4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
3ZIUA 1M8GA 4HJXA 2VTBA 3FOCA 1Q19A 1I2DA 2JAXA 1OWPA 4NX2A 4GRIA 1Q77A 3BL5A 2E0IA 3FG9A 1WKBA 1N1DA 3P0IA 4H3SA 4K0RA 4F3RA 2A88A 1QU2A 1I6KA 4OJMX 1M83A 1EUYA 3NBAA 3Q12A 2RE8A 1WQ3A 3N9IA 3TQOA 1P4MA 4MUNA 3OP1A 4DNXA 3ZUGA 1N3LA 3DV2A 3FH0A 1ZJWA 4QBTA 4ARCA 3X1JA 4GU5A 1F9AA 1N2BA 1M8PA 3IVXA 4MWEA 3CLTD 4ZCRA 2VBUA 1U3DA 2HGZA 1T6XA 3PNYA 4R2MA 2HZ7A 4ZT2A 1NUSA 1O0BA 4UZEA 3IODA 5AHWA 1P7PA 3KT0A 1EXDA 1KH1A 1EFVB 4Q16A 1T6ZA 1IVSA 1M8FA 1VL2A 5IJXA 1B6TA 2A4MA 2QUJA 3IMCA 4KR6A 3ZJVA 4K03A 1NUTA 1R6UA 1IRXA 2PZAA 4MUEA 1K4MA 2A1TR 1EJ2A 4CT0A 2J4DA 1IQ0A 1IHOA 5KCMA 2V0CA 3ZJTA 1H3EA 1GAXA 3KT8A 3SZGA 2BTEA 4MW0A 1QRUA 1TYCA 4KPUA 2YWCA 1F7UA 3S3TA 1EFPA 2JANA 1ULHA 3G5AA 3PNBA 4NZPA 4MW5A 5FO0A 2WB2A 1MOPA 3MUEA 1NSYA 3QE4A 1TYDE 1V47A 3IUEA 2OYNA 2A7XA 1OD6A 2PIDA 3FNRA 2RD2A 4YP7A 2GKSA 4ZT5A 4EG5A 1N05A 4FZJA 2QJFA 1PFUA 1N2GA 1YIAA 1J21A 2IP1A 1YUMA 5HG0A 1NI5A 1KAQA 1IQRA 3DO8A 4YP6A 4A91A 1LW7A 3A4IA 1JIKA 4JFAA 3CLRD 3ILVA 2DXIA 1N2IA 2Z08A 3QTBA 4J75A 1WXGA 3N8HA 2QUKA 4Q93A 4BWVA 4PBRA 3IOBA 3H97A 4CDMA 3MLAA 3Q4GA 5DK4A 1F4LA 2QUIA 1ZH0A 2CYAA 3ZGZA 4JZYA 4OUDB 4S1OA 1YIDA 4CDNA 2WQ6A 1GN8A 3CLRC 4WSOA 1KQPA 1WXIA 3FY4A 4ND6A 1NB9A 4MULA 3ZJUA 1M8JA 4ARIA 5LM3A 4U7JA 1NUPA 3GMIA 3G59A 1XJQA 1U7DA 3P52A 1A8HA 1QRTA 2IELA 1NUQA 3LOQA 3ELBA 4KKVA 1LI5A 5JBNA 3NBKA 5HUHA 1U0BB 2CYCA 1XNHA 3CLUD 2QUHA 1IQUA 3Q10A 5TGTA 5TEWA 3N2YA 1QTQA 4EFKA 4MUGA 1H3NA 2CUZA 1KP3A 1WXFA 3IH5A 4RUKA 2CT8A 4MW2A 4CQNA 4MWDA 1J1ZA 5TEVA 3KFLA 3L92A 3IOCA 5KWVA 1KH3A 2H29A 4L2IB 3CVUA 1WZ2A 4EG3A 1J1UA 1VLHA 3ND5A 3P0JA 1R6XA 3CLSD 4JXZA 3AG5A 2DEUA 1KQOA 2A1UB 2XRZA 1YI8A 1ZH6A 4R0NA 4HJRA 3ZXIA 1JMVA 3SZ3A 1N06A 2TS1A 3INNA 1N2JA 2R5WA 2P3MA 3C8ZA 1JEDA 3GUZA 2IJGX 1I6MA 2VBVA 1O5TA 4XFJA 3LE8A 3X1MA 1WY5A 1XNJA 3UY4A 1T9GS 4MVYA 5TS2A 3IOEA 4TS1A 4EG8A 1COZA 1VBKA 3IMGA 1X8XA 1KORA 1PG2A 3F3MA 1N78A 4XFDA 1QU3A 3RK0A 3CVXA 1Q9SA 1FYDA 4E1AA 1O6BA 4EG4A 1YUNA 3VGJA 4NAHA 3FWKA 1GTRA 3COVA 3MLBA 2QJOA 1KKUA 3E27A 4AQ7A 2WQ7A 1D2RA 1O97D 3TZEA 3SDBA 1N08A 3KT3A 3H9CA 1OWLA 1G59A 1MC1A 3AG6A 1WXEA 3H99A 3SEQA 3FI0A 4ZCPA 2CV1A 2XRYA 4G5YA 4JXXA 2JA2A 3A2KA 3AIIA 2I1LA 1R6TA 4MW1A 2CSXA 3L93A 4ZCTA 1MAUA 2D54A 1KQNA 3JXEA 4MUJA 1LI7A 5KHAA 4NAUA 1UFVA 2V0GA 3CVYA 4I6JA 4MUIA 2PZ8A 2EL7A 1JEEA 1BS2A 1TQ8A 4MVXA 1JZQA 4MVCA 1KP2A 1MB2A 3NV7A 4DDMA 3ZXSA 1NB0A 5A88A 1N2HA 3AL0C 4G5FA 3RFFA 2HMAA 1HYBA 2VTBB 1KH2A 4KR7A 1PFYA 3D6VA 4MW9A 1M1ZA 1ZUNA 5LLTA 1WXHA 2X1LA 3CLUC 1GLNA 4NATA 4G6ZA 2VBTA 1H1TA 1V8FA 2Z3VA 3TZLA 3U1VA 1ILEA 2QJTA 3K32A 1JZSA 3UC5A 3H05A 2J09A 1OBHA 4MW7A 4P2BA 2H2AA 1J09A 3CVVA 2J5BA 2E21A 4ZT3A 2CV0A 2PG3A 2QTRA 4WNYA 3IVGA 4F4HA 3RK1A 1NP7A 3AFHA 1QNFA 3HL4A 1TYAE 5HUJA 3HGMA 4MUKA 1MAWA 1YULA 2WSIA 5J59A 5J58A 2C5SA 4MAFA 5K0TA 2ZUEA 4MWBA 1SURA 2X1MA 1TYBE 3UK2A 2O8VA 3CVWA 4HK4A 5IHXA 5FO1A 3FDXA 2DETA 2NZ2A 1K97A 2A1UA 3RHSA 4DJAA 4J76A 2DR2A 3PRHA 4R2LA 3FIUA 2DLCX 1O97C 3FHJA 3ND6A 3RJZA 2BYTA 1N77A 3HV0A 1VBMA 1JILA 5LFAA 1JGTA 5FNZA 3COZA 1O96B 3P0HA 4QRDA 4X0EA 1GPMA 1N75A 1OWNA 1O94D 4EGAA 1OWMA 1K92A 4MUFA 3IMEA 3X1KA 1I6LA 1DNPA 1NURA 4YMIA 1IH8A 1F7VA 1EE1A 2GM3A 3TQIA 4XSVA 3D6UA 4ZT6A 5A8AA 1T6YA 1NUUA 3OTWA 2A1TS 1U7XA 1FFYA 2J08A 4EG1A 1J70A 1PG0A 2DPLA 3DLAA 4RPIA 1N2EA 2YWBA 3PNVA 4MVWA 3KT6A 1QRSA 1GZUA 1OBCA 3K9WA 2ZUFA 3IVCA 2QTNA 5A89A 4ZT4A 1G8HA 3CLSC 4MUHA 4QREA 2PZBA 4EG7A 1WOYA 3CA8A 3TS1A 3HMQA 3DPIA 3IUBA 4U8HA 1KAMA 1NYLA 3MXTA 4JYZA 2AZXA 1XNGA 2E18A 1PFWA 2PXHA 3COWA 5K0SA 2X0KA 4EG6A 4ZCSA 1O94C 3CLTC 1QJCA 1EFVA 1WQ4A 2G36A 4OUDA 1PFVA 4PBTA 1H3FA 1M8KA 4AS1A 3AKZA 5TRDA 1N07A 2PFSA 4KR9A 2OV4A 1S4MA 4I6EA 1KR2A 2ZP1A 4PBSA 1N2OA 4I6GA 2AKEA 2YXNA 1Y42X 1GTSA 1MJHA 4YBRA 1WJGA 4ZT7A 1EUQA 1RQGA 1NZJA 5EKDA 2E89A 1K4KA 3H9BA 3PXUA 1MB9A 2GOYA 3UOWA 3VU8A 2OQ2A 2CV2A 5DB4A 3SP1A 4KPUB 4YP5A 4MQ6A 1JECA 1J20A 2O5RA 1EFPB 1MRZA 3FETA 5DASA 4DDHA 3COYA 5H7XA 3M5WA 4NDAA 1VBNA 2CYBA 3QTTA 1Q15A 3G6KA 3SYTA 1O95D 4L2IA 1G8FA 1QQTA 4HPWA 2A86A 3A04A 3ISJA 3LCJA 4DDKA 1TFUA 4MW4A 2VBSA 2B7LA 4PY2A 2D13A 2A84A 3CR8A 5DEOA 5H16A 3VRHA 1Q11A 5J5AA 1U3CA 2QTMA 5F23A 2J07A 1TEZA 3RBAA 3CTAA 2NSYA 3N05A 2X3FA 1JIJA 2Z09A 1JHDA 2VXOA 2YY5A 4MW6A 3ND7A 3HFJA 3MMXA 4DLPA 2CFOA 3A05A 2D5BA 4UZFA 1JIIA 4ND7A 1IFXA 3TNJA 4MLPA 1MBZA 1X6VA 3GLVA 3SEZA 3UMVA 4U63A 3IDFA 3HZRA 2DERA 1O96A 2EJCA 1CT9A 1O0CA 4EF6A 1O95C 4DE5A 3I05A 2DUMA 4ZCQA 1G8GA 1T9GR 5BNZA 4MWCA 3BNWA 1OWOA 2AG6A
chains in the Genus database with same CATH superfamily
