4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
4MLPA 3HFJA 4G6ZA 3D6VA 2A7XA 2VBUA 3TZLA 1Q15A 1NUQA 1WXFA 2WQ6A 4S1OA 1IVSA 1QRTA 2I1LA 1YIDA 4U63A 1MB2A 3G59A 1I6KA 1R6UA 3IODA 3SEQA 3TNJA 1O97C 1H3EA 3H97A 2ZUFA 4QBTA 3ZIUA 1MB9A 1NURA 1T6ZA 3CLSD 2YXNA 3Q4GA 5J59A 3SYTA 1N77A 2J5BA 2PZAA 2CV1A 1COZA 1QU3A 3FHJA 3IH5A 1J20A 2X3FA 4HJXA 1TQ8A 1J70A 4F4HA 1KP3A 3MLAA 5KWVA 3H9CA 1N3LA 2HMAA 1N05A 1X8XA 4MW9A 1N78A 2ZP1A 4YBRA 5LLTA 2WQ7A 4AQ7A 4K03A 3TZEA 5JBNA 4MUKA 5FO0A 3IOCA 2YWCA 3M5WA 1T9GS 3CLRD 3AG6A 2VBTA 2Z09A 1SURA 3OTWA 4JXXA 3HL4A 1YULA 4XSVA 1N2BA 4ZT3A 3H05A 5FO1A 2PZBA 1VL2A 2HZ7A 3MUEA 4CT0A 4OJMX 1JEEA 1KH1A 2DERA 5A8AA 2PZ8A 1IRXA 4MWDA 4ZT7A 1KQNA 1M8GA 4EGAA 1K97A 1N1DA 2BTEA 1M8KA 4JXZA 1JIKA 1WOYA 3S3TA 1V8FA 2ZUEA 1TYBE 2QTRA 4J75A 4YP5A 1J1UA 3PNBA 4HJRA 4DDMA 1PFUA 3N05A 4GU5A 2A1UA 1Q19A 3H99A 5F23A 3P0HA 2X1LA 1NSYA 1N75A 3GLVA 2WB2A 3BL5A 1XNHA 1N06A 1T6XA 3FETA 3ELBA 5DASA 1QJCA 1WXHA 3IUEA 5HG0A 1WXGA 2NSYA 2V0CA 1G59A 2A86A 1YI8A 1O97D 1RQGA 2RD2A 1R6TA 3ZGZA 1M8JA 4PBRA 2B7LA 2DLCX 1EXDA 1WZ2A 2EL7A 1K92A 2DXIA 2O8VA 4F3RA 4BWVA 4Q16A 2QJTA 4H3SA 1IQ0A 5LFAA 1M83A 3DV2A 4DJAA 2A88A 1NB9A 1FFYA 5TRDA 1G8GA 1P7PA 1M1ZA 3HMQA 3PRHA 1KAQA 3U1VA 4GRIA 1PFVA 2QTNA 4R2MA 2R5WA 2TS1A 1Q11A 1KAMA 3TS1A 4EG6A 4A91A 1O5TA 2JAXA 2PG3A 2PIDA 4CDNA 4ZT5A 2J09A 4NZPA 1YUNA 4KKVA 2RE8A 2JA2A 1HYBA 1B6TA 2CV2A 2GKSA 1N2GA 4EG7A 1MC1A 2QUJA 3RBAA 2Z3VA 2CYAA 1KQOA 1YIAA 2QJFA 4MW5A 3P0IA 4MW2A 3NV7A 1EFVA 1O95C 3LCJA 1WKBA 4OUDB 2NZ2A 2E21A 5A89A 2CFOA 2V0GA 4QRDA 4MUGA 2CV0A 4DDKA 1PFWA 2CUZA 3NBKA 1ZH6A 2QUHA 3X1JA 1M8FA 1U3CA 3G6KA 3KT8A 3L92A 1WJGA 2O5RA 2GM3A 2CSXA 4EG5A 2DETA 1O0BA 1KORA 4ARCA 3IMGA 4WSOA 1WXIA 1KQPA 4ZCPA 3KT3A 4MVCA 3MMXA 5TEVA 3VGJA 1TYDE 1YUMA 4DDHA 1S4MA 4EFKA 2OV4A 3QTBA 4U7JA 4WNYA 1QTQA 1MOPA 4YP6A 2CYBA 1H3NA 3H9BA 1LW7A 3VRHA 1PFYA 3CLSC 1N2IA 5EKDA 1JZQA 1QQTA 4QREA 4NAHA 3FDXA 1KP2A 4MUIA 2DEUA 1OWMA 1U7XA 3IDFA 4XFJA 3PNVA 4ZT4A 5HUHA 3RFFA 1JZSA 1IH8A 1LI5A 2QUKA 3SEZA 1P4MA 1OWNA 4HPWA 5J58A 3CLUD 3MLBA 3KT6A 3KT0A 1H3FA 1OD6A 3FY4A 1CT9A 4U8HA 5TS2A 2A4MA 1G8FA 2E18A 5H16A 1NUUA 2AG6A 2BYTA 1JMVA 1J09A 3GMIA 3D6UA 3K9WA 3TQOA 1GLNA 2DUMA 2QTMA 5IJXA 3COYA 4MW1A 4MWBA 1JHDA 1GZUA 3COVA 3COZA 3CVXA 4ZT2A 4ND7A 1KR2A 3FIUA 4E1AA 4MW7A 5H7XA 4MUNA 4MWEA 4CDMA 3OP1A 5LM3A 2A1TS 1WQ3A 2XRZA 4PBSA 3LOQA 1EFPA 2IJGX 4NATA 3L93A 1K4KA 3UY4A 1QRSA 2A1UB 5BNZA 1UFVA 1U3DA 1XNJA 4DNXA 4KPUA 1LI7A 1ZJWA 1MAUA 4JZYA 2VBVA 3I05A 4RPIA 1JECA 1F7VA 1F4LA 5KCMA 2OYNA 1O96A 3K32A 1Q9SA 4JFAA 1EUYA 3ILVA 3IVXA 1BS2A 1EFPB 2AZXA 2E0IA 3TQIA 3AG5A 4XFDA 4X0EA 1NZJA 1I6MA 2CT8A 2D5BA 1N07A 3ISJA 1T9GR 1O0CA 4AS1A 1GN8A 3UMVA 2A1TR 3HV0A 2P3MA 5IHXA 3X1MA 4ZCQA 2G36A 3IUBA 3PNYA 1GTSA 1JIJA 3FWKA 4K0RA 3ND5A 4R0NA 3FI0A 4MULA 1EJ2A 1PG2A 1X6VA 1WXEA 2C5SA 3KFLA 1OBCA 3HGMA 1Y42X 4NX2A 5TGTA 1V47A 2YY5A 3A04A 4MW6A 1VBKA 3CLUC 3NBAA 3ZUGA 1F9AA 5DB4A 1OWOA 1QNFA 3QTTA 3N9IA 4KR9A 3CLTD 2JANA 1NUTA 3F3MA 3E27A 5J5AA 1NB0A 3CVYA 1OWPA 1O95D 1O94C 4NDAA 3FOCA 3FG9A 1OBHA 3CR8A 3SDBA 2GOYA 1KH2A 3A4IA 3IMEA 1N2JA 1A8HA 1F7UA 2HGZA 3G5AA 1IQUA 4RUKA 4Q93A 3P52A 1T6YA 1NYLA 4UZFA 1QU2A 1R6XA 2VTBA 1IQRA 1GPMA 3Q12A 3SZ3A 3UOWA 4CQNA 1GAXA 1ILEA 3A2KA 2DR2A 1ULHA 1KKUA 2XRYA 2J07A 5HUJA 2Z08A 1Q77A 3LE8A 2E89A 4G5FA 5TEWA 4ARIA 3RJZA 3RK1A 4L2IB 3Q10A 4KR7A 1DNPA 3VU8A 2EJCA 4YMIA 2IP1A 2OQ2A 1IHOA 1NUPA 1MRZA 3IMCA 3ND6A 4PBTA 2J4DA 3DLAA 1GTRA 2X1MA 1K4MA 1J1ZA 4I6EA 5K0TA 2PFSA 3CVWA 4HK4A 1TYAE 4ND6A 1WY5A 3P0JA 4DLPA 3C8ZA 3AIIA 3COWA 4R2LA 4MUHA 3N2YA 4MUFA 2D54A 1XNGA 4ZCRA 1JGTA 1MJHA 2DPLA 4OUDA 5DEOA 2VTBB 1EE1A 4TS1A 3GUZA 3CVUA 2D13A 3CLRC 2A84A 1VBNA 3X1KA 4MWCA 3CLTC 1O96B 3INNA 1O6BA 4DE5A 5AHWA 4ZCTA 4EG1A 4MW4A 4ZT6A 4MAFA 1FYDA 3AFHA 3PXUA 1IFXA 1QRUA 3IVCA 5K0SA 3CA8A 1JILA 3RHSA 1H1TA 3ZJVA 4KR6A 1XJQA 2VXOA 4J76A 1U0BB 2AKEA 3DO8A 2YWBA 2IELA 3UC5A 3ZJTA 3SP1A 5A88A 4YP7A 2X0KA 1WQ4A 4G5YA 4I6GA 1TEZA 4JYZA 3CVVA 3MXTA 3ZJUA 1M8PA 2PXHA 5DK4A 2CYCA 3UK2A 1I2DA 1MBZA 2H29A 5FNZA 4EG4A 2QJOA 1VLHA 3JXEA 3SZGA 3IVGA 3ZXSA 4MVWA 4MUEA 2H2AA 3BNWA 1D2RA 1NP7A 3QE4A 4KPUB 4ZCSA 2J08A 1N2OA 4MUJA 4MQ6A 4UZEA 3AKZA 2VBSA 4EF6A 3RK0A 1PG0A 1TYCA 3IOBA 4MVXA 1JEDA 1JIIA 1MAWA 1KH3A 4PY2A 3CTAA 1N2HA 3DPIA 3ZXIA 4EG3A 1EUQA 1N08A 1NI5A 4NAUA 1O94D 1NUSA 4I6JA 2WSIA 1G8HA 3ND7A 3A05A 4MVYA 4FZJA 1ZH0A 3FH0A 1I6LA 1U7DA 4P2BA 3HZRA 1N2EA 5KHAA 1ZUNA 3N8HA 4EG8A 1EFVB 1OWLA 1VBMA 4L2IA 3AL0C 1TFUA 3FNRA 3IOEA 4MW0A 1J21A 2QUIA
chains in the Genus database with same CATH superfamily
