4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
1I6MA 5F23A 3C8ZA 4NX2A 4EG5A 4R2LA 1VBNA 5HUHA 2ZUEA 2J08A 3NBKA 1VL2A 3H9CA 4CDNA 1J1UA 1VBKA 1H1TA 1G8GA 2A1UA 3IUEA 1ILEA 1FYDA 3VU8A 1GTSA 2CV0A 3I05A 2DXIA 1M8PA 1H3NA 1N3LA 1SURA 1EUQA 3N05A 4MVWA 4QBTA 3UMVA 1O97C 2J5BA 3CLUC 4PBRA 4AS1A 3G5AA 3A4IA 3OTWA 1OD6A 1P7PA 1X6VA 4MW7A 1N2HA 5J5AA 1F4LA 1B6TA 2VTBB 3P0HA 4H3SA 2VTBA 3COZA 4ZT5A 1KH3A 4NDAA 3N9IA 3MXTA 3DPIA 2Z08A 4MW0A 1T9GR 4MLPA 3P52A 3JXEA 3IMCA 4PBTA 3HGMA 3L92A 4ND6A 1N77A 3FNRA 3MLBA 2D5BA 1O0BA 1EJ2A 2WB2A 1U3DA 3H97A 1DNPA 4EG3A 2JA2A 3IUBA 1EFPB 5BNZA 1EFPA 1GZUA 2VXOA 3FHJA 2ZUFA 4U7JA 1XJQA 1OWMA 1TYAE 4HPWA 1Q11A 3FY4A 5DB4A 1IFXA 1JGTA 3FWKA 4MUEA 5HUJA 5TRDA 4EG1A 1PFWA 4F3RA 4R2MA 3ZJTA 1T6XA 1T6ZA 5DK4A 3PNVA 2PFSA 1ZJWA 1KKUA 4JXZA 3Q12A 4KR9A 1Q15A 3ELBA 4ZCPA 1M1ZA 3PRHA 3TZEA 5K0SA 1YUNA 3IVXA 2CT8A 2CSXA 1M8JA 4MUHA 2NSYA 4ZCSA 3AIIA 2E18A 4AQ7A 4L2IA 3A2KA 3HFJA 1JIKA 1G8HA 4MWDA 1JHDA 2JAXA 5H7XA 1M8FA 5IJXA 3ILVA 1K97A 2JANA 3K32A 2NZ2A 4G5FA 4MQ6A 4EG8A 5IHXA 4I6GA 3UC5A 2YY5A 1KORA 1F7VA 3TS1A 1IQ0A 2O8VA 1D2RA 3ND6A 2VBTA 4Q16A 3Q10A 4S1OA 5LFAA 4U8HA 2PXHA 1KH1A 2RD2A 3UY4A 1QQTA 3IMGA 4J76A 4YP6A 3SP1A 1WY5A 1KH2A 1V47A 1YI8A 2EL7A 1VBMA 5TS2A 4NAUA 4ND7A 1TYBE 3ND7A 2J07A 1OBHA 1QJCA 1WXFA 5TEVA 1N1DA 3COYA 1JEDA 3KT8A 2A1TR 4DDHA 2QUHA 3CR8A 1OWPA 3CLSC 4MVXA 2VBUA 1N2BA 3AG6A 3SZGA 4E1AA 3Q4GA 3ZJVA 5JBNA 2X1MA 4MUJA 3IVCA 2E0IA 5FO1A 3LOQA 1KP2A 1MB9A 3ZGZA 2D13A 1MC1A 3IOEA 1F7UA 2OQ2A 3CA8A 3BNWA 5J59A 4DNXA 1R6XA 1X8XA 4NZPA 3SZ3A 2A1UB 1TQ8A 3GLVA 1NB0A 1N2IA 1NSYA 1GN8A 1M8KA 1G59A 1EUYA 1FFYA 2VBVA 2CFOA 1COZA 3G59A 4KPUB 3IODA 4KPUA 1IQRA 1KQPA 1K4MA 1U7DA 3H9BA 3K9WA 2VBSA 3IDFA 4HJXA 1IHOA 5FO0A 1J21A 4DE5A 1U7XA 2PZBA 4P2BA 3DV2A 5HG0A 2DETA 4EG7A 3AL0C 1U3CA 1TFUA 3NBAA 3KT0A 4ZT2A 1F9AA 3ZXSA 1QTQA 1N08A 1GLNA 3SEZA 4MULA 5TGTA 3ND5A 1NP7A 4K03A 4WSOA 1O0CA 4MW9A 1N75A 4ARCA 1EE1A 1JEEA 2YWBA 3OP1A 3MLAA 4RPIA 3ISJA 2TS1A 3H05A 1R6UA 4A91A 4MW6A 2CYCA 3X1JA 2CV2A 4DLPA 1YIDA 2CYAA 3D6VA 1WKBA 2IP1A 2V0GA 1JILA 3CVYA 4F4HA 1QRSA 1MJHA 3SYTA 2HMAA 1NYLA 1QRUA 4ZCQA 1TYCA 4ZCRA 4MAFA 3CLTD 1GPMA 4MWBA 3E27A 4FZJA 1OWNA 1O6BA 4CQNA 1Y42X 2QUIA 4KR6A 4OUDA 3KT3A 4MW2A 3NV7A 3TZLA 1KR2A 4L2IB 4UZEA 1ZH0A 1ZH6A 2QTMA 4DDMA 1MRZA 1J1ZA 1NI5A 4JZYA 1NUQA 4CT0A 3AG5A 1K92A 4MW5A 2DERA 3M5WA 2EJCA 3CVXA 1YIAA 3AFHA 1I6KA 4MUNA 4MW4A 3CVVA 3RK1A 1QU3A 1LI5A 1QRTA 2C5SA 2CV1A 4JXXA 3IVGA 2PZAA 4G6ZA 4ZT7A 3LE8A 3COWA 4ZT4A 1O94D 2PZ8A 1NZJA 2AKEA 3CTAA 1G8FA 2IJGX 1T9GS 4XFDA 3INNA 1QNFA 1HYBA 1PFVA 2H2AA 5H16A 1N78A 1V8FA 3ZXIA 2O5RA 2GKSA 3DO8A 3A05A 1H3EA 2H29A 2XRYA 1N2OA 4OJMX 2BTEA 3RK0A 1WXEA 2OYNA 1N05A 3SEQA 1A8HA 3SDBA 1JMVA 2DPLA 5KWVA 1O96B 3KT6A 1O96A 4DDKA 4Q93A 1J70A 4G5YA 1KP3A 2HZ7A 1WOYA 3BL5A 3IOBA 3DLAA 3TNJA 2X0KA 4I6JA 1N06A 1LW7A 2RE8A 2AG6A 1WXHA 2V0CA 3GMIA 1ZUNA 4MVYA 1XNHA 1O5TA 2R5WA 1GTRA 1J20A 1VLHA 2DR2A 4EF6A 2PG3A 3IH5A 1IRXA 1N2GA 2QUKA 1JZSA 2BYTA 3D6UA 4YBRA 1H3FA 5A8AA 3VRHA 1JIIA 2D54A 3AKZA 3ZUGA 3N8HA 1U0BB 4J75A 1WZ2A 1NUPA 1XNJA 3MUEA 1N2EA 4HJRA 5KHAA 3PXUA 5AHWA 4YP7A 3FH0A 3TQOA 2YXNA 3RJZA 2X1LA 3UOWA 2A84A 3X1KA 1JZQA 4JYZA 1WQ3A 4BWVA 2OV4A 1CT9A 2WSIA 1OBCA 4QRDA 3UK2A 2YWCA 2DUMA 1N07A 1IVSA 1Q77A 1EXDA 1YUMA 4EG6A 3ZJUA 1O97D 3CLUD 1NUSA 1O95C 1O95D 1YULA 4TS1A 2DEUA 1JIJA 3G6KA 3LCJA 2ZP1A 1M8GA 1MAWA 1KAMA 4R0NA 3U1VA 1K4KA 1MOPA 3IMEA 2A1TS 3GUZA 4WNYA 2E21A 2QUJA 1PFYA 1TYDE 3QE4A 1KAQA 2Z3VA 1WXGA 1ULHA 3RBAA 2P3MA 1RQGA 3CLTC 1BS2A 1N2JA 3QTTA 2PIDA 4YP5A 2A7XA 2QJOA 5LM3A 3L93A 4RUKA 4OUDB 4PBSA 4MWCA 4NAHA 4MVCA 1GAXA 1KQNA 1I2DA 3RHSA 4ARIA 3TQIA 4KR7A 2A86A 3H99A 2DLCX 4NATA 1XNGA 3P0JA 1LI7A 3A04A 2I1LA 4ZT3A 1M83A 1Q19A 3N2YA 4MUKA 3IOCA 1PFUA 4EFKA 4MUGA 3P0IA 3FDXA 3FG9A 1IH8A 3PNYA 5K0TA 2A4MA 5FNZA 1T6YA 3HV0A 1OWOA 2E89A 2Z09A 4X0EA 1Q9SA 5TEWA 2X3FA 3QTBA 2QTRA 3CLRC 3CLRD 1JECA 2XRZA 3ZIUA 1NUTA 2CUZA 3X1MA 1O94C 5EKDA 4QREA 1NUUA 1S4MA 3KFLA 1J09A 4EGAA 3FI0A 4MWEA 3HL4A 2IELA 2J09A 5J58A 2QJTA 3FOCA 3MMXA 1WQ4A 4HK4A 5DEOA 4K0RA 1WJGA 2HGZA 4ZT6A 2GM3A 4GRIA 4YMIA 1NB9A 3FETA 3CVUA 3FIUA 5LLTA 5KCMA 1UFVA 2QJFA 4DJAA 4XFJA 3VGJA 4EG4A 1IQUA 3COVA 3RFFA 1KQOA 1TEZA 2G36A 2GOYA 3HMQA 3S3TA 4MW1A 3PNBA 2WQ7A 4PY2A 1MBZA 4GU5A 4MUFA 4JFAA 2CYBA 4CDMA 5A88A 2B7LA 2WQ6A 5DASA 3HZRA 4KKVA 1QU2A 1EFVB 4U63A 5A89A 1EFVA 1PG2A 1WXIA 4ZCTA 4UZFA 1OWLA 3F3MA 4I6EA 3CVWA 1P4MA 2QTNA 2AZXA 1R6TA 2J4DA 1MB2A 1PG0A 1I6LA 1MAUA 4XSVA 3CLSD 2A88A 1NURA 4MUIA
chains in the Genus database with same CATH superfamily