4B3GA 4HEA6 3FKSA 2W71A 2YZ2A 4XOIA 1UANA 1YS7A 5D8DA 4AWBA 4E5DA 5KPDA 5ABPA 2I2AA 4PEVA 1FNSA 2FGJA 4XQ0A 1GNSA 2W90A 4KXWA 1XVUA 2PNJA 4CLHA 4CV3A 5JYDA 3ZS9A 1KBOA 3CM0A 4D0LB 2VATA 4HEJA 2Y9MB 3V33A 2RGNA 5DDIP 1DARA 5FIUA 2EVWX 2HJ9A 4G9EA 4LOJA 1LTQA 2HMYB 4O08A 2FFBA 1JAHA 1HYHA 3AEUA 4R8RA 3REQB 4KPEC 5CX4A 3NFYA 1OASA 4RA9A 1JDVA 2ZBUA 1V95A 4Y1RB 5TT0A 3RRNA 3S8MA 4EY5A 2O05A 2OFWA 2WJHA 1XMIA 4DC1A 3QLVA 5EWLB 3SNHA 4XOUA 3Q2OA 5TRTA 3JZFA 3N2NA 1VQOB 1LSOA 3M1LA 4I4TA 5LJLA 1AHNA 1XRQA 2QTWB 3H0EA 3O03A 3V8EA 1Y6JA 4HGZA 4WK4B 3HPRA 1NUSA 1W581 4DA8A 4WKNA 1Y5MA 5AM5A 4XONA 5H83A 1HPLA 2PJRA 1DXYA 1UDCA 3S27A 4ISBA 1TO2E 3C4JA 4M3NA 1V6AA 2EKDA 3ELYA 4Z0NA 3SBXA 1DELA 1XGKA 5IJXA 1SHUX 3T38A 4HD8A 1DG9A 2OE2A 3FGOA 3LOUA 1V8DA 1REQB 4I1OA 4ZZ1A 5I7OA 4EX6A 5EMKA 1HNXB 3EIWA 1K4MA 1KQ3A 2VPTA 4LNUA 2Q62A 4NU5A 3MMPA 4O5AA 4C0HA 3U61B 2PUBA 4TV9F 3I9NA 4LZWA 3WLHA 2I6SA 2GYYA 4YMWA 1FW6A 4A8PA 3P2MA 1C7IA 4L3OA 1ZH2A 1U8EA 1R74A 3AU8A 3B38A 1WW2A 2ZE8A 1O9BA 2GQFA 2Y3IA 3AR8A 3FBGA 4FX2A 1SUFA 3MRXA 4UVHA 5KMGB 3WIDA 4PX5A 3OEHA 3BF8A 4XJSA 5G0WA 4MYCA 3BEDA 3R3SA 3GEIA 3MJRA 4E2YA 3EF1A 1WUYA 5BNTA 3CCSB 3U60B 3RSCA 2O9JA 4HLUC 1KNQA 1FS6A 5JAHA 5LPNA 5KTNA 1AXRA 3AY0A 2GEBA 3ECSA 1VHLA 2HPZA 3OHSX 1ID8A 2KLBA 2V4MA 1FP6A 2A7QA 2Y0PA 2X41A 3U3OA 4DLAA 2WB2A 4JLBA 2V7BA 3FPBA 4Y2YA 4ALIA 3QE4A 4GE3A 4QQFA 2XB2A 5DGTA 2O6HA 5F2KA 1I3LA 4RFSA 4Q00A 2HCFA 2EZ9A 1MJNA 4YP0A 3RREA 2FG7C 3INGA 1E8NA 1JPNA 4B40A 3EDCA 4UVGA 3HU5A 3LC2O 2GD0A 2P6UA 3BXXA 1C80A 1DB3A 4JXKA 4B3CA 5E6UB 4IXDA 3SI7A 5IDWA 3I01A 1BEUB 1SQGA 4YRNA 3MT7A 5AVOA 3NGLA 2ZCVA 5DO9A 5BY2A 4MNTA 1G1AA 2OTJB 1IQPA 1F4PA 4JJAA 4DNTB 2WF6A 2IPXA 3C4QA 3K30A 2JFVA 4N6GA 4RJJA 3VNBA 2F64A 2ZZMA 1E5VA 1FU7A 5C5CA 1N2IA 3FNGA 5JJ5A 1Q0TA 3QTBA 3A4YA 2R1VA 1CQZA 3VR4A 2G17A 2ZXIA 4AP9A 2VKTA 4AX4A 3TD6A 3KVNA 2D5AA 3IT1A 2ZI3A 2B4AA 1DLIA 1A9RA 4P53A 1D04A 2DBQA 1CLEA 1Y0RA 1N1GA 1ZW6A 1L7RA 1G64A 2ZJ7A 1L7PA 1T8UA 3I53A 4S0ZA 1I1HA 4JCOA 5B37A 3D6AA 4WSOA 4TN5A 4X84A 5IH3A 2HMUA 1U2GA 1EUDB 1IL0A 4FX5A 2GD1O 4BYMA 1RHMA 4WNCA 1BX0A 4G2TA 3E23A 4J0FA 2XUJA 3IILA 2IHZA 3VYSB 3ZHQA 1VCMA 1NIJA 2DHRA 3CCEB 2I2DA 2VPWA 2WSMA 1ES9A 3PE3A 3CH7A 2VQDA 1SELA 3CTMA 1XMPA 1H66A 4CM7A 2NPFA 4UNIA 5T6BA 4MIOA 1V7QA 4B8ZA 3B9QA 2GFHA 4OQNA 1U2GC 3AJDA 4MTLA 4QEDA 1RXCA 3INYA 5EZYF 1Y37A 3OPVA 3RYFB 3TWOA 3CNHA 4DA7A 1P33A 4EMTA 2ZKLA 1EWQA 4HNHA 4W6QA 4NKRA 2H5EA 8ATCA 2I1QA 2YWXA 2FPSA 4JH0A 1FVHA 4RELA 3RIXA 2NQ2C 2BFDA 2CUZA 4FMCB 4IDCA 3GXOA 3Q88A 1L5QA 4FBLA 3QUTA 2QI9F 3W5SA 1L5RA 1UH5A 4B71A 5F1KA 3GLIE 1PS9A 2VDWB 5FA5A 5AW1A 1BGXT 3S2ZA 4M1EA 3BWXA 3AP1A 5M3BA 5KWVA 5I9NA 3CVUA 1XTUA 1PL0A 4FFSA 3OU7A 4JQZA 2XKKA 2GF0A 1GNVA 3KHKA 2ZB4A 4RA9B 4ECAA 3CUVA 4MVJE 9ABPA 1V0FA 1RBMA 1KQOA 3KXDA 5JZVA 1II9A 5TGZA 5CCXA 3NW9A 2BJVA 1K7XB 4R5MA 2XE4A 4Y7DA 3CURA 1U1FA 4J0KA 1LTHR 1V4NA 1HR0B 4H3HB 3FDFA 1EP1B 4B1FA 4LV5B 1JWAB 1AKEA 4NOMA 3TLGA 4XRRA 5AKGA 3ED5A 3PC7A 3NHPA 3D4PA 1GGNA 4KWHA 1OXBB 1HDRA 1P0CA 1RP1A 3CEPB 3MCZA 3ZWWA 1NRJB 2PLWA 3I45A 4HADA 4UULA 5G4KB 2GZHA 4AMBA 3T7KA 5ALDA 1V5FA 1XVTA 2I1VB 3BWVA 1IPFA 1D7OA 4Z3KA 1COZA 5HJ2A 1DADA 4MXDA 4EQZA 2DOGA 2D3LA 5KDOA 2PH3A 3IMGA 4EB6A 5BNFA 4JL6A 1TD1A 2BKXA 4ESHA 5I01A 4Z4VA 2ERXA 2WPNA 1AA6A 5DX1A 5CCBA 3FSGD 1QVVA 4ER7A 1FYDA 4QOGA 2RBGA 3FCYA 5JAMA 1NF2A 2GTIA 2YN0A 1TT5B 2GM4A 2G9UA 3E7PA 3HG7A 4FYVA 3MYRA 3SC3A 2G5GX 2A0FA 2WU8A 5KMGA 5GOTA 5TF4A 5IU6A 3QPUA 2CRVA 4AQ7A 1TJ5A 3BTSA 3VR6D 2VLBA 4NXNB 2OMKA 2B35A 3SDBA 1QJ4A 1QFSA 4KWIA 3FCSB 1CUUA 1ZAKA 1DV1A 3C7TA 3RTCA 2J41A 2WD7A 1Y9DA 4EZIA 1SUDA 2FPPA 2GBIA 1OYYA 5HP4A 1EDOA 2ZIUB 4IIFA 1IJKA 5EE9A 3IAM6 1N5IA 3WP0A 3KKLA 1HSOA 3H3FA 1E1LA 4L5JA 5FUXA 4R2HA 3RC9A 2FWAA 2IEBA 1JFFB 2DFNA 4NCNA 3DLIA 2PKEA 1G8YA 3O74A 1KEVA 1ZU5A 4GSLA 3TR5A 2WNIA 1NBMD 3N53A 1DKOA 2HA4A 3A0UA 3QU5A 4FGUA 4LK2A 4M0MA 5EIBC 3IR7A 1KQNA 4M83A 4MCJA 5A6SA 1SC4A 1W8IA 5ITSA 4FKMA 5JJCA 5JY1A 1MW8X 4PZZA 1XRNA 3NATA 1VGVA 3PEWA 1K4YA 5JANA 3OQOA 1E4EB 1J2UA 4BQOA 2AMJA 3HCNA 2VK4A 1YS9A 3MTGA 1I2AA 3ZU5A 1UPBA 2XHZA 3PZBA 1COWA 3ASQA 3W2IA 1KP2A 4K86A 5ALXA 4Z2AA 3SWWA 1TC1A 5CH8A 3OZEA 1EXWA 1X7GA 3ZX4A 4Y2VA 4EJ2A 2ACWA 5DM0A 3CKKA 4KH0A 2BFBA 2JD1A 5B2EA 4HFRA 1IZZA 4F1WA 4CBVA 1HDGO 5C5DA 2NUAB 2FSUA 4MICA 3T9AA 3QVUA 3TPCA 2GEKA 4G1VA 3UC9A 3QEOA 2CVFA 2PMEA 5JLJA 4D8YA 2WIBA 1DFGA 4XUCA 2XUZA 1U2EA 4LTDA 4ZOEA 1B73A 2VP6A 3ANLA 4E2FA 4CLRA 1A97A 2PVPA 3L4SO 2O2IA 1J39A 4HDSB 4RLSA 2VRBA 3VKVA 6REQB 4J07A 2C2YA 4KITB 1X80B 3EBOA 3ZIAA 3F7MA 2YWEA 3PFIA 2WQZA 2P1RA 2J8ZA 5E3HA 1JZSA 2CLMB 4KAJA 1XU4A 1XD2A 3HI6A 3KEGA 1DBPA 4G1CA 1O4VA 1A98A 2C5GA 2ZROA 3QMPA 3KZVA 2GETA 2VXBA 1AS0A 4KB5A 2AS0A 2BFAA 3SHVA 4M1YA 4U9HS 4Y1GA 1P5RA 1KTVA 1GRVA 4YHBA 3M4XA 4HC4A 4UU0A 3V8NA 2M6KA 4PRZA 2A78A 2J0UB 5CA1A 5LD2B 4P9NA 1XZLA 4YPVA 2NLOA 3UV3A 4ZQCB 2BM1A 1CR1A 1Z0IA 3ZBPA 4Q4AB 4K7JA 4C6RA 5H1YA 2JK1A 3DZDA 2OYRA 1ZR2A 2GZRA 3PWTA 1XMSA 3Q8KA 1B0PA 4CQMD 3BFXA 2DQ4A 1Y5IA 4GVXA 1WTAA 3CEHA 3L7NA 3V1YA 5BSFA 3F3KA 4ACAA 1IIRA 3V8RA 4JU8A 3CVWA 4DV3B 3N75A 1G21B 3FDXA 3TXYA 3AF0A 3G2JA 4C6TB 1P0FA 3AJRA 3BHJA 3M6LA 5DHRA 2EFEB 1CJTC 3C97A 1NSTA 5DSZA 2ZAMA 2BKAA 2VTDA 4D5GA 3H65A 5ADVA 1DQRA 1MX3A 2ATCA 3TN7A 4S2UA 4RH0A 1X8LA 1JKMA 2W4MA 3C6BA 1II0A 16PKA 