4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
1O94C 1QU2A 2O8VA 4MW6A 2DXIA 3I05A 4JXZA 1KP2A 4MVCA 1T6XA 1K92A 4YBRA 1NB0A 2CT8A 2AG6A 1NUQA 2DUMA 3INNA 1JZQA 1M8FA 3PXUA 1ZH6A 3GUZA 3HV0A 4G5FA 5H7XA 1KP3A 3H97A 4GU5A 1R6UA 4ZT6A 2J09A 4MW9A 4KKVA 4DDKA 3IMGA 3CLUD 1F9AA 3RK1A 1H1TA 1WXEA 3U1VA 1PFUA 1V8FA 2IP1A 3K9WA 1R6TA 3G6KA 2CFOA 2E21A 2J07A 2QJTA 3H9BA 2TS1A 5IJXA 3Q4GA 1R6XA 4J76A 1NI5A 1KORA 1UFVA 1XNGA 4MW2A 5HUJA 4P2BA 3ZXIA 4QREA 4Q16A 2CV0A 4ZCPA 3CVXA 4TS1A 4G6ZA 1NUSA 4ZCRA 1QRTA 3IOCA 3UOWA 4PBSA 2QJOA 1BS2A 1J21A 1NURA 1IH8A 5JBNA 3BNWA 3ZUGA 5A8AA 1WKBA 5KCMA 3ZJVA 2IELA 3N8HA 4Q93A 1JGTA 1Q19A 5EKDA 1KQNA 3SZ3A 4RUKA 1NYLA 4H3SA 5TGTA 2OV4A 1GN8A 1QTQA 1OD6A 1WY5A 1NUUA 2GM3A 1NUTA 3BL5A 1O95C 2GOYA 4MWEA 1IFXA 2D54A 3VU8A 1N78A 1VBNA 3TZEA 4EG3A 1IQUA 3KT3A 3COYA 2D5BA 5KWVA 4MQ6A 4HJXA 1MAUA 2CYCA 4ARIA 2HMAA 4R0NA 4DJAA 4JXXA 1O95D 3QTTA 3KFLA 4MVYA 2P3MA 1OBHA 3IOEA 3ILVA 1ILEA 3FWKA 4DNXA 2VTBA 4U7JA 1N06A 1PFYA 3H99A 1B6TA 4AQ7A 3ZJTA 2X3FA 2DPLA 2I1LA 2DLCX 4ND7A 4MW1A 1TYCA 3CLTC 1KKUA 3ELBA 1MRZA 1J1ZA 2VBTA 1J09A 4PBTA 5K0SA 5FO0A 3ZGZA 4DDMA 4MAFA 1EUYA 3G5AA 3CLTD 3CLSC 1PFWA 4JZYA 4MUGA 3QE4A 2DR2A 2X1LA 3QTBA 2CSXA 3IVXA 2D13A 1MBZA 3UY4A 5LFAA 4U63A 1GPMA 2AKEA 3CLSD 4I6EA 1V47A 3CVWA 5BNZA 2BYTA 2QJFA 3H9CA 1N2IA 2CYBA 2QUHA 2JANA 3RBAA 4UZEA 4CDMA 4FZJA 1KAMA 3COWA 3MXTA 1N77A 1JMVA 1U3DA 1JILA 1ZJWA 1N3LA 2CYAA 1YUNA 3CVUA 4JYZA 1U7XA 4I6GA 4A91A 1MC1A 3TNJA 2B7LA 1F7UA 1MB2A 4OJMX 1U7DA 1G8FA 2A84A 2E18A 3COZA 2YWBA 1JIIA 2JAXA 3CLUC 5J58A 2ZUEA 2G36A 3ZIUA 4E1AA 1O0CA 3HMQA 4X0EA 4J75A 5DEOA 4ZT2A 3CA8A 3KT8A 3K32A 3VRHA 1A8HA 5LLTA 1O97D 1EXDA 3CR8A 3FY4A 1Y42X 3AG6A 4RPIA 3ZJUA 3ND6A 3IUBA 2VTBB 4ZT5A 1IHOA 3FETA 1O6BA 1M8GA 3CLRC 2WB2A 1GAXA 3N05A 4QRDA 2Z08A 2Z3VA 2VBVA 1EFPA 1I6LA 2NSYA 3CLRD 1T9GR 4CT0A 1KQOA 1N75A 5IHXA 4CDNA 4OUDA 3SP1A 1MAWA 3MLBA 4MULA 4NX2A 1P4MA 1TYAE 3D6VA 3X1KA 2YY5A 3HZRA 2NZ2A 2A1TR 1K97A 2EJCA 3N9IA 4MUJA 4DDHA 3N2YA 5AHWA 4BWVA 3A2KA 1JZSA 4CQNA 3E27A 3TZLA 5A88A 3JXEA 4L2IA 1H3FA 4HK4A 5TEVA 2AZXA 1OWMA 1WQ3A 4MWCA 5TRDA 3SYTA 4EG1A 1VBMA 1K4MA 3FH0A 3ND5A 1NB9A 1T9GS 3IH5A 1FFYA 1ULHA 4ND6A 3LE8A 2PG3A 2QUJA 1X8XA 3FI0A 3AG5A 3IODA 1WQ4A 2WSIA 2ZP1A 5H16A 3P0IA 4GRIA 1N05A 4MUFA 3AL0C 4ARCA 3VGJA 1G8GA 5DK4A 4ZCQA 1N2BA 2XRYA 4XFDA 3CVVA 2VBUA 4ZT3A 4MW7A 1ZH0A 3CTAA 1S4MA 4JFAA 2A88A 4ZT7A 1TYDE 3TS1A 4MW5A 3S3TA 4MUHA 2E0IA 1LI7A 4EGAA 4UZFA 1COZA 3SEQA 1YIDA 3P0JA 5TEWA 1H3EA 3FDXA 1XNHA 5K0TA 1N08A 3Q10A 1YULA 2VBSA 3PNYA 4MUEA 3GMIA 2H2AA 1Q77A 3P0HA 4R2LA 3IVCA 3UC5A 1P7PA 1GTSA 1N1DA 3AIIA 4XSVA 3RK0A 1EFPB 4DE5A 1Q11A 2OQ2A 1WXIA 1LI5A 4HJRA 4MWBA 4OUDB 4U8HA 3X1MA 3DLAA 4KR9A 2YWCA 1Q15A 4EG6A 1IRXA 3DO8A 1I6KA 1GZUA 3LOQA 3PRHA 4F4HA 2EL7A 2J08A 1G8HA 2YXNA 1EFVA 1DNPA 1WXGA 1OWOA 2IJGX 1OWLA 1X6VA 2QTMA 2A86A 4PBRA 1WXFA 1KQPA 1PFVA 1KH3A 1EJ2A 1G59A 1YUMA 1HYBA 1JEEA 3RJZA 1O97C 3A05A 1NUPA 4L2IB 4KPUA 4MVXA 2CV1A 5LM3A 3C8ZA 3CVYA 1VL2A 4YP6A 3HGMA 2JA2A 1WJGA 3G59A 1GLNA 1JIJA 4ZCSA 3LCJA 3ND7A 4MVWA 3IMEA 4MW0A 1I6MA 3FG9A 1MB9A 3IOBA 2A1UA 3IVGA 1N2EA 3SEZA 1O96B 4MLPA 4WSOA 2R5WA 1QU3A 3AKZA 1EUQA 4EG4A 4EG7A 4F3RA 4ZCTA 1N2HA 1WOYA 4R2MA 1XNJA 3KT6A 3MMXA 1VLHA 3MLAA 1O94D 1CT9A 2HGZA 1T6ZA 4MUIA 1KR2A 4EG8A 3D6UA 3FNRA 2V0CA 5KHAA 1TYBE 2ZUFA 3IMCA 5HG0A 3M5WA 5A89A 3A04A 1J70A 4NZPA 4PY2A 2PZBA 3NBAA 3PNBA 4S1OA 3H05A 2DETA 1F7VA 1K4KA 3AFHA 3IDFA 1U3CA 4K03A 1NSYA 5TS2A 1QRUA 1MJHA 2O5RA 4YP7A 1JECA 4EFKA 4MWDA 1YIAA 1N2OA 1O0BA 2J5BA 2PXHA 2QTNA 2E89A 4NAUA 1EFVB 1M8PA 2OYNA 5J5AA 2DERA 4G5YA 2PZ8A 3HL4A 1QQTA 2CV2A 1O96A 1O5TA 3L92A 3PNVA 4MW4A 1XJQA 2Z09A 2A1TS 1OBCA 1MOPA 3NV7A 4KPUB 4YP5A 2WQ6A 4HPWA 2DEUA 3OTWA 1OWNA 3F3MA 1M8KA 3SDBA 1M1ZA 3RFFA 1N07A 1SURA 3COVA 1I2DA 1QRSA 1JIKA 2V0GA 1EE1A 2A1UB 4NDAA 3FHJA 3DPIA 1KAQA 1IQRA 4YMIA 1PG0A 2X1MA 3OP1A 3ISJA 3MUEA 4DLPA 4EG5A 5F23A 2A7XA 4I6JA 3Q12A 5FNZA 5DB4A 2BTEA 4KR7A 1FYDA 1LW7A 1D2RA 1WXHA 1WZ2A 4NATA 4NAHA 1TFUA 2QUKA 3KT0A 2QTRA 1ZUNA 2C5SA 3GLVA 1Q9SA 1JEDA 3A4IA 3IUEA 2WQ7A 1N2GA 1QJCA 1NZJA 4AS1A 5FO1A 3P52A 1T6YA 1QNFA 4QBTA 2XRZA 2RE8A 3TQOA 1PG2A 3DV2A 1VBKA 1RQGA 5J59A 1GTRA 4K0RA 5HUHA 4EF6A 4MUKA 3UMVA 2HZ7A 1OWPA 1M8JA 2QUIA 3ZXSA 1TEZA 3NBKA 3X1JA 2X0KA 1KH1A 4MUNA 1M83A 1IQ0A 1H3NA 3SZGA 2PFSA 1TQ8A 1IVSA 3RHSA 2A4MA 2CUZA 2GKSA 2VXOA 1KH2A 3UK2A 3FIUA 2RD2A 4XFJA 2J4DA 1J20A 4ZT4A 1JHDA 1F4LA 3FOCA 1U0BB 4KR6A 2PIDA 1NP7A 3HFJA 5DASA 2PZAA 2H29A 3L93A 4WNYA 3TQIA 1YI8A 1J1UA 1N2JA
chains in the Genus database with same CATH superfamily
