1SY6H 3ZSSA 4ABWA 2B2XL 5HD8C 3LPOA 1OARH 2YOCA 3ARGA 1COBA 2JKXA 1E67A 5EDXA 1PG7W 4PW4A 4KK6C 2C9UA 2QKIB 4Y2NA 2PW1B 1OKEA 4OZIF 5I1EL 1ZVHA 4U1LA 4U3SA 4PRPA 2Y69B 3FUHA 1VLXA 1JF1B 4NXKA 5FCUL 3L4XA 2CLZA 2QADB 1UXWB 2IPTL 4LPXA 3REVB 3TFBA 5GGUB 5C7ZA 3VFUB 5INCB 3QK0A 2XU9A 1RZJC 5IM7B 1DSFL 4DGYH 4DN3L 2R1XA 3KLKA 2AABH 1HQ4A 4L5FH 5C97A 2VDQB 1DVZA 2F54E 1GA2A 4HVBA 1MH5A 3LZRA 4L2YA 5C0IB 2GHWB 5HYSG 5EOQH 5K59E 3ZL1A 3BGMB 1YEWA 3B37A 4M9OA 5FHAL 4MQXC 1UB5B 1CGVA 5AAWA 1HSAA 4LEOA 4QKTA 2UY6B 3EDFA 3U4BL 2KQMA 2XXFA 3S37X 2A0LD 2EYRA 4XMXA 3QYMA 3FF7A 3HNSH 4Y2DD 4Y16D 1A7BA 4N0YH 1OTUD 2XQYA 1MWAB 4GXVH 1A6WH 1B88A 1SHWA 1PS3A 2QKIA 2KI6A 4ZUVB 1N67A 1MVUB 2Q7YA 3UTTE 3UG4A 1JF1A 4YE4L 2V4LA 1QPXA 2BVTA 2CALA 3CJJA 4JO1L 1UXWA 4JRXB 2FYVA 3E6HA 4OD1H 4AV0A 5GGUA 3VFUA 3V0WH 3LNIA 3RYMA 2X2IA 2CRZA 2PETA 3RY6A 4ADIA 2EVIA 1U8JB 2W1NA 4MCYA 4C56D 4Q6IB 4RAHA 5IUSA 5IM7A 1QFWL 2ZWZA 4BFOA 5C0ND 2FWLB 2IV8A 3NGBB 4QR7A 2C1OB 1PLGL 2JV6A 3MRRB 2DH3A 1FYTB 5C0IA 2G75A 5JHAA 4NJ9H 2DMKA 1PQZB 4Z95L 3BGMA 2YQGA 4HEPG 2EO9A 2HPTA 1Z9OA 1FVEB 2FD6L 2VMFA 3IS0X 4RBPH 5BZZA 4ZMZA 2UY6A 5E4IA 3WNMA 3BQUB 4PAZA 5DGQA 1IC4H 1F18A 5AZEH 5AVRB 1YEHH 1UT2A 4NQUA 1DR9A 1TETH 3VA6A 4G11A 1K4DB 4ZUVA 1MCLA 5AZUA 3RI5K 3ZDYE 5KAQF 3SPVB 1BM3H 4OLXL 4B0MB 2IAMD 3FB6B 5ISZE 1TO4A 1T22B 2DQCL 2NYKA 4WKXA 3FCTA 3PYCA 1U8JA 2A77L 3OGCB 5I8OH 5GS2D 4I7ZC 4J3OF 2C1OA 3T6WA 3S9DB 4XAKE 3DKHA 3MRRA 2A1WL 1FYTA 2X6BA 3IE9A 4OLWH 5DK3A 3WG7B 2WQVA 1PQZA 1T66C 3O3UN 4Z18A 3RB5A 3SKJH 1E7VA 3IMVA 5I24A 1J5DA 3BQUA 1EV2E 4NM4L 5E00B 4NWUL 4XMKH 5SWZE 1UWXK 1K5NB 1HNFA 3OHMB 3FAWA 5BQ7B 2DLGA 3TS8A 4M7LL 1J8HE 3QG7L 1EEQA 3OR6B 4XOEA 1USQA 3QZWG 4L1TA 1D9KC 3QQ9D 4QXUL 1PCSA 4JM2F 