3S29A 2CZGA 3KU1A 1YRHA 2C20A 2J9YB 3EVGA 1JIXA 4QRDA 5IAKA 1W0JA 1E6MA 4G1UC 2XOEA 2EARA 3OOSA 4FYWA 4ZU3A 1TCCA 2XIQA 4Z51A 1YGPA 2HSGA 2VP0A 5K4GA 3O3MB 4Q9DA 2C84A 1J97A 5C51B 2XXAB 2PQ0A 3WB9A 4OMFG 1PK9A 5EWMB 3B3FA 221PA 3DZHA 3R3UA 4V1CB 2C57A 1XZPA 3COPA 4LYHA 4MIYA 1KPHA 4XVCA 3ONUA 5F12A 1VLYA 1C2YA 4GIBA 1Z28A 4HS4A 1Z4NA 2WV9A 3PQDA 1PUJA 1ATZA 1E61A 1GGMA 1GY8A 1YBHA 1TT5A 1JQAA 1ZD8A 2D5IA 3A58B 4LX0A 4NVRA 2C4UA 3K1AB 1W4AA 2FR8A 3Q8WA 1KI6A 1G7SA 2ISCA 3KK0A 4V0NA 3VUFA 2ZSHA 2EFGA 5BV0A 5HIAA 2WYWA 3LKVA 1AM4D 1Z38A 4ZWNA 3GJ8A 3WNVA 5EPEA 1Y1SA 3DD5A 3ZGVA 4MS4A 1N6OA 1LLUA 2FSHA 1T9KA 4JX8A 1U1EA 1WMSA 2Q3BA 4QBKA 4URUR 1FDUA 5HA5A 1KGDA 5LYJA 3TE7A 1GIAA 2EV9A 2FPPB 2ONJA 4R7ZA 5JASA 5JAUA 2OFFA 3TNLA 4EVRA 1FP4B 4PZUA 2CW5A 4M0LA 2FSVC 1SD1A 3KJNA 4DQVA 1JIVA 1MIOB 4H1VA 4Q82A 5BRNA 5AK4A 4JI7B 2Q5LA 1JJ2B 2RARA 3H9UA 3OM0A 4MYRA 4YAIA 5JNUA 1ZZEA 4NK5A 1F8XA 3RSLA 2XYRA 5HE9A 3WKBA 1PX0A 4B81A 3TQFA 3SU8A 5JYCA 1TQDA 3CH6A 5D5QA 5H59A 1XEFA 3NTQA 3WGIA 1FE8A 2GGSA 1OAAA 3BICA 4IH4A 4FMDF 2YJ5A 5HIIA 4HDKA 4DS3A 3F8WA 2ZJYA 1PKXA 1M1YB 2M9MA 1FFBA 1YK1A 2AHOA 4AJKA 1A9XB 4H4DA 4R2KA 1PR1A 1L4YA 2CXRA 2EFJA 4JENA 5FTJA 1NZJA 3NDIA 4ZQBA 1RKVA 4UDXX 4NJOA 1AKWA 2BP7B 4Q5IA 4NC9A 1U81A 3UOWA 1VSVA 1ZVKA 4OJTA 5BV8A 2OQ2A 4P4SB 4EB8A 1Z8FA 5CD9A 2C2BA 5T8KC 4RW0A 4XKVA 3SLKA 5JSFA 3C24A 1UMBA 5K4HA 5D3MA 3HJNA 4Y6QA 2V0NA 1XZMA 1BOOA 1TT7A 1KYYA 3DQPA 2QR3A 4HUJA 2X22A 3I9V1 4MGYR 2F59A 5AO9A 1BAPA 1KYVA 4MR8A 3SIXA 1EQAA 1IHMA 1VBNA 3B13B 1U8CB 3G6KA 5A02A 1T91A 2JCGA 1P19A 1EUZA 4J0QA 4YCAA 3D2CA 4FOTA 4TMXA 4PC3A 5GY7A 2FMKA 4JI3B 3O8NA 4KN6A 2X9LA 2WHQA 4JGBA 4DHWA 4QJ3A 2Q4EA 3X0DA 2XNDA 3KEFA 4OAQA 4ZOAA 3T3HA 1P4GA 2YZMA 3PZRA 4P2GA 4ZJZA 1U2RA 3OLVA 1GQ2A 1Y6QA 3FYUB 2Z2IA 4F5ZA 1T1JA 1N2CA 1SKYE 1ZGCA 1U3CA 4P5PA 2C78A 4RMNA 5A9SA 2J07A 1UXKA 4WGGA 3RVDA 1FB5A 2KI5A 2WJ6A 4R83A 3NRJA 1VE1A 3VPSA 3BF7A 3VR3A 1MKYA 1S6YA 4KLAA 1QH8A 1RAFA 1VHQA 4WEQA 1TK9A 3PF9A 3SQXA 4DLPA 1DKPA 3VH4A 5KTPA 3IUSA 4QGHA 3BREA 2CFOA 5K8LA 1J8YF 1ABBA 2JZNA 2WZQA 2EHDA 1P60A 1ZOSA 4A8JC 4TRJA 3WBJA 1R16A 4C6TA 1CUIA 3KBBA 4DYVA 1TUBA 4RM3A 1K8QA 3P0FA 1U7WA 4JITA 2WE7A 3IPLA 4FXPA 2FSSA 3WTCA 2IYUA 1IOZA 1N6RA 2ID8A 3RV3A 2GESA 2ODBA 4KUGA 9GPBA 1C81A 1WMFA 2B37A 3ZXXA 1UDAA 2ONYA 2W6PA 3GWGA 3HJUA 3J7TA 4OOEA 3DT8A 3OZUA 1HE8B 2JHAA 4XI9A 4OB7A 4E46A 1DAPA 3PIRA 5CTAA 3WHPA 3ZWPA 4LF5B 1DRWA 4JLKA 2IKQA 3ERCA 1RYHA 1YZ3A 4FDMA 5JALA 5DWDA 3VTZA 4OHVA 1GPNA 3NTLA 3V8PA 3ZHZA 3IKTA 2WWYA 1Y6FA 5IJ0B 3C3EA 4HZUA 4BLTA 1XEXA 2CHQA 1INLA 4EHHA 4E1BA 4IR7A 4AVYA 1E0JA 3AONB 4ALMA 2JGFA 2JFOA 1RI5A 3OLWA 4Q9IA 2A9QA 2LBPA 4YVFA 4CCYA 1V1RB 2A88A 1RRPA 3NJ4A 1VI2A 5LBIA 3AF2A 2C0CA 1SQFA 1YI1A 2F90A 2R5NA 4TYNA 1AK2A 3RTDA 1JQJC 1PR6A 3RF7A 3D7MA 1T0PA 4D9FA 3CW2A 5IJZA 2PXXA 1Y8AA 3G5UA 2WOOA 3ZY4A 4DCGA 3O2NA 2XA9A 3GDWA 3SC6A 2HO4A 3NKFA 3UT5A 3OOHA 1GD1O 1OAKA 5TXGA 2QD5A 2WINI 3M3HA 2A5DA 2K5UA 1XIVA 2NU6B 2RK4A 3LHFA 3Q1KA 3CC2B 2V65A 5GGXA 4CM5A 3V1MA 1ZL0A 3HH8A 2HPVA 4B7ZA 5E9JA 2V6BA 4O4HB 3T7RA 1PNRA 2JGAA 1DX4A 1HZJA 3RTBA 3KPVA 1D07A 1BWQA 4D3YA 3B3AA 4G1BA 1KH1A 1VE5A 4QICA 5LB4A 3QY0A 3ZE7A 3I9FA 4QVGA 4Y2SA 1IVSA 2GF9A 4OKIA 2J33A 3CPSA 3E7DA 4MVJG 4IP0A 2J9RA 3I1IA 2Q50A 4K03A 4XCXA 3EW7A 1TECE 4XX0B 1KR5A 5JVDB 4TRRA 3OU2A 1A77A 2XB8A 3FKJA 3ER6A 1NVWQ 3IBGA 1B8OA 4G9GA 2QU7A 3HY4A 4W8HA 5BYBA 2DGDA 2HM7A 2BDEA 1Y1KE 4YR7A 4G0UA 1PT8A 2NO1A 3TSOA 2E4AA 1N57A 2VHXA 4PM4A 2V7PA 1NHWA 3D0KA 4II3A 4H7DA 4E5YA 5AESA 5FI5A 4KLNA 1IUKA 1JJIA 3T7IA 4B82A 1XCBA 1CP3A 1S02A 1ZIOA 2X13A 2FW7A 3OMWA 3W7AA 3IBSA 4XLFA 5CLQA 1I0IA 3K2IA 3GJRA 1Z6YA 3EISA 1P9LA 4YCMA 2HIHA 4UAVA 1Y6RA 4XEUA 3OQJA 5A5VA 3I39X 2CFSA 3TSYA 1XRLA 3G2IA 1OFTA 2Q3JA 5C37A 10MHA 2IXBA 2VNJA 4D81A 3ELWA 1XDDA 1ZS9A 4CIWA 3FSJX 2MSEB 3LNNA 2AZTA 3P20A 4RPGA 2GVDC 3JQ9C 1KEKA 3T0GA 1J0AA 5AIAA 3JQEA 3QMMA 4OIMA 4ZPJA 4YP7A 4C6SA 2EL9A 2GKSA 3V1KA 2XVAA 3MWLA 1OLSA 3S1LA 3V32A 3V4FA 2C8VA 1YUMA 3TTXA 3DTVA 1VKJA 2C9MA 4X6YA 1ZJZA 4ZOLB 3USCS 3ZHRA 3CPEA 1EXMA 1QGDA 2ZDQA 4AZSA 1M2HA 4GR9A 4ZVLA 4CKXA 4EFDA 4Z7QB 4BFVA 2WU3A 3GELA 2YNMA 3CUEF 3HBFA 4WZAB 5JNSA 3R76A 3NWEA 3VDXA 3L4JA 2WVAA 1R8QA 1Y63A 1QLWA 3O8RA 3PYMA 3OZWA 3KVOA 4RKRA 3KR9A 2P2CA 4EB3A 5BR7A 3N8HA 1B0ZA 4M7RA 5IS2A 1MZVA 1MC5A 3Q6RA 3PPYA 3H97A 5JY6A 1GAJA 1RJ9A 2AMFA 1M34A 3BTOA 1XDUA 1FUEA 5DK4A 3WOVA 3X1DA 4JR0A 3EPKA 4Q1EA 3L9WA 2IX3A 4BZQA 2NQ8A 3DMNA 2OWDA 4K9SA 2IWHA 3BG5A 2NUPA 3A6DA 3HA2A 1X14A 2X5JO 3AQIA 3GCXA 1PJCA 1XALA 3OTQA 2DFPA 4ND6A 3CGWA 4PSDA 1BU5A 1OYOA 2BY4A 2G9RA 3E9QA 1U2SA 4QAQA 2OYCA 3CP8A 1IPHA 1BGWA 5MN5A 4UMFA 1SC9A 2I6GA 2ZE7A 1L1RA 4G24A 4MVJA 4X7PA 4DSUA 1OLXB 1MB3A 3W04A 4D80A 5KYUB 4JJKA 4P58A 3WWPA 3L79A 2GCGA 5IYZA 4CF6A 1IOWA 4QECA 3LOQA 4P36A 4KHZA 3ZC3A 3ZWXA 1YFLA 4BLUA 1FJXA 1TIPA 4B4VA 4ENWA 4P1VA 2BM0A 3NORA 5EAIA 2QDKA 2FLVA 3DFZA 4KVZA 2CB0A 2CYCA 4CMKA 1H6AA 4K8RB 2ZUBA 