1TF2A 2Q27A 3PYXA 3LDUA 4BLSA 3HCCA 4EI9A 4POOA 3QVUA 3HCWA 3JQAB 4KH1A 4LXQA 3W9SA 2DB3A 1UD8A 5JW6A 4F91B 4NZOA 4QUHA 2IHZA 4TV9F 4JBHA 2PKQP 4J0KA 1X77A 5JXWA 2O54A 1RWPA 5ANRB 3ZBUA 1UK8A 3GNQA 3CX6A 3ONWA 2H0AA 3PDHA 1YGYA 5BW8A 3RRBA 1X2EA 1E6KA 2R6ZA 3EWIA 4E1VA 4EJSA 2P6RA 2ZJ0A 1LQ2A 2J5KA 3MCAA 1HDGO 3RFXA 3V00A 4G89A 4GRAA 1P5HA 2HYDA 3CLSD 3ZPNA 4L4XA 3P45A 4BWYA 2CWWA 3Q2IA 1MABB 3OI7A 4AWBA 4UFOA 4CLXA 4O08A 2NZJA 3G0CA 4NONA 4RE5A 2IU3A 4ZRMA 4BMSA 3E5HA 4MOWA 1KDOA 4M9XA 2IEDA 2RG1A 3W5JA 3AR6A 2NAFA 1T43A 3KCQA 3LAWA 3ZTWA 4EHAA 5BR8B 2DLNA 1E58A 1OXKB 3RS0A 3WDSA 3EXG1 2FG5A 4X7MA 2EWMA 3HB4X 4U9UA 4DPKA 3C8UA 2ZP1A 2D7CA 4L5BA 4AYXA 1ZN7A 4JJ8A 3BC9A 1K63A 2C5FA 1G3QA 1NVDA 2DHRA 1VSTA 2JD0A 2R00C 1U1GA 2YMPA 3HN2A 1K0FA 3OEYA 4PFSA 4IFBA 2HAEA 1VHJA 4M8IA 3PUXA 2FR1A 2UKDA 5CH3A 2GN6A 2X14A 1L5KA 3VH1A 1B0ZA 1BD3A 5I6DA 1RJGA 2FGJA 3PKZA 5T5QA 1T2DA 4XSVA 2ZBGA 4ZHSA 2R96A 4AK9A 1D4FA 4PCUA 3QWIA 1COWD 2PNJA 4CKWB 3O8QA 1E3JA 1ORRA 1WPRA 3DBRB 4K28A 1P18A 2W4IA 5EJ4A 3VNRA 4P80A 3A4LA 3B52X 2H2FA 4URZR 1YQWA 2H63A 3P9QA 4LMBA 4OP2A 4ZGQB 3M6VA 3KOMA 3R24A 5KUTA 1M8GA 1XCJA 4YECA 5T67A 4GLLA 2O8FB 4L5YA 1K97A 5HQ3A 3CX7A 1X1AA 3BXGA 3LT1A 4MMZB 5CIQA 2YZKA 4C89A 4QDZA 4P4SA 4U7FA 5CT5A 3SK0A 1ZMBA 5FA6A 2V1XA 1DIGA 1HF3A 1ZH2A 4KFUA 3U7GA 3OPVA 1E2HA 2JN9A 1NQWA 1VFPA 4MV5A 1D9XA 3CCCA 4TTRA 4BMPB 1U5BB 4HJRA 4OBXA 4GBGA 2R60A 5EJGA 2QVXX 5BN5B 4AWXA 1QS0A 1T1RA 4MLDA 4R6XA 4TL7A 4XR9A 2YJGA 4HUJA 4MVJD 4NK4A 1N75A 1PLKA 5FTNA 3CMEB 2GVZC 1I6WA 1PNVA 5E2AA 3T3GA 4YV7A 4NULA 3T9FA 3UV3A 3M4JA 1XRMA 3U1BA 3A8IA 1A1SA 1YF3A 3BEDA 3AERB 1A9PA 2P1ZA 3HO6A 1LZKA 4FMCB 3HQ4O 3ITNA 4JIMA 4KVZA 4B6SA 5HS4A 3M2TA 3E6AA 1TE2A 2LZJA 3NGLA 4LW8A 4BGUA 1AQNA 2XQIA 3ESDA 3JYHA 3Q0EA 2WIBA 3I2JA 3VDXA 1KY3A 1J22A 2DJIA 4QECA 3HGTA 3AUUA 5JSYA 2B36A 4C3UA 1NM5A 4F5DA 5LFAA 1I5RA 1AMUA 4ZKDA 4KQEA 1E2UA 2FLVA 4NHOA 4BKPA 1QHYA 1QYCA 2P77A 3HUUA 4H31A 1N2SA 3O4RA 4QHTA 5LB2A 3MUNA 2QMUA 1JDVA 2A9RA 2CUTA 3DUWA 4FUQA 4QJ5A 2JC3A 3B9PA 4WCDA 5EIBD 3DTTA 4Y9RA 2PX6A 5DGTA 4DA0A 1NDUA 5KVSA 3QQ5A 3CR3C 3K9QO 3TOSA 2KSQA 1E96A 3DE7X 4KAJA 3NS7A 4QWMA 3DT6A 5M2QA 2WVAA 4IDQA 4UHFA 4JBGA 2YXLA 4DJJA 4CM1A 4CLOA 3QVOA 2IXTA 1IZ8A 1N2GA 4J7CA 4W5TA 2IBTA 1UT8A 2HA5A 1GPYA 1UPAA 3IIJA 4MR8B 1D2AA 4F2HA 1FXSA 1SBZA 3HU1A 2JIDA 4JR0A 3W78A 4MI3A 4O2AF 1J9EA 2VA9A 3BREA 4HAVA 3OM9A 5HM6A 1JIVA 1O95C 3ND8A 3U56A 3KSBC 3P0EA 1MX5A 4IH4A 4JR1A 3VKGA 3RF7A 3K16A 4N7RA 2ZIZA 4QRDA 2WHXA 4BC1A 4HC4A 1X1TA 2BC9A 2Z8ZA 3ONDA 4GOKA 1CF9A 4J2OA 4PRZA 2FPLA 1RMTA 5IYZF 2HHJA 3BULA 4CLRA 1U3CA 2QAIA 3SFZA 4M6WA 4UULA 3GEMA 4WDRA 2RSLA 3ORRA 3W2GA 4C0HA 2VBCA 1W36C 1T6BY 3ZU5A 2JD2A 1R27A 3UN1A 1E2QA 1BAPA 3QG1A 2NP7A 2J0EA 4A15A 2WSSA 5CVDA 5JYEA 2WFLB 3JTEA 2IZ0A 2YBEA 2DTDA 1RQ7A 1U8ZA 4LKRA 5IXSA 1QBGA 2X2PA 4Y6RA 4BGDA 3LZDA 5CRIA 4CQMB 3UJ6A 3UAXA 2BGJA 4KFCA 1NDHA 1G98A 4RNCA 4NPCA 5CIWA 3W9UA 3I9V6 1E3DA 4IEFB 3JATB 3OPXA 4HB3A 4MUIA 1LWOA 3QVWA 4RXUA 4TTJA 4YHHB 4W8GA 2OR3A 3S1LA 4E0FA 3DVAB 1XEWX 4HEHA 2FI1A 4UREA 1IBMB 2V96A 3L18A 2XCIA 1I80A 3ZD6A 4QM6A 5M34A 1IL0A 1YZNA 4KH0A 4C0QC 2QPOA 4QFBA 3UOGA 2GEVA 1JLMA 1ZH8A 1SG9A 1IXZA 2QROA 3SIXA 4D6XA 1LC0A 2W2KB 3PC8A 2BMWA 2C3OA 5IAGA 5B58C 4UNRA 5DK6A 5CJ2A 4X0CA 4B0OA 3MLBA 3ZVRA 3EDRA 2O20A 2HV9A 1UWKA 1KZLA 4MB6A 1NUHA 3TDMA 1MIHA 2ATVA 4RU1A 5K8LA 3RUPA 2F9MA 4JP1A 4B3JA 3TTVA 4RY9A 3DMFA 4II7A 8ABPA 2WHPB 3IDZA 3HS3A 4YACA 5EHIA 5GZ6A 5CDSA 5KVAA 2F8MA 2WWVD 1RZRD 1JZTA 2AQIA 2VSFA 2QTFA 3TECE 4FQ7A 3HVHA 5IM4A 4TSFA 4Z3OA 1SOMA 4YBZA 1NQ5A 1T0HB 2RKOA 2QX6A 3PDIA 5EXXA 1JR6A 3IAS6 1H2AS 2R11A 3IKLA 4J0CA 3E22B 3KLOA 3VAAA 4E1AA 2GO7A 5IUKC 2AG0A 3ML1A 5LM3A 2YIDA 2ZJ5A 2AD1A 2I2WA 4NCHA 3IJ5A 2EXXA 3FUUA 3S29A 2ICAA 2ZRJA 1CIPA 2QI9F 2CKDA 4NATA 3DCIA 4IV8A 1TKBA 1VQNB 3JD2A 3AF1A 4RSRA 3UTCA 1DJLA 1D2EA 1GZDA 4BKMA 2ABWA 2OBLA 3EOAI 2O0KA 2OAQ1 5H80A 4UVDA 3W34A 5I47A 4ZAWA 3PTZA 4JSYA 4Q03A 1U2DA 1V0FA 1ZJWA 3F6PA 4L5CA 2DPYA 3L79A 5AM1A 1Z08A 4C20A 1UF9A 2G04A 5DBFA 5FORA 4BZQA 3HVKA 4RBNA 4FHFA 2YRXA 2VBGA 3AW8A 3P5BA 1PJ7A 3Q6MA 1EJBA 4HRYA 3EX7C 1CUWA 3EGCA 2YVQA 3B78A 4K05A 4KUEA 3VR3A 3AHGA 3R3WA 4XGRA 4ML3A 4P83A 3LVBA 1N9KA 5IFLA 1JSRA 3AETB 3U09A 1NZJA 4HWTA 4OB8A 2HUPA 3KZ1E 3TR6A 1EZ1A 1ZUWA 3FWNA 3K2BA 5BN4B 3V32A 1RT9A 2VDNB 3DHYA 4LVUA 5C1BA 1U0FA 3AL3A 2ENUA 1V4NA 1VIDA 1P44A 1EFRA 1ZI9A 2EQAA 3P32A 3PDWA 2FZCA 4WOPA 3A3GA 5CLLA 1DMSA 4BATA 2ZAMA 3AJAA 1E1LA 1U1EA 2WP8J 3EZLA 1JT9A 1NOJA 4MWTA 4Q4HB 5CYFA 5D1HA 5DDIP 4BDTA 3RUCA 3OE5A 2RGCA 3D2BA 4A92A 4ZVLA 3Q85A 1WB6A 3HR7A 3VA7A 1V1MA 3EIEA 4L4ZA 5JMWA 4YI3A 3DYVA 3ZHOA 3PI7A 4J0JA 4NX2A 1Y42X 2HXSA 4PPNA 5HKLA 3H9QA 1W88B 4UE6A 3ER6A 4MMXB 2X13A 5E0OA 5C8ZA 1F6DA 2X4IA 4K6HA 3CLUC 4PAQA 2MYUA 3VSCA 1A27A 5AQEA 2C8LA 4RZXA 3F3MA 2UZ3A 1Q1EA 1CZKA 2VTEA 3E27A 3OOEA 4ZAGA 3V34A 3EN0A 1ZJYA 2FU5C 3KL4A 3USZA 3LVFO 1S9HA 4B82A 1QVWA 1TTPB 2VIIA 1Z34A 3JY6A 3KIPA 1NNUA 1ARZA 4Q7QA 4ZCMA 4D79A 2PUDA 3A4IA 1XTZA 3GDOA 2CE2X 2HWYA 2A35A 1BE6A 2WIKA 2BGLA 2D1SA 1AGRA 2B0JA 1U0HC 1G21A 1SHUX 1C7ZA 1I4EB 2VHEA 3N8IA 4R6WA 3FF4A 1CIVA 3R5KA 1SCIA 3OQMA 3T53B 3GUHA 4HB0A 1IQRA 3OH8A 2GCOB 1YI2B 3TVYA 1H9BA 3UJDA 4YPOA 1E2KA 2O1SA 3KCNA 3WV4A 1N0UA 3DEAA 3GVXA 4N12A 1Y5RA 4U9IS 1XVVA 1K2VN 2VP9A 1EESA 5TQ2A 