5JUEH 1H0DB 2WLMA 3LB6C 4KVCH 1FN4B 2ARJB 4EI5D 2R0LL 3NPZB 5E5LA 1SDAB 4PJHF 4J8QA 4K9EL 4WW2F 1MQKL 2EDQA 5KOVC 3S7GA 4IK6A 2YZ8A 1CLYL 1DQLH 1RVFL 1TYEB 2AP2A 3SBWC 1IIIA 5D7SH 1T0MA 2CNYA 4LSVH 4ZW6A 3OGCA 4JDTL 1T89C 4HJ0C 4LLWB 4B96A 4U1IA 1RUPH 3T2QA 4P2OA 3FO0L 5IQ7L 2WN3A 4JPKL 5JQ6L 2WB7A 1UTDA 1IVLA 4M6OL 1ML0A 1BIHA 3QHZL 5DUPL 4YBQD 1JZ7A 2O61B 1AHMA 1HIML 1CR9L 1BVKA 5JW4R 1JHLH 3MPCA 3TWCL 3B2DC 2PTTB 4LNRA 1MXGA 4LRNH 3KPNA 2CCLA 1T21A 1KCWA 2F5AH 2XTJE 3KGUA 1QBBA 1K5NA 5BQ7A 2EVJA 2DV6A 2HRPL 4NKIL 1DJXA 2IH3A 3DX2A 3OWRA 2ZOLB 5C0RH 1I8MB 3OR6A 4POYA 2G0LA 1QSFD 1FDLL 4TVUA 3JWNE 2FECI 4WEUD 3L1FA 1H0DA 1AIFB 4LGSB 5IMOB 1FN4A 1S46A 2KPNA 4YPGA 1QI4A 3H3PL 1X9UA 5K69A 2AV1A 5ESVB 4KTDH 1F11B 1JZJA 1U3ZA 2CR6A 4YSCA 1DVXA 3P3TA 3QUML 2YEVB 4ISVB 1LMKA 2C4FU 1ZTXH 3QORB 3C5SA 1AXSA 5DD3L 3UAAA 3MBXH 4F92B 4K8RL 2F61A 4OLZH 1CDHA 1N0LA 2DQGL 3SE8H 4PRID 5IJVA 3MLSH 4LEEA 3VYOA 3F7PC 3RWGB 4GEJA 4X6BB 5C6WH 3H3KA 3OKEB 2MCPH 4I87A 3FB8B 4WGWB 4HQQL 3DARA 3HE7B 4XVUD 2AI0H 5DO2D 3GSNA 4PLKC 2ICEB 3OHXB 2B1HL 3EGDB 4ZX5A 4TSCH 2ZOLA 4U4IA 2XTJC 4K73A 1I8MA 2VDNB 3VGFA 3IAGC 5IMOA 1AIFA 3CVBA 1JRHH 4KMTL 4MB1A 1FGVL 2ENSA 5E2TH 3JWNC 3VI3F 1NCCL 4M3KB 1R3IL 2RJMA 3GMNA 4N2DA 4NLAA 2C26A 1EUTA 2IJ0C 3ZZQA 2X1OA 1BYOA 2EIZA 4HOXA 4YSAA 5ESVA 1GOFA 3ZQWA 3QI9B 2IQAB 1F11A 1RSYA 4TMPA 1ZT1B 5B1JA 3ZKSD 1AS6A 1AQKL 3QDMB 3QORA 1JGDA 3SJVE 3EUDA 1L9PA 3EYSL 2Y3AA 3ZR5A 3IMRA 4FNPA 2ZICA 5ADPL 4ICXA 4UQIM 3VI4E 1OWWA 1R34A 4AXWB 1DCLA 3VXME 2RACA 2BS71 1EVTC 4UOW0 1B2YA 1GYWA 3RWGA 5KYWB 1T6VN 4X6BA 1ECZA 4BXVA 1IFHL 3VWJD 2HYMA 4XBGB 3FB8A 3OZLA 2WOYA 5F0JB 1LDSA 2O30A 3HE7A 1B0GB 5D4HA 1JZGA 3DMMA 2EZ0C 2B4CL 2AJUH 4RIRB 3WS6A 5IY5B 1R5IB 3SDCB 4IS6B 