3RAPR 1EVIA 3GPBA 2QSUA 5CBPB 3GVJA 3OKAA 3TF5A 1VSUA 3F0TA 4JD5A 2D6FA 4EY3A 2ZJBA 3NATA 3VXKA 3ML1A 3L7IA 1V0EA 2VPZA 4RL6A 5JI2E 4KYVA 5AM1A 5HUQA 1QPZA 2D0DA 4YHBA 2I2BA 4D3SA 2H1VA 3H42B 3RC3A 5D3MB 4XVUA 4Y2RA 3WLEA 3UGJA 5F51A 4Y2TA 3GEDA 4FYXA 1WW3A 4GZ3A 2A0YA 4AMUA 5H02A 2CJWB 3MILA 3WC4A 1ISFA 3JYOA 4WMLA 2V74B 2YOGA 1JQJC 4Y8VA 5T4HA 3RM3A 4ZI2A 4F6RA 2FWNA 4JT4A 4FN4A 4AP5A 2Z5FA 4R1PA 3V46A 5KOYA 1RPJA 2VDNB 4ASUD 3O74A 2WPNA 1CW2B 4FS3A 1O6CA 3HA5A 3O8BA 1W35A 2FW7A 3SNHA 4DSUA 1NVEA 4MVJM 5FNVA 1WP6A 3S28A 2OUKA 4CQMB 5DTQA 1DWQA 3FUCA 4ZGGA 1CEEA 2H6EA 2W6JA 1OI3A 4R9NA 4P2BA 2NTVA 5IEJA 4H16A 4ZDJA 2C2ZA 3KZMA 4Q3AA 3HJGA 1CJSA 3EARA 1ULBA 3BKXA 3M1YA 4KH0A 2ZSAA 5J2UA 3AM1A 1PVOA 5EJGA 5ULLA 4BO3A 4G6ZA 3UMFA 4WOBA 2B92A 3WGNA 3JAKB 3GVLA 3CEJA 5KINB 3IAEA 2A9VA 4Q4HB 3IEXA 4D0RA 3OZWA 3B1WA 3IB3A 2F48A 2QGFA 4PGGA 4XIIA 3WB9A 1FJ2A 1WIWA 3LLCA 3RSLA 3V1KA 4B09A 1FDIA 3CGWA 3ZJVA 1LTHR 5IDQA 4UFPA 2R2GA 4RMNA 4BNHA 2P5SA 3EFOB 3L1IA 3L4EA 1I33A 1O6ZA 1Q0SA 3DEHA 4GI7A 1KQNA 3G8DA 3DGEC 4YNBA 1PJ4A 1MN6A 4JYMA 3PFHA 2R68A 3NPMA 4GD3Q 1NUUA 2XNSA 1ELOA 5IXYA 1RHQA 3NHZA 2CJFA 4BFXA 4WBNB 1GKKA 1E1CA 3Q9NA 4LZAA 3CE9A 3R5JA 1ZW6A 3VPHA 1RI1A 4N0QA 1ZX1A 3RFVA 3W3AH 1MAUA 1C7QA 3GROA 1CXZA 2J9FB 3MF4A 5EJ5A 5A0VA 3BSWA 3K7EA 1YQDA 4O33A 1F12A 1U3VA 3EY4A 1NXOA 2YXPX 3KE9A 4PCUA 5IBRA 2ZYVX 3DA8A 4G9GA 2VSNA 3B38A 1HTTA 3IVRA 4MVYA 5BSRA 1V6AA 1Y7IA 2VF5X 4K9OA 2VJCA 2PUBA 3CZRA 3EUAA 5DW3A 1PGPA 2QLLA 2JI6A 1PGNA 2Q62A 5CNJA 2DTEA 1Y4SA 2JHAA 2JK1A 3MJRA 1PQ4A 4HN2A 3CLTC 4ND7A 4O4JF 1TIKA 3P2MA 3S2YA 4D8YA 4EJSC 5C8DA 1FZTA 2YW2A 3NIBA 3LBAA 4EECA 4B44A 4D6YA 4KXMA 4DA7A 3C8DA 2CB0A 4F6RB 1OB5A 1SOAA 1QH0A 4MIYA 1TK9A 4EX6A 3KSDO 1ZXXA 1CLEA 4GOLD 2ZT5A 4S12A 3GRZA 4HLUC 4Z4IA 3FPKA 4OHXA 5TQ2A 3ANMA 2Z2KA 1JFSA 1V5FA 2COUA 4BMPB 2ZT6A 1UDXA 1YJXA 4QHYA 2OENG 3CX8A 2DR2A 4CG3A 3VC3A 5FNVB 1J42A 2WSMA 1U9CA 2WA1A 1PR0A 3G9TA 1ORWA 4BVBA 5FHRA 4CM5A 1V47A 4WPGA 4X63A 4DIUA 4YAUA 4NYMQ 1J7KA 5JXHA 3EIHA 2YUIA 4AG6A 4R9SA 3MK31 3KQVA 5J2UB 1N6LA 3SYKA 3W1VA 2JLXA 4IIYA 1LQUA 2KQUA 4I8DA 4KO2S 4QHTA 4RVCA 5DYGA 4QSMA 1TKRA 4BQOA 3UM9A 1ZRHA 2HMSA 2CDAA 4KMOA 4J0DA 3PLAE 3FPGA 4R1LA 3ZX4A 4EVIA 1QRAA 1U3DA 4KR2A 3U19A 3RGGA 5L45A 4RS3A 1FNSA 1XF1A 3JYQA 4MB6A 3KO8A 5AVRA 4JLJA 1JXAA 3RS0A 4ZC8A 1MC1A 3U13A 2B7LA 4EI7A 4QYXA 3PEWA 3FLMA 1BS1A 4KVZA 3S5JA 1C0EA 2HI0A 1DMSA 4UPEA 1T91A 1ZUWA 2XWSA 3WVNA 4AX8A 4JV5B 3ILSA 2GJ8A 1JIIA 1P2GA 3C3YA 1ZY2A 3EIEA 1X1TA 4M0CA 4N3CA 5DXJA 3V00A 3GRPA 3O1LA 5K6TA 3UW3A 2G36A 2GNPA 3WHLA 3CC8A 1E1CB 5B1IA 2R00C 4B3BA 1KBZA 5FTWA 5IP5A 2GM4A 2B2NA 2FPPA 4PVCA 3KR2A 2K5UA 3FCEA 4GRDA 1ESNA 2G7MC 1OZFA 3CS3A 5LQNA 3ZPNA 3HRKA 1PR1A 2VYFA 4WVLA 3VM6A 3X44A 4EJMA 4RPIA 3ZJUA 2WSSA 3ND6A 4BOYA 2ST1A 5FOTA 3U0VA 4GP7A 4ZT5A 3LPNA 1EZ1A 1V9CA 5ALOA 4KITB 3ROZA 1I1NA 4BZXA 4D4JA 4ZAVA 3FF4A 5BRNA 1I7SB 1BA3A 4X60A 1JDSA 3SZUA 4AF6A 2B2CA 2O4CA 4URFA 5C31A 1S1MA 1V4VA 5HF8A 4BEJA 1MA3A 4EZEA 3K09C 2Z6UA 4M1ZA 4M1WA 2JVIA 3ROFA 2V7TA 1DU4A 1GTMA 2OO7A 4JMLA 4MA4A 1P9RA 2DPHA 3L0PA 5AJWA 2QRPA 2ZVPX 4H6VA 1P2TA 4LOHA 3TVDA 4TXHA 1DAIA 4LMRA 5IHXA 4R1NA 2E48A 2PRYA 4OXNA 1W52X 3L49A 3U7QA 2IUTA 4P08A 4FQ8A 1S2IA 2YZNA 1ZK4A 3AKDA 5ERXA 1L5WA 2WTEA 1ZEJA 2PAAA 4G97A 5C81A 4H7DA 3OTOB 2OCKA 2Y9PB 3U44A 1CIJA 2EYUA 3OF3A 1Z07A 5IX8A 3KZOA 4OJTA 3HUUA 1TC1A 2YVQA 3OU6A 4MUJA 2CZCA 3ZI4A 3WJ1A 4QUAA 2OECA 1AHPA 3A2KA 2QZZA 2VATA 5DNWA 1K7SN 3EEBA 2GA9A 1NXQA 4H7EA 3KEWA 2K2QB 2OLJA 2W6PA 4K6MA 4HFJA 2QS9A 4ABYA 2YZ2A 4Q82A 1DJPA 1NN5A 5C3UA 4X8LA 1CZNA 1C30A 3UJ7A 4JSTA 4BRZA 2HPAA 4FMPA 3UG7A 3WISA 4QQKA 1B6GA 1CZLA 3PENA 1WQ3A 4GBED 1T2VA 4K3UA 3RRBA 4LF4B 1SBNE 4DC1A 3D7MA 3H1AA 1MV8A 3MBOA 1ARZA 1S8FA 3RVQA 5JV5A 4CR6A 4LHZA 4LC0A 2MSNA 3OFSA 3R3YA 2IH5A 2C7BA 2C31A 2QN8A 1IJFA 4K9SA 4L8GA 2PLFA 5JNVA 2RC6A 1LVUA 2HMVA 1YR2A 3LX8A 4WIAA 1VDMA 1BX3A 2Y6UA 3T3IA 2BPOA 5CDFA 3AUJB 1N6HA 3ESBA 5FLYA 3SIWA 4ZTZB 1W0JD 2R62A 2FPPB 3OPQA 3UA4A 1A1VA 2P4HX 2AEFA 2A88A 3JVUA 3OLXA 4UE6A 3QZUA 4EGSA 3EX7C 3P1JA 3S29A 1RRFA 3ESAA 4P2NA 2DCMA 4ZJZA 1XRJA 3TUIC 5LQUA 4NFYA 1AGPA 2ODWA 1XCJA 3KPUA 3P0JA 4IOMA 4ZQBA 4OHZA 4BKQA 3FDXA 4FYYA 4IJUA 1TQ2A 5C3MA 4WNCA 1B43A 3AF1A 2ORIA 3P2JA 5IRCD 4MJ3A 4M22A 3NMUF 4TYPA 3V4RA 5KPDA 1GVNB 4B2IA 1QORA 1HDZA 2WV7A 3IMFA 5DBOA 2L2QA 2WT9A 3F9IA 1PKEA 2F3QA 2FX3A 2GYVA 2DMRA 2TSYB 4HH1A 4MKRA 3RHTA 4D4MA 1GTSA 3KZVA 2WUEA 3KOXA 3BXZA 3TD2A 4BX3A 4W5OA 1OPRA 2YS7A 2CRVA 1ISJA 1ZFNA 5A7FA 1GPWB 2OG1A 5FPHA 3TAHA 3T99A 3INYA 1AS2A 2B1QA 2WSLA 3KVYA 4HWRA 4U7PB 2B69A 5FWAA 3JX9A 3U7QB 5JANA 3UJDA 2B7BA 3B1FA 1CDEA 2EG9A 4LY9A 5ECDA 4B74A 3U44B 1TPZA 2G4LA 3Q8MA 3CNBA 1J0DA 4QTXA 3HFSA 5ISMA 1T9ZA 3C3JA 5KUTA 3PWKA 2G0AA 2CDRA 1KOLA 2A86A 4XCQA 1LGYA 3V4OA 1JHMA 3MWLA 4L5JA 5F9MA 3SSOA 2BMFA 3L4BC 3TOCA 1GZSA 1EDEA 4WKCA 2P9QA 1JEEA 1C30B 4E5KA 2VHCA 1D1TA 4NJEA 5BN4A 2QW1A 3MHTA 1GL3A 4RDXA 4NCAA 1NQUA 1G2QA 3PIDA 3LZCA 5KTNA 4JBHA 2FG7C 3G59A 3TSZA 4D4GA 3HBNA 3OZBA 3FR8A 5F3RA 3WMRA 3FHLA 2QMEA 4MV6A 2W42A 2Q07A 1MB9A 2IWRA 1EI9A 4JT2A 1A2QA 1BNCA 5K51A 1FTSA 1ONNA 1SBHA 2W6QA 4FIZA 2J48A 1EXDA 3AEUA 1B0ZA 4OLBA 3B1XA 1WOYA 4R2MA 5BSXA 1DVRA 1DEHA 1RRVA 4R7GA 5F7ZA 3Q0IA 3X0DA 5FL3A 1B6RA 1YZFA 5CDHA 1VLHA 4WXYB 5KEIA 4Z9BA 4N9QA 5JECA 1PAUA 1I30A 