4YCLA 3EGXA 1KKLA 1DQRA 1AVTA 3I12A 3KAKA 4XGQA 5JSZA 2VA8A 3K2IA 3R7WB 4DCCA 3OQPA 4ALLA 3ETLA 3ONVA 4NOLA 4UNSA 2GGSA 3RK1A 3FOFC 4DNQA 3H4VA 1XYYA 1YHNA 1NWHA 3EDYA 1UEIA 4BKOA 2O2SA 2DBQA 4KXNA 4QQNA 1OX4B 4ZHQF 1NF2A 3OPNA 4IOKA 4BEWA 1XYGA 1LSJA 4LFAB 5AVTA 1T9AA 1BVHA 4INZA 5SYMA 4XDHA 4GQNA 4L73A 4DHWA 3UPTA 5FXMA 4NYMQ 4YWHA 3THWA 2G80A 4MMYB 2GBIA 2XMGA 3LC7O 2JH9A 4Z2AA 4C2UA 3KHKA 2C4UA 2R00A 3ABZA 3EY9A 3NBZC 4GGOA 1VE3A 1XMSA 3HNRA 4HN2A 3D7RA 2CLMB 4KCGA 4DQXA 2XTAA 1CJBA 4E32A 2C9BA 3H4MA 4EFNA 2ZT6A 2YVKA 1Y9JA 3PE4A 1LTHR 4LZJA 3TZ6A 4PX2A 3GD7A 2UZIR 1P91A 3FCXA 1AS0A 4N0EA 1VCIA 2G07A 4MUFA 3GZJA 3FSGD 2XNDD 3L0OA 2QSUA 1J0EA 2PUVA 2A0YA 2C4HA 4Y6GB 5A3VA 4EGQA 3DXXA 1G3IA 1LJLA 2JHPA 4DIUA 4BFCA 2Q5FA 5CXUA 5KQSA 4TS9A 2H4FA 2JGFA 3OECA 5DH9A 2Y1WA 1FTSA 1I2CA 1GARA 3PCXA 5DX1A 3RT1A 3UGQA 1I3LA 3E9CA 1QMPA 2ZDQA 3DFIA 3EUAA 4JODA 4HDSA 3VZBA 4ALIA 4M1MA 1UJCA 4F6LA 2GTHA 1MCZA 1AQLA 1EVLA 1ZUNB 2B7CA 3BAFA 3TSZA 2V6GA 2ZUCA 3WQBA 2P3LA 1FDUA 1TD1A 4YRQA 3RRZA 3ZX4A 4C5AA 3KEOA 1NQUA 3TR5A 3SU8A 4GKJB 3IPXA 3D3EA 4IJVA 3Q98A 1EMDA 1W49A 4K9MA 5CT6A 5CX1A 1TLLA 1UKCA 3T7SA 5KREA 5FJIA 4OK6A 5CBKA 1JILA 4O0LA 1ZS9A 4FDUA 2HLNA 5BSUA 4TRMA 4N0MA 2I7TA 3LGSA 2CFRA 1QQ7A 2CVZA 5I7HA 4OVKA 3KU1A 1DBPA 4MB2A 1PD1A 3BN3A 5E8JA 3QMWA 5HIKA 1TLTA 1BQEA 3LQRA 3OTQA 5FPSA 3EIWA 1YJAA 5EWMA 1CZRA 4KO1S 3UC5A 2E55A 4M86A 3C15C 1ZCZA 1JA1A 3O8NA 1U2EA 4FJ0A 4P3XA 3RS2A 1UINA 5B1HA 3MWKA 3AXSA 2EKBA 5ARCA 4MHTA 1KIAA 3KLNA 3AP2A 4TKUA 2ARKA 2X3YA 3VR0A 1OBFO 2PH1A 2H00A 3TL2A 2VAXA 2PZFA 2CYCA 5B4VA 5KNBD 2CK3A 1NVFA 2IOFA 4YO8A 4B6OA 4W5OA 3BRSA 2GPJA 1L6IA 4DOMA 1RYEA 4R98A 5IZCA 1OXMA 2X5JO 2ZM6B 8AT1A 1ELOA 4H4CA 2ZRAA 4YLEA 3THOA 4KIGA 3BWVA 5B12A 3G0BA 3QFHA 4NS1A 4YR9A 4PINA 4JDUA 2XUHA 4OKNA 4XSGA 4XFKA 3G5MA 1GG8A 1SXPA 4B79A 1GUZA 4MJ3A 3UVEA 1RS0A 2P9GA 4OIMA 1B8UA 3K92A 1L6RA 2UZ1A 4JL6A 4OXIA 2XWQA 4P35A 4ZJPA 1I1HA 4B43A 2OM2A 4L6CA 1WMFA 1UAYA 4ZOLA 1JHYA 3H0EA 4R81A 5B6IA 4XUDA 2ODNA 4PX5A 1V6SA 1I4OA 1NW3A 1ZMTA 3CZ5A 1LWNA 1ZFNA 4HNQA 5L3RA 1N08A 1K75A 3A1WA 3HJFA 2JHFA 1UBRS 1G2IA 1ZGBA 2IYQA 4X41A 2EJUA 5I7WA 1NQAO 4KYIB 3UWPA 3T0IA 3LX4A 1CUSA 5JHHB 1OH8A 5KQGA 4K9DA 3GH1A 3NB0A 3ZW9A 1MO6A 2J3MA 1TUBB 4DRXB 3BY1A 4IYJA 5JPIA 3CH6A 1MB4A 4PHCA 4ZXPA 1QHHB 4S05A 2WD8A 4EL0A 2H18A 4QBHA 3PF8A 4PC7A 2A92A 3PGMA 1EFVB 1KKMA 2C84A 3U3MA 4YT4A 1Y89A 3D7MA 3PUVA 1TFUA 2J7KA 4UAGA 4AMGA 1TGYA 3FYHA 3NIBA 3ONFA 5ALNA 5ESXA 4QV2A 3PGLA 3BMCB 4YY3B 3PKIA 4BMVA 3MT9A 1O7JA 1GU1A 5TMDA 3ROEA 1EFUA 5ALIA 3W5IA 4PZ9A 1DLIA 4DHEA 4YONB 3KTOA 2RBEA 2DG2A 2Y76A 3QE3A 4B09A 1U80A 3L6OO 1EBFA 4HGQA 4I50B 2C42A 4HGOA 2FA9A 1MB2A 4BP3A 4EY5A 1KO4A 2FRVA 4EA7A 1UBNA 1F1JA 4P3OA 4QO8A 4YNBA 4D9KA 3WLRA 2HCRA 2BKLA 2V03A 1U6IA 2WC1A 4P36A 4X1KB 5ALMA 5FOUA 4L9AA 1NXPA 4Q3BA 1W0KA 1P7YA 2IUSA 2FSHA 3SEFA 3WZLA 1AKTA 1ZNZA 1G42A 1GFIA 3B2EA 3ZE6A 4AJEA 4DSAA 3ELDA 1RNLA 3G13A 4IUYA 4MUBA 1WR8A 2YXNA 5AKJA 5LD2B 2IUYA 1N1MA 5J59A 1XDBA 4TVBA 1SXIA 2BJHA 4E5DA 2COKA 3NHLA 5J1SB 2YJNA 3PVDA 4RM2A 1YBFA 4QDOA 2OCPA 3SIWA 3GUYA 3JWEA 2XE6A 4RD1A 3MLAA 4C2BA 3H9CA 2AOTB 5JD4A 4XB1A 5H5JA 5DTRA 3STVA 4EJMA 3GNSA 3MYRA 4RLQA 7MDHA 2FP3A 3EFBA 4FEAA 5GOZA 2VATA 1X1RA 1MVLA 3JQBC 3V76A 5JBNA 1U8UA 4MUKA 5FO0A 3IQEA 3ZDCA 1NBOA 2ANBA 2BT4A 2LIPA 5CTAA 1DP4A 1T9GS 1X7XA 4AO7A 4RM0A 1MTZA 2JJ1A 5JUWA 4LY9A 2Z09A 5FA8A 1K6IA 4CNQA 5L3SA 2HB6A 4W9MC 1CPYA 2G1UA 4ETMA 1LDMA 2PD6A 3SE7A 1HDEA 3SFVA 1Q44A 4XVUA 2O2ZA 3R9XB 3WLQA 5A1TA 1ZQ9A 2B5VA 4UOZA 3BIOA 4IPTA 3WAJA 1YU9A 2CHGA 3G0GA 1YRHA 1YR6A 2AE1A 5H02A 1M3SA 2QVYX 3AVQA 3Q8MA 3VM6A 1B26A 2AJBA 4G1EB 2W93A 4FD2A 2PZ8A 3EGEA 4OP1A 3T3NA 3WRYA 2JEYA 2HSJA 2Y9PB 3PU6A 3PRKE 4ZA2A 1WRBA 3WJ1A 1FFAA 1OA1A 2FPKA 3AZOA 4B4OA 2BTEA 3U7QB 5FBLB 1JIKA 3OAAA 1F0NA 2BGIA 1CQJA 2P9BA 2WD9A 2O50A 4JEHA 4WY8A 4C4AA 5IFKA 4ZYXA 1ZMOA 3ZLJA 1N3YA 2WT4A 3QVJA 3CS3A 4KXUA 4PZYA 1W5BA 1JJFA 2D2XA 1HYEA 3CNBA 4MI9A 2ZBFA 4PCAA 2QX7A 3GLVA 3X3HA 4B7UA 1XZGA 3ZHUA 1M6YA 3ZDXB 3PJGA 3DFMA 2CDCA 1DQSA 1HV8A 2LTAA 1G41A 1UDWA 2Y8EA 2YICA 2XE4A 3V2HA 3KOWA 5AJHA 5JLJA 4HDCA 4KQCA 3FX2A 3GRPA 5DLDA 1J06A 3Q7EA 4GKBA 5I7AA 4FYKA 4MO9A 4QU9A 1YZLA 2QRJA 2IHYA 1LFAA 3FMIA 1NSTA 4HAIA 1QQ5A 4PC1A 2NTNA 3QVSA 1IHDA 1TZCA 2B34A 4IDBA 3FVVA 4JN6B 4C0JA 1WZ2A 3A4YA 3OOWA 3EWSA 5BQOA 3KO8A 1IQ0A 2B3DA 3HJRA 1AHPA 4E5UA 2XEXA 3EAGA 2WJZB 2Z5FA 4EATA 3TN7A 3BKWA 3BOSA 2HK7A 3UHJA 2VQSA 1M0SA 2YJ4A 3EODA 1GEEA 1P7PA 1QONA 2XY4A 3HXKA 4MAAA 3U1VA 4Z4QA 3CYFA 1ZU4A 3M34A 2JZNA 4DXAA 1NMXA 4RY8A 1EVIA 1B16A 1YQ9A 3HYCA 4LQLA 2E82A 4NFLA 5FL7D 4CDNA 1SUDA 4E2ZA 1EIWA 4V39A 4CM3A 4DXHA 5DJ5A 4RTSA 3W5BA 4KKVA 1WE2A 2RE8A 5DX8A 2KLBA 5F2EA 3G6EB 2B4YA 2IIVA 4GMDA 3RVNA 2P9ZA 3FMGA 1R10A 1T8WA 5AJYA 3ASPA 1O3YA 1WUHS 2ZYTX 1D7OA 2XMPA 3PXEA 4GE3A 1N6PA 4FCWA 3OY2A 2D5AA 4ZTZB 2IOHA 4X7BA 5ITVA 2BGWA 2OWEA 1YJXA 3UK6A 3UXHA 3UW1A 1E3SA 5L8VA 5BN3A 2QTZA 5CCDA 5ULLA 