1C0LA 4FXOA 4WZBB 3AFIA 3M33A 1M1NA 3AC0A 3V2GA 1NM5C 3JCZA 1Q0RA 2IXEA 1D6NA 1M74A 4C3ZA 5K8LA 1YASA 2ZL6A 3T15A 1NAHA 2JLSA 3BVPA 4EUKA 5HUHA 1EXVA 4ROSA 3CIFA 3TFOA 1UJ6A 3DLIA 4R5MA 3SXJA 3KQNA 2XEXA 5LWHA 2PO7A 3HEMA 2QR3A 3G49A 2FEPA 1UDRA 3HI4A 3RSFA 3V7YA 4CDNA 2DQSA 3QVXA 3O9ZA 1SBNE 2A1UA 2AR0A 2CE2X 3NDJA 4IHJB 3ZDDA 5KTMA 3TL3A 1FSFA 1WW8A 4TTAA 4KWIA 4KQMA 2DRIA 3H9QA 4KXNA 1M0TA 4I2VA 2FJPA 2P0YA 1EZ4A 4W8OA 5EXTA 1RD4A 4HV4A 1VI5A 2AWNA 3EBOA 4LHVA 4UQOA 3THYA 1XHLA 1JHUA 1LSOA 1V5FA 3P9IA 4QXMA 4QGBA 3VH3A 1T13A 2WF8A 1X7ZB 2PS0A 1UJMA 2AJTA 4E46A 1AA6A 2ZZEA 3U09A 4DV0B 2O8CB 4R40A 3UT6A 3OZGA 3QKTA 3MXTA 4L8VA 1ZH8A 2P6UA 1XRPA 1YQGA 2PGXA 2ZYHA 3KEMA 4X05A 4Y1RB 4ZAWA 1SEPA 5T41A 3UB3A 2CVFA 4B87A 2ZBUA 5L40A 2P68A 4FYIA 3TSZA 5I01A 1DVRA 1X7WA 5KNBH 2VKTA 4HVTA 3HCPA 3LDUA 3PXAA 3O2NA 4BP1A 1G20E 2CJFA 1TCAA 1Z2AA 2ZIFA 2ZJ7A 3QUCA 3IUSA 3WHIA 4B0OA 4EPTA 1RXCA 2J6BA 4BWYA 4RTOA 3ROXA 3QX8A 1XE1A 4OLHA 4QECA 1P0FA 2H0RA 2PGIA 4F5WA 4Z8XA 4RPKA 2GRAA 3N0XA 3P2MA 3INYA 1X7XA 3ZZNA 5IF9A 4BFCA 3BMCA 2YZMA 5IC4A 4B45A 3ZCQA 4WMLA 1WW3A 2OV2A 4ZMSA 5AESA 3MTIA 2BFBB 5FYQA 5EWMB 4NZNA 5LUAA 4QAJA 2ATXA 1J49A 4BZQA 3HI6A 4MUEA 4JBHA 4JJAA 2BI7A 2ZRJA 1KI6A 3PNQA 5LYYA 2LCQA 4LRSB 1QVVA 4HNAB 4PZDA 3ZY6A 3IHLA 3NIGB 3PPVA 3EFOB 3CZMA 5FADA 3HZZA 3ZJTA 2W0SA 4MPDA 1YZQA 3FFXA 4P34A 5CBKA 5MHTA 1VKRA 1ENOA 1QDEA 2B4TO 3L0ZA 3Q12A 4MROA 5FL7A 2CBXA 1PP4A 3EA0A 4PG5A 2QR5A 1M1ZA 3DKRA 4WH0A 4DR6B 3H6GA 4KDCA 4K9MA 1VL8A 5MN5A 1JDJA 4YGXB 4I5DA 5JXJA 1AKRA 1QANA 1JH9A 1PEYA 5A05A 2JBAA 3G1UA 1Q6ZA 3KLNA 3L02A 3L79A 2WHRA 5E4YA 5BV1A 3P2KA 3A1FA 5AVYA 3JARA 2MYNA 1ZM7A 3M34A 5KOIA 1DIRA 3OC0A 3HVJA 2Y6UA 2YZNA 1WRBA 2QA4B 3IEIA 4ZQBA 2XQGA 1Y7LA 1HFJA 1Z3CA 3RYCA 4B3JA 3A3BA 2XYGA 3GEHA 3R7NA 4HNVA 4ES6A 4JOSA 1U0FA 2J0UA 3NYWA 2FGKA 4ZDIA 3PWTA 4EJSA 4F96A 4TZ6A 1XDGA 5JD5A 3VPSA 2M2IA 5CA0B 5LIRA 3NBXX 3E3LA 2A3RA 2JH9A 1AK1A 3AB7A 3OU7A 4J0JA 4NECA 3ZE0B 4DSOA 3OSZA 1DX6A 4XGIA 5DN6A 2ILVA 2CMGA 4YP6A 4EFMA 2FB9A 3FDZB 1AMUA 2B0JA 3O4VA 4P0TA 1AS0A 4GR4A 4ZEMA 3P27A 3NB0A 4YCMA 2VJOA 1LLCA 3BERA 2IKSA 3GJ0A 2D0OB 1C2TA 4AJKA 3UG7A 3RNLA 3I1FA 1T4CB 5BUQA 5HSGA 1D0IA 3HZHA 3FBTA 3MGGA 3IAM1 1XRMA 3F3KA 1TTHA 5CLQA 3QU2A 3QK7A 2PR7A 3AWIA 5ICSA 3NEYA 2C2OA 4BKMA 5BSXA 1QYVA 2R00A 3TNYA 4KI7A 1WY7A 3PDIA 2CZQA 3QFFA 3KAPA 1UMDA 1XWFA 1WKCA 4QUKA 4UNPA 3ZHCA 1IB6A 3U3ZA 1YF3A 5DBEX 2ONCA 1EK5A 1HDRA 1IG3A 3DLCA 3DTVA 4LV5B 4Y1GA 5JWOA 1AUOA 4WCDA 1YJ5A 1JW9B 1R37A 2I2DA 2R6FA 2YFYA 3PA6A 1NVGA 1U7ZA 5K2MA 4XCQA 2HKIA 3OLWA 4I3GA 1NY6A 3GPCA 3AKDA 3HRKA 4Q4HB 3MQ2A 3SYMA 5BN3B 4ZOLA 1NDUA 4W7SA 2P2DA 1E5TA 3O8DA 4RXMA 4GGPA 3V1LA 2GZHA 3VDNB 5DFAA 4CWAA 4I4TF 2EZ4A 2WKWA 1CE8A 4M22A 2NZUG 3M5CA 2QG4A 3CXRA 3ZCUA 4EFLA 1ATIA 3EG5A 3KSAC 1M6EX 1N2IA 1EUYA 3F74A 3F71A 4U7GA 2W22A 1ID8A 2EX0A 3BQ9A 5ENZA 3ACDA 1QF6A 2ZGVA 3LUAA 1P81A 3KQPA 1U7DA 3PS9A 3R7BA 3URKA 4L95C 4EEXA 1PQWA 1NXQA 3L7BA 2FLKA 2ZWAA 4KXWA 4ZD6A 3GRVA 4FS8A 4O25A 4AZ3A 2EQ5A 4RDCA 4I55F 3IFSA 4WOPA 1E3WB 5I5GA 3QOYA 4QEDA 4H7HA 1VQPB 1D5CA 4JJ4A 4NRDA 2QLJA 1LNSA 5HZHA 3Q7QA 2FPRA 3AR7A 3HCRA 4P9SA 1J5XA 4KO1S 4PO8A 1Y37A 5A02A 4Z4UA 4ZT2A 1DO0A 1SOWA 4FWIB 4YJ3B 4D6YA 2NTJA 4ZCLA 1WULS 2I29A 1U94A 4LFBB 4ABTA 1JSXA 2VF5X 3NQ41 2VJKA 3FBGA 3R7SA 2FW6A 2OFWA 2XNCA 5AICA 3RT9A 4E6EA 2IDZA 2RHDA 4Z9BA 2QZZA 2BN4A 1T8RA 3FRHA 2YWBA 1E9DA 1I4EB 1WU8A 1O08A 3G7UA 2J3KA 4QOJA 4QT4A 5HDQA 4UQPA 5FUVA 4DCNA 1P4JA 2ZLBA 3SKXA 3PEVA 1K66A 2ANBA 4XORA 2D3WA 3B6KA 4KOEC 4A91A 3QTLA 4JCOA 3JAMA 2BTOA 1W4AA 1XXHE 1LBHA 3H84A 3OSUA 5EWLA 3T41A 4BZXA 1IVNA 1EBUA 4EY8A 1DWPA 4XLLA 1S0UA 1WKBA 2EWVA 1LI4A 3VU0A 5KSWB 1XQXA 1U5CA 1ZG3A 2RARA 3IDSA 2FR8A 3P0EA 4WNIA 4DR3B 1E3IA 1PI3A 1OSNA 4E13A 5DTEA 1JXAA 3LNNA 2E9SA 2FUEA 5D2CA 3QEAZ 4XWTA 3WWEA 1XROA 1MIOA 3UB4A 4TTPA 4C3OB 3U44A 2D74A 2Q2OA 1DAIA 3E9EA 5F98A 1PZGA 2ZSIA 3GP3A 3NJ8A 4H7KA 4CMCA 2PU7A 2BT4A 4H60A 1XBTA 5AYVA 1EWKA 1MVNA 1Z4NA 4EKNB 4LISA 3ISTA 1UPFA 3VV3A 1EX7A 4N3BA 4EQZA 4DUGA 1MW9X 1JHPA 4ASUA 4NOJA 3VYWA 3D59A 2Q3CA 3RYIB 5JNSA 3ZDCA 1T3ZA 4RU1A 4E21A 2IUYA 5I9IA 4D02A 4IKOA 2V7QD 3NIDB 3ONDA 4C0WA 3W2TA 3KL4A 3TZQA 3RASA 2EJCA 5EE3A 3RV3A 1HEYA 3GVIA 2ZE6A 3T53B 3QBEA 3PGJA 5ECYA 4OPOA 3TQFA 4AN1A 3VR5A 3DMTA 1B0AA 1D1NA 1E43A 1K68A 1NASA 1CZNA 1O4VA 1WHSB 2C5SA 4IDCA 3NTUA 1KYZA 3GLFB 5I51A 4KNWA 1QTNA 2FRVA 2NVBA 3OZAA 3I52A 4HZUB 2GD1O 3W9BA 1CUJA 5EN4A 4HVLA 1HLGA 5CNKA 3FZYA 4R2KA 1NGSA 1AUVA 1OT3A 2QTTA 4J16A 3FPSA 4M54A 3SYRA 3ZG6A 1LPNA 2PMBA 1X80A 3H17A 4L5BA 3W2GA 1A95A 5JMWA 5AM4A 4IMJB 1DKUA 3CRMA 3ZWCA 1XVAA 1L1QA 4PQEA 4X9XA 1W85A 1YONA 5BYBA 4V0SA 3R0QA 4C1NA 4DCGA 5A06A 1XZEA 5CB4F 2NU7B 2F55A 2XBMA 1WWKA 3GEEA 5ILOA 5DOVA 3L0IB 5JI3E 2WA2A 5FB3A 4XLCA 1E5DA 3GJZA 4ND2A 2PUGA 4MGZR 2BELA 2W2PA 2FEOA 1BMTA 3EDYA 2VCEA 4QSMA 5AM3A 3PJGA 5IVKA 1FSZA 5GZ1A 1RJGA 4YY3B 2FW9A 4G5RA 4E3WA 4PNEA 1C4KA 2HPHA 1DMRA 2WILA 5EE0A 3S8EA 3K0FA 1ZHOA 1AZLA 4Q3DA 1WXHA 1JIVA 1COWD 2BFDA 3PGKA 3GMIA 2J3QA 4OAQA 3QHPA 2G1PA 1E7YA 1T5OA 3BIJA 3E9MA 5D1HA 5F1YA 1ILWA 3IB6A 3TQCA 1IRXA 1W2WB 5F33A 3GQVA 3HO1A 1VPWA 4Z7QB 3KQQA 1MGOA 4N9QA 4XB2A 2R1TA 4W5JA 1DJOA 1MD9A 2QL7A 3B85A 1ISRA 5AJXA 5FTWA 3S2UA 1LS1A 4DMFA 4BLOA 3FFWA 3N8HA 1Q7CA 1YL6A 2KYRA 2MU1A 3CUEF 3TO5A 1HPLA 2V7UA 4NBWA 