3GP5A 4HAUA 2PMWB 3GUYA 5TS3A 4IDCA 1E5QA 1EK5A 2OXIA 2RGAA 5JJBA 3H3FA 2QAGA 1GG5A 5LKAA 3VYRB 3NZEA 1TEHA 1NOJA 4PAOA 1UBSB 1D4OA 2ZAMA 1QB7A 3BRSA 4OK3A 1JR3A 4NZPA 4HWSA 4QXPA 1XMPA 3N8NA 4INAA 4PSDA 3VZQA 2GEKA 3WBKA 4PZ0A 2Q2NA 1GSOA 2C4MA 3D7SA 3ER6A 1T5SA 2J7PA 4O29A 1UP7A 3JQ7A 1JTVA 3OH8A 2G25A 3VH2A 3O7WA 4NOJA 4NYJQ 5F7XA 2HO5A 1QCDA 1FXWA 3OWOA 1RNLA 4L9WA 2VP0A 1KO5A 2YNMD 1U3CA 4H1HA 4A1FA 4EPWA 1QUEA 5G1PA 3W7AA 5HFJA 2O5RA 5A62A 3Q40A 2NXNA 4JDUA 4M6WA 4M7OA 2WJVA 2VYNA 3EFHA 4I3FA 3B20A 3DWFA 4MJXA 2IUYA 2FMFA 2R44A 2PXHA 2PZFA 4H7JA 4ZO8A 5LB2A 3TL6A 4BLVA 5KVSA 4KQGA 3OEHA 3CHYA 1RP1A 1WQ1R 2FW6A 4NAUA 3PDUA 3SEAA 4P84A 3STUA 3FE2A 3N87A 3U7FB 1ODKA 1IHDA 2WF8A 3LAWA 1GG2A 2IF0A 2P9BA 1C9KA 3R3WA 5ALQA 1NFRA 3O4GA 3NEPX 5FKJA 5A02A 4WLNA 5F7OA 3UCEA 3OQNA 2XNDA 1LDGA 2KSQA 4AO8A 1XCPA 6ABPA 2UU9B 1TTQB 1SOWA 3M49A 3RVLA 1Z35A 4NJEB 5BN4B 3LLVA 3OIGA 4Q9DA 5DTEA 1YZTA 4ID3A 4MINA 1XZFA 2HRDA 4BO6A 3M9LA 4QJ5A 2I6QA 4FCTA 4MQ4A 4TZ0A 2DWPA 1QZ3A 3JWGA 4FYJA 3D6TB 3JSXA 3RFFA 5HKBA 4IJWA 4RV4A 3TOZA 1CQZA 2YN4A 3BKWA 2YDYA 4J3FA 3PLNA 1YDMA 1XP5A 2DBYA 2YWDA 3GIRA 1MEOA 2J6IA 4YMIA 5HKKD 4LCEA 4BX0A 4UXJA 4BE7B 1UEXC 3AEUB 2EFCB 1AKQA 2PWPA 4I3GA 4OQDA 5CFPA 3F49S 1GG8A 1NJSA 3FWPA 3O94A 4IKEA 1W36D 3THXA 3PR1A 2PRSA 4DR5B 4NATA 2ABWA 1WXXA 3E1GA 3RU9A 2VP6A 2G9RA 3AWIA 1T29A 3F8WA 4IWNA 3RFCA 5FYQA 3VJLA 1FYXA 3JYNA 3GLVA 2HDWA 2QAGB 2LGJA 1GPJA 4OYYA 4RY9A 3ZIDA 5CDYA 3PD0A 2FMTA 4ZOLA 2M6RA 3IUEA 2DT5A 1BN6A 1E96A 5E6UB 2DKFA 4EEKA 2IYNA 3BDVA 1YSCA 3PJDA 5LXTF 2Y0PA 4F2PA 4ID9A 1F9EA 4BB0A 1HO3A 3UJHA 3D7LA 1SBQA 1YR6A 4G63A 4JT8A 3CUUA 5DXFA 4BV9A 3JQ7B 3ZU3A 1DB3A 1NXSA 4CMGA 4LX8A 4OL9A 4BVEA 1GTRA 1UBLS 4I5FA 1N2SA 2RHDA 3U3KA 1YA6A 2PUCA 1TZCA 1W0CA 2YJ5A 1S1CA 1TEZA 1P9LA 3ZBTA 1VQKB 5DNDA 1GARA 2OM6A 3B5JA 3E84A 5FULA 4M6WB 5JROA 1H3NA 4BPBA 3ZHXA 1Z0KA 2HHCA 3A1CA 1XA4A 1UAYA 2WJYA 3ZLTA 3RAJA 3ZE9A 3O6VA 2H16A 2I65A 1Z8DA 3QUAA 3ENQA 5AVQA 4KR6A 3H5VA 1LPSA 5I7WA 1S6YA 3C5VA 3T34A 3LGSA 1HRKA 1ZKMA 1XHEA 4RTNA 2WWYA 5IT4A 3FJOA 3DXYA 2B5WA 5CT6A 5ESDA 5JWHA 1A4UA 3TSWA 5C7IO 5BSKA 4KNYA 4GWKA 3DBIA 4OOVA 2GTIA 1E3XA 1VPDA 3B3QA 3TMAA 4BNDA 1JB9A 4GECA 4LRQA 1DAOA 4Y6QA 1Y3FE 2PGXA 4IZ6A 4UVHA 5D1HA 1NUQA 3V7AA 1T0JB 2OZLA 3UOAB 1BDBA 4BNIA 3IDQA 2WINI 1YJ5A 3HCNA 3R3VA 3QBTA 1OVGA 2Q4OA 4LMPA 2DQZA 3OZTA 5LA6A 1MX9A 1CDZA 3PV0A 2Z0MA 4M9QA 4NEQA 2FPMA 2GVZC 3QYJA 3TIXB 1JHPA 3FNGA 4NRDA 4Z4ZA 1W93A 1XZQA 4UZSA 1XZNA 5TV2A 2XCLA 4TV8F 3U1VA 1W25A 2AB0A 3FROA 4E6PA 1R6TA 3GQVA 4E4RA 1O08A 2NZJA 2TS1A 1GRRA 1K6JA 1SC9A 3IPAA 3KS9A 3BMOA 3OZVA 3I5AA 1TM4E 4JB8A 4LHSA 3THXB 5ER9A 5KJ6A 3QUQA 1Z4LA 1G17A 1EMDA 3OKFA 1UFVA 4GNRA 2WWWA 2D1RA 4XAQA 4S04A 3OCVA 3H4VA 4H18A 4UBIA 5GINE 1YQXA 4JGGA 4DR7B 2WUFA 4WGGA 1E5XA 4Q16A 4ZOLB 1CUIA 2XPCA 1SHLA 1X1RA 3B3FA 4LCJA 4E6EA 4EENA 4HNTA 4EIWA 2NV2B 5B2ZA 1YCGA 2E5FA 3BX1A 1R6AA 1NUSA 3O2NA 4E3ZA 2OMEA 3DMNA 1ZN8A 3T56B 5IUJC 1ILWA 4FE4A 3B1JA 5ADUS 4O2LA 5MHTA 4Z4GA 1XLTA 3BNWA 2GPWA 2ISSD 3R8FA 5JEEA 1RZ3A 2H4YA 4B6FA 3QF4A 5D8DA 1XZBA 4FFMA 3L0IB 1AQNA 3AJEA 1T0HB 3PE4A 5ECWA 5IH3A 3OM0A 2KLHA 4P3IA 3WGTA 5DCYA 3ADBA 1K5PA 1SD2A 1NHGA 2EXXA 4H7KA 2WVAA 2X0NA 4JJ6A 3N5KA 4KUHA 4Q39A 5EXSA 3RS8A 1SHTX 3SHWA 3G0CA 3H5WA 5ES4B 3C74A 1IJKA 5JAQA 4C0SA 2GOYA 4O59O 3VAYA 1F1BA 4OOEA 2XHZA 1OUMA 3ULKA 3TZEA 5AUOB 1CHNA 1BX0A 1FMJA 1E3MA 4UXIA 2CYCA 1UXJA 1E3LA 2HMAA 3DW1X 3KL2A 5CYOA 2BI4A 1O95D 2IUSA 4BKRA 5MGBA 2WLTA 4BNDB 4Z4YA 1Z4OA 1DLJA 2OYSA 3LZ6A 2GQFA 1ST2A 4WLOA 2F1IA 4DMHA 1W6RA 3ILVA 3FWKA 3JY6A 3IUNA 3LYAA 2VT6A 4NARA 5AI5A 1LD3A 1KYWA 1VE9A 3SBXA 2HHHB 2OZLB 1Q95A 1XRSB 2P2CA 1MO2A 3JQBC 3SC4A 3RCBA 3U7IA 2I1LA 5LA6B 3OQ6A 2ZZMA 1RWMA 5I7FA 4MB0A 5EP2A 1FUKA 1YB2A 4JODA 1Z2AA 1R88A 1KO7A 1J1ZA 4MV4A 4QULA 4UM7A 4URVR 3TFOA 4J4BA 1WUTA 2YJ4A 3ZWXA 2MSCB 3E03A 3MOIA 4PC2A 1NNUA 1NOKA 2ZAYA 4IIXA 4MAFA 4DC9A 2V7BA 4RXTA 2ZAIA 4O1HA 1Q44A 3BMOB 3MYRA 4YRRA 1K7CA 3EVZA 4LQ4A 2RHBA 4LWZA 4TPKA 2AH5A 2ZRPA 1DO2A 1GGHA 2P0EA 3B6EA 3BE4A 3P0RA 3TR6A 1XV5A 5AVXA 2RBEA 1Q1QA 4W5WA 3UK1A 2RCNA 3A6GA 1AGNA 3K6KA 1W5AA 4PFJA 3JVEA 2O3QA 3C4QA 4G9BA 1N5IA 2XBUA 2BM9A 2YV1A 1MT0A 1DC3A 2FF5A 3TTXA 2BZSA 2YIVX 1IZ8A 2FR0A 2LVBA 2WRZA 4HX9A 2CYBA 1M34A 4OGFA 4QDXA 4Z9FA 4X64B 2J31A 1ZGZA 4HN9A 1T4DA 2EWMA 1L5OA 3NORA 2DHEA 5GONF 1HUQA 3G13A 3B1VA 4DN6A 1MD9A 2IKSA 3IJRA 4UVDA 1TF5A 4KGZA 1JMVA 2QQGA 2ZBQA 3WA7A 3IE2A 2ZVJA 1X0VA 3FGPA 5EFZA 1G7TA 2HNAA 1VHQA 3M81A 4M0UA 5DWVA 3QF4B 4XZ3A 1LQTA 1UKCA 3DAPA 4HD8A 4KXWA 4IUBS 3H04A 2YRFA 3KLNA 5BRJA 1AUQA 3GFTA 3L1KA 4GR5A 2TMYA 3IQWA 2ZS7A 1IPHA 3KQWA 3S1SA 3PYXA 4OJMX 4RIIA 1G8FA 3KEGA 1SCJA 1DJLA 2C97A 4DTIA 4RVFA 4YP1A 1JR6A 3JQRA 1IHYA 2VDOB 1GWNA 3QMMA 3N2LA 1PV1A 2X4LA 1FFDA 4WD3A 4YRKA 1VJRA 1VMAA 2ZIZA 1YS1X 4PLGA 4ZT2A 5EJ6A 3KT8A 2E4XA 1VPWA 1RM0A 1TKAA 2JB9A 1YRWA 3PXDA 2OKGA 4MV3A 4UUAA 3RC2A 3TCNA 4D3XA 1U7HA 3AG6A 3MELA 1NG1A 1DKMA 1HE3A 