4D9CA 5AW9A 3WP0A 1NXQA 1B93A 4PWZA 3SEAA 3CKKA 2YTZA 3MELA 3TAXA 3FN4A 4DK1A 5HMLA 2VPQA 3PUNA 3N2GA 2CNBA 3DCNA 4JQOA 1UK9A 3G2JA 4CJXA 4DTCA 2CSXA 3BWXA 2V3VA 3OPYA 3IV6A 1L7EA 1LPBB 5KU7A 4BIIA 3MMXA 1E7QA 1L8OA 1TYDE 4WBXC 4OYRA 5ADVA 1OFGA 2PJUA 3QI2A 4LDQA 4MQLA 3TUJC 2DC1A 3O2QB 3RRNA 2OV2A 3G0OA 3W8RA 4ARAA 2OQIA 5BSVA 2VPYA 3DDYA 1LK0A 2A6PA 2EV9A 2W71A 1MOPA 2DFNA 1XEFA 5EFZA 3CGWA 2H85A 1NW6A 5FRDA 2DFLA 5BSGA 2AFIE 3T3OA 1AF7A 1W34A 2NYRA 5ER9A 5FTWA 1OXTA 3CEPB 5IYQA 3AVXA 2EJVA 3NDBB 3WGHA 5KOJA 1RHMA 4GMFA 2A3NA 2BFPA 3BD7A 1Q74A 5IDYA 3TPCA 2ZB4A 5DV9A 4G36A 4NYIQ 3M49A 4OHYA 4DNRB 4NAVA 2VT7A 2MSNA 1X0XA 2X5KO 2UAGA 3JR7A 5H0IA 3IGFA 1AURA 2D59A 1RWMA 2WSLA 1XHFA 3BA6A 4GG1A 3FMPB 2PBFA 2NZXA 4TLEA 3GEDA 4CEJA 2PYIA 5AOBA 4XLFA 1U94A 3ILXA 2JCBA 3HR4A 4M1ZA 3PJFA 4F46A 2JH3A 3LA6A 2FLWA 4YP0A 4DIFA 3R3HA 3IUJA 4JL8A 4A03A 3OQBA 1SXJB 4MRNA 4TV8B 1W1UA 4XB6B 3O2NA 3OZ7A 3B82A 2C7QA 2Q1WA 1C3VA 2AC2A 2R6R1 4LRYA 2MTBA 4TX1A 2CLEB 1B4DA 1PDVA 4I4NA 1CUEA 4QUKA 2NXEA 3SJAA 2VNAA 3QU2A 4N82A 1CT9A 4AZTA 4Z9BA 1LVGA 1WSAA 4BMOB 4QAQA 1NXSA 1SHJA 2QOEA 4MV7A 4ED9A 5FOQA 1CNEA 2MT9A 4J1NA 5F1YA 2HSEA 1F2TB 3S1AB 1MEOA 1TRKA 1ABEA 1Z28A 1UBLS 4ZT2A 4ZI3A 3T12A 3GGOA 1KR2A 1BXGB 4M0KA 1AXGA 1UMKA 3OZSA 3ZWMA 4DNFA 4NMMA 4U1RA 3TB4A 4F2GA 2C9OA 2RGBA 2Z4RA 3QF7A 1Y1LA 4PBSA 3K70C 3CRW1 3MOIA 1OMOA 2ZUVA 3AFNA 1FFWA 3CG0A 4Z8XA 4R0VA 2GBPA 1E89A 1JWAB 4XYMA 1Y0BA 1YK0A 1SBIA 3WY9A 3PFBA 4AWAA 4BVBA 1Y8QB 4DNXA 1U3UA 1GUYA 2JFFA 2Q3BA 2BF4A 4PM4A 1DOZA 3V9AA 4ZYUA 2B5WA 1P8JA 3OIDA 1YE5A 3GAMA 3GEIA 4LCBA 1A4XA 1I5OA 2NTJA 1F7VA 1F4LA 2OYNA 4AURA 2IYOA 2J0QA 2AEMA 1DLJA 4JBXA 3UMMA 1WSVA 1P33A 2ID4A 9LDTA 3U7HB 1U63A 4P33A 3ITEA 5JXIA 3KQWA 4DR5B 3LF1A 1OTYA 5I9TA 2JHGA 3AG5A 4U5XA 1I6MA 1Z2EA 4BEVA 5FOTA 2I4MA 3ESRA 4IUBS 2P4HX 5FTJA 3TLEA 2L19A 4O0MA 2ODTX 4N3GA 4B35A 4LJ5A 4MKIA 4ZDIA 5KMGA 1CDDA 4ASUA 4DMMA 3A36A 3AF3A 2ECKA 4FNAA 1HT2E 1NBMD 3DBHA 2VYND 4LF7B 1NN1A 4EMSA 2H5IA 1JPJA 3P4XA 1XRSB 3EEIA 3ZTTA 2A94A 3IUBA 2NUPA 3IV9A 5FBQB 3UH0A 1BVYF 3CH7A 1LSSA 4RKQA 1IVNA 3ROXA 4P9SA 2HIHA 4C04A 4UDOA 1ZHFA 1ZGGA 2YDXA 4JKIA 3X1XA 1F8XA 4GOND 3PHGA 1CDEA 1LQUA 2C1EA 1NLZA 4MVJF 1CY2A 1NV8A 5ENVA 2G40A 3CUWA 4Y6PA 1E4VA 3WQRA 3C7CB 1OWOA 2WE7A 3CTMA 3NOXA 3P9YA 3Q40A 3N58A 4LTNA 4QBFA 3IJPA 1XA3A 5IJAA 3M1AA 2IPXA 1YB7A 3D2AA 3DXZA 2OE2A 2PS9A 1PJSA 1YE3A 2LV8A 5LBTA 2XCOA 1CBUA 3OT1B 2QRQA 3PBKA 4LQCA 2ZJ4A 3UB3A 2B1QA 4V38A 3ZNQA 3BSYA 4L5AA 3R0VA 3ZXUB 3JAWB 2P67A 5KJ1A 4B6PA 2G72A 2I29A 5K99A 2IOFK 1ZUIA 2OTCA 2QMOA 1X94A 2D1RA 1F7UA 4UU0A 1OY1A 1SUEA 4BP1A 3EH1A 1M1UA 3GMDA 3M5PA 4L3WA 1T6YA 4DRZA 3LIIA 3ZWKA 2ZRKA 4ALJA 4JP8A 1OT3A 1R6XA 2GH1A 1JTFA 3EBPA 4GAEA 3RPEA 3B85A 3MWYW 1LNZA 1GGJA 1K5HA 1TMGE 2NUTB 2DFVA 3DQQA 4O2BA 2VCYA 4XYEA 2C4WA 4BTVA 4NECA 2J07A 1BWQA 3QBTA 1XV5A 2PUJA 1KP9A 1K7XB 5F1PA 2GHTA 4Y2PA 4XQ9A 1U2PA 2VJAA 2NU7B 3DW3X 2Z9BA 3K94A 1Z5VA 3KZXA 4NQZA 1VZ2A 2WY2D 1OVGA 3G4SB 4Z9FA 3VSEA 1KI6A 5B53A 2W70A 3SQXA 2GPAA 3GFGA 2H7CA 3ZQKA 1VB5A 1E43A 4G81A 3W2IA 3G5LA 3SOZA 3B1JA 5C7YA 4F9GA 1GQYA 3K2QA 4ZI2A 6AT1A 3P2MA 5GONA 3FXAA 1B0PA 2DJ5A 1QVVA 2J4DA 2YV5A 4I8DA 3TJRA 4BNIA 4JI2B 4RD0A 4UNIA 4MV3A 3SN6A 3WMFA 1U0RA 1JIQA 4PG5A 4DDVA 1ND6A 2I1WA 3LWZA 1V2HE 5CLFA 2AKAB 2JGRA 3TRDA 3MJ4A 5JBIA 3R09A 1G4HA 2CJYA 2HPVA 2IIBA 1YJBA 2OYCA 1VJTA 2WAXA 3HO1A 4BNUA 1A5SB 3HSSA 3ZHCA 2YCLA 3KWJA 5AMXA 1N5RA 4MUHA 4DMKA 2DMRA 4Z4GA 4OH7A 5IDQA 1ECLA 1GD1O 1RYDA 2X0IA 1M1KD 3LDFA 3HCFA 5LZ4A 2OA0A 3O9MA 4W1RA 2WU0A 4G3XA 4F1WA 1SM4A 1Q7CA 2BM1A 2C5EA 3CBQA 1T1SA 3DFKA 2NPFA 4RACA 1YA4A 3VR2D 5D6OA 3O3NB 5J2TF 4LF5B 2I03A 3IURA 2IDKA 1S8AA 1JMKC 1IBSA 2XUQA 2ZSFA 3I76A 3NBUA 4FHZA 3OHMA 4QLOA 5CHEA 4A5OA 1AXRA 1QJ4A 1A71A 3GPBA 5K0GA 3IPCA 2J5QA 2EFJA 2NQ8A 1ZCAA 3LXMA 4Y2HA 4EG1A 3BB3A 3CP8A 3ZS9A 4QPJC 1CRQA 1YOVA 2AG1A 2Q1YA 1W1IA 1VM6A 2O8EB 1KGDA 4F86A 3VQTA 2IHNA 2RC6A 1QRUA 2ZPTX 4F9EA 5K8CA 2BFEA 2MSCB 2WZNA 3HL0A 3T61A 2I67A 4NXNB 1N6IA 4LXUA 1PJAA 1X7XB 2QN1A 3OF3A 5IH7A 2HI0A 4QU0A 4Q1EA 1XQWA 2K6GA 1ECJA 1VKRA 1H5UA 1X1BA 1X7YA 3KUCA 4J4HA 4DR3B 1R50A 1G1MA 3N5CA 4JAVC 1FMFA 3BMXA 3GUCA 4L02A 3AYXB 4HBZA 2HH9A 2YRWA 4Q01A 4QXRA 4WBNA 2QM7A 4R8SA 3ZJTA 2JD1A 3BIWA 3ZH9B 1CEYA 2A0UA 4XN0A 4A2CA 2FOLA 3V8QA 1I3MA 4HV4A 5KBYA 4R40A 3AP1A 2PE5A 4EYSA 1EVKA 3KOOA 5E38A 1Z0JA 3KUKA 4D97A 4OYHA 4QFDA 5CVUA 4ND8A 3OLYA 5CLQA 2XYRA 3C0KA 4OXRA 4PU0A 4WLUA 1EXWA 4F11A 4PYLA 4X44A 3WWZA 2DWPA 4O4JA 3UICA 2VEDA 2WU3A 2A9KA 3T0FA 1NL3A 2WSSD 4LIPD 3U17A 3RYCA 3UQZA 4X1KA 1A2BA 2SICE 2FV8A 4JK3A 1PQPA 3QV2A 2RAFA 3U3JA 2P69A 4AO6A 5A04A 2R7KA 3PFHA 3QKSA 3M6UA 3N2NA 1NG1A 4RW0A 3R3UA 3G2QA 3MMPA 4XKJA 4J16C 4EH1A 1NP7A 3SDZA 1QFMA 1SCAA 3AF2A 1QGZA 3DDCA 3G1WA 4KPUB 3AHEA 1NU8A 1C1XA 3QVGA 4YIKA 1JXMA 5KC9A 3RAFC 1ADYA 1B0UA 2CXQA 4NBWA 2HSDA 1YVRA 2G1KA 5IK2D 1DWPA 1EFHA 4HAYA 2DYKA 3SQLA 2QI9C 3PK0A 4JI0B 1W76A 2EW8A 4WZAA 5LXTF 4B7ZA 2SCUA 