2A33A 4ISBA 3ISVA 4WZBA 3AUTA 3CC8A 3OPNA 1PHPA 4QVIA 1T43A 3NWOA 4FBMA 2CDAA 4HN9A 1H6BA 3WO1A 3CCSB 1B14A 4Q1VA 3C16C 4AURA 5D7BA 1TLLA 5BUCA 4TKLA 3IEVA 1JP7A 1S9HA 5F4BA 5FWXB 1K7CA 2CZGA 2A0YA 1HE2A 2ZTVA 4HNRA 5HCNA 3I62A 2QAGC 1TZ2A 4K3UA 4ZEVA 3OX2A 4ACAA 2P4QA 3KYCA 4E2ZA 5JQGF 3Q7TA 1OAOC 2D7CA 3A4TA 1LEHA 4AUKA 4DBLC 5FBKA 2X58A 5LQDA 4NEHB 3FYUC 3OY7A 3FSRA 2JCBA 3C15C 2BFNA 5K6AA 3PC8C 3BF7A 5TARA 4M0DA 3KOYA 5DP1A 3K72B 3MEQA 4J0IA 2PGNA 3OE4A 1RKVA 4CMHA 4XRRA 4CM8B 1DTWB 4YWJA 5C4GB 1LV8A 5E9QA 4KYIB 2CXSA 2O8CA 3LCJA 4DMUB 4RJIA 1X14A 2O05A 4RORA 3LYHA 4LA4A 4RLQA 1NP3A 3RABA 3WBBA 3ZQJA 1ETHA 4Y1RA 3UHAA 4DAOA 1VA5A 3MOSA 3NWEA 5LQJA 2CLEB 3LUPA 3VDXA 1WBJB 1Y6RA 3E9YA 4MWGA 5BT9A 1RQ7A 1A3CA 3RGWS 3T4UA 4DDWA 1UEXC 1YFLA 3IBSA 1VF7A 4N3CA 1UK8A 3QUBA 2KLHA 3SQWA 3R9XB 3BQJA 3LNTA 4M89A 4NARA 2Y1FA 3PQ4A 4JQOA 1N5DA 4YP5A 1RTTA 4MUYA 2AXQA 4F4JA 1T4GA 3I1JA 1CULC 2XADA 4TKZA 3B36A 3ADKA 4JKYA 2FX3A 4OUDB 3RB8A 4BNDB 3N8KA 4OJYA 1NA5A 1Z5VA 3A9TA 4MWCA 1JWBB 1XQVA 2PWAA 4EAAA 3N75A 1UK6A 2LGJA 2R5NA 1CY8A 4IIBA 1MOSA 2ODAA 4YYEA 4BC1A 1KHTA 3BD9A 2BFBA 5EWMA 4GLLA 1EIWA 3NP9A 5C80A 4QU9A 3KWMA 2BMAA 1FDWA 5U4QA 1BFDA 1IXRC 2L42A 3ETDA 3ZHQA 5I7UA 2QTLA 4X61A 2JAHA 2P1DA 3Q38A 1A71A 4LYJA 4MUKA 4TS9A 2R6DA 1VTKA 3DBHA 4UXHA 2Y93A 3EFOA 2O3RA 1N2CE 3JATA 1TLTA 2A4MA 4PYNA 2UZ0A 4R9UC 3B53X 2IPXA 5A1TA 1E5XA 3HU1A 1Q9SA 1V8DA 3G0DA 4YJKA 3RU2A 3CLRD 1FE8A 2XRZA 3FLEA 3L0BA 2ZBRA 3BE4A 5FOXA 1SXPA 3DL0A 2CDBA 3NWPA 4KSYA 1L5RA 2VPPA 2ZSBA 2R7LA 5DH9A 3BBPA 4DQVA 2PT6A 3LFUA 1J09A 4GQBA 4QODA 1V3TA 5F3DA 2JGFA 2V4UA 2A3NA 4NHOA 5A5DA 2UUAB 5HFJA 2PGJA 3T4XA 2GJAA 4RJJA 4ZWNA 4JITA 3NYQA 4NTZA 2PHZA 2WSYB 3ZIAD 5KVAA 1T24A 3NI2A 5FI3A 1C9YA 4N0QA 1MO5A 1RMTA 3QY9A 1MFZA 2HV8A 4WBNB 1JHAA 4GICA 4CKEB 3PLAE 4RDJA 5FORA 3II6X 3SJUA 4ZYLA 4XPIB 3N2GB 2AD1A 2WNSA 3E9ZA 2CHFA 4GWKA 1LPBB 1JKJA 1TEVA 2NZ8A 4FOSA 4J94A 4BO8A 5HF8A 4FFBB 2PD3A 3MFYA 1UXJA 2A9FA 2CHVA 3MOIA 3BULA 1J42A 2CF5A 3IAEA 4L5CA 5F73A 3SZMA 3FDZA 2QTAA 4ALLA 3QX3A 2PX2A 1R27A 4EGQA 1GQOA 2XYQA 2CYBA 2LKDA 2Y0CA 4QGAA 1EGQA 5J40A 1KRHA 4HWPA 1B4DA 5TMEA 3FZNA 5TRTA 3EVFA 5FXMA 1SH7A 1T4CA 4MI9A 1G5IA 1H1LB 3EW9A 3U62A 2KBEA 1QU2A 1T9ZA 1LK0A 1LZKA 1X8JA 5EKXA 1KQSB 1Q92A 2WW8A 4M2LA 3EN0A 1OQAA 4MLCA 5ALIA 3DL4A 1FS5A 5U9CA 3I0ZA 4DC1A 5FHRA 2GB4A 2OZLB 4I0WB 1NURA 1XTKA 4KDEA 3QF4B 2HWXA 3EEBA 3D2LA 5BQOA 3RS7A 2QYSA 5IYRA 2QRMA 4MV9A 3T7TA 1A7KA 1WZNA 1ZINA 3UT0A 3ZX4A 4Q4HA 4B3IA 2RGNC 5BN3A 5CJPA 4JIMA 3AVWA 3DHWC 1YB6A 1II9A 1D0VA 2CVZA 3TLYA 1R4NB 4X7EA 4B73A 2ZZMA 1BCSB 1HI9A 3DDSA 5DPMA 1ZGHA 2FWPA 1GAQA 2BFAA 5F5LA 5KYNA 1KZ4A 2ASVA 2QTGA 3P9YA 5KKNB 5KVSA 3GT0A 2PSJA 3GFGA 4CV3A 4IDDA 2PLRA 4A2CA 1MQSA 1J9ZA 2QT9A 4PR0A 3UJPA 3WO0A 4D46A 1ADYA 5IAAA 1UWLA 5EMMA 4KCGA 3IUJA 1U0SY 2Q3MA 2J9RA 1GTVA 3O82A 2ZE7A 3OP4A 4RD6A 2BE7A 2NXJA 3ZHVA 2IUEA 1MQ9A 2OCGA 3HY3A 1MP0A 2CFCA 3WAKA 1SD2A 3TQHA 6CHYA 3KSUA 4ID9A 1KKMA 3T12A 3AU9A 4QGHA 1U3UA 3V7WA 5AW0A 2JIPA 1FX1A 1JQ3A 1SCJA 2ZJOA 4HDMB 3B82A 4KN6A 2CNOA 3A6GA 3JTEA 3A3NA 3GEPA 4NKRA 4CV1A 2VTBA 1ISSA 2RCYA 4YRIA 3SJPA 1NT2A 1AMOA 4HNGA 4RIHA 5AMXA 2J31A 3SXUB 4FMPA 3MJFA 4YJ3A 3BEDA 3L7YA 3K6SA 1RVV1 3DBRB 4K9OA 1RQRA 1W19A 3JXEA 4U7DA 5LLDA 4KPEC 3L92A 5DX0A 4LJ8A 1SC1A 2F3SA 3AW9A 4CT5A 4U2FA 1OGIA 3RW9A 3ELYA 2D0IA 5BSYA 3I58A 2VZ0A 1NNSA 5DIZA 2QL6A 4I8XA 4JJKA 4XCXA 1KOLA 2Q8QA 3CESA 5IZCA 2I4NA 3RBXA 1C1DB 5KTTA 1U2GC 5FPYA 1FXSA 3RY8A 2AI3A 3TOSA 4IGIA 2XGJA 1ACMA 1G63A 4ZVNA 3MBOA 2WAMA 1VJDA 5I9BA 1ZOSA 2AZMA 5AW2A 2B2XA 3M9LA 2BGJA 5JXWA 4LZJA 2C96A 4PC2A 1SXJC 1UDBA 1XDBA 3BMNB 4B09A 4PYMA 4L6AA 1SPXA 1U2PA 3RUHA 3VTFA 3N0VA 5FI5A 5G02A 3NAMA 4AI6A 3DE3X 1A7AA 1B0PA 1MTOA 2ZTMA 3OZRA 4LUCA 4KBYA 1RJFA 1Y3AA 2NP6A 1P2TA 3I39X 4HQ6A 1Y3HA 3I42A 2H1FA 3HA2A 1HLDA 3I9FA 4QJIA 5SYNA 1DJMA 4ER0A 1CRPA 3E7XA 3PRHA 4ZKDA 4ZKEA 4BNYA 3R5HA 1ZSYA 2FWJA 3LZCA 2W43A 2GHQA 1RKUA 3JSAA 4P4GA 1ZNYA 3T5CA 6Q21A 2HCJB 2R8YA 2BBSA 2R1ZA 1Z5GA 1NWCA 2ZAGA 4KKXB 4YLGA 5D3ZA 4GZMA 3G0CA 3PHBE 5E0OA 5IJXA 3UMMA 1PK8A 3ES9A 2BMEA 3NCHA 4RM2A 1ZAKA 2VT7A 1EUCB 4WTOA 5CRIA 1RJDA 2HGSA 1CUBA 2DWCA 2OD9A 3GN2A 2VXCA 4TLCA 3REGA 3DE1X 3PB3A 3QKRB 3VO9A 1YGYA 4O2AB 4Q16A 1DTEA 5BYAA 3GPLA 1C0KA 4NIMA 4ZTUB 1S72B 1S8NA 4O4HF 5KTSA 4KUHA 3GLFA 4UBLA 5ITZB 2QN2A 4LYEA 2WIAA 2REBA 4UNSA 1ESCA 2E5FA 2JD0A 3LT5A 4HZUA 4EMBA 3MC1A 1T0PA 5GJBA 5F7OA 4LJ7A 3QSYA 2VP0A 3CSUA 3JWGA 4KAXA 2HNBA 3WB0A 1JQ5A 1A9QA 1XALA 2IIBA 5E1OA 4B2YA 2WG0A 2HA5A 5F77A 1MGPA 3A6EA 1XN4A 2WF7A 2OBSA 4TYPA 4TSKA 4M3NA 5FPKA 2YMQA 4OYLA 2VI5A 3QLTA 3R75A 2NU6B 3OQIA 2V5VA 4JQZA 2FTKE 4OHZA 2OVFA 2NU7A 2PH5A 2WNHA 2WR8A 4BP9A 4ZOBA 4F46A 5HXAA 2Z2YA 4P32A 2LXNA 3TE7A 4Q47A 5EIFA 4UU1A 3OAAA 2QUHA 1Y4AE 3WICA 4MVXA 3WTCA 4BEBA 5IMBA 2HZBA 2AFVA 3MYRA 3Q4GA 4XI9A 4E1AA 1K8XB 1KY4A 3DOCA 5IU6A 3OCUA 1ML4A 2E0IA 5FO1A 2PLAA 2ZFUA 3GJQA 1MB9A 4Y0NA 1N32B 2Y71A 1JI3A 3BSYA 4DRYA 