1V1JA 4NE7A 3ICOA 1DQYA 2WD7A 4Q3LA 1EJ6A 5LJLA 4MR7A 1QRRA 1EP3B 1NPYA 2UUCB 1NA5A 1O6BA 1XU9A 3CT6A 3NVDA 3O82A 4Q24A 1LWNA 3RWMB 4DLXA 5IT5A 5THQA 3DOJA 2X0IA 3CM0A 3TPZA 4NH0A 3ZDDA 3N05A 3SAJA 4KQHA 3V8PA 3W4KA 5FBRB 2Z56A 2Z08A 3OKPA 3RB8A 5K8IA 1XPRA 4WWHA 2XA2A 4P25A 3D2CA 4N5LA 2JFOA 3TGLA 1XEXA 3LIPA 4UM9B 1L5ZA 1GLVA 4LY3A 1TAGA 1ISMA 4ACBA 1HH4A 4YQZA 3ZCRA 1T9GR 3THRA 1T3ZA 1E5LA 2EP5A 1BD4A 5HKOA 3SP1A 3H5LA 2PO5A 1YC2A 2NAFA 3JRWA 4MULA 4AMVA 3WFZA 1MX1A 1XNRB 4D98A 2H1LA 1RE0A 2Q0QA 5EUMA 1IZ9A 2NW6A 4F4CA 1RKBA 2C94A 2FX5A 2ZSDA 4HB0A 2YW9A 3HZRA 2XGJA 1E62A 3T51B 1C9YA 2GK4A 3GPDG 1V2HE 2OPBA 4AWXA 4Y9DA 3HJUA 5FI5A 3ZPXA 1HLPA 4GG1A 4YJHA 1K8ZB 1NU8A 3WIEA 5BNIA 4OI4A 1O6FA 4RDHA 4EKEA 3N7UA 1TA4A 1T5DX 3T9EA 1CU1A 1VQNB 3MZ0A 3DYBA 4DF3A 1XIVA 1M34B 3RS4A 2OM2A 4NK5A 2V4ZA 3O0DA 5J1SB 1NBMA 1UDBA 3SM9A 1QF6A 4M83A 4LNAA 2ID8A 2V6MA 3I0MA 3HM2A 4L8WB 1MEEA 5EZ5A 1ZVKA 4O0MA 2X76A 1ISIA 3DCNA 1PYGA 2FW9A 1E9AA 4ZKEA 4OEHA 1K4MA 1PR4A 4UHDA 4AJ2A 3ND5A 4ZHQF 5BRAA 3BCHA 4R2JA 1OTHA 4IL5A 5D00A 5EWJA 4PINA 2POQX 4E5UA 1CUVA 3U7RA 4ENSA 1GL9B 1XHLA 4BXOA 1VYVA 2IPLA 5CR9A 5H16A 1OA1A 2CLEB 4BVGA 2EEPA 2ZYGA 3FD8A 3QPVA 4PAWA 1F0PA 4BU1A 1U6KA 5L3QA 2QVZX 1KPHA 2HMYB 3TTTA 1QF7A 3UV7A 3WYEA 1GILA 4KUEA 1K6EA 2BHSA 3D8HA 4BHTA 4F1WA 5CA1F 4X7CA 3DD5A 4R8RA 1ZITA 2JZNA 4LJYA 3OW7A 3NG1A 1UT5A 4FR2A 3WHPA 1XRNA 3E9MA 4L8JA 3UTDA 2WD7B 1YIDA 2HR1A 3G8CA 2ZIAA 4FFPA 1N5RA 4MR7B 2R6GA 3ZD8A 3VR3A 2ONCA 3K0BA 3FGOA 2QRJA 2V9PA 3EUEA 4B6RA 3QLVA 1SM4A 5BSYA 3OA0A 3GMIA 2V7WA 2F7SA 1EP1B 4R6WA 1V5IA 3W6OA 3M33A 4A16A 3GY0A 2QPTA 1G20E 3E7XA 1YVDA 2IA5A 1TECE 3DTYA 5EVJA 1XEXB 4MWTA 4IPTA 2VNSA 3EH2A 3HGQA 2GWHA 4IDQA 3A06A 4XOIA 1RZRD 1TF2A 1YA8A 4WUVA 4B32A 3V7YA 4BEWA 4KYTA 3W7VA 1W5BA 4YI5A 4PO3X 3DO8A 3FBGA 1I6KA 1MJFA 2B9EA 2KWIA 3EAQA 1VFNA 4HRAA 1YKGA 2ZYIA 4IJMA 2JLUA 1T3GA 1IXSB 1UJ4A 3LQ4A 2C4WA 2Z3ZA 1X19A 1L4KA 2CVZA 5ALPA 1H0RA 4YJHB 1NQAO 2B82A 2QE7D 3PVZA 5FP0A 1NKTA 4LDZA 2G7ZA 1KH3A 3T3DA 3UN1A 2BT4A 4CMAA 1PWZA 2EC5A 4IW3B 2JHPA 3UCXA 3W3AD 3ET4A 4AMZA 3IBTA 4ZN6A 2VNHA 1VXRA 2CB9A 3KOOA 5G41A 1GFWA 2LBPA 4EABA 3OPXA 2DP4E 1Z3IX 5LM3A 1KVQA 2O8NA 2ZPTX 4FHCA 2EQ5A 2D2VA 3HYTA 3O3MB 3P9QA 4P0TA 4BNMA 5C2JB 2X9NA 4QXAA 4S1WA 4XSHA 3VPBA 5EWJB 4YT8A 4KI7A 4W9NA 1QOZA 1JTFA 4GH5A 3DS8A 4BXOB 4BQEA 3ON5A 3GLFA 2IEGA 1FRNA 1M2WA 1Z6ZA 2OCGA 2P9GA 2WABA 1N2EA 3A25A 1JR2A 4Q47A 3CX7A 2F1JA 5JY6A 3PXXA 4FYIA 2WIDA 1QU3A 1HTWA 2NNWB 4BB5A 1UDAA 2JJMA 2VNKA 5L3QB 3R6KA 2VZ9A 4H60A 1AZTA 4I50A 3ROGA 4LRYA 1FU7A 2Y0BA 4V0OA 5KJFA 2CHUA 2XMBA 2D2FA 3CJQA 2YC2C 3I4FA 2NO7A 2J3EA 2X6QA 2MOKA 1J23A 1K4YA 3U3JA 5IJ9A 4EG8A 1E98A 4YAJA 5L6LB 5ITVA 2A3NA 2W9XA 1GPLA 3GFOA 3ABIA 4CJXA 4EJFA 4ZRMA 1G38A 1TYBE 2O1SA 1FW8A 4BTLA 4GLJA 1NNSA 2G5TA 2ZK7A 4BP9A 4KN8A 1ID1A 3ELYA 3GH1A 3RU3A 4XYLA 1N0HA 3TAUA 2IPMA 2PGIA 3PU6A 5LMUB 2DFKB 3Q3GE 3L82B 3QLEA 1W4RA 4NJOA 4PZYA 5TC4A 5I4KA 3NEAA 3FUVA 3T7SA 1UH5A 4B3MB 4I08A 3Q72A 1RWVA 4Z99A 1H9AA 2WSBA 3HSYA 4TSFA 3KAPA 4JLUA 5AW4A 1UAAA 1H6DA 3CH5A 2OGTA 3OIUA 4IVPA 1CQIA 3G5LA 5H3CA 1GKUB 2JAWA 4DA4A 4M0PA 1P75A 1QIMA 3N0VA 4X9XA 5FQOA 5KTRA 3TZKA 4K28A 2Q3MA 4ER0A 3ZU2A 5EWLA 3MFYA 3B1ZA 2EFGA 4M9UA 1JHUA 2C8KA 1TRKA 3EQ6A 1YIAA 4M55A 2VPWA 4JC5A 4FK8A 1E1MA 2XUAA 1SEVA 4FFRA 3ELUA 1N34B 3O4RA 4D3DA 2Z1DA 5T4FA 1U1FA 2MHCA 3CNHA 4RY2A 1R0WA 2QR2A 4U2DA 2BHTA 3RR2A 2DSTA 3IUMA 2XBMA 1U80A 2JJYA 3GRUA 1YZQA 2AI3A 2DKOA 4AICA 4RPDA 4L4UA 2V45A 4EUHA 5U9CA 2EQAA 4KQ2A 2I7XA 3R24A 2GZMA 2PGDA 3GT4A 4OPVA 1V7CA 1ADCA 3ZLBA 2XLBA 3R3JA 3E2IA 3H13A 5HXAA 1LZLA 1D6SA 4DB4A 1BDMA 3HJAA 1SKQA 1XJQA 2Z09A 1THMA 1OBCA 2A1TS 2ZT8A 2ZR0A 4N6GA 1PJ2A 1XALA 3ENKA 5KDLA 5IG2A 5JARA 1U99A 2J3KA 4TUYA 1FNCA 1GNRA 3N28A 3G6WA 3TW4A 2OB2A 4KVFA 2R6JA 2ACKA 3DM5A 3HWRA 4X92A 3SS8A 4GM4A 1RBQA 1M1ZA 2RBGA 2Y93A 4Y2VA 2C7QA 2HYIC 1VYHA 2V0GA 2CDCA 5B58T 3UA3A 3EWNA 3GLFB 1N0IA 2QRNA 1SNYA 1SOMA 1RLTA 3DPIA 5LBTA 2ZAGA 2AQIA 3ET5A 3D6MA 3OFND 4GVXA 2W4MA 3GJ8A 1NE7A 4XJXA 3VSDA 3L7AA 4ZRNA 4BNFA 1JLSA 4WK4B 2XVZA 1I4WA 4Y9UA 4I50B 2XA9A 3QJGA 4HDCA 1PTJA 1GT6A 5KQMA 1LW7A 2PUHA 1BE6A 2OHOA 3NANA 2FSVC 1CF2O 4LYDA 4RKYA 2CXHA 5LZ7A 3L8DA 3E15A 1RAAA 4BGDA 1WZ2A 5IJ9B 1CJMA 2BISA 4HI0E 4NAHA 4OP2A 3CZPA 4D79A 3QU2A 1IZ0A 2GCPA 2QORA 4I1UA 4ZVMA 3JRXA 4R81A 4LG1A 3LGXA 2OBFA 4JQYA 1E2EA 1AXRA 3DQZA 1XEFA 3H18A 4R1QA 3T06B 4C78A 5LWHA 4RZHA 4QGSA 3T52A 3AJAA 4E7OA 5J23A 3L46A 2GZHA 2CDNA 4JIGA 2V5UA 3W6ZA 2A67A 3EGWA 1BE8A 2CVOA 1BQEA 4JH0A 3RBZA 2HMTA 4X20A 1R4AA 1EVJA 4RVDA 3WQRA 2Q1UA 4AULA 2ATCA 4GQNA 3EF1A 1NVDA 5AVWA 3J80A 2CNKA 2BFCA 4FYKA 4ESOA 5EJ9A 1CQIB 3MFQA 1PBNA 1RBMA 1VLMA 3BE6A 2RJOA 1N8TA 2C2MA 2UZ1A 2YOHA 2EWVA 4JOBA 1XZIA 1KTVA 3GA0A 5BQXA 2X0KA 2FPOA 2B83A 4G26A 3MHPA 4N7MA 1MF7A 1WMAA 1PJLA 1ML3A 2OBMA 5DBFA 5EWLB 3VNQA 2BEUA 3HBAA 3O90A 4FHGA 1RYFA 2YZ7A 1F2TA 3ZKAA 4LKOA 4PYJA 1DL5A 3T0FA 1M6EX 1BVHA 2AEEA 4FOPA 4PZLA 1MABA 