4UTRA 1WCIB 4JP3A 4Y1RB 3CCSB 2JCYA 4DGSA 1EVEA 1IXRC 2IZOA 4CF5A 3OQHA 4EFMA 1SVMA 4EYOA 3GAZA 4XGIA 3N59A 3VYUB 4P2BA 2PDAA 3D43A 4O4HB 4PO8A 5BWNA 1M73E 2CK3D 4HFJA 2VDLB 1D0VA 3GIDA 3EW7A 2X3UA 1ZZEA 3E5MA 3N8HA 2WWHA 4DQVA 4O1IA 1K9MD 2AR9A 2VN8A 3GBSA 3KSUA 2ADMA 1Y5LA 1JAXA 2G28A 3MPOA 4U6QA 1MXHA 3E0XA 4GR4A 5EUQB 2OVBA 1JT2A 3C7KA 2W9XA 1H2BA 2GM5A 3EE6A 2ZT7A 5FQNA 3IEPA 1R4MB 3N0TA 1Q0PA 4G26A 4DB2A 3MJCA 2GF9A 2YV1A 3ZXXA 1GR0A 5C1PA 5HTOA 4UEWA 1RQPA 2QQ0A 3CRRA 3LT0A 4XIJA 5IBQA 5P21A 3TNFA 3FUXA 4B3MB 3FLMA 5ALDA 5EIOA 1R6UA 1M6VA 5HIMA 3ZVNA 3PB3A 3VHQA 1Z0IA 2HJHA 3EXEB 1H3EA 1CG6A 4QTUB 3OJLA 4MLCA 1OREA 5C31A 3UV7A 3K6KA 2JGEA 3QFTA 1F4VA 2GWRA 4F21A 1I7PA 2Q1UA 4GLJA 5PGMA 5EEHA 4YRKA 1OB5A 4JKOA 2ONKA 1JQBA 4HXYA 3T41A 1ACLA 3WLTA 1U0SY 5IEBA 2E2WA 2YYZA 5BWLA 5CIYA 4NCKA 4I0WB 1OPXA 3AOEA 3G23A 3MC1A 4HYQA 2A5JA 2XV1A 1QFXA 1W73A 2YFKA 1XTQA 3KKLA 3QYAA 4AZWA 4II3A 3I9MA 4H17A 2X8JB 4C76A 5A02A 4JY7A 3LQ6A 3UKDA 2EP7A 4ZEVA 3JQ9C 5K8TA 3FDJA 3FPJA 4JI8B 4R1SA 2NZ8A 2PVCA 4C5BA 2H9AA 3BZBA 13PKA 3L06A 1XMJA 3TL3A 2JRCA 4N40A 1OFUA 3W1WA 1P1CA 4JR2A 4R3NA 5H1YA 1U28A 1Z0DA 2V74B 2DKFA 2Q1XA 1X15A 2FZWA 4MYHA 4QGBA 2FK7A 2IZ1A 4YJFA 4ZOCA 3RANA 3H05A 2HWKA 4EMTA 3S8MA 5JEEA 1GKYA 5I01A 4MQEB 5KYNA 1QGUB 1WY7A 1FP4A 2X0FA 1EBBA 2Q7XA 3JPYA 1XZBA 4KXYA 4R1TA 3ELUA 2DERA 3LKZA 5HBRA 2LP4Y 1IRXA 3BHJA 4PGAA 3VTKA 2WKQA 1J00A 2ZIAA 1DQPA 1H4VB 1DFHA 2P3QA 3SKVA 2J85A 1EP2B 4AAYA 4KXVA 1N32B 4QOFA 5DHFA 1QH9A 3KL9A 2SECE 3L43A 4HEJA 2J3HA 4PZAA 3VU3A 3F5SA 4P81A 1Y9EA 4LJSA 2RCYA 1XQ9A 1OYOA 1Z6YA 4X8LA 5AXCA 4GGPA 1RYHA 3N05A 4GU5A 4UUBA 3EZFA 4I46A 2J5RA 3A9UA 4CM8A 3LPLA 4HAWA 1Z25A 3OURA 3UT5A 3LOPA 2DULA 4I3FA 3FETA 1OLOA 1N06A 5DI3B 2Q3LA 1BRMA 1TO6A 1R12A 3RUFA 5DSTA 2XBMA 2H4YA 3KE8A 2NSYA 3QUCA 2I71A 4ZREA 5AOCA 3UG6A 2D3NA 1PJTA 1P0FA 3K6SA 3DYIA 3KYJB 4UEOA 3L7IA 4H35A 2E87A 1LLUA 4KIUA 3QLJA 4AIRA 5K8IA 1MENA 1EXDA 1W8DA 3LH5A 4HZIA 3QU7A 1KA9H 4H1HA 4IVNA 2VJLA 4XTRA 3RO7A 3E8SA 1RIFA 4F3RA 4BWVA 4Q0MA 3EF0A 1PZHA 2F1HA 1S89A 5C8YB 4N49A 1IEQA 1PR2A 3PC2A 1W581 4HXGA 2P2ZA 4LHZA 4KLNA 5IVPA 1MN6A 1VDMA 3HA3A 2H17A 4FVTA 3HMQA 4DLXA 4K9RA 5TJ9A 4C87A 3UT5B 3V4VB 2O7NA 3Q15C 3S2IA 4DIKA 1E6LA 1DC4A 1LVUA 2K4MA 3H5VA 1PJ4A 3L1JA 3TYXA 3NWJA 4S2UA 1K2WA 2IYRA 2PG3A 1I33A 1YQTA 1OPRA 5EYPA 3WNZA 4ZP1A 5I7OA 4A3SA 5EZYF 4CIYA 4BFVA 2ECPA 2BH2A 4CMEA 3NVMB 5J47A 1XKLA 2CXSA 3AMVA 3QUTA 2FW7A 1AQUA 4RCZA 3EVTA 4IWYA 5B7QA 4Q3DA 1X7WA 5LDHA 3S81A 3KEFA 1NA5A 4AJLA 1DTSA 1EFRD 3SBXA 4NJEB 4CM5A 1I7DA 1SFRA 2O2IA 3NV7A 2QTAA 1E2NA 1TMYA 2WJ4A 4LFCB 4LRSB 4R8RA 1PT9A 3LCJA 5AW7A 1MH1A 5EUCA 3TGLA 2X6XA 1G3MA 2EBWA 2V59A 1CW2B 4IS2A 2Z8XA 1KE2A 1M0TA 4AJ4A 5FOSA 8ADHA 1CLUA 1E1QA 3E5NA 2JBAB 4PR0A 1UJMA 2ZRNA 1NWCA 4BMDA 1V39A 3X1JA 3C85A 3KT8A 4HUQB 3ESBA 4PLTA 3BXEA 1Z36A 3FCSB 121PA 3A6PC 1BFKA 2J9ZB 4XLEA 3F6BX 4OI4A 1ZSNA 2OOSA 3IUPA 2GRJA 4LNUA 5AXDA 2PT6A 3PHCA 2X8KA 2EQ5A 1OFHA 1PJ5A 5E4FA 3PT5A 1V1RB 2R3SA 4ZOLB 1YZQA 3FOWA 3OOYA 2AJLI 1SHZA 2R62A 3IDAA 1FUYB 2OPHA 1MVNA 4Q5IA 4AB1A 2CHUA 3A1VA 4CMJA 2OQRA 1J9ZA 2A57A 3SGLA 1DJOA 1RRVA 3E2PA 4QEZA 4CCYA 3IE1A 2GM4A 5BSEA 1AT1A 1VSUA 3ORHA 4LGVA 3WL7A 5HW0A 1LW7A 4BLUA 4CMIA 5EKDA 1YBMA 3ZHVA 4DLLA 3FOZA 4XN3A 1NAHA 1OFUX 2P4EA 3LMKA 4JJKA 4LMPA 3HJGA 5D3MA 3TLKA 5DTJA 4AU1A 4C0KA 2OSBA 4NAHA 3RS9A 4BQOA 3B20A 3I2KA 4KBYA 4FWTA 3O4JA 1V5EA 1M5UA 4YRMA 5H3LA 5LKRA 4L3OA 2PX5A 2QMQA 1B6GA 2R1TA 3EHDA 3IE0A 2YIMA 3K20A 1D6SA 4IQ4A 2ZR8A 4PWYA 5KYWB 3SJCA 2QMYA 2EDAA 1LLQA 3A3KA 4M38A 4RTJA 3TW6A 1SMKA 3FCOA 2QZ4A 4Q4AA 1FYVA 2BFCB 2G4VA 2Q1TA 3P4YA 1EKXA 4L8GA 4CEHB 2ZYAA 4ZK2A 2RGGA 1EX6A 1O6FA 3PGVA 5AK3A 1C3EA 3OA2A 3A4TA 1YI0A 2NG1A 1GADO 2PEYA 4GBED 5D1NA 5EQFA 3G5UA 1YR2A 4OJNA 5IBPA 5CDHA 4ESVA 3UYLA 3DBOB 1X3SA 4MPRA 4WD3A 1O94A 1L7MA 3VR6A 1SGWA 1FCJA 4G0OA 5E3JA 1UJ4A 5KS2A 3P2IA 2PBLA 3JAKA 3LCCA 4I9HA 4Q1AA 2XCSB 1W36B 2C97A 1HFJA 4ZEMA 2IU6A 1O77A 1MU0A 3COZA 5EMKA 3AHIA 4E3ZA 4L0DA 3TMYA 1DAPA 2O2HA 4YUYA 2FE4A 3FIUA 2OCGA 4B84A 1PTKA 4NU6A 4XGNA 3AKEA 5DGHA 4OA5A 4X20B 2Q9CA 5C4GB 3VJKA 2G25A 4MPPA 5EC8A 3RYFB 2VJDA 2W43A 5CVCA 4FE4A 3ZY6A 1D1NA 2CBXA 4X1OA 3WLNA 2VL7A 2ZYRA 1AZTA 2X0EA 5LZ9A 4YCDA 1VRCA 1Z8HA 1XZJA 2ZEJA 4KZKA 1Y37A 2P2LA 4MUXA 2GHIA 1C9NA 1MPXA 3I05A 1QKJA 4OCZA 1H42A 2Q2NA 3HLYA 1OX5A 2FW9A 3M70A 4RWZA 3UOAB 5JY6A 1H5NA 1Z6ZA 2B94A 3GDFA 4GFDA 1D1SA 3S2YA 4BNZA 3GLIA 4Z4TA 2L82A 1W2HA 3JZFA 1JV2B 3C14C 3MWLA 1GXSB 3VI3B 4D5GA 2ZRBA 1UMDA 3KQYA 4A0FA 4Z1MD 4B3BA 4JHXA 2ZBQA 4K9NA 2NUAA 3EUEA 1VPEA 5IAEA 1F12A 3CRQA 3MQFA 5AVRA 1XNRB 4E70A 3ERCA 5T4HA 4AS1A 4B0PA 3NJRA 3T1HB 4J4TA 1A88A 2VP0A 3ZV3A 2BN4A 4FMBB 1NE2A 4KIJA 1SUAA 3KPVA 1D2MA 3ONUA 2MR6A 3TBFA 1NN3A 1PS0A 3IKVA 2G36A 4LI0A 3K6SB 4EW1A 3DMTA 5AW4A 1GTSA 6ADHA 1O87A 1KWGA 4DANA 3SKBA 1DFIA 1P80A 1X6VA 2ZE8A 2D0PB 4CKBA 2X76A 3I42A 2E4AA 2R7MA 2IS1A 1JTEA 5IP5A 3FPPA 3PIDA 4J90A 4NJMA 1UXJA 2BBTA 1GZ4A 