2R751 1D1SA 1I8TA 1RYEA 4TVOA 5L4SA 2PUVA 2ZZKA 4ZYWA 3MTQA 4IDOA 4IX1A 1I5RA 4DXAA 4YUWA 2YXDA 2Z95A 4TM7A 1Q7TA 3LBNA 2P7HA 1H05A 1UXIA 4P36A 4DARA 3LWNA 4ZGQB 1SUDA 3GPDG 5AVRA 5IXJA 4G37A 2JGMA 2PYDA 4WCFC 5JAOA 1DAGA 4JWKA 4OYHA 4LQ4A 1SB8A 1YJNB 3WP0A 3V1TC 3CWCA 5F3WB 3QHQA 2Q9UA 1JTEA 5D85A 1ANKA 3BIOA 2YVLA 2JFHA 4DE5A 1NT4A 2C92A 1YQXA 4MV3A 1NVUQ 1KVRA 1SA0A 3AR9A 3WZLA 4EG7A 3L4BA 3GNLA 3FCEA 4ROTA 5KO2A 1LDYA 3V8PA 4X7FA 1ABEA 1DWUA 3DGFC 4XUDA 4R2IA 3DTVD 2G80A 1RRVA 5KSOA 1N08A 3O4RA 1VXRA 3KLPX 2PFGA 2QW0X 4L22A 4AYWA 1ODKA 4ZZ3A 2H51A 1ZNWA 5I7RA 4DA4A 4FDTA 1EWVA 2E4ZA 1NHGA 2Q5FA 4XJXA 3BD7A 3W5IA 5JH7A 1E2NA 4XD7A 3RRMA 4OI0A 2EQAA 2XODA 1FW6A 3PC2A 5T8KA 1GG8A 1U5AA 3JQ7B 1KJQA 2CLIB 1K3TA 3H75A 3IAS6 3IV6A 1TM7E 3DWIA 4FILA 4LXGA 1L5YA 4N8DA 2RKOA 1WD5A 2IYQA 1M2GA 3GRUA 1TDJA 5CIQA 4DMGA 3PXDA 1RWWA 3MJSA 2WSSA 2CF6A 3IQXA 1ZD9A 4UUPA 3GT4A 2ZTLA 4FI3F 5NLLA 2C42A 1RRCA 1L5SA 1K6JA 1SKYB 2V8OA 3AIMA 2ODNA 5CMLA 2PE5A 5HILA 3DVRX 1PNRA 3R5KA 4ZZ1A 4R1SA 2FSSA 4JT8A 4O1IA 2C0CA 4QBIA 1TYCA 2EFCB 1GPNA 1QIHA 4NXNB 4EAQA 1IN6A 3R9XA 4DNPA 3UMYA 1WZUA 3GUVA 4X6YA 4FZJA 3NNNA 5BP7A 5FA5A 1IATA 1Y1RA 2J6HA 4OUDA 5E6RB 3PQCA 4Z4QA 4L0DA 3KT3A 4BNDA 4ER6A 3NV7A 5JD6A 3AVVA 2O6HA 3TZLA 3NE5B 4F5YA 4LHSA 1W4ZA 3R3XA 4V39A 3W7AA 2J48A 1QHFA 1VPEA 1NF3A 2NGRA 3B1FA 3BY2A 1E60A 1QOPB 2W9XA 2WICA 1NMXA 3GUCA 3D02A 3OECA 3F0TA 3FFTA 2WWXA 3RSOA 4OHMA 2NSJA 1FB5A 2QA5A 3CVOA 1U80A 5KEIA 4UOEA 2JEOA 4MKXA 1L5MA 4JEMA 2B8WA 3KVOA 2QN1A 3DNPA 4BP8A 1XPOA 1DTSA 2BEVB 1AKEA 4D99A 1ZJJA 3A11A 1WUYA 2AFHB 5DGIA 1DPFA 4BLRA 1GO2A 1NLYA 4WFKA 4BOYA 1RHRA 1T8WA 3CPJB 4DB2A 3DVLA 1N9KA 1ZM2A 1P29A 3U7RA 4REQB 1N3IA 4CLHA 5IBPA 4KQ1A 4ENQA 2C04A 4LSWA 3ZEIA 1BVHA 1VE3A 3GEBA 3KE8A 4B2LA 2IPAB 2GFHA 4YQZA 1JVSA 3QP9A 3QUQA 4PSCA 4PIMA 2VSOA 1C3VA 4BNUA 4P3KA 4M1TA 4P83A 4Y2PA 2YQ4A 3WI7A 4URZR 4BMNA 1U65A 3U3RA 3DUFB 4CKEA 4OKIA 1XCPA 5I48A 3OT1A 2WUEA 3QFHA 4Z7NB 7GPBA 4U2DA 2YJ4A 4J0FA 5A2QA 9ATCA 4ZARA 1E1QD 4IIJA 1V3UA 4PO1A 2IC5A 3EFBA 1K89A 1DPGA 1G291 2ZYTX 4LXUA 5IKOA 3ROZA 5CFNA 5HP4A 2QX8A 4JDUA 521PA 3B70A 4N3GA 3BGDA 2C5FA 2IHUA 2Y2UA 4I9HA 1F6DA 3GFQA 4CIVA 3U13A 4JXKA 1GDDA 1TO6A 4I6JA 3RTEA 3WV4A 3AHGA 4JLMA 5C31A 5HZMA 4OXYA 1I4LD 1WOPA 2F4NA 2CRVA 4BJ3A 1P5ZB 3AXSA 3B89A 3C97A 1OH8A 1GTRA 4AP6A 4P5PA 3ZNQA 4AM8A 3IH5A 4Z51A 1Z4PX 2A1IA 3L05A 4FB5A 4A0FA 3QEJA 4IRMA 5IJ0B 4U6SA 5SY9A 3EIXA 2QNBA 4CMIA 3BGIA 2GKGA 2YFKA 1EAMA 2W6IA 2XEDA 5FL3A 4R3WA 3AKZA 4QWWA 1QP7A 2BUBA 2Z5LA 5JZVA 1DHRA 1O8CA 1HURA 1J8QA 4UJ5A 3FCSB 5EPUA 1JE0A 3HKDB 3TLAA 1P62B 3I8OA 1XNJA 3MUEA 3DLBA 4CF4A 4QNMA 1QGYA 1C3LA 4XMYA 1G60A 3NGMA 4WZAE 5IK2D 4GKAA 2WF9A 5KBYA 5AQEA 5CX1B 5K0LA 1RAHA 2YS7A 5HKKA 4CR7A 5IXSA 5HF6A 4RHFA 2QYHA 2JHAA 4KQKA 3HBFA 1OXSC 3SC6A 3V8NA 1Z08A 2O07A 2QZPA 2RJNA 3NTQA 4NBTA 4OQ4A 4YVFA 1V11A 4R68A 3SHVA 4R3NA 4MTLA 4CL3A 1Z2DA 4C4RA 4PABA 3CBQA 4KB5A 1ZK4A 4DG9A 4ZK6A 4UM9D 1Z15A 2I8AA 4LI0A 4ZOEA 4RVDA 2R25B 4BV8A 4ZHSA 1EXDA 3U80A 3ZV5A 4RJLA 4E0FA 1SG9A 3ZJUA 2QMQA 2GFQA 4JHLA 3KDAA 3SHWA 3RD5A 2XCIA 4JKOA 3QPWA 4OH7A 4ALIA 3O83A 4H3KB 3TLKA 3K70D 3VR3A 1ECCA 2V45A 1Y9JA 3VHQA 4MYSA 1SGWA 1JAHA 4Q02A 2FJ0A 3IRVA 4HDSA 2F2TA 1PWXA 3CM0A 1VE6A 3FR7A 5FWNA 2BSXA 3SXUA 4MDFA 1KI3A 4OSOA 1GUDA 5FPTA 3WDMA 4FMCF 4F91B 4YASA 1H94A 3ZIDA 1VJSA 1C81A 2H16A 5A1JA 1V16A 4B6EA 5CCBA 1LQ2A 5LYJB 3HVUA 2XCTB 1OBOA 2WJIA 4N41A 3IL2A 4JXJA 2MR5A 4FFWA 4HSEA 1FX0A 3L7KA 1X74A 4HRVA 3NUGA 2V6FA 4JL8A 5TPZA 5BMVB 5F4MA 5P8WA 3PUYA 1JBKA 3VNVA 4FT2A 4QLAA 3RRZA 2J3MA 4P6YA 2Q07A 3GJSA 4MR8B 2WINI 1USKA 1ZN7A 1Z62A 3AF2A 1QLJA 1JSRA 1TQ4A 3FWHA 4TVBA 2OHOA 3ZWAA 5HTOA 2ZRLA 4DXHA 4XWYA 1EHYA 2FP4B 4H31A 5EXXA 1YJWB 3VI4B 2QVCA 2HK7A 1K5DA 2EG5A 1D03A 2ZBQA 3BMQA 4OMDA 2BONA 3RAGA 3P0JA 1WL8A 5H83A 5REQA 2AE1A 3OEHD 4QQFA 5IARA 1NBIA 3TX2A 2X1HA 3WYGA 1EA7A 1W5BA 3HK2A 4A10A 4D8UA 1Z25A 2IHYA 2ZZFA 5M34A 1SQFA 5KJ1A 3LLSA 4X93A 1HNXB 2Q6IA 4HGZA 3EPRA 3ZE7A 1Z6XA 2QRHA 4AKSA 1CEEA 2PYZA 2XYVA 1YNSA 1E99A 3KC2A 3WQZA 2NIPA 1OIVA 4AJJA 1TM3E 1NUUA 2H4WA 2OLEA 3CZPA 3KO8A 3PPYA 4KJZA 1FNCA 2X0NA 4BX9A 4UDOA 1J07A 1X9IA 2V7EA 3GRZA 3TX6A 1YJ9B 3Q98A 1D2AA 1JFFB 1Z6QA 2HPVA 4Y2XA 1U0RA 3SM9A 5JSHA 4IG9A 1I94B 4YAKA 1AKMA 4IP0A 5TPWB 4NCHA 3C3YA 1E89A 2VDJA 4BFWA 4JH0A 3S2FA 2RKBA 4P58A 2CXNA 4ZO6A 1Z8HA 2GETA 2QU8A 1GLGA 4O2AA 4YFYA 5EZYB 1CJKC 2V7BA 2XUJA 3UV6A 4OU5A 1WZEA 3TLBA 2BZ0A 1Z7WA 2H9YA 3L1JA 3N6RA 1R12A 1RT9A 1EDDA 2G28A 1CERA 4PYOA 1HDCA 1L5LA 1YMUA 5KYXB 1UAGA 1I36A 3L7AA 2F48A 3RJTA 3TDMA 2O3JA 3K0HA 1E9AA 4AF7A 4OD0A 4OSEA 3U4AA 1ACJA 1NLMA 3H5LA 4WKGA 1ORHA 1AKYA 3VOSA 3RREA 2R6GA 3CPWB 1I7SB 1G6OA 3QPCA 3QEKA 4M7PA 4UHBA 4HEA6 4M6WB 5JRJA 3R7DA 3OE7D 5BSHA 2G09A 4HDCA 4G23A 2UZ1B 1T5TA 5K0FA 5KU1A 2UVQA 1PJRA 4AMGA 1P4MA 1VKNA 2IYNA 4JSYA 3V8BA 3FSGD 3IVRA 3WYCA 5IPFA 3QELB 3CW8X 2P0EA 1XMVA 5AUOB 2O8EA 1QH0A 2IXFA 4X45A 3VNAA 1UBHS 3VR0A 1GZDA 4MUMA 4PZUA 