1YIJB 3SN6A 4PSUA 2XTMA 4OQXA 3UW1A 3VC2A 1HA3A 1NP7A 3LUAA 2GJRA 3QVUA 4B46A 1P4RA 5EUBA 1GCIA 3RIMA 1H6CA 1RJFA 5DGDA 3KVVA 2Z43A 1XZAA 2VTVA 1AF4A 9ATCA 3JQ6A 2NSHA 3AEYA 2EX4A 2JGMA 3PQFA 3MCWA 4HDKA 2HXSA 4XKJA 3K8QA 5K8UA 1JKMA 4IDGA 1ECFA 2SKEA 2NM0A 3SSAA 2X5JO 5JO0A 1K92A 1MJGA 4D4LA 4CM1A 4Y0NA 4TUYB 4XOPA 1Z0DA 3FDJA 4YBRA 2CT8A 1ZXLA 2YC4C 4B79A 2E3JA 4E5MA 1E59A 2MINA 3LECA 3GUZA 4HX5A 1V37A 1X1DA 2FEOA 2D06A 4R41A 5U1PA 3ZDFA 1XPUA 3R3UA 1XXHA 2UZ0A 3KNZA 3KYIB 2JLAA 2VH1A 1XVVA 4LJ4A 5AT1A 3IMGA 1L5KA 2ZTGA 1F9AA 2XSZD 2OKCA 1JNXX 1H1TA 3RK1A 2AQHA 4B85A 4PM4A 1OLUA 3TFWA 2O6LA 4W82A 3W5VA 3F6YA 4H4CA 2QG6A 4RK7A 3EMKA 2YNMC 4WFQA 4UTXA 3I5MA 4BTEA 2QJTA 1Y89A 2HQSA 4BUCA 3Q4GA 1NLYA 3I45A 4M8NE 2IZOA 2WG0A 4UMDA 5ALGA 3I9NA 1JJVA 1NVAA 3M6IA 3PNMA 1DZIA 3FPCA 1HBJA 2NPOA 2VA8A 3HCAA 2ZQYA 2W2QA 4FEAA 4PZ9A 4FSHA 2BEVA 3AFGA 3P19A 3W7BA 2Y1WA 3HYRA 3ZIAD 1OV6A 3E81A 3DLBA 1AS3A 1ZMOA 4Q37A 2F64A 3GIDA 1MIOA 3QEAZ 2HGSA 4J0FA 1JRLA 4IKPA 3Q9SA 3KL9A 4X20B 3E22A 4GMFA 4X7RA 3WGHA 4EW2A 1QRTA 3KWJA 1G0OA 2VPTA 4JI3B 4YRDA 1OLSA 2BFCB 5DLPA 4E2ZA 1JXOA 5DI9A 1J8YF 3U31A 4EWLA 1ORDA 2FOLA 2HADA 2UZ1B 2ZATA 1WKBA 4I5EA 1OX4A 2UVQA 5KCMA 4WOCA 5CYGA 3V1NA 3TZCA 1T4GA 2IX3A 4P80A 4Y6SA 1MOSA 2Q4DA 3S5UA 4OHCA 3GPIA 2IS6A 1F2TB 1GKLA 5EKDA 2OOKA 1FP6A 1TGYA 13PKA 4A0SA 2ON6A 2VF2A 4XVCA 1YACA 1MABB 3AQ4A 4FW9A 4IXDA 1HKHA 1XDGA 1C9NA 5CT4A 3LFHA 1CDOA 2AC7A 2D5BA 2ZRFA 3PDHA 1U28A 2ZRMA 3HYSA 2LPMA 1B93A 2ZRLA 4OJYA 5JE8A 3WGMA 4G1UC 2P68A 1Y9JA 4FKBA 2D2IA 4HDKB 4NV1A 3HXMA 5C4GB 5TF4A 1YVEI 3G2OA 5HEKA 4OHVA 3T4PA 4EUKA 3L8CA 1D9ZA 1OBHA 3IOEA 3QUTA 1VMIA 3P9ZA 4UD6A 3R44A 2V31A 4ME6A 3G0DA 2ZPUA 1VKRA 2X0FA 4UTVA 1DBVO 3VNRA 2MINB 3MTGA 4UXHA 4CMIA 5IKXA 3T3EA 4JJKA 2DVMA 3SZMA 2VNJA 2MSLA 4GR4A 5FQNA 3K20A 3W9UA 1F8FA 4DUGA 1OIXA 3G2MA 1XXHB 4MA0A 3RO7A 5F1KA 1YZUA 3G9ZA 2AA3A 4FHDA 3HSSA 5KMGA 1S01A 1EBBA 3HH8A 5LC1A 4YMTA 2IPNA 3JSAA 2ZWOA 3URKA 1A4RA 3OICA 3ES9A 3HDJA 3MTJA 5A05A 1IWBB 2X40A 5EJ2A 1AG9A 3U37A 1OLUB 2ECQA 4M2LA 1Z5ZA 3PJGA 3QA3E 4WZBE 2OESA 4HWPA 1WTAA 2MR5A 1Z2EA 3PUXA 1M5UA 4HBGA 3IPLA 1ZUD1 5BV1A 3OCCA 4ZOCA 1NNI1 3R0VA 5H81A 4B83A 3IVXA 2JIPA 2XCQA 4G0OA 3PXGA 3IEMA 3ZHQA 4HXYA 5AYVA 2CBZA 3F1KA 7MDHA 2BEVB 1KYIA 4IIUA 2DRIA 2ISQA 3CVWA 4Q00A 3CBGA 4BFZA 1IOVA 2VXCA 3GAMA 4MWGA 4NG4A 3TLEA 1VL1A 4ECEA 2ISCA 4L5AA 4S1TA 5D84A 3B70A 1NIJA 2E1RA 4G85A 4E30A 4C20A 3B2NA 1J9ZA 3BWVA 3BYZA 3E3NA 3F6BX 4I1VA 5COBA 3V7UA 3ZHBA 4ZK6A 3COWA 1SPXA 1SH7A 4Z7NB 1OLSB 4IMIB 1UBMS 4DJEC 4ZI5A 1E6UA 2AE2A 1T5EA 2FZ5A 4QUGA 1KE1A 1Z7YA 3MBKA 5DSXA 1C9DB 3SJCA 1VRVA 2ENWA 5GM1A 5CLIA 1OX4B 3PL5A 3FA2A 4WERA 5BSFA 1YJAA 4A3SA 1IBRA 1DEOA 1WV0A 4YEDA 3AEKA 1SXJC 1VLOA 1GYQA 3P2IA 5KSWB 3COZA 2E18A 4HQOA 3ZCQA 1EFAA 2VJJA 3KCQA 4LZOA 4OHMA 4TT3D 2ZSIA 4NZOA 4BO0A 4G5GA 1XQXA 4GW3A 3SYRA 5IC6A 4FFLA 3HGTA 1CCWA 4J2HA 2GEUA 5IYNA 1R8SA 2R1VA 2P2ZA 4JEIA 2NUAA 2R9VA 4Y3UA 4M46A 4CF6A 1NTOA 3W90A 1ZCZA 2XOXA 3TR0A 3RABA 3RVOA 4MUBA 4OPMA 1RI3A 4IV0A 1H4TA 3E9RA 1G1MA 2A30A 2D3WA 5LLTA 2G70A 1Y6JA 3CCVB 2O1EA 1GN9A 1VIVA 1PO7A 1H0HA 3EXAA 4QOEA 2D3TA 1E2NA 3VZDA 2VDUE 1BO6A 1L7EA 3H8SA 5JNLA 5AVJA 3QJYA 4D9MA 2VSQA 3IAAA 4TLCA 3UK0A 3S2UA 2GN9A 2VXBA 2ZI6A 4UEOA 3B1KA 1VTKA 2VDWA 2JHGA 3L7KA 2A33A 4CMIB 5HNKA 1F2UA 5JSKA 3OLQA 1JHAA 1OFTA 2P5YA 3UYLA 1KEEA 5ALSA 3ELWA 4A6PA 1E1KA 2FI1A 4WKOA 2HK6A 2IEAA 5CTAA 3D8UA 5KMGB 2ZTVA 5IAJA 3D4LA 4L4ZA 2H4HA 1U0EA 1QAMA 3K73O 3C24A 3M6AA 4Q3NA 2KYRA 5BNFA 2JIMA 5JS8A 4PLHA 3DHNA 3UAGA 3V3KA 4LYJA 3NDBB 1Z3CA 4OAOA 4OGLA 1KY3A 5JS1A 3X1KA 5D87A 4K9NA 2JIZA 5K0BA 1Y63A 1W19A 2YY5A 1M9NA 4V0LA 3FTEA 3QKWA 4TSRA 5G0UA 1F4VA 1O54A 4EY7A 3COPA 3I1IA 2VNIA 1M1YA 4HZIA 4HAVA 2QRKA 2FUNB 1V16A 2JLRA 3A36A 4H1VA 1TUIA 4LOIA 1NJ2A 4R7TA 4UHHA 5HK8A 1M0EA 1KK2A 3KD2A 5FFFA 1JZSA 2XKAA 3K4PA 3PC8A 1HDRA 1EVQA 2HM7A 2I67A 1OKKD 4YJ2F 1CRLA 3GH3A 2BM1A 1ZGJA 1E2JA 3KWLA 2QM0A 2YFQA 5G4KB 4C0BA 4DL9A 5BW6B 3OCJA 4JQOA 5JD4A 4P33A 2WWVD 3ONVA 1AK1A 1CUDA 3PGMA 2NTYC 1SKBA 1RWQA 4RADA 5DRYA 1UWKA 4UDYX 1MDFA 2Q41A 2FAXA 2QLFA 2QX9A 5KVQA 1NVWQ 1X8LA 2AIRA 3GR6A 2GB4A 3I30X 3RUEA 5FOQA 5I3CA 4CIYA 1FRZA 4A0FA 3AKEA 4Q03A 1H93A 3AEKB 1M2JA 2B35A 2AMLA 1ABFA 2G9ZA 3IODA 4X41A 5CNIA 3BTSA 1W47A 4LHXA 5KSOA 3ZLUA 1J2RA 4UAVA 4X1OA 1DRWA 3MT7A 3ZYZA 1GZVA 2OVFA 3PL1A 5EKTA 5CD9A 4AS2A 5BYAA 3LDFA 3FOZA 3WP1B 3OZDA 4K9PA 2PNFA 3KETA 3LLSA 3LV8A 2AXNA 3T5AA 3QVLA 1TADA 4MX8A 2WF9A 4LIPD 1BGXT 1XKLA 3F8TA 3GEIA 4PPQA 4ZT7A 4QECA 3H9NA 5C80A 4MUHA 5HMMA 3ECCA 4A0HA 1D2EA 2H4ZA 2XKJE 4GXQA 3Q3EA 1Y7HA 4RULA 4W6QA 1VE3A 4F9GA 1T4MA 3A7DA 4E31A 4IGEA 2VDWB 1N7JA 3H83A 4B47A 4Q3DA 2F3SA 1F2UB 2DZDA 1KEEB 3DFMA 1NKVA 3JQAA 5BQOA 3OQMA 4C4OA 1RWKA 3OWXA 4CTNA 4YRBA 1XMVA 4MVJP 2ZTUA 4JJGA 2F4VB 5AVZA 4Q1EA 4QPJC 4GMGA 1N1DA 2WJIA 3GCXA 4OMFG 2RH8A 1RIIA 4CODB 5AO9A 1OH6A 1XPJA 2MSKA 2OQ2A 1NW7A 5DKFA 4KHZA 2GNOA 1L4NA 2YIJA 4UNRA 3JQQA 2GPSA 3PNPA 