4UUMA 3C3EA 3SXUA 3WTCA 1DIBA 4HX9A 1KQSB 2GXQA 3K4HA 2X6TA 1CJTC 1QTRA 3NTVA 3Q3VA 4QDXA 4RJ2A 4BYGA 1N6LA 1R15A 2Z2YA 5A4MS 5ECDA 2BHSA 2NV2B 3WHLA 721PA 1JU3A 5SY4A 5LSAA 4WNIA 3FWPA 1CDOA 3QHAA 5AT1A 1XE3A 3FG9A 4ER3A 5HJ5A 1OBHA 2EX0A 4KPFC 1N2CA 1Z7BA 3PCTA 5KJCA 3L8YA 1VJ0A 4E1BA 3KEQA 4JJAA 4LBYA 2J45A 2FP4A 1VRVA 3L6DA 2G1PA 2Z6BD 2FZLA 1R8YA 2X53S 5HBGA 4KLRA 2REBA 1CNMA 4X93A 2DWCA 1FSZA 2GKOA 3LNTA 2ZZNA 1BCSA 1NYLA 2OAEA 4P4SB 3EYAA 1NRXA 2TMKA 1ZSVA 3R3XA 1L7AA 2Q50A 2X8LA 3PICA 5HQ3B 1FDRA 2WV7A 3ZU2A 3L9WA 5TY0A 4N76A 1LPOA 4HSGA 3L7KA 1XZEA 3IIKA 3I1FA 4DG9A 3RSCA 1UKYA 3ME5A 1XRLA 3R76A 2JH8A 1TTTA 1KIFA 3I39X 2OHGA 3I58A 3ZE1B 1JFFA 4HPXB 3ZQ6A 5MHTA 2MSWA 5FYDA 3WRVA 2XEDA 3OLZA 3H7IA 3Q10A 1RXSA 4FC7A 5TJHA 3ZV7A 1M2HA 2V5VA 4IUDS 4DWVA 3Q3AA 4I5EA 3WWYA 4EHJA 3G2PA 1EQUA 3BFXA 3EQ8A 1AB6A 2ZU6A 1F5NA 2OQ2A 1RPZA 2DKNA 2I2XB 4EUEA 2NWQA 1V4VA 3QLEA 1S3FA 1QV7A 1XAHA 4CLDA 2D1TA 4J3JA 1FU7A 4GNRA 2I3DA 3B89A 4QO7A 3C6ZA 1B8NA 5JWOA 1R6AA 4ICIA 4HB4A 4L74A 4X24A 3U4GA 1XEWY 4H3HB 1N4AA 2VZLA 1KMCA 1WVGA 3DYBA 1BX3A 3DAYA 4Y2VA 4Y1GA 3IKMB 4GKVA 1LD3A 2QLNA 4ZGWA 2F1IA 5F9HA 4Q24A 1JSZA 4PNPA 4Y6OA 1QS0B 1AMOA 1J0BA 4NXMB 1CC1S 4O02B 5AW5A 1FC0A 4ZK6A 1WMBA 1XRNA 4OGWA 4UTPA 1YZUA 1HNZB 5B3LA 3RYHB 1C0EA 3FZNA 3PUIA 3MJTA 2JHAA 1CRWG 2GZ1A 5C4IA 1W44A 1IXYA 1QIEA 1L4EA 1F8GA 4UCXA 3UMFA 3F7TA 2VDRB 1AH2A 1WZUA 4EF4A 4CG0A 2V98A 5J4LA 1C3JA 2ZXIA 1NI3A 3E22A 4LZOA 4YDQA 4O4HA 1IAVA 2WP0A 2RB5A 1E2LA 1FYDA 1JRLA 3UWMA 2Y4OA 5AD1A 2FZEA 2PO5A 4CM7A 3MWEA 4XRGA 3JASB 2GD0A 5C18A 2XADA 1E3LA 5T64A 3ZDFA 1SKYB 3J7TA 5LJLA 1KBZA 1SU6A 1YBHA 4TM7A 1KTVA 3RFUA 1WULS 2R8PA 3ZJVA 2B25A 4Q18A 4HBGA 2CY0A 2I7CA 4KK3A 5EINA 1LS6A 2P65A 3SLKA 4C3ZA 1YS6A 2WJ6A 2XYPA 3BMQB 3PC8C 3QMPA 4JLPA 1GL3A 3FCCA 4L4YA 5IHPA 1QQBA 3M1LA 3W6NA 5KNBH 1SEVA 2NUPB 5THQA 3GJYA 2QRVA 3PQ7A 1Q17A 4QVAA 3O84A 3K5HA 2HRDA 1U8FO 2OYSA 1KPIA 1SB9A 2XUIA 4HF7A 4AXBA 2AQHA 3HUTA 3R2JA 1E1CB 4IKEA 4R16A 1E66A 3MXOA 5HK8A 3VPSA 1QH1B 2BSXA 2HIAA 3ENNA 5DN6D 3ZJUA 1O1YA 1BWRA 1L4NA 1MABA 1M8PA 3EPPA 3F9CA 2IHKA 3OZEA 5B5SA 4ER6A 1M34A 2VHTA 5LBUA 2BGGA 3PWKA 1CX9B 2AK2A 2P9YA 3BJEA 1BA2A 2X41A 3N1UA 2JIOA 2JFPA 5H59A 4M0FA 1IHUA 3KUUA 3QBEA 4NC9A 2GVNA 2VUIB 1WBDA 1AF4A 3RV4A 2B7BA 2FWAA 2XSZA 1KYYA 4CR6A 1KVQA 2P9JA 5KDDA 4G0VA 1WAMA 3GOHA 2J9FB 1H2FA 1TJ5A 3LUFA 5BV2P 4BOYA 1HRDA 5CDFE 4DMCA 2ROQA 3HDHA 1QCCA 1T35A 3FAZA 3H42B 3IL2A 5LQRA 3UK1A 1UM9B 1N6RA 3GFFA 4JVLA 1TYCA 1U7ZA 2RHOA 3KDPA 1JIIA 2FJPA 5TVKA 2QRMA 5IH3A 4RD6A 1NUAA 1VQ5B 1N2HA 4F04A 1G66A 2GCEA 3ZXIA 4CZ2A 1WTHD 1V3QE 1FQJA 1ZVMA 2JHCA 3OUZA 1CUXA 1RI1A 4OF4A 5KSZA 2CD7A 4OI0A 2UZAA 1SZDA 1XELA 2KWIA 3DAGA 4L8FA 3E15A 3H19A 1BVUA 2NYUA 4M0EA 5CNJA 5ITWA 1G3UA 3V46A 1A7UA 1THZA 2YMQA 1KQ3A 2VKQA 4DMHA 5DMHA 4M1QA 2HSGA 4J03A 2ZM5A 4IL5A 2G71A 2RH9B 3EG9B 3FYTA 1VL8A 1DJNA 2LWIA 1BMFD 3HU5A 4V0ME 4A73A 1YL7A 3KQVA 3SKYA 3W8NA 1E98A 3FNRA 3PR2B 1GPJA 2VO1A 4GQIA 5MF6A 1P77A 2P6PA 1VIVA 2H1WA 3DBLB 3QX9A 4NCAA 1QIKA 3AU9A 2V9ZA 3IBSA 5KEIA 5JNLA 4F5YA 2WVGA 2ONYA 4A1FA 4J7UA 4G6ZA 7AT1A 2J3JA 1NQXA 2XDAA 3EF1A 3GJ4A 4CKCB 3H0CA 2C2BA 5IKMA 4IIGA 4DCJA 3WQZA 4I5GA 4PFKA 3LRTA 1YXMA 4EP1A 3VDQA 4OAPA 3RWMB 4I08A 1T5OA 4W7SA 5A6SA 5GJWC 4EA6A 2G17A 2WINI 4PW0A 5KKNB 2WTMA 4WZLA 1BDMA 1J2UA 2NZWA 2YW2A 3GPIA 2VOJA 2YZ7A 3WZ2A 2EP5A 5KAMA 1H2WA 3VDMA 3ZJ4A 2UU9B 4OQNA 3HM9A 3UM9A 2HJSA 2OLEA 1EDEA 3BXHA 3QKWA 5IYRA 1FLVA 4DTIA 3JQ8A 3ZN2A 2BKXA 4AN0A 1NURA 4RVDA 4BO8A 4LA4A 1NE7A 4YMLA 3EARA 1Z17A 4IMJB 3SYTA 3ASSA 4TKMA 1TU0A 3GPCA 1B8PA 1USUA 2GBGA 2WTBA 3ADBA 3EIHA 2BEJA 2FN7A 3IUMA 2G70A 3DONA 2JGDB 2OO5A 4TTSA 3DZKA 5ED0A 3SX2A 5UKDA 5CNKA 4DT1B 1AZLA 1QKKA 1R9MA 2O48X 1OQAA 5KWVA 1IPHA 2HNBA 3I5YA 3N2LA 3V7NA 2X5NA 1SC1A 4INOA 1RPAA 1DWUA 3PC7A 3DQZA 5FBHA 4FWBA 1I0IA 2VJQA 4UE2A 1G2QA 3PHHA 3IOCA 4HIZA 5JNVA 2YW9A 2YWCA 2YJ3A 4CL2A 1R8JA 3D8TA 5E4YA 5EIHA 1FS6A 1G9TA 1GFZA 2R87A 1XLVA 4Q9JA 3AUKA 2B35A 4L9WA 3HL4A 3JARA 4KFRA 5DW0A 1AUQA 5B3AA 2EZUA 3VC3A 2PH5A 1QYVA 1R9JA 2YMMA 1Z18A 3M6WA 3MPUA 3OLXA 4FLEA 1B8VA 4JDPA 2VHUA 3PI6A 5AVXA 4QUAA 5FO1A 5JRZA 2ZYGA 1QP7A 1J9GA 4KOEC 1XP8A 5E7MA 1ES9A 2JLCA 1V43A 4M87A 2BTOA 4B40A 5E9WA 4Y98A 1H4QA 2AB0A 2QZ9A 1BMDA 1KDTA 1V7QA 4N3AA 5J3OA 1EFAA 2IF0A 5CT4A 4DM4A 5FQOA 3K8OE 5FTLA 1T36A 1MJFA 2GEFA 3LYUA 4GSYA 4ALNA 3JYPA 4R9VA 2ZUEA 4L6IA 3SMQA 3D1VA 4W63A 2RGDA 1J1UA 4FKMA 2MJLA 3SIRA 4DA6A 4KQ1A 5CBPB 2AUTA 2ZIEA 1BW9A 3DE0X 3KKMA 1F0PA 4PG7A 3W7AA 2EIHA 3HADA 5EMHA 1XAIA 3W6PA 4D0RA 1T6XA 1JJAA 1X80B 2NVBA 3U3XA 1OXXK 5E95A 4Q3NA 1QYIA 4N5HX 3RU2A 1PT5A 1WP4A 3SJPA 3D0QA 1IUKA 1BDBA 1Q3KA 3DPUA 4FQ5A 2JGDA 1K6EA 3G79A 1ZL0A 1I1QB 3D64A 2GN8A 4DEYA 3CXUA 4HLDA 4YJKA 5HIIA 4OSOA 4JI7B 2EWVA 5DHAA 1E5DA 3RKSA 2XXAB 4Z0HO 1YIOA 5AP9A 2C94A 1UP7A 2PR2A 2E5FA 3ZIAA 1DG9A 2JFNA 3DV2A 1UDXA 3L5OA 4GPEA 3V48A 1E59A 4A82A 4QKQA 2ZZEA 3X2FA 4HDKA 2CLLB 5ICFA 4OOSA 1PZNA 4IIXA 