4RPLA 3IBCA 4WN9A 3STVA 3SJZA 1KMCA 2XVZA 4V24A 3RTBA 2YXLA 3QKIA 5IS2A 4WZEA 1EM8A 4U7PB 2J08A 4F4FA 4OHYA 1H2YA 1U0TA 3D8SA 2GPTA 3P5SA 4R31A 3QEBZ 1HQKA 4JLDA 3V1UA 4WXEA 4CUKA 1H3NA 3A9UA 2B1JA 3NAGA 2DT8A 4D9CA 4DMLA 5JBIA 3L8GA 5AW4A 3E9NA 4HUQA 5EC8A 5C5IA 4B7ZA 1UZNA 3SGLA 4YV0A 1A9ZA 5ED0A 3U4IA 4JLPA 4I8DA 1JHQA 3HUFA 1MZPA 4KQXA 3IEXA 3Q5EA 5K01A 2HA3A 3I01A 2JFVA 4RD3A 3A1VA 4LRTB 5EP4A 1ZN2A 3CEMA 5H0IA 3WK4A 5F51A 4PHHA 1L7QA 5DU2A 1EK6A 4HDNA 4II7A 3FPKA 2FEXA 1WNTA 3D5EA 5M04A 2PSEA 3M81A 4DNOA 3T1HB 2P2GA 1PL0A 4NDAA 3QU4A 1SVOA 2JHGA 1Q6YA 3DD5A 4ZEWA 3RO7A 3VQTA 4DADA 4OI2A 4AO7A 3NV9A 4BU1A 3EIQA 2XOXA 2QE7A 1W5TA 3P2YA 4LDPA 1Z13A 1NULA 5BQFA 4X1IA 3DOHA 3O6VA 1SWVA 3QLVA 1PSZA 2RI1A 1BTOA 3L04A 4HRXA 5CH8A 4BZWA 1XYYA 3CO5A 1P2VA 5FAKA 1DFGA 1FVFA 4ND6A 2GREA 3QE2A 4C1BA 4HX2A 4WCVA 2QG6A 3MPUA 4F92B 3H2BA 1FSGA 4TT3A 3BT7A 2IDKA 1TKRA 2E4XA 1EJ2A 2ZJ5A 3JQ7A 3K1YA 3MTDA 4W9NC 2XVMA 4IXWA 1SJ9A 2OHHA 1FMCA 4OQDA 2IU6A 3REQB 3UHJA 3RFXA 1M0EA 3WRYC 1GZUA 1KPGA 3RTCA 5CJJA 7YASA 4WJZA 1GNPA 1HTBA 1TYZA 2PGOA 2GKOA 1T15A 3C5EA 3ITKA 2YCBA 4NBLA 5DN9A 4CR6A 2SBTA 3JQ9C 4LPKA 6AT1A 3EVGA 2IL1A 3DDOA 4W63A 3WQBA 3QLUA 1SKBA 3M4NA 4OHOA 3T5TA 3A4YA 1JG3A 1Z5UA 3S29A 2ENWA 3IULA 5KDOA 2OZKA 4AKEA 2D8MA 1PLLA 2GCOB 3ZH2A 2V7GA 2W90A 3DDCA 3K31A 3PLRA 3P9QA 5DK4A 2BVNA 3ZVNA 1KXZA 1TQ2A 3HDVA 4XM2A 1NXOA 3R8CA 4OPSA 2FG7C 4FC7A 5E6RA 1W96A 4JDPA 3VISA 2XMPA 3G8CA 1EJ0A 1KIMA 3UCXA 4EDFA 4F45A 3H3XA 4OJTA 5ELMA 2AIRA 1FDOA 4KVAA 3E4CA 1GAWA 2PLWA 3HV2A 2EDCA 2XCRB 5D87A 3PNSA 1BE0A 4FHZA 3B7PA 5H4HA 1NRXA 1BVUA 1R6AA 1FDVA 2W6JD 2QGFA 2Q4BA 2RIPA 3ZKAA 5HMLA 3HCCA 1ORIA 2HMWA 2QVLA 4LJ6A 3GLGE 1VPVA 3EF0A 1L8XA 3G6EB 5HGXA 2WTEA 1E64A 3PBKA 3ZWVA 4BE4A 4Z4IA 3QOXA 1G21E 2H5LA 3RLFA 1ZNXA 4F38A 2Q29A 5K3AA 4AMVA 1E3XA 3C3XA 4D74A 5BUZA 1XQBA 1HYEA 2CCKA 2RD2A 1I1HA 3WL6A 4ZXPA 1MNAA 5A4MS 4REQA 3DKIA 3IMGA 4F3TA 3AESB 1N7GA 4WOJA 1YS2X 5IKPA 3IP9A 3NKFA 1NU6A 5FTKA 2EL7A 3E9QA 1VBMA 4HEJA 3UENA 5JNVA 2Y1LA 4AICA 1TYBE 1EFDN 2EHDA 2V97A 3PR3A 4H27A 4Q9HA 4RZ3A 1NVMB 4XQFA 2X0IA 4IJUA 1MB3A 3WLOA 4C7XA 3DE7X 5JSZB 4JA2A 3EZ9A 5EZSA 5FBWB 3UW1A 1W0CA 4CGZA 1GIAA 1NW9B 1FTYA 5TXGA 1YGPA 2GAIA 3D26A 2LBPA 4EGJA 2IPMA 4FGZA 2O2YA 2UXBB 1YT5A 4DDHA 5A03A 3CLSC 721PA 1DC5A 4XN0A 1GPH1 1XF1A 2FZCA 3ESYA 3GLSA 3IKLA 3M6AA 3H2IA 4KO8A 5A9TA 4ALKA 4DLWA 5IRCD 4HAIA 4IRUB 4MUJA 4UASA 4P25A 1XELA 5E8RA 3U1TA 3V4LA 1MC1A 5GGYA 3JWEA 3PLNA 1F14A 3QJ5A 3MBKA 2IS6A 4LBWA 1T5DX 1CIJA 2A7QA 1X8XA 5D1NA 5J35A 4PIVA 1HFEL 4M0CA 4Q4DA 4GECA 3USES 5IJ0A 4CEJB 1VQ6B 4FEGA 4LV6A 1UWVA 2R9VA 4MARA 2JL1A 1COZA 1ZGGA 2IODA 1GKIA 1PR3A 2EC5A 5TQ0A 2ZIUB 4LG1A 1TD9A 2ONYA 2QHXA 3FPHA 4C0AC 1U02A 1B00A 2YWDA 4ZQCB 4D9BA 2ZVQX 4XWGA 4C01A 1DEHA 1A4XA 4HB3A 3LL7A 2IUFA 4XB6B 2YCLA 4EWLA 2GA8A 5EVJA 2P2YA 5CVTA 1XLUA 4Q1EA 5G4LA 1ISIA 4EEZA 1HNNA 2V6JA 4A6EA 3OE5A 3BE6A 4L5JA 5DKFA 4QGFA 1P74A 3LVQE 1AXRA 3WYDA 1W0JD 3ROQA 4FR2A 5DMHA 4MJ3A 3V8QA 1E61A 3GJXC 4A15A 3DC2A 3CT4A 1YRQA 1Y8QA 4MULA 2X5XA 3C6XA 3D3EA 4OIMA 2ADOA 3PE6A 4P1ZA 2C61A 2Z58A 4MGHA 3T5GA 1QX3A 4FE7A 5L3SA 3ZHZA 4I7EA 3HWWA 3KQLA 1IK4A 2Y0EA 1EM6A 3AKEA 5LOVF 5EZ5A 1VQLB 2B6NA 4IWYA 3MLAA 3WGTA 3ITDA 1CSEE 1VJGA 3I0NA 5CR9A 3UAXA 4ICIA 1U8AA 2H08A 1TK2A 1Z12A 5D5PA 1Z39A 3RRBA 3S5JA 3KFVA 1MORA 5JXIA 2C59A 4UVHA 2HMUA 4DLPA 1FJGB 4AJ4A 4HGNA 3PPIA 5KCZA 1PZHA 1GZVA 3O95A 3OT4A 5EFOA 4A0HA 2VJJA 1MNQA 2NLOA 1YZHA 1RHUA 3DE6X 2J8ZA 5LYJA 3SIPA 5CDFA 2BKXA 3FLMA 2A6PA 4BGDA 1U3VA 1DV2A 2BGRA 2IF2A 2J30A 2VVTA 3AUKA 1X39A 4AZVA 1KOJA 3NR2A 1LJUA 5BWLA 2RONA 4PYJA 2QY6A 3QPDA 5JALA 3QEOA 3ZU5A 1PQUA 3E61A 2CCJA 4L4RA 2VDUE 2V4DA 3H11A 2FMKA 2H85A 3ESXA 1OUMA 3QI7A 3U9SA 4MW2A 5B7GA 3NHZA 4RHXA 4HFJA 3F67A 2Q6LA 5A5EA 2FP4A 2QJRA 2GJ4A 4BVHA 4IXNA 4OOXA 1J1ZA 1IHXA 3Q9LA 1H6DA 1OFVA 3DZGA 3ZGXA 1NUQA 3VC2A 2NV6A 1W36D 1I0ZA 2I6GA 4N0PA 4F0JA 1K92A 3EDOA 1ZS9A 3CVXA 4JR0A 3I45A 3F3SA 2EP8A 5GONA 3OZCA 2J0VA 2NAPA 5HJ2A 1SG0A 5C1PA 2FSFA 4BUZA 10MHA 1LI5A 3O4GA 4PC7A 1E6KA 5AD1A 4YWHA 3U7GA 4PPQA 4N54A 5DSZA 1M1XB 3CNBA 4QPDA 3L0CA 2JB9A 4OB8A 3TEJA 2B92A 1KSHA 1NUAA 1O94D 2DH6A 1NZJA 4X6LA 5KJEA 4G0VA 1YXMA 1U7UA 1VQ8B 3MTAA 1F4PA 4XYEA 3BIWA 2Y6VA 1PO7A 2J0QA 4NCAA 1AMNA 1JFFA 1V35A 3CH7A 5TGDA 1MUUA 3KD2A 4JC8A 1VYHA 1PYDA 2DX7A 2GN6A 3HCBA 2CNDA 4FYPA 3U3KA 1QYRA 1NZDA 2XQVA 3FPJA 3QFSA 5AH0A 4AK9A 2GVZC 3QBJA 2JEZA 4GLBA 4QOSA 1K0FA 2CLDX 2VJAA 1NM5A 3PNOA 3JYNA 5FPHA 2H52A 3LUHA 1XX6A 1YZFA 2IBMA 4EECA 5EZYA 1ZOPA 2O0JA 4RKFA 1JHXA 3T9FA 3GLQA 5LQNA 5FTJA 3B3AA 2EARA 5JLJA 4WXYB 5KWVA 1O96B 3CRW1 3H4MA 3KT6A 5KYXA 4PZ9A 4BXOA 3N8NA 4EI7A 5LDHA 3R20A 4FZRA 5K3CA 4LK2A 2IWRA 2OHXA 3BL5A 3JALB 4UBOA 4GMHA 1GFZA 1Z4JA 1XTTA 2XKBA 2Z56A 3QKSB 3RHTA 1KDVA 1CX9B 1KDYA 2AN9A 1C3EA 4BP3A 3DCYA 3T34A 3Q8WA 2JJ8A 1J33A 4IV0A 5BQPA 1HKHA 4M6WA 5LNK6 2R68A 1TKCA 3C3DA 2UZ1A 2QUKA 3S2EA 2BYTA 1UKZA 3D6UA 5IDYA 4CTNA 1Y7TA 5A8AA 1WTAA 