1OROA 1RWXA 4EW2A 2B36A 3CYFA 1B16A 5IYWA 4E4YA 2EF0A 4QAJA 1WKVA 1IHDA 1T2CA 2MSDB 5CR9A 1E43A 1KMCA 1FSFA 2W2KB 3E61A 4F38A 3AT1A 3VGPA 4G1FA 1W49A 2QXUA 4IQ8A 3KVRA 3O83A 4GNRA 1KH3A 4WN3A 3GNQA 3ZDQA 2J3DA 4KQWA 3LWDA 2CJYA 2FETA 4QGAA 4YJ3F 1M0TA 3GQBA 3GLGB 4KPFC 2R8PA 2BFNA 1XTPA 2A1UB 2H4XA 2HLDD 2IVFA 5CT5A 1GDHA 3GYBA 3RT1A 1J33A 1ZD2P 3JQGB 2F9LA 3W05A 1YTLA 3I6MA 1M6YA 2CCGA 1UBHS 4TYMA 3VU0A 5F35A 5J4YA 4X20A 4OX9Y 3ADKA 2GHTA 4C76A 1CE8B 1BE1A 1NNUA 4PO9A 9ATCA 1U80A 2F3QA 2H07A 4P7BA 3RYIA 4ZHQB 1F4VA 4J1TA 2Q5JA 3WWDA 3CKLA 5IBCA 2C7RA 2C3OA 4TSRA 2XOKD 1XCGB 2YV1A 2NZ8A 4DMRA 3AFMA 4ARVA 1NX6A 1E69A 4MB0A 2TMYA 1XCMA 3OPYI 3S1AA 3CCFA 4LXXA 4O2AA 2V7QD 1AT1A 2GXSA 3OBIA 4PGHA 4NNPA 5DTEA 3LPDA 5KOJA 3ICWA 2XE6A 4MO9A 3ZV7A 5B3KA 1UT5A 3L40A 3WFJA 1XZHA 1VQ7B 1XAGA 3F7NA 1ZBQA 3E18A 2OFXA 3UA3A 2QJOA 3ZCRA 2JHFA 4JI5B 4BEJA 4IJMA 5ILOA 1M1YE 4RTOA 4BNJA 3H3JA 4N76A 1SBYA 4DNQA 2HYDA 4L5AA 3NC4A 3RQSA 5F3RA 4D96A 4EGFA 4EKNB 4Q02A 3MOGA 1DCKA 2INGX 1JXQA 4TV8A 1Q57A 1SZJG 1G8SA 3UMFA 4P08A 2I87A 4F7DA 2CEKA 2Y1FA 4UCXA 1I4WA 2OCAA 2ZE5A 2Q3FA 3PQ8A 1X94A 2JA2A 4U6SA 1MB0A 2WP8J 4BNHA 2C7QA 4IVPA 2VF4X 4FZ3A 2GHQA 1SZDA 3CNNA 3HUTA 3N0RA 2II6A 4ZO7A 4CG3A 5DNCA 3K0SA 3NR2A 4B84A 1W4ZA 4L22A 1YZNA 3F0TA 3OQBA 4CEHA 1R27A 5FUWA 3RGGA 1YFJA 4Z53A 1LLCA 4CXMA 1RXYA 4UFNA 1QKJA 3T9BA 3B89A 1G2OA 1XF9A 1RQLA 1UFVA 3DHVA 2A0YA 3DD1A 3ORRA 4L8VA 3WLPA 2H1OA 1PR9A 4P81A 4U7DA 4MKGA 4E13A 1FSZA 1T3ZA 4O3FA 4QBGB 3WLOA 2YICA 5JCZA 4FGLA 4TT3D 1V96A 1L7NA 4DHEA 1YCDA 3DVAA 3O9VA 1K8ZB 2ZSDA 3LC7O 2Y05A 3NV7A 2OAGA 3VKUA 3ZXSA 4KW7A 2EFYA 1P6XA 5GJVC 4A0QA 4H59A 1OYVA 3IP8A 4TLDA 4HNSA 1P4RA 4A2PA 1U8XX 2B1JA 3EQ2A 2O8CA 4N7MA 2BFCB 2WEKA 4M9CA 1JQ3A 1PFYA 1QZ3A 3O75A 1Y5RA 5LLTA 3GDHA 3SBEA 5JW6A 1VCNA 1X7WA 4I50A 3QMVA 2DC1A 1T10A 4MV6A 2R7MA 2VBFA 3O2SB 1Z08A 2H4YA 3E4CA 2MOKA 3GJ0A 3FNHA 4NV1A 1V8FA 2FZCA 4LNUB 4BNNA 1RXEA 1BRMA 3L7DA 5KYUA 3VSDA 4EUSA 1X1SA 3B82A 4IEIA 3IUYA 1HC7A 3OZSA 4YIKA 3CLHA 2DBYA 4TVBA 1J09A 2H2HA 3T56B 2J5BA 2Q5CA 2WG1A 5C1DA 3RUCA 4EMSA 1QVFB 1VJGA 2O50A 1H1DA 2TRSB 4YJ2B 4ZT3A 3SDSA 1QKIA 1E7QA 4RPLA 1IONA 1F5NA 1J23A 2J5KA 3T1TA 4X93A 2IYXA 2LCQA 2KW5A 2QN7A 4N9WA 4E7PA 1GKLA 3O4RA 3OKPA 3I5UA 1E9FA 4WNYA 5EE3A 1PJ8A 3ELDA 4ESEA 1OI7A 1SFRA 3NGXA 1X7HA 5EWLA 1FDOA 3GHYA 3FPEA 1RC0A 2O2ZA 2XVXA 3ZLVA 5J58A 4XORA 5CB8A 2FUKA 4QYTA 4XIIA 4ASUD 3J81k 4HH3C 4BU0A 1A7JA 2XQFA 4JC8A 1RQ7A 2A2ZA 3U49A 3M4ZA 5BSRA 4DRZA 1JDSA 5NLLA 3UN1A 1ONNA 3EGWA 2EIHA 1C0LA 3STTA 3PJDA 4LK3A 5CMLA 2Q1YA 2C9CA 4EENA 2OHGA 4JUFA 5DI3B 2MCFA 3UYKA 2RGAA 2Y4OA 4LHEA 4NE9A 5KU1A 2P9ZA 4KGXA 3RIMA 1YBFA 4BQNA 4C0XA 3JQGA 1VPLA 3H16A 1VF7A 5HIMA 4FOPA 2WAOA 2BYTA 2UUAB 3UBTA 3KQYA 4EHFA 3W34A 1SKYB 2G5PA 1OZ0A 1S7GA 3HJRA 4IUCS 1N9KA 5ES4B 3Q7TA 3SS9X 2H1HA 1SXJA 2VDPB 9LDBA 1B76A 2FMFA 4GPIB 1QDLB 3QXJA 2BMWA 2Y1GA 2AZDA 2Z6VA 4S3MA 2H2IA 3LPMA 3WIUA 3HKEA 5HFAA 5GIOE 1RI3A 1SC3A 2W2MA 1T2FA 1TZCA 1ZFNA 3G2NA 1ZD1A 3JQAB 4OH7A 1JFSA 1O9GA 1A5BB 3HCRA 2LV8A 2O5VA 1E5TA 1DNPA 2R6GA 1FFEA 2WF7A 3QF7A 1NURA 5FPTA 1OVMA 1ID1A 2JFYA 3C6QA 4XSVA 3D6UA 2B2CA 5K8VA 2Z9BA 3VNRA 5LU9A 4C3UA 3ZCSA 2ROQA 2GM9A 4B76A 3ZTWA 4Y6SA 1RJGA 5CNKA 1E9RA 1O6ZA 2P79A 3E2PA 1GRRA 3CWQA 3EPRA 4A6DA 5L3VA 4LF9B 1NTRA 1YC2A 3CHYA 2NUBA 3BXGA 3V42A 1XLWA 4B7UA 4YT8A 5BURA 3S6JA 1QRSA 1HLFA 1L7OA 2XUPA 1EWTA 2BGKA 4QUDA 4TV8B 4G0VA 4WLOA 1IIBA 5AVRA 4DN6A 3UMGA 3CZAA 2RJ3A 4ML3A 1N3YA 1A4IA 3C7KA 4OK3A 3H9EO 3IUBA 3K70B 5F9HA 1K27A 3B36A 3WYDA 3U13A 5KYYA 3KCNA 4J2HA 1LDBA 1X15A 2E87A 2WILA 2PH5A 3KL4A 3CZMA 4GRDA 3GXBA 3GN1A 5T6MA 5EYPB 3MWJA 2FP3A 4NJEA 4B6FA 3GUUA 4O3MA 4URVR 5DX8A 1GA4A 2EBWA 2G04A 1T4DA 3EBLA 2DBZA 4HDNA 4IDDA 4JYBA 2I6XA 4HZGA 4AZWA 2Z2JA 2DU8A 3AKDA 3SHWA 1LZLA 3FI9A 2QMOA 4DV0B 4F9TA 4KE9A 4ZO4A 1CC1S 4CNQA 3PUIA 4BV2A 2AQIA 3RFTA 1VSUA 1PW7A 5JBQA 2O7SA 2RSLA 4KVAA 4ZT7A 3JD2A 5ERYA 1IN8A 3ABOB 3HKBB 1HQDA 4LJRA 3ENQA 2HL6A 3DCYA 3O73A 2W2LA 3PXUA 4RH3A 5EKDA 2B8NA 2J1LA 2H1LA 3AZPA 3LP8A 1EVKA 3F6YA 4O4LB 3ZJ4A 3H19A 2W6OA 2XNDD 3N6VA 3G71B 1CY1A 1V4VA 2GCEA 1FFAA 3H2HA 4ZO6A 3X44A 5KJFA 5L8VA 4XQEA 4Z4FA 1XZCA 4X0CA 1C14A 2OV1A 1D1SA 3B1XA 3GUCA 3OZIA 2O2HA 4Z8XA 2NQTA 1GZ4A 2GLUA 1Q12A 5LBTA 4BZPA 1YZLA 2DBRA 3AKCA 4NENA 3IJRA 5CNMA 5DASA 5DRTA 3C3KA 2WSBA 4KLRA 2J0QA 3A36A 3TLXA 3QFRA 2GDJA 1ZSYA 3QTTA 3ZDBA 3HKDB 1NQAO 4XWKA 5B1SA 4PPYA 2OSVA 3WZMA 2PT5A 2G88A 5E1OA 2O0KA 2LNDA 1VQPB 3ISJA 2Q5EA 5CVUA 4DLXA 3F8TA 3HA3A 2VBSA 1T4GA 1I01A 3EXIB 1EG7A 3MK31 4AX8A 3W5CA 4FFWA 2GAJA 3VRHA 1U5AA 2PEZA 1PGQA 1S89A 2G1KA 2SICE 3QW4B 4BP9A 5F3WB 4WXHA 3N3AC 1OLUA 4DYDA 4QODA 3I2FA 3JWEA 4ZZ3A 3I12A 1JDPA 1PUIA 2X3FA 1PO7A 1XAJA 2LXNA 4MQEB 3WQBA 4B4OA 3Q9NA 1O08A 1JAIA 2EJBA 2IV2X 1WOOA 5HBGA 4LOKA 1SJ9A 2VAPA 4COOA 2JJ8A 1X7XA 3IB6A 2NTJA 4MWTA 2PBFA 5I7WA 1JWLA 1ZEMA 3EDQA 3HFJA 2QTVB 3RRMA 5CGZA 1UQRA 2QJWA 1P2FA 2N42A 4GXRA 3HEBA 3UZUA 2ZPTX 4KN8A 1IUNA 4J2OA 