2A58A 4FT2A 4P7JA 1YS2X 2FXIA 2Z1DA 2ZRGA 4R2MA 3WDMA 4V0KA 3M82A 4G4SO 3QFCA 4XWYA 2Z5LA 3PL5A 1FJXA 2P4QA 2GWHA 2A33A 2X86A 5LA6B 4PSAA 2RKBA 5AHKA 5K6AC 1UWCA 5EP2A 4MGEA 1NI4B 3RUAA 1WOSA 2XUFA 3ZG6A 3A31A 2CHQA 1CUYA 1WCV1 1H2EA 2PA3A 2RG7A 1PGJA 4RNDB 5E1OA 3T7TA 3TLXA 1ACMA 1N2CB 3GA0A 2ZRFA 2Z3VA 2CDNA 3BH0A 2QB5A 3D4BA 3MLEA 4Z4VA 2BE7A 4MW5A 4OQ4A 3HY6A 3O95A 1XZMA 3GLSA 4ILKA 5DFAA 4IZIA 2QKYA 3T35A 2BUCA 4F3YA 4G4GA 1TK2A 1NULA 1SJ9A 3OY7A 4LK2A 1DAGA 2WR8A 3QPUA 2XNSA 4NJMB 4TZKA 1P4RA 1QVZA 3K30A 4FEYA 5E0KB 3RU3A 3OQNA 3ADCA 1YS9A 3H5IA 3D81A 1F20A 1G9XA 2FSIA 3E9MA 2QUHA 1G3RA 1GSOA 1M8FA 1T24A 3DOUA 3H1FA 3TQHA 3ROPA 1YIJB 4BX8A 3QE9Y 1A04A 4TLMB 3T9BA 1YGPA 2X7XA 3GUUA 1ZO8A 2QP3A 2RK4A 5ERYA 3KHSA 3E84A 4HTAA 3JQQA 4OPVA 3UJAA 5L46A 3GPLA 4M2LA 3NHSA 4LRTB 1YUMA 1ZICA 3CU5A 1G5TA 1O2DA 1QF9A 1U2GA 2XNHA 3I4CA 3NHJA 3QTBA 4OU5A 1TMOA 2EARA 3D0RA 3DVLA 2OXTA 3ZWOA 2Y66A 3H2YA 5TXGA 3CISA 2M5SA 3VRHA 4C0AC 5F4JA 5K4HA 2LR0A 4O33A 5EMLA 1L3BA 1K27A 3FWYA 1VKZA 5JXJA 2E4YA 2YV3A 1UMDB 3CF0A 1IN7A 4XXHA 3T9AA 4XWKA 3DDZX 2GXUA 3FDXA 1GILA 4BPRA 4RCYA 3AP3A 3BGWA 1USWA 3EZNA 1GNRA 4XWGA 4BX0A 1U7XA 2M2IA 5IKXA 3OMWA 1BNCA 5JSUA 1HYQA 5FI1B 4C0SA 2W8BB 1SXGA 2N47A 4Q1BA 3V4OA 5LDDC 1DEAA 2DWQA 3BX1A 4XPIB 2IH5A 2F67A 1IH8A 1VG0B 3CEAA 3EW9A 3IXMA 3PGJA 4G6IA 1BMFA 1K28D 4GPAA 1LH0A 3IJEB 5LIRA 5LP6A 3EQ2A 1P9LA 2FJ0A 4ZQBA 1SUIA 4X63A 3BMCA 3DAHA 3RVDA 3WBFA 2AZXA 3HFSA 2F3PA 3L7JA 4RYDA 5H16A 1NY6A 1UKEA 4DRYA 1U9ZA 2Z5VA 1LBHA 4O4IB 1R7RA 2W6MA 1B43A 3N0WA 1MV8A 3F6EX 5JS1A 1RYZA 2C98A 2C5HA 4DZTA 5IRCD 1RWOA 4TL8A 2IUFA 4NFYA 3BHMA 2C77A 2IV7A 5LWQA 2Q4OA 1YRYE 4EGFA 1FF9A 1D7AA 1YC2A 4WASA 4QLBA 3O3CA 5EKXA 3UKOA 4TT3A 1FOEB 2C1ZA 2Z6UA 3N28A 1KK1A 1IBCA 5EESA 5IM5A 3RAPR 1KK3A 1Q84A 4IDHA 5IW8A 3QHPA 2Q5EA 5A9RA 1DKOA 3NU1A 3GJ5A 2YQ4A 3GYGA 2C20A 2JFHA 1K4KA 1SQSA 3BTSA 5LZ7A 2HEGA 3LC2O 2A2ZA 2FE1A 2FWJA 4PLFA 4RQBA 1JDBC 2BV3A 2YNMD 5LU9A 1JXOA 5DLEA 2G83A 2QPAA 4EO7A 1Q0UA 3Q3GE 1QG4A 3GOQA 4WFJA 1JR4A 3H2BA 1GAQA 4EBBA 1RWKA 2VQ3A 2YYYA 2NT3A 1NP3A 5JAUA 4X45A 2HCTA 3ZW7A 3HKBB 1ATIA 1EB8A 3JU3A 4PXYA 1UXHA 2NACA 4X3CA 4K2HA 3OCXA 3UWDA 4XFDA 1CQXA 4D9JA 5BQ5A 5IJ0B 4EW3A 1CEEA 1L7XA 3D59A 3IXLA 2IVFA 4QXAA 5AVVA 3PDCA 4KE7A 4NKRA 1SQ5A 4EI2A 2BCJQ 1E9FA 4FX2A 1SVNA 3HBAA 4US0R 2GJKA 3I1YA 4OMFG 4QG7A 5IXYA 3SSNA 1VQ4B 2QM3A 2TMDA 2YN4A 1R5BA 1VLMA 3KVRA 3NW9A 4FEEA 4LYYA 2VUUA 4K0RA 2I3AA 1YR9A 3D6MA 2UYCA 3ND5A 1K8ZB 3OQIB 4F12A 3BXOA 3B1KA 5DRTA 1ZNWA 2BEWB 2P79A 1NJ2A 3FMFA 1XZLA 1OBCA 5EWJA 3COJA 3JQAD 3OJOA 2R84A 3PPWA 3B1YA 1OT5A 1DT3A 2YY5A 3OC6A 3BDIA 3OICA 2UUCB 2FPPA 3LUBA 3ZUGA 1C4KA 4M88A 4GX1A 1IULA 1QNFA 4MCIA 3ZBPA 1AQYA 1ECPA 4QEDA 4YPVA 5JNUA 4KO3S 2Z43A 2HK6A 2A9JA 1FL9A 5CM2Z 1O95D 4KO4S 5ERGB 3M6LA 3QU5A 4LZWA 3R6GA 4IHQA 4Y9UA 2IL1A 1LXCA 1QVFB 5ILGA 1BHSA 4B45A 5AJZA 1FUIA 2R8RA 1QPGA 4HMQA 1JQKA 3K1AB 5LL6P 1Q7GA 3G5AA 4AX4A 3L46A 5K3FB 1U31A 3SI7A 3KC2A 3OWXA 1T2NA 2DFTA 3PVCA 3WKEA 2XCRB 1KRHA 1BXRA 2J46A 3KKPA 1X14A 1GPMA 2C9DA 2D62A 2YZMA 4G9GA 4MCAA 4N18A 4ZVQA 3REFA 5HXAA 1W36D 5ALXA 3TEJA 1XMOB 5JATA 2FN4A 1AZWA 4KO2S 4S0XA 3G71B 3JD3A 1DKUA 2XJ4A 3LZ6A 5HUJA 4U3JA 1UM8A 3BSFA 4P3NA 4LY6A 3I0ZA 1FDTA 3ORSA 5KYVA 1SCUA 5IUJC 4ARIA 1J5XA 1QDUA 4B87A 3VR4A 3UW3A 1VE9A 2HM7A 3D3WA 4L2IB 1FX0A 4XVQA 2ZWPA 1W1WA 3TWOA 5K0LA 4CDGA 2WSYB 3GJSA 2AN9A 4JMLA 4DCPA 1UXIA 3ZDRA 3THYB 2OUIA 4YMIA 3F6CA 3CC2B 2AS0A 2BBOA 5ALLA 4G0WA 2P9FA 4RE6A 5HWSA 4Y2YA 3PQ3A 2N46A 1JYEA 4JL5A 3T6KA 4DREA 2BGNA 3FPKA 3HB9A 4LF9B 1G1AA 2QSZA 4U3JB 1OHHD 5AJXA 5G0TA 3VHXA 3D1LA 1L8XA 5HGXA 3PC4A 5DHQA 4HR7A 1U1CA 4QUGA 4V03A 3ADDA 3R9KA 3TINA 3AR4A 2ACEA 3QV1A 4G0NA 5JJCA 5KOIA 3MOSA 2VYVD 3OU2A 5H82A 5HM8A 2EYUA 1MR3F 1VCOA 2FMUA 2YWFA 3VO1A 3BBLA 3LWDA 1L5OA 3DNFA 4U7GA 2C7BA 2HFJA 2QTLA 1RKQA 4AKIA 4UM5A 4H7PA 3MJSA 5KZMB 3RE1A 1YB5A 1A9YA 3G89A 3OIFA 4R8LA 2ZYHA 3H1TA 1RJ9B 2HRCA 2PQ2A 3EDOA 3GWZA 3KOXA 1C4WA 3BWYA 3K1AA 3PCRB 5G02A 5DM60 2B20A 5K01A 1M2OA 4FYWA 1KARA 3INNA 4YDSA 5D85A 5G1OA 4YAKA 1XUOA 4RIFA 3VUEA 4BNHA 2O5EA 1G5RA 1UZAA 1BE0A 5CDGA 4MAFA 1KEKA 2QBYA 1YK1A 1LBQA 1RWNA 3R5SA 3AFHA 2VRWA 1HETA 2P9EA 2H9IA 3HFGA 3IILA 2FSVC 2W42A 2DBZA 3IVCA 2JGJA 1MP0A 5FV7A 3S4YA 3RQSA 2CL6X 3W90A 4ZMSA 3SVTA 2ZQYA 3MINB 5EJ5A 1QG6A 1RW4A 4H08A 4HWPA 1WTAA 3L4JA 3IUQA 4L22A 3KQHA 3KOUA 2BF7A 1U0BB 4B3CA 3TE6A 4HEA6 2CVHA 4JOBA 2R0QC 5DZSA 2M6RA 3H2JA 1SZCA 5CYOA 3LU1A 1A9TA 2FEPA 1P0PA 2OBYA 4DJFC 2DQZA 2ZRDA 5FOXA 3KQPA 4K9LA 3SP1A 3C7AA 4Q4HA 2CVOA 3A0RB 4OLJA 1BROA 2V5UA 4JNKA 3ZJ5A 2GN9A 2EBUA 3GIRA 1Z3CA 3PX2A 4WZBE 2R1UA 2Z2XA 4XARA 5CP8A 3T51B 2PLRA 2PVPA 5KYYB 4RVCA 2BM0A 3S2SA 4ZANA 5GV7A 3OJFA 3AYZB 2EKQA 1NW7A 1EVJA 4HFMA 4LX0A 1II0A 3QE0A 3TNLA 2JLVA 1P9RA 4M0MA 2P68A 3OE4A 1VLHA 1J7KA 2BW0A 1V5GA 3IVGA 4E94A 2YJ5A 1N7GA 1FNCA 4XJSA 4Q3CA 3GO4A 3ZE7A 3D5QA 2F4NA 2H2AA 2CNWA 2JJ1D 1G5PA 4I55F 1SC4A 4MUEA 2PXCA 3RVPA 5DYWA 3K6JA 