1K5HA 4YR7A 3OQBA 1ZX1A 5LQMA 2P79A 1D0SA 4BUCA 3ONYA 5T57A 5GV8A 4TL9A 2WYWA 2DBZA 4TS4A 3RIYA 3ZE2B 1WZ2A 2E1RA 1VG8A 2AF4C 3CY6A 1GCOA 1NUPA 2BLLA 1L5ZA 4UNNA 5JATA 2E48A 3K71B 1R88A 1A8SA 1RCUA 1VIAA 2CBZA 4JP1A 1VLVA 3E70C 1JF8A 1G7TA 2BGLA 4IXDA 3TI9A 2YC4C 1XTIA 2ZRFA 2JJ2D 4OAPA 3RFUA 3RVSA 4YAGA 4KRFA 3IBTA 1SC9A 2N0SA 2VTVA 5IJWA 2JGIA 2XZDA 3HMKA 3D4PA 1GPWB 2XCQA 2OBYA 2XRFA 4QDXA 1EZ1A 1NJFA 5B2ZA 5KNCH 5LQAA 4NYJR 4QDUA 4Q66C 1MT3A 4RKYA 4CM5A 5HQ3A 3R7WB 2XGGA 2ZBPA 4OOSA 2O1WA 3EXIB 5LLSA 1YZLA 3I64A 4KLCA 3VU9A 2XSZD 3IT2A 1XYGA 5ETJA 4FK8A 1S6YA 2DPHA 3AILA 2E4YA 2Q0XA 5GM2A 3RYFA 4DLAA 3VPGA 2SCUB 1USUA 3DJYA 1G5RA 2OTJB 1HA3A 2A9PA 1VQ5B 3WP1B 1X87A 2HDWA 4G7XA 1EGHA 3P2IA 3PVZA 4GMDA 2MSDB 4M0MA 4RAOA 5EQJB 2Y9PB 3UJDA 4R2JA 1U63A 3EA5A 3SQOA 2RH4A 1CZRA 4TZTA 2YZGA 4JA0A 2QMZA 1RACA 3W9SA 1ZRSA 3G0OA 1Y7PA 3ZGVA 3BWVA 2NO4A 2FVGA 2ZI7A 3OCZA 4NZZA 5E2AA 3H13A 4OFZA 4U4AA 3IUQA 4JUCA 3TIFA 5JFOA 2P3MA 1FXWA 4OM7A 3M3HA 1QIGA 1W87A 1NAIA 4J1TC 2QW1A 1KE1A 4C2AA 3TOXA 4MWTA 5G41A 4QA9A 4Y9DA 3REQA 4XA8A 4OIFA 2C2HA 3M3DA 1UMCA 3M1AA 3PDWA 3EGIA 2PH7A 3ABSB 3R0XA 3WV5A 1WCV1 3NHFA 3OUTA 2YV1A 3OPMA 4HO1X 4B43A 2VHCA 3GYGA 2HCFA 1Z88A 3H8WA 2YVUA 3H99A 3R5TA 5U4XA 4YIHA 1XTRA 4FHFA 1G6HA 2XUZA 3EZGA 5K1ZA 1CNMA 2FMXA 4Z86A 4NONA 4DWWA 3TRDA 1C7RA 1PFUA 1RSZA 1U04A 5BW8A 1FW8A 4HWRA 1HC7A 4HGOA 4IILA 3K1AB 5EMJA 1D2HA 5DYIA 3TL2A 2RHHA 2VSQA 2OCYC 3MLBA 4IWXA 1YFJA 3AF0A 2PZMA 1J25A 3H9UA 5FI0B 2W6NA 3ZLVA 1N8RD 1NUTA 2DBYA 4CF5A 2I76A 2WE7A 4EELA 2OCPA 5A6SA 3QNUA 2X7XA 1J23A 5E6SB 5HNKA 3CF0A 3VR6A 3BDIA 4AULA 3DM5A 1T9DA 1WXXA 1O2DA 3HL4A 1BWPA 3KPWA 3R4VA 2ZJ6A 3USZA 4H7PA 3K8OE 4P6VF 3MYYA 1NQUA 3WGZA 1O89A 4JC0A 3M7IA 2ZUCA 4RE5A 2PQ2A 1EE9A 2HIHA 3OO0A 3PGVA 5EJAA 2VSXA 4V0MA 2YKGA 2HA4A 4N01A 4ED9A 4Z9AA 4YMIA 1NB9A 1MDFA 5AVJA 3RC1A 1P18A 1K7EB 5TF0A 4IYRA 4ZOLF 4X07A 1C8BA 4L9RA 4DCCA 3VPBA 2HLDA 1YVRA 1OKKA 4ZCMA 2VJBA 3KZMA 3QSGA 4FPXA 1O87A 4N0DA 2WAYA 3SYKA 4BO2A 1DJLA 2EKDA 3GEDA 4N6GA 5CFQA 3MS2A 4NYMQ 4G86A 3CT6A 5IP5A 5IYZB 3VA7A 3U7JA 1YOBA 1OTHA 3T3OA 2GAJA 1WUHS 5E1BA 2HBRA 3FNGA 3T3IA 4MA5A 3GHYA 4HLNA 2RHGB 4Q0MA 2WF6A 3IAM6 3SK0A 5ECGC 3VH4A 3W4KA 3OFKA 3QE3A 1N6RA 4RQBA 5BMOA 2BH9A 1RXSA 1PUIA 1CBUA 1PV2A 3K1ZA 5GOZA 2CVPA 1F2VA 4RZXA 3QWHA 5JCXA 2Q6TA 2X4GA 2XI4A 1NQWA 3KPJA 3O5AA 4HEQA 4PCLA 5JD4A 3UG6A 1YOVB 1P9OA 4C4XA 1F06A 3FPBA 3KJZA 5DIFA 1U2RA 2ZTUA 4E14A 2DFPA 3FCYA 3KU4A 2AMYA 2ERXA 4N76A 5C7YA 1PBNA 3NBKA 4JYAB 3ZK7A 3VKGA 1Q7YD 4XFKA 4TKVB 3OQ6A 2OAGA 2I7CA 4ZYVA 1L5VA 1ECJA 1UC5B 2EKPA 3CPHA 4KHPB 1XRJA 4H6XA 1GTSA 2NZWA 1FBNA 1SHUX 4GXNA 3BFPA 2BR3A 4CEJA 5JJKA 2JGAA 1SQSA 1YA4A 1INLA 1PLKA 1X0VA 4IVNA 4H7JA 4D3SA 2PCJA 4ECAA 3MGBA 3N05A 2WWTA 4G6IA 4P4TA 2GK4A 1O5OA 3GRFA 4BV9A 5KINB 1PD0A 2I03A 2AQIA 2YIVX 4DIMA 3LYLA 3IEMA 1NRKA 1D4FA 1EKXA 1QTIA 4B44A 1X94A 1WV1A 1UJ2A 2B5WA 1PS0A 3AEYA 3MQFA 5MFPA 3WGUA 1FRQA 3IDZA 3DFZA 4I1YA 4KZKA 4QEZA 3EXG1 4NFHA 1KNQA 4FTWA 4BMYA 4F1JA 2JHPA 4F3CA 4CIDA 5HIKA 1A9XB 1FNDA 5DSXA 4X3PA 4LJ5A 1M3SA 2FI1A 4OGFA 5HF5A 2FZGA 9LDTA 2JKZA 5BSVA 5IYQA 4MLPA 5SY6A 2DHEA 2X1VA 3M4JA 3NHRA 4IQFA 3CZRA 4ZZIA 4PXYA 2FEKA 2BEJA 3ZLTA 2OO5C 1MX5A 1UBFA 3CU5A 1MW8X 1DINA 4EA7A 4RK6A 2AOTA 4CIAA 4EB8A 5JCOA 1R9GA 1XEAA 1QH1A 4AC9A 2B8JA 2IPLA 1U3DA 1KBOA 1Z29A 3MTGA 1APBA 1HE3A 4E5KA 3GO4A 1H85A 1HMYA 1Z0SA 4ZAVA 5BNZA 2KLBA 3A1SA 2OHJA 2P9TA 1L1RA 2J3EA 1C1HA 3L4EA 2GJKA 2K2QB 1XTJA 3PE4A 2W2XA 1RLTA 1QP8A 3RPEA 5DF1A 3BJEA 1IY1A 2QL9A 1FA9A 2XW6A 4NPCA 5E4FA 4ZZ2A 2IHBA 3T3MB 2IEDA 3WAJA 3ASPA 3I28A 4Z4TA 1T6XA 1L8LA 1V6CA 2R8XA 3TW8A 4C06A 1AS3A 1NF8A 5KMGA 4K26A 4RTRA 1T9BA 2A0KA 2A2ZA 2J9FB 4OFXA 4MGKR 2LCFA 3ZU6A 4DV2B 2Y1KA 2VZ9A 2ZS8A 4MLZA 3OTHA 4NMMA 3HJNA 1YUNA 5C35A 3DCNA 2E5WA 2IHZA 3DNMA 1I7QB 1B6RA 2ZB4A 3AIIA 3PVCA 2TMDA 3Q3GE 3PYMA 2BD0A 5TJ9A 3WKDA 1N6NA 1XCBA 4RHYA 5KIAA 3NCTA 4AWBA 3BAFA 1WLYA 1Y1KE 2VHJA 3CNNA 4TMTA 3PIDA 3SIRA 3ZWPA 7ADHA 4PCVA 5AP9A 2FGJA 3EEFA 4IZOA 4TM8A 4X1YA 4YBZA 1NVKA 1J4AA 3D8TA 2FWMX 2HH9A 4HS9A 4I6GA 4MXDA 4JSRA 3IIMA 4OHUA 4UCWA 5AI0A 4YUVA 1ZSVA 4F4UA 1TD1A 5IJZA 2IYXA 1D2RA 4C20A 1RRMA 3INGA 4PNPA 5CDGA 1THZA 2H9AA 1E18A 2ONZA 1UBUS 3FZEA 3LRXA 2FSVC 2VTEA 3KTDA 2NV2B 1YFZA 4MINA 3I56B 2VRBA 4Y2JA 3SE0A 4BX2A 4CM9A 3EVNA 5F9FA 2R97A 3JVDA 3R6WA 2ERCA 2IPOA 4J4BA 5HFNA 3GLIE 3GF4A 4QC2A 3ZD7A 4PZYA 3E23A 5L6MB 1N0WA 1OU0A 3L07A 4QYIB 4R0MA 3O8CA 1S4QA 3GH3A 4P3OA 3NAQA 4R9SA 4P2GA 2Q3LA 2PDAA 3IS3A 1UINA 1K8QA 2QAJA 3N28A 5FUBA 2CKMA 4HR7A 1QE3A 2FZ4A 2E4VA 1QXSA 4LJAA 1DBSA 3KXDA 3I2JA 4G4IA 4I08A 1SXIA 3P94A 1UD4A 4FVTA 3DP7A 4JBIA 4TUYB 4U39A 5DGDA 2I1WA 1YMQA 4KBGA 4DLNA 1FTSA 1QV6A 1ZONA 1N5RA 5IANA 1S7CA 2GCPA 4LY3A 1D2GA 3I2IA 1PW7A 3IQZA 5TR9A 4YO7A 4F5ZA 1CQXA 1ZHHA 1JSZA 2D1YA 2P9ZA 2FSIA 3A6ZA 3DVAA 2I6TA 3L8ZA 3A9RA 2ORYA 4P0QB 1CY6A 4OHPA 1FNSA 1V26A 1W6UA 3QBTA 3UF0A 2QTFA 1Z5WA 1AQUA 1V5WA 2WI8A 3G89A 4Q9DA 1QRAA 