1CZHA 3WYDA 3Q8KA 1YIOA 4ZANA 3RYFA 4ESVA 2BF4A 2G80A 4IVNA 2R60A 3LOQA 4GDFA 4B33A 8ADHA 2BTQA 2I87A 5E2AA 3TLBA 3AV3A 3BGVA 1WOPA 1EQAA 4JXKA 4KV7A 3UZUA 3AK4A 3U5TA 1IK4A 2DFNA 1M1YB 2VP9A 4ACAA 2RARA 2VPPA 1V16B 3C8MA 3F90A 1H8EA 1X6VA 3LBIA 4PGFA 5EPEA 1G6KA 1E9EA 2G1AA 2EKZA 4RLSA 3I9KA 2QQ5A 1X1CA 2IYVA 3DHWC 5ALVA 5ITZA 2XNHA 2B8NA 4MICA 4FZ3A 4Q9IA 2JFQA 4HEA6 1T8UA 3V2IA 4BVLA 4U2GA 5KAPA 2QN2A 4XWYA 3VDXA 3Q1KA 4PHGA 3F3SA 4AI6A 1SZPA 4XWAA 4MRNA 3VHQA 3ZNNA 5K03A 1YCFA 3RNOA 2XUKA 2EGHA 1XMIA 3K0FA 2M6KA 1ZVQA 4PR0A 1J5XA 3CKKA 1GLNA 1VMDA 4RGQA 2WVJA 5DHTA 1IBLB 2XVAA 2VPYA 3OLYA 1ZN2A 3PTLA 2KX7A 2MR6A 4NU6A 4UREA 4F2HA 1I6MA 5KNDH 1KAHA 1QGUA 1UT8A 2JZCA 2IV3A 1UMCA 4XKVA 1JTEA 1RPAA 4RPHA 3DTNA 4WASA 4DWWA 3AFOA 2Q29A 1V3UA 3HV2A 1A82A 1BTOA 3WNZA 5B1EA 1UANA 2HT6A 3ZTTA 1ZVVA 1P4SA 3NCTA 3BXFA 3IQFA 3G5MA 2KB0A 1V4NA 4P54A 2Z5GA 2CHVA 1QCZA 2ZSUA 3IT3A 4IDOA 4J6FA 4B73A 5HPYB 2REQA 1Y1KE 1U9ZA 4EFNA 2QRMA 2FF7A 3WLHA 3EPKA 1F6WA 3CLKA 2XZOA 1GTJ1 1HE8B 3ETCA 3K5HA 4OXYA 5LP6F 1NMEA 3D3JA 2JVKA 4YC7A 3A1DA 1MGPA 3IMCA 1LX6A 4M1QA 3W5JA 4P6VF 3CSSA 3BGDA 3GEBA 1XTBA 1U1CA 3EPRA 2CSUA 1J70A 1Q2UA 2FPXA 3RW9A 1U8TA 2P6OA 2GAIA 3HHEA 4Q48A 5GP1A 3ZS8A 4Q7QA 3SZRA 5T57A 3JQAB 2AJLI 4LJ5A 3RTBA 3S44A 1CBUA 1Z2OX 2MSWA 4E3WA 2ZG6A 3MMNA 1CUCA 3IQXA 3QXXA 1NSTA 1Z4QA 2P77A 3PF8A 2FU5C 2GK7A 1RI5A 2HEIA 4AB1A 3ZCTA 1DBQA 1DO0A 1K4KA 3NT4A 3SFZA 3CRRA 1LS1A 4MGYR 1WOMA 1Z8HA 5IC4A 3ZQJA 4UMEA 1CF9A 4DNQA 6LDHA 3AUAA 2IFTA 1EFLA 1Z56C 2VNAA 5TS2A 4YP7A 1V8PA 4Q4JA 1C8BA 1MOZA 3K35A 2PKQO 2GWRA 2X5OA 3MWEA 3RYFB 2E4ZA 3P2OA 4BQIA 2PSHA 1GGNA 4WT7A 2QP4A 1RI4A 2RKWA 2BTQB 3MCTA 5DM2A 3JALA 2FJ0A 2QYSA 2XUIA 3NM5A 4Q7EA 3UB3A 3BCSA 3JQGA 3VO9A 4C22A 2FKNA 2EU8A 3NYIA 3LYUA 4JJIA 4JX9A 3IJPA 5J5AA 1RHKA 3BVPA 2NUBA 1OAKA 2K7FA 1XQVA 4FC7A 3I9FA 3QJ5A 5ITZB 3GLKA 1P8JA 2OAEA 5CT8A 1NRXA 2R8ZA 4ILEA 4DWOA 2P6MA 1RD4A 4FN5A 1PE0A 2AGVA 3K9LA 3VZRA 2VN8A 5JJCA 2VHWA 2H4FA 4MQEA 3KQNA 2HY7A 3NV7A 1EUCA 3LQ1A 1KDOA 5K5EA 3PTAA 1V8BA 4OOFA 3B85A 1P7WA 3K0FB 4R2KA 1DBWA 4XD2A 5EKXA 1HZZC 4ZAFA 3T5GA 2H5IA 4WXPA 4QSHA 5TMBA 1RHMA 4X95A 3VU0A 1V2GA 3UPTA 3VPCA 2FFJA 1AF7A 1QJ4A 2G4VA 4OQEA 2HU8A 2WK1A 1QGUB 3MCAA 3DVAA 2PR7A 3AFNA 1U8XX 1UMCB 2W6CX 3M6VA 4AJPA 2PKQP 4F9TA 7YASA 4F2DA 3SMVA 4DKJA 3EUFA 3R9KA 2SICE 2QTCA 1DPGA 1DG1G 3WX0A 5GADl 3HPQA 3O2SB 3IOYA 1H05A 3RUDA 2BTEA 2Q3LA 1UKAA 2REQB 5IK2A 3D8NA 4IJKA 1B8VA 2JFZA 2ZTNA 5L3VA 4MO9A 3C45A 2DECA 4EARA 1C8LA 2FSIA 2RGWA 1R64A 5KYKA 3QXSA 5IN4A 3EIXA 4HDSA 2BGUA 1OFIA 4EJSA 2AEJA 2R86A 3K94A 4P0PB 3LL4A 2Z4TA 3LPLA 2YXLA 4YIKA 4ZYTA 1T6YA 3QLJA 5EXPA 2YQZA 1E1RA 1QYIA 2P1DA 2YYYA 3G2LA 4P3NA 2P0AA 3R5XA 1HXHA 3JAWA 4DMRA 1JJFA 3VMFA 1JG2A 1BGVA 1CJUC 1D0SA 1NBEA 1RLIA 5BN3A 1RRPA 4KX3A 2XUHA 2O8DA 4JUCA 2D5LA 1M8JA 4LNUA 4DR2B 2VP5A 3MW8A 4JU9A 1K7YA 3BULA 3SY8A 3FTDA 3UMMA 4Q4JB 3D5EA 2GK3A 1JZTA 4EBFA 3MWEB 1HDEA 4PG6A 4B4WA 1IM2A 3WNCA 1HETA 4XWKA 2QMOA 2R6ZA 2RAFA 3JALB 3Q3VA 3AHCA 2OUIA 1H0KA 2J4DA 2P3QA 3JQGB 3B51X 4DYDA 1G8YA 2XF2A 2DULA 4BB9A 3SQLA 2PU7A 3GEMA 4NABA 3MTAA 5DASA 2V6BA 3AVTA 3NBXX 2XKKA 5DSTA 3GVHA 4MTLA 3W8DA 7ABPA 3QE0A 1HDOA 3OHPA 2P5TB 1J1UA 1BFDA 1Q21A 2I66A 1B23P 1CY8A 1L4FA 1N2JA 3C6ZA 3NTVA 5D5QA 2YY7A 4DLTA 3ABQB 2G5GX 3JQPA 1EUCB 2A8YA 2GBLC 4OHUA 5HF6A 2ONJA 3HTXA 5LMNB 3RT7A 2UYYA 5FX2A 4JA0A 3O38A 3JR7A 5M5BA 2ZZQA 5ALKA 3SVTA 4BUZA 5FPTA 3DKPA 1TLTA 4MWOA 2AVDA 2B4KA 2ZJ8A 3HV0A 1P9OA 1KXZA 4BAZA 2R00A 1EH5A 2EZ4A 1EP9A 1PDWA 2TYSB 3DVAB 4OB8A 4AUNA 4JJFA 2X8KA 4GICA 4Y1RA 1MTOA 2OXTA 1D03A 3JD0A 1YJ8A 1D8TA 4JR2A 1ZOPA 3VDMA 5H68A 3C3CA 3FGZA 2XAUA 1BAPA 1KBQA 3UXYA 2GO7A 3ADCA 2H2HA 3I2IA 3R8XA 1Z8NA 3QOWA 4D2IA 1FVHA 2XUFA 2EJUA 2Z6BD 5CH3A 4I3HA 3KUKA 3LOPA 1PW7A 5I9IA 4X85A 4HDSB 2IYEA 3AY6A 2IITA 1E5VA 2ZAOA 3IT2A 3QUBA 4O5OA 4TMYA 4EJSB 3MEQA 1OIWA 3AU9A 1GLGA 1SU4A 2QZSA 3QKIA 1H2XA 3I2HA 4M7PA 4UU8A 4HGPA 2WWXA 2Q1YA 1IHPA 2TECE 1WCIA 4ZCPA 5CXQA 1SQ5A 1DJNA 4ZCRA 1Y34E 3JAWB 5DCUA 1QK3A 4PBSA 1K6IA 3HP4A 3NM6B 3R6WA 2QTGA 4QYWA 1Q3KA 4EOGA 5BN3B 2JFBA 4N47A 3VH4A 3W8FA 4RNDB 1UWVA 3ZBQA 4YR9A 5JBNA 2O8DB 4LNUB 2DWOA 2H4JA 4QOIA 5TMDA 4F6LA 1KFEB 4ZU3A 4DEXA 2CHEA 4XDYA 1RQRA 2H3HA 4JITA 5B37A 4Y18A 2RGNC 1CUBA 2VK4A 4G0PA 3IT0A 2W98A 4KN9S 1UZMA 3QEKA 2EF1A 4PPGA 4UTRA 5LQJA 1XROA 4IINA 3W4IA 1EUDA 2JGDA 2BFOA 3DMTC 1CVRA 3UXEA 4L5YA 2ZUWA 3R6TA 2EHJA 2GXQA 4CMHA 2QP3A 1CNFA 1ATZA 1GDDA 1P5RA 1SPBS 3P71T 3T1OA 3L18A 4HR7A 1OTXA 3ZJ4A 5AJZA 4P7FA 4WINA 1OZHA 1V0JA 3BRCA 4Y6OA 5SYNA 3TSOA 1HX7A 1LV8A 2O1WA 2KE5A 3AU8A 1ODFA 1V6SA 2WEKA 4IIFA 4AURA 3CP2A 1C0PA 4IIBA 4TRJA 5A5VA 1PYOA 3A8IA 3ZVNA 3HJRA 2H1SA 1CWUA 4J07A 4LXHA 2QIOA 2YN2A 3QP9A 1VGQA 4C0HA 2GPNA 1M0SA 1KJZA 1AO3A 5D5HA 5DM0A 3WNQA 4R8KA 4B6GA 3G2PA 3CUYA 1R37A 5KJCA 1NQ5A 3GLGA 2JLZA 4BZZA 4HQNA 2HA0A 1C7IA 4Y1RB 4DSAA 3RASA 1RXYA 4MJLA 4M4SA 5AJVB 5IXSA 2YIDA 2VBTA 1CC1S 4NCIA 1MQ9A 4HFNA 1FVFA 4D7AA 