4OHOA 4ZZ2A 3TNJA 1H2HA 4E33A 2HRCA 4F91B 5K8IA 2CHVA 3DBIA 3GLVA 4RDXA 5DTMA 3RRYA 3VJRA 4LOAA 4L16A 4ZHQF 3N86A 2UZ3A 1BMFA 4M1WA 2F3PA 2X6XA 1SUCA 2OYSA 3KUKA 5DIFA 3RNLA 1MMFB 1ZJJA 5HQ3A 3G02A 4Q05A 3QA3E 4OM8A 5BT8A 3B3GA 4JKYA 4GUDA 3JRXA 4UBOA 2IU3A 1KJJA 3K70C 2CWWA 1DTWA 4PPFA 4RKEA 4LS3A 3WL6A 4URFA 1M54A 2ZZEA 4NK4A 1XAHA 4PN7A 3ZWNA 2WZPP 2VTVA 3NHRA 1IWOA 3OQIB 4D4KA 3D6MA 2FHPA 7MHTA 1HE1C 3AVXA 4RHUA 4XKJA 1KDTA 4CLRB 5IKXA 4DR2B 1X1DA 1Q77A 2VNKA 1U7OA 2AN4A 1QRAA 4BC1A 5KSYA 4FXUA 4NOKA 1QR6A 1XN1A 3SOZA 3EEOA 4H17A 3ZH9B 5KHOC 1Z56C 4OJMX 1BDIA 5HTKA 3O93A 1C9EA 4OQZA 2JD2A 2OHHA 4I99A 1J2EA 2ZE6A 2NZWA 1KBQA 3THRA 2I4IA 1P72A 1XKQA 4M9RA 4KMRA 3R6WA 4LY6A 4EKIA 4RDLA 4MEAA 4R7GA 3RABA 3G0BA 1FTGA 1U0LA 5GAJA 3TFQA 5FP0A 3U3MA 1QK5A 3CSUA 1GUYA 2CLOB 4OU5A 1TTTA 1RADA 2Z2XA 3BCUA 1P3Y1 2H63A 4LF8B 1HDZA 5JCJA 4JV5B 1CQIB 3KV3O 1FJGB 5I9MA 3C16C 2HW8A 1CS0B 5LP1A 2LWIA 3EA5A 3ZCUA 4YGYA 3P2KA 3OM1A 5T4EA 1LBEA 3CPJB 1ZGJA 4JLPA 3F98A 2PYDA 4YDRA 2RGYA 1DG3A 1PAUA 2J4FA 4TVOA 3W9SA 4HNUA 2AKAB 4UZEA 2ETXA 2UU9B 3KAKA 3U1TA 2JJQA 1YR3A 1CY2A 2I2CA 1R6BX 5JCPA 2EHJA 3SKYA 4K3VA 3UJ8A 5IJWA 3HXTA 4KFTA 4JU9A 1GG2A 4Q9KA 2PE3A 1O03A 2XRMA 2H0RA 3IMCA 4PHFA 1ZNQO 5JNWA 3GLIB 4HE5A 1RYEA 1A4XA 3JWGA 1R6UA 3U4DA 5JHHB 4BJ6A 2AN1A 2WDPA 3L1UA 4EK9A 1WCIA 4ZVVA 2IGTA 4H6VA 4MR9A 2Q5FA 5EHGA 3LUGA 1F17A 3I34X 5EQJB 821PA 4L0QA 4X5OA 1WCWA 1H65A 2HA6A 3HGTA 3QUAA 1E9EA 4P3XA 4QQKA 3DOUA 1JWBB 1Z4KA 3L6RA 3WLRA 2YQZA 1C8VB 3UJBA 5K05A 5LQMA 1W35A 2WM8A 4H77A 4KN9S 4P3PA 3V80A 3V9PA 2YWCA 1QRUA 4GMKA 1CUAA 5AICA 3QSYA 4RGVA 1QP4A 3OO0A 3SVTA 2C1ZA 1M34E 1DFIA 1CUYA 1UFRA 2K6GA 2QGFA 1YJAA 3FR7A 3T9FA 3HKDA 3NHLA 3IB3A 1PT6A 1EX6A 3K31A 3N28A 3OY2A 3N8GA 4EELA 4CGZA 3IR6A 3LJKA 3K2BA 2IYRA 4HQNA 1L6IA 1TMYA 1YS4A 1KEPA 3DVSX 4MHOA 2NU7B 2VT7A 2VZEA 3GZJA 3CSSA 2PIDA 3UEOA 1Z25A 5EHNA 2B5WA 2J46A 3OM9A 3QU4A 3TTYA 1NI4A 1QCDA 3HO6A 1E6UA 4IIXA 3UV6A 3O8LA 1P3DA 3U4HA 3OJOA 2H9IA 1PFUA 1ZBDA 3B2NA 5GV8A 1PR3A 3QPDA 4QHTA 1GITA 2Q4RA 1CUBA 4AMUA 1Y3FE 4WBXC 5LYJB 3DO8A 5TPZA 3OPOA 3S2UA 2RBKA 3H86A 5KHLB 2OPBA 3EWIA 2QX9A 3A1VA 4HQLA 3BKWA 5FFFA 4UTRA 2R7AA 2R96A 1LCIA 2UAGA 3MTQA 3OD1A 4JOBA 1T0BA 3TLEA 2PPLA 1I2ZA 3BMQB 4TWRA 5FDFA 3VU1A 4ZQGA 1TKAA 4Q39A 4RY8A 3W4IA 4BKOA 1NBME 1EDEA 3A2MA 4XYLA 3JTMA 5JDIA 3H4TA 3W2TA 1D4OA 3Q8XB 3OJFA 1CF4A 3LK7A 1SVWA 3KX2A 4OJYA 5JVDF 1IXZA 2VBIA 1XKLA 1YMVA 1Z6QA 3H42B 1QAQA 3SR3A 4B3TB 4I1PA 5E8JA 1NL3A 4CM1A 4YUWA 3VAZA 3OE1A 2BMAA 4J0DA 1JHUA 3DDNA 1H0RA 2A0XA 2BGNA 2PS3A 4DLLA 4AI6A 3GMIA 3TI7A 1XJQA 4XOPA 1VM6A 1V11A 3LY9A 3UK6A 5LP6A 4PANA 1A8HA 1ECCA 3AP2A 5JFOA 1IBLB 2A0KA 4EHJA 2VH5R 3NYWA 2AQKA 4KDCA 1KHHA 2B21A 3KUCA 6LDHA 2D0OB 3RYTC 2XBUA 4Z4UA 2XCTB 2A58A 2PMBA 3G0HA 4Q3DA 8AT1A 1RS0A 3PNPA 2DIEA 4EPVA 5MFZA 1VHOA 4YUVA 2C8JA 3WTBA 2NO6A 3NDPA 3HHPA 1XE1A 2PWZA 3BORA 3ODPA 2ZB7A 1KC8D 2QRPA 3JASB 4B45A 2ID9A 1H2XA 2PS9A 1RWNA 3WV5A 2DPYA 4ZK6A 5BOVA 3GMTA 3LVRE 3OKXA 2GCNA 3OLYA 3SY8A 4PNEA 3EX7C 4HSGA 3L4BC 2A35A 4UPEA 2BEKA 1T3HA 4INOA 4C7XA 1MEJA 1R6XA 2HO5A 3OZCA 3PXXA 3QHAA 3QYAA 2VXYA 4JYPA 3ZQUA 4HMPA 5ENDA 3IX7A 1KK3A 1M1YA 1ZH6A 5CEEA 2QMUA 4HQOA 1VL8A 1E20A 5BPHA 2BSXA 3FCUB 3PEEA 1Y9EA 3PUZA 1NDQA 1UMDA 1XTJA 3NEPX 2ZB2A 1ZK4A 4F45A 5EJEA 3EIXA 4EOGA 1EVZA 4RTLA 3Q40A 2HRRA 4PLFA 3RS8A 5BWNA 4B4WA 3ZZTA 3VAYA 1P5HA 2J0EA 3LZCA 1BU8A 3QWBA 5REQB 2BKUA 2CK3D 4C7KA 4P6VF 3WRVA 1G2QA 1EQ2A 2DM6A 1GOTA 4CUZA 2B8WA 5F1OA 3IKVA 5D3MB 1EGMB 2WYVA 4ILEA 3QV1A 2YRXA 4R8VA 1JI3A 1WOPA 4TMKA 3I30X 3F3MA 4JEUA 4NYMQ 1TL7C 2FWJA 1PEYA 1ZOIA 2POQX 3Q9UA 4UQPA 2FDCA 3PQ3A 2AG0A 4NBNA 1NBOA 4HUQA 4AMVA 3GPLA 3ROKA 3MWEB 4JT8A 1O6BA 4RU1A 4E1AA 3QIAA 1NY5A 2HMTA 5KWIA 2VDMB 5T8KA 1F3LA 1RMYA 1CRZA 3ZVNA 4S2EA 1W0KA 5HKKA 1E98A 2YNMC 5EL0A 1MQ8B 5LA6A 1PWXA 4F5DA 2VZLA 1J22A 5L4NA 2DWQA 2X1HA 3L1KA 5KYVA 2GXAA 5DTRA 4G36A 4M1QA 4I2VA 4KXNA 4DJDC 3OCJA 3HM9A 5ILGA 1VQKB 3QVGA 4YMGA 1PWZA 4BS9A 5FD8A 2RG7A 1F3OA 5F7OA 3NOVA 3H99A 1B43A 3U7QB 1H2EA 3TNDA 1YACA 4S1VA 4W1PA 3G0CA 1Y4AE 4IH1A 3WDKA 5AQ1A 2PWAA 5EEHA 5ESRA 1I2MA 1PS0A 4FS3A 3D6FA 2IDJA 1RAIA 4NFHA 2C5BA 2ACEA 4GQAA 2BEUB 2O2YA 2ZQZA 1PF7E 3DL4A 1Y5NA 2OO7A 4MW1A 1FDWA 3SJAA 3TX6A 1C1XB 2D1TA 4FILA 1AKMA 1IXSB 1QS0B 1N8TA 3FROA 5AH0A 4D9HA 5K6TA 3RRFA 5K3SA 1I5RA 4MV1A 1VFNA 5K8JB 5LXTB 4CLOA 3TZHA 3K0KA 4OB8A 1OZAA 5FTMA 3R5SA 1D8TA 2ZDHA 2FMHA 1YVDA 3O95A 1YRAA 5DM60 1U0JA 2YFQA 4MLCA 3UWKA 2SKDA 2I4LA 2UUCB 1CEYA 5BXYA 4MVCA 1EFRD 3EVAA 3VZPA 2IHBA 5C1IA 3SXUA 3B78A 1XJWA 3Q7QA 2YIJA 5H80A 2J85A 1I2BA 1HVXA 1DBIA 1L3IA 2W48A 2XYVA 1PJQA 4NBWA 3RFFA 2R11A 1N7GA 2QVBA 3QUQA 4JN6B 2OILA 2A5JA 2Z5FA 1VI6A 4GPBA 3TTVA 5FX2A 5I7VA 2C9OA 2GBLA 2GJ8A 4DWOA 4B17A 3A4VA 5GVSA 2ZSAA 3AZQA 5T3UA 2Q07A 3WAKA 3JYPA 3UJAA 4UNSA 1V1RA 1G2PA 2B1GA 1TKRA 2FJ0A 4EYOA 3FCAA 1XZ8A 2B83A 4M0UA 4RGQA 4FE7A 2XMCA 4LYDA 1UL1X 3GFVA 1NLUA 2ZTUA 5FA6A 3W9BA 3CRMA 3OCXA 2AJDA 4NYIQ 