3DH0A 2A9VA 3SDSA 2PRJA 1WSBA 1GNTA 3FYUA 3ZXYA 3AVUA 1VSUA 1T26A 1YLOA 1AN9A 3FVTA 1VGRA 1N6KA 4BCCA 1EQUA 2ZJZA 3B5EA 3ETJA 4Q9LA 2B94A 3D6HA 2XB8A 3DP9A 1T5EA 1PZFA 4CMGA 4I50B 2MCFA 3CNOA 3DJFA 3G59A 5CNMA 5EE1A 3TFWA 4D9GA 5ALTA 4WE3A 5ALXA 2LVBA 1KQPA 1R6VA 3ETCA 1UKEA 1M34E 1E9BA 4CLRB 3HA3A 3NHMA 1AVTA 1WCYA 4X1KB 3AM3A 4EUFA 5GIOE 3F9IA 1FYWA 3IAFA 4B4VA 4M55A 1ZXLA 3WWDA 4XJTA 2AFIE 3W8RA 1D2EA 1BW9B 4GW3A 4M38A 3CFYA 1J21A 5DI3A 4ERXA 3ORYA 2V4MA 3KX2A 1VA4A 2JCSA 3CW9A 2B1QA 4LZLA 4OHFA 2GLTA 4D42A 4YRRA 1T6BY 4LGYA 2I6UA 4TV8B 2PMDA 3EOZA 3BE5A 3MS7A 1F9AA 3EUAA 3KLMX 4EVQA 2RIRA 3WXBA 4ACBA 3N3BC 1TNDA 3PKJA 2ZT7A 6ADHA 4RIIA 5J1SB 3V8RA 1DELA 3F8WA 1ZI9A 4I4CA 3R7WA 3LTNC 4II2A 5K0JA 3NHJA 4K03A 1TVKB 2CNBA 2FPOA 2WFLA 3EXIA 1XEWY 3JZFA 3NBFA 5A3JA 1XL1A 3IB3A 4XOPA 2BGIA 4G5OA 1Z9BA 4PS1A 2EFYA 4H08A 2SCUA 4LXIA 1P9NA 5GZ6A 1BGWA 4P26A 1NXTA 2O50A 4XEHA 1YI0A 1XL0A 1T91A 1PDOA 1ZD3A 3KEGA 1E66A 4OP2A 4LBZA 3GPBA 3K9GA 1JAIA 4TL8A 1YC2A 4L28A 4MIYA 4GYJA 3JQAD 3J81A 1CB0A 1PJBA 2XMQA 3RVDA 4BB9A 4IJKA 2QXTA 3D3NA 3IKMB 1XD8A 4YAIA 2C9MA 2GEKA 5JBQA 2V9ZA 3OM0A 4EA8A 2X7JA 3D7KA 2PKEA 3NM5A 3ZU2A 3AJ9A 4L4SA 3CCJB 4FN5A 1JR3E 2ZJ1A 5T64A 1RC0A 2GQ0A 2Q1TA 2MMCA 3GJRA 4IKEA 4N0EA 4B4DA 1GFIA 5DM60 4NBRA 2FK8A 3NBUA 2IGBA 1ADBA 1IZZA 5TQJA 5LP6A 2RGRA 1PTKA 3PQDA 4EO4A 2ZZNA 5JCZA 2YUTA 3PUHA 1Y42X 4KTTE 3U5TA 3DEIA 2J7PD 3IXLA 5KNCD 2W8BB 2G4CA 3M6UA 5BSWA 1SMKA 3CCVB 2EOAA 3E58A 5EHQA 2HA0A 5T4EA 3TKLA 4BAZA 3FPLA 1WVIA 3DFIA 3O2QB 3HQ4O 5CYGA 3PRJA 5PNTA 3ZBTA 1ZIYA 2DC1A 1WB6A 5BQXA 4FC6A 2NO1A 3C3MA 2XOKD 3NXKA 2IE8A 2AW3A 4LPSA 5DHQA 1TU3A 1RAFA 3KB1A 1L4HA 3PJFA 2J59A 4MW5A 5ERXA 4F8JA 3O75A 2ON6A 3AFHA 3VVLA 1Z6TA 4N49A 1B74A 3ASVA 3H1FA 3FTQA 1YDFA 4XQGA 4NBVA 1DEOA 1ODIA 1ZOIA 4MVJI 1BXRB 5DXAA 2XYHA 2JZNA 5LQSA 3V00A 3THOA 1NW3A 5CCDA 4EL5A 4D4HA 5IBCA 4MYTA 4C0BA 5I5EA 2JBHA 5HKBA 1ZJ6A 1Z7BA 3FJOA 1EHIA 5AW3A 3D81A 1Z06A 4EY7A 2D59A 2NN3C 5E6SA 1DARA 3JD3A 4QYMA 2PS9A 1HDYA 2EXXA 2PEYA 1RAAA 2HF2A 1LTQA 1J5EB 2C2YA 5GJWC 4ENRA 2QM3A 5ICFA 2ZDQA 4A8JC 1NQAO 1U2EA 4RHTA 2RGNA 2FDCA 2D0DA 3UUEA 3F2VA 1CK4A 3AF6A 1WXEA 2OYNA 1SHLA 2ZJ4A 3CF6R 1U7PA 1KVQA 3OF3A 2DPLA 2JJ1A 1PG5A 2WG2A 1SCNE 1EX6A 3JQPA 2FETA 2JFXA 2NUBA 1GU1A 1FTGA 2BR5A 2QN7A 2YN0A 5SYAA 2BZSA 2FWAA 1G8SA 2SHKA 2WAAA 3IPRA 2VXYA 4YALA 1WX1A 1ICIA 3TG8A 1TB4A 2CLKB 1QIKA 3GVPA 2DWOA 3LX4A 3NWJA 4R01A 4BMOB 1H4VB 3TRKA 5HRAA 1QKKA 1YRHA 2E4UA 1UEIA 4LY0A 2YINC 4M83A 4GXRA 2ECQA 1I13A 4UUOA 1TYEB 4BLQA 1NI4A 4LGCA 1N2GA 5BQ3A 2JLYA 3S55A 3PGMA 1KYWA 4C5CA 2KVOA 4BIMA 1N8NA 1OT5A 1T2FA 1Q95A 4KH0A 3ZZMA 3WRWA 1ZM4A 4ZQEA 4A82A 1FVHA 1CS0A 5IFLA 4WHMA 4KFTA 2PUBA 2JIQA 4WZLA 2N42A 4XGKA 4MHTA 4NMLA 3ZNOA 4P08A 4XGRA 3HJFA 1KO1A 1JUDA 4K6HA 1EGMB 4YJ3F 2HBZA 5CLHA 2QP3A 4YDQA 2RGYA 2AI1A 4PGGA 4X92A 1FFWA 3UJ3X 4CTMA 3TOZA 1GG5A 2W00A 2HU5A 3G9UA 3TQOA 5AR1A 1V0EA 2F64A 2IIQA 4J2OA 4DF3A 3OIWA 2XZTA 1BMQA 2X2OA 4CMJA 1P1JA 2DJIA 2OV4A 4RTNA 1BEUB 2CJWB 1VKJA 4K9SA 1G3IA 5CYPA 2HIAA 1YS7A 1F2UA 3PQ7A 4J3NA 5FAXA 1KEKA 1MAVA 4HQFA 4UTVA 2NQ2C 1YUMA 1W4RA 2FW1A 4AG6A 5E0KB 1ZXBA 2ZRKA 5KQLA 4DKXA 4UEKA 2B6HA 5ITWA 2ODBA 3EMKA 4I4TB 3SQLA 1X9HA 5JPIA 2PUEA 2CLCX 3QG5A 2PT9A 2QRJA 4UTOA 3L0YA 1SXJA 2QRVB 2W6QA 3SQDA 3ODPA 4H4DA 3BXOA 3OKPA 1NQ5A 3TF5A 2OBBA 3LLVA 1A9XA 3MUFA 3RUEA 4FEEA 1G9XA 1LDGA 4CI0B 2BKLA 3BMOB 3NIBA 1IIBA 3WLFA 4DA9A 4YRNA 5I7OA 5DYGA 2YL2A 4AXBA 2ZRAA 2M1XA 1K63A 1MOPA 1UXGA 2REQB 3B2QA 4AXXA 5AVUA 3CX3A 2GO1A 2OD2A 2XF8A 2VHXA 2QROA 3R09A 4CLOB 4W7IA 3ZS8A 3LSTA 2VUSA 1ULHA 4IQ8A 5CYOA 3RBAA 5THXA 3G1WA 4JLWA 3OC6A 3UV3A 5JZMA 3LCMA 3OW7A 5JCJA 3G7NA 1CS4C 1N25A 1G1MA 4RUKA 4DY4A 2CLSA 4X95A 2JI4A 3RI3A 1IBRA 4LXHA 1KYQA 2KM1A 4N5MA 4MVJH 4NOMA 4U2GA 2PNJA 1IHYA 2QXUA 5BNIA 1FYFA 3R6JA 2FCRA 1FUIA 2Q62A 2VRWA 3AH8A 5JIBA 1SCQA 4B6PA 4BNXA 4ZEOA 2X40A 5KOYA 4J7UA 4M9QA 4ZJPA 3R6LA 1GU0A 2PZGA 4Z4SA 3A04A 3A1NA 1W2GA 2NO5A 2F43A 3VHRA 2PT5A 2VCHA 2ZAOA 4EM6A 2CNWA 4Y2QA 2GTPA 4CV0A 1QYCA 2A5DA 2QMYA 4BN5A 1ORRA 4R51A 5CFMA 1FFXA 3CG0A 1IWOA 3GROA 2J9FA 3MM4A 5COQA 2ZYAA 4WKCA 3RVPA 1RHQA 1OFGA 3CLRC 5DGXA 2ZKLA 3ZWQA 5ES3A 2WWFA 3V97A 2QTZA 2YNMA 2P69A 3KLBA 4RMHA 4EW2A 4YAFA 2QWXA 4QPJC 2A9RA 4QNRA 1ISJA 5JE8A 3T99A 1AV6A 3I4LA 4CF3A 4FCVA 3I73A 3ICPA 4CVNA 2XXAA 2W0MA 1P73A 3OBIA 2H5JA 4RF2A 5BNWA 4Q7MB 4G8DA 2UUOA 2O0LA 1EFHA 2HGZA 1A1SA 1NVFA 1Y98A 4ZT6A 5HJ5A 1ARZA 2MOKA 3DMHA 2QNRA 5M3BA 2PL9A 1M1YE 2W6OA 3FIUA 3S2YA 1H2RS 4P7FA 2WJAA 5HJEA 3N74A 1W2HA 3UN1A 3V6MA 3DZBA 3FMGA 5A7HA 3ET4A 4E7OA 5JMTA 1VKHA 3IDAA 3VGJA 1MHTA 2GEUA 2HQSA 4B0PA 4OXKA 2R11A 4JLVA 4D4LA 2CXUA 2WMNB 5MGBA 1ZPDA 3U5ZB 5KDLA 3T7EA 1KEVA 4LYYA 3EYWA 1W48A 3HFGA 2QD2A 4GU5A 2Z3ZA 3KL9A 2FN7A 1QZZA 2WZDA 4JHXA 4WCFA 3UCFA 2PUDA 4M8NE 3X2SA 5A88A 3KK0A 1QIFA 1H9AA 3E81A 2B7LA 3VNQA 1P7ZA 4NMWA 5JZ9A 1R4ZA 5AKKA 3LX5A 5KJFA 4YMSA 1T8PA 4ZGNB 2XITA 2GN2A 3DBLB 1ZCBA 1DCTA 2HK6A 4ISCA 2ZIVB 