2UZIL 2PPEA 3EGDA 3AROA 1L9MA 1I8IB 4KY1L 2VAAB 5E2VH 2X4QB 3D3VB 3KPTA 3MC0A 3AGVA 4QPEA 5J13C 3TPUB 5FKPB 2VDRL 4PLOB 3HG4A 1EX0A 2BSRB 1WS7A 2DYPD 3CN2A 2HVJB 3DGCR 2W9DL 1JV5B 4R7XA 3QI9A 1AHWC 4JPWH 4N0CC 2IWEA 1IFRA 4QJ4B 3QDMA 3TVMB 2D8KA 4CVZB 4J3UA 1CVRA 2P52A 5EFIA 3HS0B 3OAZK 4X0KB 2KDGA 3LZOA 2ERJC 3ZX1A 4IBSA 1XBDA 1LP9E 1NMBH 2P5EE 5F1KC 4U1JA 3MNMA 5CS7A 2NUPA 4GUPB 4ZFOB 1C5CH 4JGMA 3I74A 2WXRA 4XB8A 1NFDE 2EILB 5KYWA 4Q9QH 2L7QA 2FUQA 5IJKA 5LN4A 4WTZG 3KYAA 4HU8A 1ADQL 5GRUH 1FVDA 2GIXA 5BNXD 1W8EA 1Y0LB 5F9WC 1B0GA 4R4BA 1OCWH 4U6VL 2AQRA 4RIRA 4AENA 1TQSA 1VZGA 1XSKA 3QA3B 5D4QA 4LCCB 1FCCA 5MERB 3SDCA 2Y07L 4Q9RL 4DEPC 2A73A 1I8IA 2K8QA 2V6HA 2VAAA 3W1ZA 3QO0B 2WWOA 2X4QA 3TESA 1A2YB 3NJKA 4NBXB 2VZVA 5L8JB 4NX0A 3TPUA 5FKPA 2ZCLL 3BDYH 4R4ND 1ZV5A 4WFED 4H20H 1ANUA 2BSRA 5DJAA 1UD5A 1TITA 2HVJA 3QCTL 1OAQH 1JV5A 3FONB 1PNDA 4NUGL 3LKNB 2BSEA 2VJ0A 3V6OE 3SDYL 3RWCB 3TVMA 4CVZA 1SOKA 4X0KA 2ZNXA 4MXQC 3T71A 1R4XA 1FAIL 3K6FA 5FYJU 4Z5RB 5B4MD 1LO0H 2WBXA 4ZFOA 3CTTA 4K3JL 4XN5A 1DVUA 4ZW5A 1UD2A 2ENYA 3VFNA 3ML9A 3UIYA 3L3OC 3S3JA 2MOQA 1CCZA 3NPSC 2ZTBA 1HX0A 4IKKA 5D7JB 3KVQA 5IF0B 3IMSA 2FX8H 1ZDSA 2J88H 2BRRH 2I85A 5KVDE 4NUJB 4MD4B 4HMEA 4FMVA 1FIGH 3VFPA 3B1UA 3FQYA 2YK1L 4LCCA 4DERA 5MERA 5C2UB 1ADQA 1HE7A 1OW0A 3NVQA 4G5AA 2PNDA 2FB4H 2ZXDA 3DVGB 5EO1B 2DJUA 1SXAA 1JPEA 4IGBD 4H1LG 2VC2L 2ALAA 3MJ7B 3SKUD 2WSKA 2FDBP 1SLXA 1IBFA 2WOBA 2OL3B 2BWDA 5CZKA 4DW2H 1CK0L 2DLFL 2FEEI 4MRCA 4JG0L 3AVEA 4HCRL 2NTSP 7FABH 1CU4L 1P53A 3FONA 5JOPE 1ZVSB 1TZGL 4JFQA 5H37H 4AV5A 1U3JA 2AANA 3ZTJH 1QEWB 3CHRA 4V1DA 4P5TB 3SDAB 5CJ5A 2F19H 1NEPA 3V6OC 3MLUL 1T03H 5H94A 1WG3A 4R8WH 3QUKA 4BCZA 5FYLE 1MLCB 1H5BB 5C07A 4DIXA 1RZKH 2Y6SD 4QHKI 2Q1EA