4JDPA 4FNOA 3CB2A 1ZMXA 2C82A 2ODPA 4FT2A 1KAEA 4DWJA 1MQSA 4RVGA 3ZWWA 4I4IA 1UBFA 3WOHA 2CJXA 1UQRA 4DMGA 1SXGA 4IHKA 2R7LA 1MFPA 3U9SA 4L50A 5C1IA 3STWA 4AYXA 2O4UX 3TL3A 1U8YA 3K0CC 4MVJE 2CLCX 5BNZA 7REQA 3C3WA 3KCNA 3H9CA 4EKYA 1SRRA 2L0XA 4KWCA 1R6VA 5G3YA 5M7EA 1WCIB 1Q5PA 2O52A 3ZDYB 3LA6A 1CSEE 4XB1A 3VAZA 1U7TA 2DQ4A 4C4AA 1L4BA 5BSEA 4L3WA 3SLNA 2LKCA 4GRAA 3UB2A 4IIHA 1LFAA 3F1LA 3IDZA 4L0QA 1AGYA 4PYRA 1HE5A 3OCYA 4MUYA 5EPUA 3OOHA 4DPKA 1YJNB 2PQ0A 2C54A 3QX3A 2WNSA 5JYCA 2DH6A 2CF4A 4UUOA 4IS2A 1L5GB 2V7QA 3KB6A 2C7RA 1AQYA 2E55A 2QSYA 1EUDB 2JGDB 2X7HA 3OG9A 4H17A 4HUTA 3A6ZA 2CNBA 1A7AA 1T8SA 2C3MA 2GRUA 4C30A 4CV2A 2C9ZA 5B7QA 2D0IA 2Y1DA 5E0KB 4LVOA 3RV4A 4EA7A 3U4CA 1WKVA 2I2FA 1RQ2A 1X9HA 2HIHA 4P12A 2ZBVA 2OV3A 3LS2A 3NT5A 4PHTA 4WE3A 2Q5JA 1Y48E 1JLKA 1U0TA 2EDCA 4HQKA 2JKZA 1PJRA 3OCXA 2Q3DA 3SE7A 1IL0A 1OILA 4WJKB 3A0UA 3RG2A 4KGVA 4R8LA 1MV5A 3QFTA 4DCJA 2CXOA 1VJGA 4BZWA 3AB3A 3CSDA 4TTRA 5CVEA 2RK4A 3F4BA 3ZS9A 1KI1A 2WHPA 2XEDA 2NVUA 4P5DA 2XMZA 2O19A 1CS4C 1K5GA 5IBQA 5A7HA 2G63A 2VHJA 1ZH8A 4G5QA 2ERXA 2XX3A 4DG5A 3DNMA 2KLBA 3H17A 2BZ1A 1AX9A 1P2VA 3OOYA 4RZ2A 3COJA 1V8OA 3FR7A 1II9A 2LE0A 3UQZA 3BJIC 3UGTA 1NBAA 3D6VA 4N12A 2JCVA 4E5NA 3EDQA 4YP9A 5EIAA 4R8SA 3TRJA 3KJNA 4WDRA 5CT5A 1P73A 2ECKA 4NP6A 4BNWA 1PSDA 2EJCA 3GLTA 5L4SA 2BJVA 3D4OA 1RWXA 1MG5A 4C4YA 1JQDA 3ZHOA 3GLIA 1JXQA 4YPFA 4ON9A 2RDMA 4F97A 1ZMBA 7REQB 2ZR7A 4Z0NA 1JSLA 1KSFX 3NKLA 3IR7A 1T3TA 3BC9A 1L8OA 1YB5A 4JKYA 4V03A 1EEHA 1LSUA 4B3XA 3V4PB 4DC0A 1E4OA 1SVKA 2RKOA 1I0IA 4LHVA 4XX1A 4S05A 1C7EA 2BRUC 3KV1A 4JYAB 5TEVA 4ZWNA 4EI8A 4AC9A 3DKIA 3TK1A 4N5HX 1VPEA 4LDJA 2WOJA 3GCWA 2NSDA 4INZA 5ED0A 3E4CA 1DKOA 1HI9A 3GGCA 4IBOA 1HM5A 4TYQA 3OD1A 3UNXA 4MV8A 2PRZA 4BLUA 1XCGB 5C51B 3OSZA 4MV5A 1LFDB 1QDLB 2G1UA 2JL1A 2NU9A 1EVEA 2OHFA 3KQOA 3L7OA 4QYMA 3ZH2A 3X43A 2ATIA 5ELXA 3THOA 1Z5NA 2OWEA 5E8JA 1JG4A 1YV9A 5L46A 1O87A 2ZU0C 2OILA 2ODBA 4ZCQA 1XB2A 1JFLA 1Q57A 1QIJA 4F5WA 5JZOA 2FVGA 3ACBA 2Q3FA 4ZMBA 4Z4TA 1CR6A 2ZQ5A 4MW7A 4X6UA 3X1ZA 1N9ZA 3RTEA 1EXNA 2E49A 3B3AA 2J9GA 4HTAA 2HPHA 2VZEA 3F7NA 4JCOA 4PQYA 4LYFA 1PUIA 3ZVMA 4MEAA 1QHEA 2PUGA 3GNTA 5FUXA 2K2WA 2O9JA 1H3EA 1AD2A 3BRWA 1UXKA 4JLDA 5CTJA 3D6JA 3IHLA 4NEHB 3ZCXA 1CEYA 1Y4AE 5B6JA 1HGXA 1NMSA 3BHJA 4UMFA 4H15A 1BZYA 1B73A 5DW0A 3V9AA 2QNBA 5JSYA 3CISA 4RPBA 2H2AA 3CEAA 2WHPB 3P20A 2NVUB 3TXAA 1J99A 1FPMA 4ND4A 2B78A 4I4LA 3UC5A 4GX1A 2H1OA 1V1RA 2Q7OE 1R9NA 2F55A 2V96A 4RTSA 3MQ4A 2NZ8A 1TU0A 1X3SA 2W5UA 4JKOA 4LZNA 4BN4A 4RU1A 3K1AA 4IGFA 4LV8B 2I7VA 1E7RA 2AXPA 5BMVA 5JSFA 1GRCA 4Z4UA 1AKMA 1IN8A 1FQKA 2VRWA 1CZKA 2YWCA 3DONA 3LX6A 5C1BA 5LQRA 3DZKA 2IW1A 3PRHA 1Y8ZA 4BCCA 3HQ4O 4ZQEA 1KNQA 3TQTA 5K8LA 1FIUA 1LW6E 2VDRB 3QSGA 3AWDA 3GVPA 1CY2A 5CP8A 1T5LA 1QR2A 1NT4A 2FUEA 2W43A 3DLIA 3Q3CA 2O5CA 4CUZA 3RVMA 3CF0A 2XYGA 3LCMA 4U1RA 1E1YA 3JZAA 3KQSA 4QO7A 2OT3B 5IARA 4Z7OB 5I4BA 1DIBA 1LPOA 1NF2A 1X8JA 5EJFA 1VDZA 3SQXA 2J3MA 4RSMA 3P0FA 2RB4A 3PVDA 3S70A 3H1PA 5KWSA 2DY1A 2IODA 2BGMA 2DR3A 2Z9CA 5C35A 1JE1A 1V43A 4OGKA 3V3TA 5MGNA 1RHRA 4YK7A 4P7KA 1JIJA 1KETA 2WT4A 2PXAA 5JMTA 3RADC 3ND7A 3EF3A 2ZYWX 2XOKD 5HVNA 2ZROA 2Y76A 1TX4B 3RRYA 2DQYA 2DPGA 2NU9B 3VHLB 4TXJA 3MIIA 1WA5A 4QGFA 4WCFC 3PUWA 1EU1A 2PBLA 2E5WA 4LXIA 1ZN9A 3TLXA 5TVGA 1LDNA 1XNJA 4EMUA 3ESZA 5C4MA 3GJ5A 4D5GA 1PS0A 4RXMA 1O3YA 3GD7A 3OQPA 4UM5A 1CT9A 3CCCA 3SYMA 4H0NA 4W7HA 2P91A 3KLPX 3LL7A 4QDJA 4URUR 2PLRA 1WX1A 2Y4NA 4W5HA 3TOVA 5HOEA 5GV8A 2QEXB 2ASVA 3QW4B 1WCYA 1PDVA 4OLJA 1XWFA 2QXTA 4LSGA 5JHHB 5K0ZA 6Q21A 3LVQE 3EWSA 5LD2C 2HK9A 2PWBA 5KQLA 5BP7A 3E48A 1RPTA 2HZBA 1FNBA 3U40A 1KKLA 3H8WA 4HC4A 4TWJA 5C5IA 5JJIA 2GJ9A 3NBAA 3HXOA 4KB5A 2IYZA 2BKUA 3DE7X 2X6RA 3FCUB 3INGA 3K3PA 4K6KA 4PZCA 4ZAXA 3WYCA 5ER6A 2AKAB 1UZNA 4DCVA 2OTLB 3AV0B 3HA7A 4GKVA 4LK3A 4OL0A 4ZPJA 1D04A 1V1RB 1NC1A 5ALXA 3A35A 3LC0A 3LDAA 4AN1A 5KI6A 2HA7A 2MU1A 3EG5A 4Q9NA 2CHGA 1PK7A 2IVFA 3C4VA 2JAHA 4FQ5A 2WYOA 5EERA 4HAOA 3K1AB 2LDBA 3AXSA 4UBKA 3FHCB 1TZKA 1IBSA 4WBSA 4BVAA 5IJWA 1UJCA 2IYXA 1ZIXA 5E4FA 2SBTA 1L0BA 1AUPA 4R4JA 3FOBA 1KOGA 2J5BA 3QBJA 4PZUA 5MFPA 5REQA 1PN3A 3ETHA 4Q1AA 2E2WA 3ONWA 5I48A 1G4AE 4MHSA 4XN0A 5JCJA 3FMOB 4QGHA 2VHYA 3NH6A 3WYAA 2VRCA 1UFOA 3PHIA 5IKMA 2DERA 4DBVO 1XAIA 2WU1A 1AK2A 1SUPA 4H27A 1K8XB 1GUDA 4TKMA 4BLQA 3AFMA 3HADA 2BMDA 3QNWA 2R8PA 1PIWA 4MW4A 4FJ0A 5DYIA 3T9FA 1POXA 2XGOA 5CW2A 2UVDA 2D9RA 2WG2A 2XYPA 2ZIFA 4K8OA 4XIJA 1CLUA 3B9RA 4XFKA 2Y2VA 3BCDA 1TTHA 2GN8A 3HYLA 4AKGA 2J0QA 1VKZA 2GA8A 3EGOA 2M6LA 3UG6A 4QKQA 3TJMA 2GHQA 2WU0A 1WDTA 4M8KA 1I2DA 4UFNA 3WLSA 5FAKA 5JVDF 2QQEA 3TLCA 4DBLC 1GFIA 4QEZA 2OO5A 4PAAA 5FCDA 1IQRA 2OFWA 3MG9A 1RYZA 3UQYS 4HFRA 3UT0A 4D8XA 2X1MA 4O2BF 3OP1A 4EG5A 2VJLA 4ZI3A 1L9XA 1NX6A 4P7GA 2OBNA 3FDIA 4DARA 4U8GA 5DB4A 2B94A 5G02A 5FUMA 2R7NA 3F7MA 1ZL0A 4RHYA 2DWQA 4HBZA 4FFSA 4D4HA 1T8YA 1XMSA 1GKIA 5CURA 4JI5B 4F3YA 4KWIA 3LX5A 3JQBA 3DJYA 3WP0A 4DREA 5KSZA 2QUKA 3HI4A 