2ZJFA 4C4OA 5A4FS 3TLGA 1KZ1A 2ISSD 2MMGA 2QTNA 1H0KA 2H2HA 4JSTA 1I6LA 4JUFA 1V0JA 1VOTA 4B40A 2X0RA 1T0IA 4MR9B 1EFLA 2YW2A 2ZCJA 4NX2A 3BH4A 1Z6ZA 5CFLA 1KJWA 5DBHX 5CB4B 1AZWA 4P93A 4Y0VA 1J8YF 3EAQA 1Z82A 2J5XA 3V1MA 2ZUEA 1UUFA 3OCWA 5JH7F 4QVAA 4AROA 2V6IA 3C14C 5TF4A 4LGVA 1RLIA 3B7WA 1J1UA 3ZCRA 4DIOA 3GDFA 2CUTA 1NVDA 2HC9A 4KE8A 5JAHA 2O5CA 1CP3A 1ECPA 1FYDA 1QHNA 2IYVA 4WY2A 1V45E 4G97A 1QJ4A 1SKAA 1U8ZA 1Y0RA 4I1OA 3PI6A 3LAWA 4WIAA 5CAEA 1P2FA 4Z2YA 1KEWA 1CV2A 2XMSA 1HGXA 3INTA 1CYEA 4UEOA 3FOWA 4X1KA 2GQFA 2OBFA 4PBRA 2Y1OA 1BU5A 3HE3A 2ZB3A 4K40A 4EHJA 1ORVA 1Q17A 1R0RE 2UYGA 1P7PA 5JS6A 2PTGA 5B1EA 4B6RA 2XE4A 4IJVA 4CM6A 4IEEA 4V0NA 3UVEA 1AQ6A 5ILQA 1Z36A 1SKQA 4RD4A 1IL0A 4IF4A 2PVCA 5TS3A 4DUZB 5KYGA 1PJZA 3K9CA 2M6LA 3IKVA 4TV8A 2VJIA 3Q3JB 3ZWDA 2I7VA 3CKKA 4H77A 2NXNA 1HOTA 1MRSA 1XRLA 2QRUA 4OGKA 1CEXA 1CUAA 4CF6A 1CR2A 1VE9A 1DWQA 3ENKA 1T9GR 3D6NB 4US1R 3V1KA 1VSVA 4EEKA 1U6KA 2H4YA 3Q15C 4ADSG 4KXYA 5JD3A 1ZKDA 2OXEA 5CW1A 2GRJA 3WLRA 4PQFA 1AQIA 3DAPA 1N77A 1YB7A 3A1PA 3P0FA 2VAVA 3H5AA 5G3ZA 3ZLJA 1UJ5A 4E5SA 1O0BA 5AT1A 4ETIA 3D6MA 3MQ4A 4M9RA 2Y68A 3LG2A 5JQGB 1A77A 1OC2A 3SM3A 1LCIA 2G71A 3DB1A 4X91A 4OLFA 2Q5CA 3R7LA 3RUIA 1JFLA 1E3TA 3OUUA 1H23A 4EQ6B 3AEKA 4Z9YA 3FHJA 2TMGA 4EY3A 3A31A 1C0IA 3AF5A 4IDAA 4O4LB 1ES9A 5F1PA 4D80A 8ABPA 1ZJ5A 2CD9A 4E0BA 4L8YA 4EHHA 4B3MB 3U4QB 1JAYA 1R74A 1RIIA 4PX2A 1T3HA 2VPIA 1UKAA 4FBGA 3BM5A 3BHMA 3N2KB 2EQBA 3RRNA 5H80A 4IKPA 6ABPA 1GLVA 3GJ3A 4L3OA 2IF0A 3RIEA 1X92A 5G0UA 4JJEA 4MRPA 3TL6A 4Z9XA 2B5OA 1VP9A 1SUSA 3HUEA 3DZ8A 1G6KA 1DZIA 1L4LA 2AW5A 2CE7A 1REQB 2P2CA 4EHIA 4XVCA 4KWCA 4I1SA 2W8BA 4K7JA 2HSJA 3IQEA 5ALSA 3ZWMA 5K4HA 2EP7A 3DS8A 4D45A 2HHHB 1XJWA 1PWZA 3E7DA 4F97A 4AQ7A 1ZUD1 2ZAYA 2UUBB 1OXTA 3D3WB 3RUFA 3KOMA 1XMOB 1JHDA 4DLLA 4Y2TA 5H7XA 4PLHA 3GD7A 5KTOA 5J3OA 3PC6A 5FR2A 1OA1A 4TWJA 1P9WA 1VL6A 4IIJF 1OI2A 2A0XA 3I9V1 4PPGA 3CR7A 1I3OA 1XYVA 3B9PA 2EKZA 1YV9A 1U2QA 2YWJA 4RL4A 2ECKA 2H1VA 5EE9A 3U3MA 4D6XA 5C8YB 1NJ1A 4BO9A 5G1OA 1SKUA 4HQKA 1PSWA 3B1WA 4IL5A 4KBFA 5LB2A 1VHWA 1JVBA 4S1OA 3D0RA 4CFYA 2O2XA 1GSHA 3ZBQA 1DG3A 5HMMA 3O90A 3U37A 3P5BA 1CUHA 1EWRA 1BEEA 4PZPA 3TBHA 4YJ2B 4RF4A 3WSWA 4XASA 2GO7A 4X7DA 5THKA 4F4IA 5IH7A 2HEIA 5JY1A 5G0TA 2HCTA 4PYRA 2GESA 2ZPTX 4WLUA 4R1NA 2OHVA 4BNIA 5TS2A 3PFFA 1AJEA 1RZUA 3MIZA 3TCNA 2DF8A 2ZM6B 4RKQA 1Q50A 4DQXA 1YBHA 3E82A 2CVHA 4G5HA 4Q9NA 1VZ2A 3TNFA 3MUOA 5JJCA 1XNRB 5JS7A 1Z2NX 5KYWB 3FJ1A 1H4QA 2NG1A 4RW0A 5IT5A 4XM3A 4R54A 1QVZA 4LDQA 5JXHA 1VYVA 4DLKA 3HB5X 4G56A 1VLYA 1RRGA 5D5QA 4DREA 1XTVA 4N47A 2ORWA 4A0GA 3N07A 3IT3A 3ZJVA 1KVSA 4BNHA 2X0FA 4A8HA 1AN0A 2FWNA 5EFZA 1RHKA 4FOTA 2R4UA 4OLJA 4LJ4A 2HL6A 4PINA 4O33A 4UCXA 5ISMA 1N4DA 5FDFA 2TMKA 3O91A 4LBVA 1GT91 3BNWA 1VYTA 2C1XA 2G7MC 3WGHA 2WUVA 3OZ7A 3DULA 1ZMRA 4GUAA 4RETA 2FVYA 5FTMA 1TUBB 1XK6A 2JKVA 1DI0A 2TYSB 3JWHA 2RG7A 2W2MA 3AONB 1OX6A 3QQ5A 1YR8A 3U31A 2ODPA 2C3YA 1Y4ZA 1TMOA 4NI5A 4Q4AB 3CX4A 1FCJA 4ZO4A 2E85A 2JD2A 5A4AA 4LNHA 4GGOA 3K0BA 4QJ4A 3IBYA 3PEEA 4ZVVA 4YQYA 4Z0HO 2JJYA 3AO0B 1D7OA 4G1EB 1ZCJA 3LDGA 1ONPA 1KO7A 1KU0A 4XUEA 2E6UX 1N5KA 1WB9A 2FX2A 4B3XA 2H17A 4YI3A 5HZGA 2D1FA 3I5XA 3ZHTA 2BJVA 1SBIA 2CJWA 2IYPA 1ZMOA 2X0EA 3S99A 1O9HA 1QUEA 4PG8A 3STWA 1U5BB 3G0GA 2FHPA 4RDKA 2ZWMA 3MD0A 4GX2A 1VGVA 3SHQA 1PS8A 3WLAA 3UYKA 3T7AA 3MHTA 1GKYA 1DG1G 1ZJYA 4D79A 1RNLA 2P2LA 5D3QA 3TQQA 2VPTA 2UXDB 4OV6B 3LYUA 2B99A 5IYPA 1II8A 1I3NA 4NU5A 3SSOA 2YV5A 1BXGB 1L6RA 1R6UA 3A6HA 1IN5A 2BFMA 4MW6A 2Q5EA 4H7DA 5JNWA 2CYCA 4PPFA 4N48A 4DLXA 1HWYA 1U8XX 2HSZA 2PQ0A 2WM3A 3D4NA 1Z4MA 5JS1A 3AM1A 3M49A 2HDNB 4TLAA 2V0GA 5WRFA 1G2QA 2EERA 2REQA 3L06A 4FYKA 1C3JA 2C95A 5LD2C 3JRWA 3N8GA 5BRAA 3MMPA 4CLOA 4IICA 5I3CA 3ZYCA 1XMPA 3DBIA 3KOOA 4JWTA 3HRIA 4M86A 2XTJA 5J1TB 1PJAA 4M53A 3FRIA 4H7EA 1YX2A 3EX7C 1DZ3A 1OWNA 1O6BA 2CXXA 4XYMA 3F2IA 1GVNB 1L7XA 5EJFA 3EJWA 2BM8A 2ODEA 5FBVB 2I6SA 5A4JA 1SHTX 2HXGA 4O2AF 4CEHB 4FMBB 3X1XA 2JN9A 2QSJA 1RXYA 3OMWA 5ALLA 1ZW1A 2X13A 3PKZA 2OECA 4TMFA 1YD7A 3IQDB 3AJRA 4JLJA 4HY3A 1Y5IA 2AN4A 4PW0A 3R5XA 1JXQA 3HB7A 3QX9A 1ZK3A 5CCXA 1UBLS 1BD4A 1CDEA 4G4SO 4GT1A 4JLSA 4BS9A 2J9GA 1VJ0A 2GX6A 5B6PA 2EX4A 2ZJ2A 1EDEA 3E22A 1SM4A 2WBLC 1T36A 5HKOA 1Z68A 2AFRA 4PICA 3VC7A 4JXXA 1VLOA 3BK7A 3K15A 4TLBA 4X97A 3OEEA 4RELA 1H2BA 4JY7A 1W76A 3MRXA 2IJGX 3WSVA 2FPSA 4DEXA 1HYBA 2PR2A 2H2AA 4G81A 5H16A 5LBTA 1N78A 1YHYA 1I3KA 3ZXIA 5H82A 2DTEA 4O5OA 4BL5A 3SFZA 2JGNA 3Q1KA 3OLXA 1DU4A 4NYIQ 4B7XA 4CF7A 1Y7IA 4W5OA 2P9FA 1E98A 5KDDA 2XMRA 4EATA 3EMVA 4IPTA 1KOGA 1VJCA 4IJ6A 5KKCA 1E1LA 1D6MA 1M1KD 1PCXA 2RGUA 4MVJD 3TW4A 1UXHA 1GUBA 1FBTA 2PX0A 1PZEA 1VE7A 2QTCA 4N8EA 1N05A 3QENA 4D3ZA 4MQFA 4DBLE 3K53A 3OZXA 1GZ6A 1GGFA 1LDNA 2JS7A 1UBTS 1VMDA 2HZ7A 1WOYA 4NZOA 1I33A 3MD9A 1RWMA 2H57A 1GUFA 3DLAA 3HWX1 4MK4A 5FLEX 3THRA 4RDXA 3JU4A 3T7JA 4A0SA 4AIRA 1QZXA 1DX9A 3L6OO 1LFAA 4LOJA 1ZUNA 4O4HB 4OYYA 1NBMA 2GASA 1CCWA 2ZSKA 1KP9A 2QGZA