3CBQA 3BWEA 1U4OA 1SXIA 1SUIA 3UGTA 2RAUA 2ZVJA 2CNOA 2J7PA 3EHDA 3HVJA 2MHCA 3PCXA 2VBCA 2I8AA 3HU3A 2X6WA 1R50A 3IVRA 1IY0A 2I2BA 2WYOA 1WPCA 4TLMB 3ETLA 3ZUPA 3REGA 1MOQA 3CC4B 4YRFA 4UU8A 3O82A 4GLOA 1KGSA 3HGMA 4UUNA 2G9QA 5CJ2A 1ADYA 4D56A 4IUYA 5IYQA 5ITZB 2HJSA 4V3CA 2OXTA 3E3OA 3V1LA 1JHYA 4FE4A 4KE8A 1BWPA 4WMLA 3B1JA 3EG9A 3S99A 2IXGA 3MG9A 4GKBA 1JBKA 4FN5A 1X86B 2CHGA 4MVJI 4ENVA 1LJUA 3B7PA 3UG7A 5FAXA 1MO6A 2V6JA 3PJRA 3CLKA 4XL9A 1PQYA 1FFWA 4JWTA 4UVIA 2VC2B 2PM8A 4FI3C 4WNAB 1DVRA 4BFUA 3CUWA 4OOVA 3K92A 2IRWA 1N9ZA 4V0SA 1A8PA 3W90A 2C4KA 3ZVKA 3KOZA 1JYFA 1XC7A 1GILA 3TXXA 2E82A 3HV2A 4KBGA 2DF8A 4IICA 5TQ0B 1VPWA 1YDEA 3W9YA 1DKUA 1E92A 3I83A 1P39A 3O0DA 3FZEA 2Q4DA 2NVBA 1NXOA 4DQUA 1SCNE 3M6XA 4MUFA 2YFYA 4L8LA 2P9EA 2XCLA 4GPEA 4IZOA 5A9TA 2PAAA 4C7OB 4XGIA 3UPUA 2J30A 2WWWA 1BLIA 1PEKE 2ZBDA 5I48A 1RXVA 1Z22A 4YMIA 5DFAA 2EYUA 2GXQA 1EE1A 2GM3A 5FUBA 3RANA 4DBVO 3C3CA 4D79A 4ZT6A 3OMLA 3QEMB 5B12A 1JBQA 1BQEA 1VQMB 4Y2GA 2Y93A 5LQDA 3E5MA 1J70A 1Z0UA 4MGEA 1PR4A 2XBLA 4TL6A 3N87A 2I0FA 4GR4A 4MTCA 1E79D 2NACA 4D4JA 3QFSA 3QKWA 1S4QA 2JEYA 2YWBA 2NPIA 3FZNA 4P8RA 4IEFB 4ZJUA 1UUFA 2OM2A 1Y8CA 1RI2A 5DS0A 1PWYE 1RWWA 2HA3A 1K6MA 2WHEA 4FSHA 4PCVA 5EFOA 1OLSB 1U3VA 3T54A 4CM9D 5T41A 3QBDA 1RHRA 3SC4A 3TIVA 1Q7CA 3VZDA 4RTSA 2BJHA 2H57A 1QQBA 4URYR 3FOEC 4XLAA 2XNKA 1GGJA 3EARA 1T8WA 3HVKA 3EH2A 3LBNA 3WQRA 3I4CA 3CD6B 4HE6A 4LJ9A 4MARA 2AX4A 4QYXA 2JNWA 3TGLA 1GGVA 3MS2A 1QCCA 4B7AA 2X1VA 1XZNA 2G4CA 4G25A 4UJ3A 3GEMA 3JQCA 3PFKA 1GQOA 1OTHA 4PZPA 4Y8VA 3OOCA 4WCFC 5B1DA 3UXEA 2BRUC 1W2WB 4F3YA 3S2YA 2OBMA 1Z73A 3MSCA 3SXPA 4BRSA 4CF4A 1JR4A 5JFGA 1WQ4A 1XYGA 4J7XA 4OQQA 4PC6A 3F5QA 1GAQA 5K99A 4KI7A 4ND8A 3ZKWB 3S1SA 4JD5A 2OGSA 3ETJA 1I4OA 3O94A 2CGEA 1ESMA 1DUIA 4JLMA 4QFDA 3WL5A 4OOSA 1BEZA 1E1NA 1OX4B 2WUDA 4GBED 5D5HA 5DHPA 3VPBA 1Q7GA 4CIBA 3LUJA 4LGYA 1SKQA 3ZJYA 1NGSA 1HQKA 4U2BA 3D8UA 1T4BA 4E15A 3GJZA 3LVQE 1MV8A 4G4IA 1B15A 1HSZA 4ZO9A 3GFBA 5EIAA 5FRDA 3S70A 4ES6A 5ELXA 3WQHA 2HFJA 1NVAA 1YL6A 3VU8A 3H1TA 1FPMA 3IBTA 4GEGA 2YY6A 4BZZA 5KWJA 1ZR4A 2F8TA 4GBMA 4U2GA 1NZFA 5AJHA 3E5NA 5DX0A 4YMVA 1KEEA 1QC5B 1QNLA 2ARKA 4ZGGA 1E3WA 3TL3A 1OAOC 1RC1A 1MRZA 3SYTA 2QXTA 3RVPA 3AEZA 3TYXA 3A3OA 1DAOA 1ZX1A 3WIEA 3BHMA 1ZGZA 2BR4A 1NX9A 1G0NA 1XZDA 2ON6A 3MD0A 4ZVKA 3N58A 4CL8A 4TT8A 4B5LA 3L0BA 3WQQA 1GYPA 2I65A 3H6KA 1SXJD 1XE3A 2GMWA 1IK6A 2JDID 3O5AA 1CG6A 3EWNA 3FUTA 3L77A 3MM4A 4IXTA 4K88A 4WXPA 4RFSB 4WVFA 2XOXA 3Q41A 4YLGA 3COJA 3UWPA 1NJGA 2N0SA 5ALLA 4TWIA 3KAJA 4QEKA 3EZYA 4LVNA 3V1NA 2IEGA 3TOZA 1VSTA 3L05A 1Y8ZA 1D4FA 4U9IS 4LC1A 3CG4A 3CF4G 4ZRDA 1GPLA 5F4OA 1KI3A 2DWPA 3GT3A 5DEOA 4EY7A 4FGZA 1FJ2A 4LDPA 4NBRA 4CU2A 1H8HD 3SZLA 4QG3A 1NVDA 5H5JA 1ONBA 2YX1A 3D9QX 3N2EA 2ATEA 4M22A 4PIVA 1TU0A 2FSIA 5FBKA 2BTOA 1N6HA 4BBPA 1NRXA 1F2VA 1ODSA 1L0BA 5KWEA 3GLTA 4DWJA 1AE1A 3P71T 1M73E 1YQQA 5EJ6A 1L4NA 4ZHQA 1VJ0A 1A88A 2MSCB 2F4NA 1E64A 1XJCA 4YUZA 4ZYTA 5IUJC 2RB5A 5SZKB 1DRUA 2BCEA 1G9TA 2NXWA 2ZAIA 3KQPA 3A05A 4P86A 5K0JA 1Q3KA 1M2VB 3VR5A 3AESB 5ULLA 1XRJA 1YR2A 5CNIA 3WLIA 4GMDA 1XTSA 3PA6A 3CH4B 3EEYA 1Q16A 1K73D 4GPAA 1HORA 5GONB 3T7CA 3SEZA 2O4UX 4HKTA 3AWIA 4FM9A 4MS1A 2C7GA 4RQAA 3LHSA 4UQOA 4GMHA 3VO1A 4UAGA 1QO7A 1A1SA 5BSKA 3KLPX 1CT9A 1LNQA 3R75A 4XTRA 2DUMA 4ZZIA 3FOZA 3BGVA 1B93A 5BNZA 1C1HA 3QA9A 3SICE 5EZSA 2IH5A 4O2BA 3WGZA 3LT1A 1BVRA 4NFLA 4D99A 1JEYB 5G1OA 1EI9A 2X4LA 3WBKA 1GL3A 3CWZA 3FOCA 2X0FA 2ZYUX 3C15C 3GA5A 3P9IA 1L8LA 3DXFA 5ALNA 2L19A 2OORA 1FK8A 2H7CA 2R8EA 3I3SR 4IGEA 4RSGA 5TMEA 5BQOA 2G3YA 4L15A 2WJWA 5AVXA 4FWIB 2DSTA 3NJ8A 1KJNA 2WHYA 3WLMA 1WV0A 2P0YA 4GLJA 5M04A 1ND6A 5HCUA 3PYXA 4M55A 1WQ3A 1A3CA 1L5HB 2ASVA 5C46F 1QPGA 4JEIA 3TQOA 4BNIA 5TMPA 2W98A 3KKOA 4WZLA 4PRYA 2ZSJA 1ZA1A 2JEZA 3WRXA 2CCKA 2OCLA 3IS3A 3TUZC 4BXOB 4TMZA 5EZ6B 3L46A 1T3GA 5DHAA 4KKSA 5CB4F 1HLPA 2QLJA 2DVMA 1NVGA 1KZYC 4IDPA 4FW9A 4RHYA 5JBIA 1LH0A 4WLUA 1MDFA 4IDBA 2HH9A 4QU9A 1OT3A 4CN8A 3TO5A 5TQ2B 3FFTA 5IZCA 3THXB 3W79A 4A26A 4OF4A 2R1ZA 2V7VA 4NMMA 1S3GA 2DPMA 3N0WA 1O0BA 3EODA 1UK6A 4X94A 3TLGB 3EIHA 1Q1NA 3WYBA 5AHWA 5L3RA 5JI2E 3HCAA 5G2OA 5JATA 1YZVA 4LRXA 3BE6A 4JLDA 1SXJC 1E2QA 2DE0X 4UM7A 1QHHA 4B6EA 5G4KA 5LC1A 3IR5A 4ND8B 1EFHA 4YRRA 4Z1MD 2VWGA 3I52A 1JBEA 2ZBRA 2OCPA 5C80A 2RMKA 1SBZA 1U9JA 3S44A 1LBTA 1Q50A 3ENZA 3ZJVA 3EZNA 2ZTVA 2XTNA 3VBEA 3NKVA 4AJJA 3MCAA 1KOJA 4C43A 3DOFA 4PWYA 4RQTA 4N0EA 3SJUA 1EJ2A 1F6DA 2NO0A 2UV8A 1L8OA 1ZVQA 3GRPA 5H8WA 1IQ0A 4AAYA 2ZW9A 4PLGA 3CE6A 4B6SA 2V0CA 4Z7JA 1YRQA 1NQVA 5AM4A 2AEFA 3SZGA 1WMBA 3NH6A 4R1SA 3SBDA 2Z2ZA 3QU2A 1M6HA 1Z4QA 4X54A 5ALYA 4G4SO 2BTEA 5CDFA 3D1JA 3JWHA 4IIUA 1JHXA 1PGJA 2JA1A 2GEJA 4XAQA 1DCTA 3C1AA 2FE1A 2VNSA 4MVJF 2F1IA 3LQ1A 1EFPA 3MJEA 3S3TA 2V1UA 4P1ZA 4GGMX 1ULHA 1TEXA 3E58A 4N5HX 5CX1B 3ST7A 2VDNB 2TYSB 2WD7B 2PXCA 3P2YA 3FM9A 3BK7A 1QVWA 3X2SA 2B61A 5J4KA 3P2EA 2RKOA 4G85A 3IJ5A 2M6LA 1MRSA 4XVQA 5HFJA 2HCRA 3CH5A 3L8EA 