2QTRA 2JIDA 4YFVA 4A0RA 1IZ7A 4NF2A 3GT0A 4G5HA 1Z12A 2NOAA 3R7BA 2PTHA 4RVHA 3LUJA 4YCBA 4L76A 3SLGA 2QTHA 3NP7A 1MPXA 4PVDA 1KZ9A 2RHLA 3A4IA 5KIAA 4ZTUB 1ZW1A 3BXPA 3HCPA 2AN4A 1JDPA 3FZYA 5ALFA 5AR1A 1QNFA 3ST7A 4IIGA 4Z4HA 3PHJA 2ZBUA 3ABZA 3I28A 3NONA 5FA8A 4QXMA 1OTYA 2HK8A 3DZ8A 3MTBA 3ASQA 1FTWA 3PE3A 3T1QA 4AMGA 2VHEA 3SHFA 3GRKA 1VBKA 1RQGA 3E20A 4V0SA 1FPQA 3A1NA 1S2NA 4MITA 2NZVG 5BSWA 2EKPA 3UBTA 1JP7A 1ITZA 3IVAA 1JG7A 3FWNA 4L4YA 4OKIA 1IQ0A 2GO1A 1IN4A 2PIAA 4ND8A 3CUKA 3L9XA 2XMGA 3EWAA 5REQB 1N92A 4UDOA 3TRIA 2EKBA 2OD9A 1XMJA 3JWIA 4P58A 3UK2A 1DC6A 2H5EA 3VTKA 1J20A 2W71A 1WU7A 4EMSA 1ZINA 4J7UA 3LK7A 1QUFA 1BWRA 3E7PA 3GFBA 4JWKA 2UUAB 2UXCB 4IFBA 4HAYA 5FBWB 1M5RA 1ZJ6A 2H29A 1Z4JA 1VI5A 3BSYA 3NHBA 5E6SA 4COOA 2WZPP 3QMVA 4QVGA 2VUTA 4U00A 3OTGA 4TN5A 4GSKA 2NYRA 2R11A 4BASA 3GUCA 2QD4A 2DFDA 5BN1A 5LPNA 3V2UA 4C01A 3MAGA 2WG1A 5DLEA 1CJKC 3E5NA 4A8PA 1ZR4A 2HPZA 2P2DA 5K0FA 4AD8A 4R68A 1IN5A 4E13A 1PWYE 5AI4A 3KVOA 2EWWA 4O4JA 1YO6A 3MJEA 2H48A 1T9CA 1GUZA 3HR8A 4HQ0A 5C5DA 1AURA 2OBTA 4FFWA 3CONA 4ASUA 3I09A 5CK5A 3WS7A 1U2DA 1HPLA 1EJBA 5F2OA 1XKTA 3JYPA 2AE1A 3KKPA 4ZZIA 4X1YA 5AHRA 4JGIA 3W3ZB 3VTFA 2WR8A 4NK4A 4WZAE 4DAOA 1T1IA 4FNGA 2FR1A 4RETA 5AKIA 2G8NA 3MB5A 4O4HF 4DQDA 5LNK6 1R6XA 4C4SA 5BQPA 1UJ6A 2IHZA 4G0UA 2PLNA 2WBLC 1AB6A 1KDYA 1U9IA 3FF1A 3V4FA 4HPJB 3L02A 4F3NA 5JH7F 1J0AA 1E58A 2GPYA 1PJTA 2PEYA 3ANYB 1NJGA 5HGJA 3H84A 3R0XA 1NHWA 4GZ5A 4Q01A 4AY4A 1HK7A 4YACA 5FIUA 3AJ9A 4KLAA 4PU0A 4LYEA 1C3LA 1U8AA 1XDUA 3T7TA 4PX3A 1Z6AA 1U6IA 5JUWA 2J9ZB 2OE2A 2OV1A 4DM7A 5TLSA 1YR8A 4OQFA 1E3JA 2VBCA 1TCAA 1QC5A 2IDJA 4M1SA 5C5CA 4MKHA 1E6WA 2YJZA 2DH5A 2PX5A 4J0GA 2B61A 4GE3A 3N8HA 3ADOA 1W76A 2R6R1 5L7YA 1C9EA 4NCBA 4JLWA 5KNDD 4JP5A 3C6QA 4IZHA 4AN0A 3ICEA 4ND8B 3OPMA 1S8NA 4LV5B 4Z0PA 3SEFA 5BNWA 4JI7B 4G7WA 2JLCA 3AVQA 1FMCA 4PO1A 4HV4A 2GDZA 3VR6H 4MGIR 2NYVA 2ZJZA 4EGCB 2ZSBA 1WE2A 1EFHA 2HU2A 2WM9B 2C20A 3PWTA 4TTAA 5E6SB 1YZ3A 2L69A 3P8ZA 2WYHA 4XOUA 4BGEA 2V6IA 4EYEA 4ZGBA 4AJLA 1RAEA 1IRIA 2GJSA 4L4RA 4CT4B 2ETXA 4MAMA 4EI2A 2QR3A 2LZ0A 2ZIGA 4M9RA 4B71A 1XTPA 4L7QA 4KREA 5I9NA 2VK2A 2AEMA 4F8JA 2FSFA 1ZMTA 2YJTD 2HOQA 1FVXA 5DU2A 3GVIA 4NENA 4WX2B 1U0LA 2X3FA 2X2OA 4O4JB 3E1SA 4QBHA 5HDQA 3AVWA 1NN3A 1NXVA 1Q0RA 1PEKE 2J3LA 2JFGA 2QN1A 3L7JA 4V0ME 4YBZA 4CL8A 4EKNB 1PHPA 1VE7A 3B52X 4JVSB 1HYEA 1OW3B 3T9CA 3KHUA 4WTOA 4J2OA 3SGLA 1SKMA 4LQCA 3HJCA 2XMPA 1H6BA 2XDWA 1YQQA 1YRAA 3EODA 4LDPA 4UE3S 4X1YB 5FEUA 1OIVA 3WQZA 4DDTA 1SMKA 3IO3A 2DUJA 2PPLA 2GPBA 5EHGA 1JAIA 2KHZA 3VVLA 2CXPA 5DGCA 2QVYX 1TW2A 3QE4A 4BP3A 1BQ3A 1WCXA 1N0UA 1Q0ZA 2FLKA 3RIHA 5I5EA 1QQBA 2WKPA 4XGRA 4D25A 1XYYA 2XCIA 1U5BA 2FK7A 3N8DA 3SSMA 4AZTA 2AJCA 4OYHA 3W1EA 1QCCA 2D59A 2QENA 3DGFC 3EVNA 3HUEA 1KGSA 2QJFA 1NAIA 1L4UA 3B13B 5DBEX 4M38A 4DGSA 2YZMA 4AU1A 5F1YA 3G7SA 2LKDA 1Z62A 2QQFA 4IH1A 1GNTA 3HVJA 4DIMA 4URXR 5IJAA 1JILA 1GQYA 1UBJS 1YUNA 4K6HA 1G0NA 3QFFA 1QC5B 1W49A 1J8QA 2OCYC 2XGSA 3HXLA 4D9KA 3HO1A 3GAAA 3E9ZA 3VNSA 2BGKA 3CXUA 4JB2A 2E82A 1AVTA 2PH3A 4XJTA 3TNJA 1SQSA 1DXOA 1ZCJA 2WZCA 4GP6A 4RD1A 2NSLA 3LVBA 1LLUA 2XA1A 3NGMA 3PPWA 5GGYA 2PQMA 4XOTA 2VK8A 2HA6A 3L7LA 1I5OA 4JLPA 2BLLA 1RKQA 2PX0A 3PC4A 1XWWA 1N1EA 1TJ3A 5AIAA 4XQCA 5I9SA 4BDSA 5EMJA 3F5DA 5EHZA 1YQGA 4WI1A 3WO0A 5KX5F 4OU5A 3DWGA 2IXGA 2JJ1D 2A9KA 4G3XA 4RKEA 4RW0A 3VZSA 3W1WA 4WLVA 2W6OA 4I9UA 3CR8A 1C0IA 1AK9A 4IJ6A 4MKGA 4A73A 2VQ3A 3EISA 3O26A 4LRWA 2WKSA 3KPVA 3A9RA 2QSJA 1IHOA 1VQLB 4HHEA 3K0SA 5IASA 2AJTA 5KPJA 1V95A 5LZ9A 2C8JA 4NENB 5J43A 4YDQA 1I5EA 2ID9A 4H3KB 4LYAA 1P1FA 3GLUA 1FFBA 1ENPA 3KYJB 5ADVA 3CP8A 1EG7A 1UBUS 3CCFA 3CN7A 3X2SA 1JSXA 3U09A 3NVAA 1PZFA 4F5YA 4QYIA 3D7KA 4QNRA 2J85A 1MAWA 3KZCA 3ABOB 1ONOA 4GP9A 3B6IA 3WK4A 4DRXA 3VH3A 3BXXA 3UWDA 2XMQA 1EWYA 3BPSA 4LJKA 2EJBA 4BO4A 1D0IA 2H31A 1U5BB 4MMYB 2PRJA 1M3SA 1TA9A 4ZA2A 2JS7A 5E1BA 1INLA 1GUAA 1EA7A 2GZRA 3ZXYA 4EJ2A 4DR6B 4MEBA 3CRW1 4X7EA 2XTNA 3RUFA 3TZLA 1QXSA 1W8DA 1N6KA 4YWHA 4HADA 3WDSA 3LZDA 5CM8B 3UMSA 4YDSA 4J3JA 4I1OA 3VTAA 5LBIA 3HB9A 3KSAC 1XFAA 2BEJA 1H42A 3QFRA 1G1AA 4CHTA 4RFLA 4LF8B 2O2YA 3CNLA 3Q5DA 4EHBA 2KVOA 3VKWA 2IPAB 3ASSA 3QF7A 3ASZA 3GJ0A 1PT6A 3WLRA 3QMPA 3GJ3A 4MUFA 1GL6A 1MQ8B 1TGVA 1SCKA 3MMZA 3KG2A 4MR9A 3WJ7A 1YA4A 1U8ZA 1PNOA 9ABPA 4B7CA 4BWGA 3DC2A 4XFDA 4P3XA 4ZQIA 1OGIA 1N5LA 1IM5A 1H2BA 2XQGA 3B1YA 4DPMA 1D1SA 1UMBA 1UODA 2EIHA 4JFAA 3SKXA 1WORA 3MAAC 3MBIA 2H00A 4MW5A 4POOA 3I1YA 1A5TA 3H2GA 3LXUX 2ZM5A 4HNRA 4CN9A 1COZA 1PGOA 3RSFA 3CCLB 2OFPA 2SHKA 3MWGA 3PDIA 4IF4A 2GBGA 3QW2A 3EPPA 1W9MA 4WKGA 3ZQUA 1OFHA 1DEAA 1WB4A 2ZJ5A 1TW3A 4L57A 1PNRA 4D26A 4JI2B 4ZQGA 5CLJA 1XAJA 1T0UA 2N1MA 3ZGOA 3JR3A 1II8A 5CDGA 1X92A 4TYYA 2ZSJA 2CMDA 2OHXA 2V5AA 4EVRA 5EZSA 5E3JA 2FSVA 4ONEA 4N3NA 4YT4A 1NMXA 3RQSA 4OXIA 1DTEA 3U6BA 2VDPB 4PF1A 3OT5A 3RK0A 2ADMA 4TLBA 5CG1A 1KMNA 1GVHA 3L6DA 1QGYA 1ZD1A 2CXXA 2WW8A 5F4BA 3NR2A 1K88A 4QYIB 3WTBA 3PQ5A 4KL8S 4OPOA 5AJUA