4FM9A 3H1AA 3GEPA 1N2OA 3K0FB 3UFBA 3ZCVA 4KWEA 3E35A 5A0VA 2PWPA 4R8VA 4MVJP 5DTQA 1DAEA 2CCKA 4DLTA 3WGQA 2YFYA 3W9YA 2EHDA 4ZRNA 3ZWDA 5BR1A 1DG3A 2QR2A 4D46A 2PUAA 5F2KA 4GQBA 3HN6A 4WCVA 1BDIA 2IU0A 4LPKA 3Q9LA 5KOHB 3W5DA 1Y6GA 3E9NA 4M9CA 1NI5A 1HE3A 2JZOA 1NVBA 4XR4A 5HOQA 2QNBA 3DHVA 4K81B 4XLCA 2NP6A 2G9NA 1QIJA 2WFZA 1M74A 2FZVA 1E1RA 1T4CB 4CU2A 2EERA 4M1KA 4PYMA 2ZYWX 4DABA 2LIVA 4TTQA 3I3SR 1SB8A 4BL5A 2IPOA 2RJNA 1NRWA 1Z2NX 2B78A 2ZRIA 3M9XA 3AHFA 1ZUNA 4CQLA 5CB4F 6LDHA 1N25A 5HZMA 1NW4A 4Z8YA 4PQYA 1A4IA 1U11A 3B5JA 4I55A 2Y4NA 4EY8A 1MEJA 3JWIA 4DJEC 2UUOA 4RPGA 4J6FA 3WGLA 5K8VA 2GD6A 2ZCUA 4UBJA 1ZX1A 3N9IA 3EOBI 1FQWA 4WBNB 3N86A 4H3KB 4KVAA 2XWPA 3BFKA 5JBQA 1Q15A 3I09A 5IVKA 4S1OA 5D5QA 3CH5A 1U2QA 4PO3X 1Y7HA 3ROTA 3ZX5A 4JITA 3WFIA 1DEXA 1I2AA 1E92A 4W99A 5BT9A 3RYTC 3JR3A 3IODA 3NWPA 2C4MA 1DHRA 1Z5NA 4URVR 2RHCA 4KSCA 3GVKA 1C8VB 1T4BA 4TMXA 2VVTA 1CV2A 3V2UA 4IOLA 1XJWA 2ZJZA 1HX7A 5K8UA 4WGFA 1Q7TA 3B3GA 4GBJA 4IHJA 1K3FA 1VMDA 2Z9CA 2F1RA 3UJNA 3NVDA 1ECGA 4CKCA 1C30B 2OCKA 4GYKA 4KYVA 1GTMA 1NR5A 1UP6A 2GARA 3SQMA 4B5LA 1SOAA 3SXJA 4AKTA 4NP6A 1WW2A 4PNHA 2FFJA 1HDXA 3O2JA 4JLKA 1G5QA 3BMNA 5HDBB 4Q7EA 4BB6A 4FMDB 1I3NA 1ONPA 2RAUA 1L4UA 4FSXA 1XVTA 2FRDC 2BGUA 4YBRA 4LVCA 4AG6A 5JFGA 5LLTA 1O58A 4CNBA 3LX6A 4X7CA 2VZEA 5DWVA 3VXKA 4OOVA 3I9OA 1D4ZA 1YR3A 3CNHA 1MW8X 2XECA 2ZVDA 4NOJA 3MHPA 2VBTA 3DOOA 3NR2A 5FWAA 3RT9A 2B8JA 2FW8A 3I2GA 1EZZA 1DQNA 1T9HA 3C43A 3I37X 1CQZA 1OI3A 4Q6BA 5DNEA 4NCBA 1QTNA 3G7UA 1U0JA 4ON9A 1Q1AA 3L77A 2ECQA 2PA0A 5BXQC 2O8CB 2O8DA 4YJGB 2ZG6A 3TLMA 2XMZA 3AFIA 2B69A 2R6GA 1QHEA 1CVIA 3GFRA 4W6QA 3NOVA 2WYWA 4BKQA 1L4HA 4MWDA 5DU2A 5CFQA 1QKIA 3A25A 2PO7A 1KYQA 2RB4A 2ID7A 2PUCA 5BRAA 2JFGA 1BCRA 1S5PA 4K9PA 3Q38A 4L27A 1YAJA 1IDOA 3OCJA 1L5SA 1BKYA 4ZD6A 2HQBA 1Y8ZA 1HQCA 1NI4A 3U62A 3K5WA 3RBVA 1YITB 1GV1A 1CZOA 3AU8A 5LA6A 4WA7A 1NVKA 3QW4B 1Q19A 3H99A 1TJNA 3VYSB 1NRKA 1ABFA 5FADA 2VLIA 4CTMA 5E7QA 2PRSA 3A1EA 2BI4A 1OGYA 4S1VA 2C0PA 4ZI5A 4ERXA 4NDNE 3LTNC 1C50A 2Z3WA 1SCKA 1WXGA 4ID3A 4B8YA 2ZJ8A 4LHEA 3E5RA 4TRJA 3V3KA 5H83A 1G2PA 3I55B 4HZUB 1KEUA 1GM5A 4BFLA 4JB8A 1W0JD 1RDFA 3EXFB 3EB9A 3ZGZA 3S2FA 1M8JA 1W4RA 2DSTA 2J87A 2OTJB 2Q3JA 5FWNA 1JS1X 3BFVA 1DKPA 1P2UA 4JUBA 5F5LA 2P91A 1UBEA 4AY3A 4E12A 4V1CB 5EY5B 1F2UB 3EJ6A 1VSBA 1UWLA 1X0VA 2HADA 3B7GA 2GILA 2VDVE 3ZZUA 3Q5EA 5JT1A 1ZIYA 2PRKA 4DCMA 4G5SA 5K2MA 4CFSA 1YZFA 1GCIA 3NAZA 1O03A 3D3KA 4KEAA 4HMPA 5YASA 2NMVA 3ILSA 2PLNA 4KQ2A 3DXYA 4LXTA 5HR5A 1QO0D 2ZAYA 5EQDA 4PF1A 2V4MA 4TZ6A 1E3MA 2QAGB 1XTBA 3MW8A 3HUFA 1UKZA 4C6RA 4KXFB 4DLNA 2QV0A 7YASA 1FSGA 3N2ZB 3QELA 2QNIA 3KPYA 3IP1A 2HBYA 1PW5A 1HG1A 4QUZA 1B6TA 1E9DA 2AOUB 1D8AA 1T5LA 1FEZA 4RIGA 3B3FA 3IR5A 1Z2AA 3GA5A 4Q6WA 1H0RA 2ODQA 4EGJA 2AMJA 2C99A 4TYPA 5KTRA 2DOKA 4WFQA 3R44A 4LC9A 3PQ4A 4XUGB 1Z33A 1W96A 5M04A 2ZIUB 3DTVD 1GVHA 1ANKA 2I34A 4QTYA 1E6MA 1RTKA 2JIMA 5EXTA 4BC0A 1F1BA 3HB5X 1DMRA 4W8HA 3T1OA 1NNSA 3WRXA 2ZE5A 4EVQA 5IC6A 5A89A 4J94A 3CLHA 5LQDA 1JYSA 1P3DA 4II2A 4GZLA 2RBKA 3KZMA 4DDKA 1ONNA 2IZZA 3NASA 4Y7DA 2F4VB 2XB4A 3QKRB 5BSFA 1PVOA 1VQ8B 4FFMA 2H2WA 4C4RA 4TLAA 5JHGB 3OKFA 5EXSA 1VPDA 1M0EA 1IHYA 3KJHA 1YVEI 3LHDA 2YWDA 2Q3EA 4IGAA 4X66B 2VP6A 4UHCA 1KK0A 3N2KB 3KT3A 4RFSA 3GJRA 3DBHB 1GZ5A 1RU3A 3H5LA 4X91A 4EFLA 1E3WA 4MV9A 1VE1A 1UL1X 5KO2A 4PIPA 1UC5B 4G4IA 1RI3A 1JQJC 2C7OA 1CJKC 4OPOA 1Q21A 1T29A 2JI9A 2WF7A 1QTQA 4LJAA 1FXWA 1YMVA 2NU6A 3IULA 3QKSB 1Z4LA 2ZSDA 5EEGA 5ESRA 1U5CA 3JRWA 1X2BA 4Z4YA 2XNKA 5P8WA 1JFFB 1NLYA 5HFAA 5J4KA 1L5RA 4YP1A 3ZBQA 3SHFA 4N0DA 3B1VA 4KXXA 1YJ8A 2BP7B 4B6FA 4CI9A 1RHRA 4Z1MA 2B30A 3KEMA 5B4TA 2FWMX 3QX3A 1Z5PA 1PZGA 1QAQA 1X7HA 2A3RA 2Q2WA 4FI3C 3CHYA 1AM4D 1P5FA 2HA7A 3AFMA 4YQZA 1RI2A 2FUEA 5ILQA 1XZHA 3KM0A 1BCRB 1JN0A 4E2YA 1JQDA 1ZW1A 2UDPA 4HH4A 2Y93A 4NBNA 4OHVA 1RXUA 3ZH2A 2WAAA 4RK4A 2J31A 5F3DA 3FPLA 1NVMB 3ZHQA 2CZQA 1LA2A 1FTQA 2EFYA 5FBKA 5JJ5A 1YJNB 4QGGA 3OCUA 1RRKA 3JD0A 4OB6A 4QJIA 2ZRCA 1EG2A 5GGXA 1UCFA 1QP8A 2J48A 1KDRA 2PH3A 1E1YA 2JVKA 3DMRA 3MILA 3FKSD 3OZRA 4LK3A 5B3JC 5AKYA 1D3AA 4R9UC 2BZGA 1OC4A 2EKLA 3B6EA 3HXTA 5E9JA 1YQUA 1LS1A 3K9WA 2HHCA 2VSYA 4XM0A 3NEJA 1U9CA 2BFEB 3L6BA 4G97A 4IG9A 3EDQA 4DIBA 4DDWA 1WSWA 2I3ZA 4IXDA 1E9SA 3L7AA 1DXYA 2O0MA 1U4SA 1UDBA 4LRQA 2Z2IA 4GBMA 3DHNA 4F1JA 3N07A 2Q4EA 2ZSHA 1K8YB 1DDGA 5D3KA 4CM4B 1L5LA 1M7BA 4HVCA 4YEJA 1BEUB 1YDHA 3ZGNA 2PVSA 3RTBA 3A58B 3EPKA 2CXPA 1S72B 2ZWIA 4MWGA 4E08A 4FEGA 5BWMA 4G9BA 3EIFA 1U3DA 3MTQA 5I9SA 4TV8A 4MQUA 1B2LA 5EZ6B 4A0GA 5GIPE 3GUVA 4BLRA 3F5DA 2P75A 1RYFA 2F90A 2IFTA 4OLFA 3RUDA 4G0ZA 2GO1A 4HQRA 3KFVA 3V80A 3NHWA 2BEUB 4IRMA 3SX4A 1ZCFA 1GNVA 2VJPA 4M36A 1W29A 3FIJA 3I45A 3OM0A 3Q5DA 3LTEA 5KPDA 1SC6A 2V3CC 4Y6SA 4WN9A 3RVMA 3LNNA 4FKBA 1Q7RA 3ER9A 2W83A 1P2TA 4W1SA 1DUIA 1GFWA 5AUNB 3GFSA 2B9VA 1HOXA 2HY7A 3AVOA 4ER7A 4J6EA 3FJYA 5TMEA 4HX2A 3MK31 1H85A 5BP7A 1MZPA 3KXDA 4AKSA 3PJDA 3BMQA 3SBOA 4EARA 4KFSA 4OJYA