3KYCA 2ZXEA 3WYNA 5HZKA 1PTKA 3K2EA 2XQGA 3ZDRA 1JG4A 4KBYA 2FVYA 4QGBA 2EDAA 2P9QA 4DW8A 3U1BA 3LO8A 1HFJA 3KKNA 4PLYA 4HLCA 3PIIA 1UBNA 4GOJA 4P6YA 1V5EA 4ZT5A 1V5IA 1HDYA 1X0VA 1N05A 1KY3A 3U44B 3ETDA 1E99A 1OV6A 4Q6BA 3GMSA 4RK0A 1RXSA 4FNAA 3PEFA 4YP6A 2XCSB 3E15A 1WUIS 4MWSA 2CE7A 3K6KA 4BB6A 1Q0RA 4KXUA 4JJZA 4G8BA 5JSHA 1T3LA 3LRTA 4AYWA 1ZZGA 1F5SA 3BXOA 2OKCA 3ILVA 3N2GA 1KYTA 2B2NA 4O1HA 2PCLA 4FDAA 3NWBA 5EXXA 4GF5A 1UXJA 2XCOA 3C85A 4RM2A 1GL7A 5ER9A 2XT0A 1T34A 4OSEA 3HKEB 4AJNA 5C9ZA 4P3OA 3F47A 2D62A 3IKJA 1GZ5A 3PC3A 5TLSA 3FF4A 1BG6A 4CDNA 4Y7CA 2O8BB 3T3OA 1E5XA 3CLRC 3JQ7A 4PLTA 1DL5A 2GERA 3CRVA 2GYWA 3IXMA 4DILA 4LKRA 5FWDA 5HTOA 4NMHA 2PX2A 1UOQA 1VTKA 4WKGA 1LX6A 4KLCA 3QPBA 3GC6A 4U2CA 1TK2A 4L76A 1U8YA 3SHFA 3WI7A 1ZVMA 1BFDA 1V43A 1YT5A 1ZRNA 3FWHA 2XEXA 2PX3A 3WC4A 2Q8NA 4C21A 5JS1A 4G01B 1U63A 1JG7A 4O4LA 1U3TA 1AHHA 3TQRA 2AFHE 4DM7A 1RIIA 1M2KA 1BW9A 3PVDA 1SAYA 2DCMA 2JKVA 4QPCA 5KTRA 3NBMA 4KWTA 4G8CA 4X8LA 2YJNA 2B9EA 3ITEA 3W3AH 4BWYA 5ADWA 4PN3A 1GXSB 1C3OB 4KNYA 4CIDA 4RXMA 2AFIA 4LJSA 1SIUA 4PAAA 1SU7A 1UJ6A 1SU8A 4KQEA 4BECA 2EBFX 3WMGA 5KYYB 3OH8A 4S0XA 1ADGA 2BKVA 3X1YA 1CUJA 4K87A 5TEVA 3UAZA 5TF0A 1GAEO 4X44A 5CFMA 3PFWO 3AF5A 3LVBA 2CHEA 1Y82A 4P4LA 2AK3A 3RVSA 4V02A 3BYZA 1LSJA 4H1HA 3LM8A 3NOQA 4DABA 5F7JA 4EG3A 2HIMA 1W73A 3ND5A 4FHCA 5IRCD 1QYWA 2B69A 3FDZA 4M0CA 1ZCJA 1MDBA 2AUTA 2JARA 1UT6A 5KREA 4JYMA 1VIDA 2YWHA 1EJBA 1V39A 2OGTA 3BRQA 4F5WA 2AWOA 1YMQA 4TL8A 3ZXIA 3OF3A 4CFZA 1T3SA 3DZ8A 4YROA 1RZUA 3CEAA 4GSYA 2AOTA 4IDHA 5K0ZA 2AOWA 3AXTA 1KEZA 2VAVA 3SHQA 3KSMA 2QG4A 1VCHA 4BTEA 2I4RA 2PUWA 1JEDA 4R41A 1U9ZA 1J2JA 3ZGOA 4D42A 1CUHA 2I71A 1BYIA 4QPJC 1ZCZA 4RWZA 3TKLA 4RD6A 1M7GA 2IVZA 3ZV3A 1NKTA 4WA7A 4Q9HA 3LNTA 2FEMA 4CRWB 4EHAA 3L8CA 1U98A 2FQQA 2G77B 2G7ZA 3HN6A 4OL0A 2HZBA 3AUUA 4POAA 5IN5A 3VSAA 1T6NA 3NHBA 4XFDA 2QQEA 4KIUA 1E2DA 4N40A 4QUGA 2QTBA 4D3FA 2Z0MA 2VZ8A 1F14A 2IFTA 1A76A 1WD7A 4M0KA 1W2HA 5FI3A 2DKOA 2R00A 2CLIB 2NVUA 3AFOA 3COVA 3OZDA 3GZNA 1ML4A 3UF0A 2JBWA 2PD4A 3LFUA 3R5JA 4BWGA 4INZA 4F84A 2WQ7A 4KQKA 1OQAA 4ZEOA 1I5EA 1VQ1A 1Y3IA 5AM0A 5I9BA 2R7LA 4TRMA 5E1DA 5I7UA 1JQ5A 3OHMA 3V4OA 2O06A 4OXRA 3SMQA 3W5IA 2PMDA 3VYTB 2DSNA 3UXHA 4CKCB 3OOWA 1JG1A 4PABA 4HEHA 4JLUA 5J1TB 3PT5A 4Y9DA 3N39C 5AOAA 3CNQS 2EGUA 4TKUB 2BDUA 4MB6A 3IAAA 4AJEA 4A2WA 4A6PA 1D6NA 4GPZA 1HF3A 2HD4A 3LW8A 3OC6A 1MZPA 2GT1A 1KMQA 3I9LA 1XMOB 2Y6VA 4EATA 3HSYA 4ND3A 3D5QA 2Q21A 3FOWA 4OEHA 3WDMA 4MKIA 3LXXA 3OETA 4AN0A 4RK6A 4BP8A 1TOAA 1NJ6A 1DBSA 3NBUA 2VRNA 4HDKB 1FFXB 2B98A 3R8XA 1IXYA 1ICEA 1WPRA 2XGSA 5A4AA 1ULTA 1TQ8A 1P4AA 5FOSA 4LFAB 1YFKA 3PU6A 1D5CA 1QLJA 2NM0A 3M70A 3MGCA 5GM2A 4BVBA 2WVJA 1GUZA 3ZHBA 4Z49A 1KI8A 4LZAA 5GJCA 3C5VA 1N8NA 1RM4A 4IMJB 5FTNA 5IAAA 2H6EA 2JB9A 4MSUA 2RCYA 3FHOA 3G6EB 3H2ZA 4D9GA 1OGJA 4WH0A 4FZRA 3RR2A 4JAVC 4X71A 4W63A 4D41A 4PO8A 4Z3DA 3HJTA 3MINA 4HWRA 2R8RA 1C3LA 5CCDA 1Q91A 2GYUA 1YVEI 2XNSA 5CLHA 4MR8B 3BK1A 4ZVNA 4HRYA 1WCIB 3DZFA 3W8EA 2JCXA 2HHLA 2CJWA 1HURA 1ZEJA 1T5OA 2FCRA 3A1FA 4KU4A 3EXFB 3PQEA 1DJOA 3ESDA 2D00A 1QDEA 3D8HA 4X1YB 5EHXA 1GNLA 4P2BA 2WFZA 4HNQA 4W5HA 5F9MA 3CVVA 2ZEJA 1VQ5B 3ADPA 1HWYA 1K0FA 3I42A 8ADHA 2R3SA 2XODA 3BJEA 1IWBB 3SEJA 4XM3A 1RE1A 4KV9A 4HBGA 4US0R 2CV0A 2F1JA 3N8KA 3NP7A 3A6HA 1SA0B 3BA6A 2COKA 3JQ6A 4X8HA 4J3NA 1Y7TA 1FDTA 3AHFA 1NJ2A 3OE4A 4K6FA 2GNPA 1XD8A 4YAWA 4JROA 3OLZA 2W70A 3PENA 2FP4B 3GZ4A 3E1GA 3QVOA 1F2UA 3VOTA 3PUXA 3FVTA 2VAWA 3TZBA 4E2WA 4YALA 3DYIA 3GBVA 5MN4A 2C4HA 4OREX 4CODB 1ZOPA 3WLLA 1U0NA 1LNZA 5KINB 5G41A 3O4VA 2NZ2A 2Z4TA 3BMOA 3FTNA 3GLKA 1HTWA 3HY3A 4DJAA 2QRNA 2J9XB 3LCRA 4Y30A 1NW7A 4R2LA 3SIPA 2DLCX 1ZUHA 2AOTB 2XD9A 4AKSA 2C99A 3HV0A 1X92A 3DZGA 5G4LA 5G1PA 1JQEA 4IY1A 4AUEA 5ICCA 5LFAA 3COZA 2P41A 2VJYA 3B8EA 3E2IA 2B4QA 5TMBA 3R7SA 4MPDA 2GN8A 4IWNA 2JVIA 2VJMA 1LFAA 2FKAA 4EZEA 2X8JA 1K92A 3SVLA 2D4AA 4H6PA 1A04A 4CLXA 4WBNA 4BPRA 5UKDA 4R0VA 1J0XO 2HWXA 2OB2A 2QTZA 2GCIA 4QUJA 1XTKA 3G85A 3OCUA 4YAEA 3O1JC 1SUBA 2EIXA 1PJ2A 4HNAA 4QYIB 1A9SA 1V37A 3PD0A 1XP5A 5HX7A 3T1YB 4G8JA 4A2CA 2VTKA 4Q19A 2PVSA 4XCVA 3B2QA 2MYTA 3CNEA 4PZYA 4L6AA 5IX8A 4ARZB 4PS1A 1MLDA 2G7MC 2NOAA 2J08A 1D4AA 4HGYA 4NWIA 5AJVB 2AI1A 1PNTA 3SX2A 4KWEA 4Q37A 1M76A 1RM5A 1UJCA 3P0EA 5C18A 3SF8B 1G8JA 3QEJA 4TTVA 3RKSA 3VJKA 4YUAA 2RGDA 2WK1A 4MRMA 2C00A 2VEOA 4NCJA 3VVMA 5F4JA 1BCSA 2Q3HA 2LIPA 2QTNA 4IWXA 4RQBA 4RNDB 4XDYA 1YIOA 1U0RA 3DPIA 2E4YA 2YJ6A 1DXQA 4M99A 3O4IA 1QO0A 2WLTA 3FMOB 3GN2A 3UJPA 1WM1A 2ESRA 6GPBA 2DFTA 1OB5A 1KFEB 1UJBA 2FSVA 1EVIA 1O94C 3FUCA 1XTRA 1YJ5A 2IP4A 2Q2WA 4DTIA 3KJGA 3T9EA 3VR0A 4DR6B 4I5EA 2IYPA 3GQVA 3ROPA 2UZIR 2XXJA 3VYWA 1JXMA 2DKFA 4UBJA 1LLQA 4Y6OA 3VMMA 5AXCA 1BD3A 2ZXFA 3HVHA 1L3BA 3NBZC 3T1NA 1NQWA 1U2DC 2OV4A 3C5EA 3PFCA 5HRUA 1SK9A 4US2R 4CT5A 5K01A 5IM4F 3AUKA 4WKCA 4PVDA 3MIIA 3ZXUB 3WL4A 1NT2A 4LDJA 1Y0YA 4NQRA 4M1OA 1GR1A 4IAOA 4U8GA 4QFCA 1F8YA 2YYZA 1JHPA 2IEIA 1MR3F 1YA8A 2ZQYA 5KZMB 1KMMA 1U2DA 2NTVA 4G89A 2R00C 1XDSA 1K9MD 2BLNA 4PFKA 1AKTA 3KL9A 4UUBA 1OKKA 4NP6A 2H9YA 1RKQA 3E7XA 3HBNA 2D2IA 1QHSA 5I9TA 3UPDA 3EPPA 1O94A 4X00A 4X90A 1D3AA 1KS2A 2E9SA 2VFAA 3WLEA 1KDOA 2LW7A 2R6CA 3AJAA 5CUQA 3KPWA 2IYQA 2ECOA 3C6ZA 3KB1A 4KQHA 2VNAA 5EIWA 3D7KA 5DYGA 2QW8A 5KJ1A 1SU4A 5HF8A 5ICFA 1PZXA 4ESVA 4Z1OA 1D2MA 1K68A 1C1DA 1ONSA 1U6IA 4QVKA 1CVLA 2PDAA 3CW8X 4D98A 4EKGA 2YFKA 1PGPA 2GRAA 3GJ4A 3IBCA 4JT2A 5H16A 9MHTA 5EPUA 1GADO 2IDMA 3I76A 1R5OA 5FUYA 1WD5A 2WJJA 1VMEA 2IEZA 3K9FC 3HAGA 3BSFA 1TRKA 5A5EA 4NBKA 4N65A 2GAIA 2I6QA 4PQYA 4PZDA 1D1PA 3DMPA 3UHPA 4ZDJA 3UWDA 3IQXA 4KKXB 5DBOA 3IO3A 3DEHA 1CETA 4W5TA 4BNYA 1JTFA 1DOAA 3G8AA 1Z5GA 3BMXA 3MILA 2HBYA 1L7EA 4HI0E 3HMKA 4YCDA 4C0KA 1D09A 5LXTA 1JFTA 4J9UE 3W4KA 4I8XA 1Z34A 5DXFA 4Z0TA 5A7HA 4C3ZA 3GBPA 4OB6A 3A4TA 1DAIA 4GOXA 3ONEA 3QELA 4PRLA 3RIEA 4BJ5A 3DE1X 4F12A 4H2DA 5F64A 2DR2A 3MWEA 4NHEA 2MYUA 1DEXA 1IXKA 2DERA 4EF6A 4OAPA 3WJ1A 4OXKA 5EQFA 2YXPX 3SZMA 2IE0A 3KJXA 3PGLA 1OWOA 3GLRA 2HNKA 4CTJA 2B5VA 1ZMTA 3DTVD 3U48A 3FZYA 4Y0AA 3CZ5A 3NI2A 4DLRA 3HZHA 2LZ0A 1NJ5A 4FD3A 1OWPA 4G5XA 1JEAA 2HEIA 2P4UA 4IINA 1KMNA 1U8AA 5KYNA 3M0EA 4LEIA 4X64B 1ORTA 4CE6A 2HQRA 4OQPA 5HIKA 4FNMA 2Q1WA 4QDXA 1OV4A 1VJRA 1C9DB 2WZBA 1IJBA 2WIAA 4GOMD 3ETEA 3UAOA 4P22A 1HFWA 1IULA 1PVVA 2GEVA 4R8MA 1O87A 5FR2A 3UMJA 4BLRA 3GRFA 3WKDA 4Q7JB 3ER9A 1P4MA 3U6BA 1RWBA 3HU1A 1EVEA 1JQBA 4IJ6A 5DLPA 5AOBA 5K2MA 4CLOB 4EX7A 5KU7A 3GCZA 4CL3A 2R44A 1B0UA 3DFIA 3HN2A 3QK7A 4RETA 1QYVA 1ZJWA 1OSNA 1G7RA 3FAKA 3DKKA 1RM0A 2E1RA 4E08A 4GOOD 2GZ2A 4LXTA 5K9ZA 4YCBA 4BNTA 1E89A 3LSYA 4P31A 1P7YA 4JT9A 2XYGA 3O8DA 4NJMB 3GLFA 7REQA 3FF1A 5DLYA 3RYIB 2F8MA 3PQ6A 3IODA 4XLZA 1CUXA 3N07A 2EW8A 4UEKA 4DARA 3ZD8A 4GNKA 5E2AA 5GONF 2K2WA 3DLPX 2V9ZA 1AF4A 4FB5A 2WMOB 1VL2A 3TKYA 3KSRA 1NN5A 3FUVA 3TRFA 4J94A 3K1TA 2CVOA 2PA3A 2DY1A 3W2GA 4DLUA 3V8QA 3ZN2A 4YEJA 1NXQA 5CYPA 4C2AA 4OX9B 3RG2A 1BFKA 1KPGA 4JKIA 1WLYA 4ZEWA 1U8ZA 1JP7A 3P2JA 2IE8A 4BO1A 1OH5A 1AHIA 4CT0A 5KOJB 4D6PA 2C96A 1QHGA 4GQBA 1EUCB 4IRMA 1QH0A 1Z3IX 1XTZA 1G6OA 2Y0BA 3PSHA 1DCMA 4J0CA 3HO1A 4MVJM 1J42A 1H3EA 3OZ7A 1PD1A 3WMWA 1CZOA 4YLEA 1ARZA 4Q3LA 5D6NA 1X9IA 2OXFA 2EQ5A 2P11A 4E5VA 3ZV4A 2X7XA 2ZCJA 1QMGA 5K3OA 1TQHA 3E53A 4RPCA 5HK9A 1OOEA 3W7VA 4N3GA 2QRGA 3H5NA 2FZKA 4MP6A 1VMKA 3KR2A 4M8LA 3QEBZ 3LYUA 3QW2A 2O0MA 2ZRDA 4LHXA 3EDOA 2VHQA 2Y1XA 4GHWA 3HJGA 4IIHA 3RBVA 1MX9A 1UOOA 1LX7A 4PQEA 3QENA 4D1YA 1YIJB 2RD2A 3W2EA 2JGKA 2FWPA 1IN4A 3RPEA 4EG5A 1BQ4A 2APJA 4WXMA 2QV7A 1W5BA 2PV7A 1DT5A 3A9TA 2ZT8A 3PL5A 4OFZA 4C0JA 1RWKA 1EH5A 4ZO8A 1OFHA 2Y77A 3ZWYA 4GC9A 4LMPA 1IQRA 5EUMA 2AFHA 1QYCA 5MN6A 2ZJ8A 5LZ5A 3WMEA 1KZ7B 1BTOA 1XHEA 2YUIA 3F7TA 3H7IA 2NAPA 4L3VA 2C1XA 7GPBA 5LZ9A 4AD8A 4YO7A 5HGXA 1EM8B 1WDTA 1N1MA 3DZBA 4PR0A 5FKJA 5JRDS 2WWIA 4GI7A 5BW4A 3FCOA 3NDRA 4LGCA 4UEOA 3MLAA 4ZQHA 1CZLA 3EA0A 3VR1A 2ECPA 4EYEA 3ZZ0A 1NYQA 1NVVQ 1T2EA 3N8IA 1EDDA 3C3DA 5FNVB 5C8DA 1CR0A 3PQ2A 5A05A 1RWPA 1ZJ5A 4CEHB 2FN8A 3ZKWA 1E4YA 3WV4A 4F8YA 1AZWA 1VPVA 2RJNA 2R1TA 4KSYA 5LOVB 4OQ4A 5LQJA 3LDHA 1D2EA 4L9SA 1R0CA 1RBYA 2VPXA 4MULA 4X95A 5E0OA 5F4BA 4D8TA 4GXQA 4REOA 3K0FA 3VHLB 3Q2KA 4KUEA 3PQCA 2M1XA 3LDAA 3BY1A 2A9JA 3K9BA 4WZKA 1TA9A 3MJDA 4K2HA 4J3JA 2AF3C 1QB8A 1HZZA 1MO3A 1W93A 3Q5DA 3ZGLA 4CUKA 4KKVA 4NG5A 5JBNA 3NBKA 5BO5A 5IVDA 3SCZA 4F4JA 3FX2A 3T3IA 2OO5A 4B73A 4Z54A 4B33A 3D3KA 1TAHA 1P5JA 2UUOA 4J0EA 4DV6B 2WTXA 2CL0X 3X1WA 3EJWA 4TT3A 4E5PA 5LA6F 3U80A 3VQTA 1P61B 2I8CA 5LIPA 4H3KB 1NN3A 4P9SA 2FSFA 3K8YA 4RUKA 5J23A 4CQNA 2XGGA 1WF3A 5J2TF 5GINE 3PUJA 3ETHA 4MUMA 5DCYA 2GF2A 1M0EA 3RIGA 4L2IB 2OQRA 3R6GA 3ENKA 1SBIA 4JBGA 2CMFA 2RI6A 1Q20A 1B3RA 2E4VA 4KXXA 4MPRA 1I14A 4X7EA 4CEJA 1FVFA 1F51E 3DKIA 3PR3A 3BA1A 2F00A 1P9WA 2J6BA 3TPZA 5I8PA 4W5NA 5SZIA 3X2EA 4AN1A 4GRAA 2OZVA 4KCGA 1R0KA 4YRLA 4HNRA 4ZGNB 1YR9A 5FBVB 1KIMA 4BFLA 4PG4A 1Z06A 3SYKA 3GLFB 4FFNA 3WHIA 3HB5X 4ODIA 5KAMA 3N8DA 1FFCA 3CCJB 4E2ZA 3DKVA 3FPGA 1BVUA 4EYGA 5FLXA 2WUFA 4NEQA 3TW6A 4JA2A 1SXHA 2CXNA 1W2GA 3D8RA 3SQNA 2QL6A 5HOQA 2X5NA 1VB5A 2R65A 4CQLA 1JFRA 1P7CA 1QU3A 4RVUA 4MS1B 1ZK1A 3LA6A 2JLXA 1NVUQ 1Z4JA 1YRBA 2JAPA 2PLNA 4MYHA 4R69A 4GQNA 4V0QA 1V26A 1J0BA 1KI7A 2ACVA 3O26A 3IIKA 4F1KA 5TNXA 3F5FA 4Q4CA 3THSA 3AEYA 1TIKA 3B48A 4EGCB 4MAMA 2VVTA 1KKUA 2CE2X 3FTDA 4PR3A 4PRKA 1G5FA 3UTDA 4J49A 2HK9A 4JASB 1AG9A 2JI6A 3WWEA 1SCBA 1T9HA 2WPDA 1F20A 1OWLA 1GPH1 1DIRA 1L7MA 2RHGB 3JZIA 1ORHA 4A9AA 3BL6A 1GT91 4CIYA 3UAYA 5DM2A 3KOWA 2NZYA 5JNVA 3ASVA 2EBHX 2GUWA 2WW8A 3K72B 2AYZA 4WN9B 3WLNA 3FTPA 1EWKA 5CG2A 3LL4A 4PLVA 3BSYA 5C1BA 2VJNA 1JHOA 5KJCA 1RDFA 4ABTA 3C41J 1PYGA 3TVTA 2CSXA 4NJEB 4DCUA 3O8OA 2IIBA 5SZJA 3AEQB 4IHJB 3JXEA 3SLGA 4CV1A 4N9QA 4W8OA 1BWRA 1WSRA 2FCAA 2VRCA 2P3SA 3ILYA 1GKIA 1KZLA 1TZ2A 2QP4A 1FF9A 3NO4A 5D7NA 5KX5B 2C98A 2JFNA 4BXOA 2R0QC 1WP4A 3WWCA 2D5CA 2VPPA 4HDRB 2PZ8A 4I6JA 2B4KA 3LKBA 1CZKA 5IJ9B 2B82A 2VYNA 1J9EA 3DFUA 1T4CA