4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
5IJXA 1O96B 3ZIUA 2PFSA 4EG6A 1K97A 1F7UA 4KKVA 3A2KA 4I6JA 3CLRD 5LFAA 1K4KA 2PG3A 3SYTA 2Z3VA 1LI5A 4EG8A 3D6UA 2J08A 3FY4A 1Q77A 1IQ0A 3MLBA 1OD6A 4MQ6A 4MW9A 4EGAA 1NI5A 4MVCA 1LI7A 2DUMA 1WKBA 1WXGA 1NB0A 5TS2A 3G6KA 3CVYA 4MLPA 1YUMA 5HG0A 4MUNA 1QRUA 1IQRA 4UZFA 4X0EA 5F23A 5HUJA 1GTSA 2D13A 4CDNA 2QJTA 1I6KA 1N2OA 4KPUB 1MAUA 4PBRA 1DNPA 3ND6A 3ILVA 1MB2A 1NURA 3HFJA 1EUQA 1EFVB 1EFPB 2PZAA 1K4MA 5A8AA 4A91A 1WOYA 1ZH6A 4MAFA 1H3FA 3P0HA 1KQNA 2JAXA 3AFHA 4DE5A 1Y42X 3RHSA 3PNYA 4KR6A 3IH5A 4L2IB 5K0TA 3SZ3A 1KAMA 2CYCA 3S3TA 2DETA 1PFUA 2DPLA 1VL2A 2D54A 1N2EA 1FYDA 2A1TR 2V0CA 3QTBA 2G36A 4GRIA 2YY5A 4MUKA 1JECA 4NZPA 3ZJUA 1ZJWA 1O5TA 1XNGA 2Z09A 3HMQA 3IVCA 4HJXA 3N9IA 5H7XA 1HYBA 4PY2A 1MC1A 4AS1A 3CR8A 5J5AA 5LLTA 3G59A 1MAWA 4K0RA 2A1UA 2AKEA 4MW6A 3ELBA 1WJGA 3LOQA 4HPWA 3CLSD 1JEDA 4YP7A 2X0KA 2BTEA 2E21A 3UOWA 3FWKA 2GKSA 1NYLA 4MVXA 3N2YA 1QTQA 1QU2A 1PG0A 1N77A 3DV2A 2DR2A 3K9WA 1IHOA 1M8PA 4KR9A 3P0JA 2CYBA 3H9CA 4AQ7A 2CT8A 4QRDA 3ND5A 2E89A 1OBHA 1WXFA 1N05A 4MUHA 1J1ZA 1KP2A 1N2BA 1N2HA 1J21A 1WQ4A 4YP6A 4NAUA 4JZYA 4TS1A 3FETA 3IDFA 1O6BA 2VBSA 3U1VA 3L93A 1M1ZA 1N2GA 1TFUA 3TZLA 3CA8A 3NBAA 1NSYA 3P0IA 3AG5A 3IMCA 1O94D 3HGMA 1G59A 4MVYA 3IUEA 1U3DA 3QTTA 1YUNA 3SDBA 4G6ZA 1EFVA 1M83A 2Z08A 2A1TS 3GMIA 5A88A 4U8HA 4ZCQA 3PRHA 1M8FA 1U7DA 3DO8A 4EG5A 3GLVA 4DJAA 3COZA 4ZCRA 2PZBA 1J1UA 1N3LA 1O95C 3SZGA 1O96A 4MUGA 1OWPA 4ZCTA 3VRHA 3IVXA 4K03A 2OQ2A 4MWEA 3H05A 4L2IA 4QBTA 2OV4A 3UK2A 4RUKA 3TQIA 2A84A 4R0NA 4DLPA 3INNA 2QTMA 1YI8A 1JIJA 2IELA 1I2DA 1O0BA 1TEZA 2EJCA 2WQ6A 4J76A 1TYCA 4I6EA 2A4MA 4PBSA 1O97D 1WXEA 3FNRA 2QUJA 1PFYA 3PNBA 4MWBA 1F4LA 3X1MA 3K32A 3MLAA 2WQ7A 2R5WA 4YP5A 5TRDA 1IRXA 3VGJA 3ND7A 4RPIA 4ARIA 1RQGA 4XFJA 1N07A 4G5YA 1JZSA 4XFDA 1QNFA 3ZGZA 4OJMX 1CT9A 2J5BA 4DNXA 3OTWA 1KKUA 4ND6A 2IJGX 4MWDA 1S4MA 3IVGA 4ARCA 3UY4A 1TQ8A 4ZT5A 1QQTA 5EKDA 3TNJA 3OP1A 1GN8A 2VBTA 2NZ2A 5K0SA 1O97C 2QJOA 3L92A 4CQNA 4HK4A 4PBTA 1B6TA 2YXNA 1OWNA 2PIDA 4MW0A 2WSIA 2PXHA 1QRSA 4BWVA 2YWCA 1I6LA 1NUTA 4MUFA 2PZ8A 5KCMA 1G8HA 3IUBA 1X8XA 1F7VA 2CYAA 3ISJA 3FG9A 3ZJTA 3SP1A 1IVSA 3COVA 4Q93A 3AIIA 2HZ7A 2H29A 4JFAA 1O0CA 1NUSA 1BS2A 1QRTA 1N2JA 4Q16A 4GU5A 4HJRA 2VBUA 4DDMA 2WB2A 2ZUEA 5TGTA 1JIIA 2X1MA 3PXUA 3UC5A 4WNYA 2JANA 2VXOA 3IODA 3PNVA 3N05A 4NATA 4MW4A 1LW7A 1COZA 1OBCA 1O94C 2A88A 1SURA 1GAXA 4NX2A 1Q9SA 1OWOA 1KR2A 2CUZA 2RE8A 3Q12A 1KH2A 2X1LA 3H99A 1JIKA 2A1UB 4P2BA 1H3NA 1JZQA 4ZT7A 5H16A 1T6XA 1XJQA 2P3MA 3ZXSA 4I6GA 4ZT3A 1X6VA 3Q10A 1NB9A 4MUIA 4WSOA 4E1AA 2DLCX 3X1KA 1YIDA 1GLNA 1KORA 3TQOA 2DXIA 2AG6A 1MRZA 1KH1A 1WY5A 3NV7A 1QJCA 4U7JA 1U3CA 4UZEA 1MOPA 3CLTC 2DEUA 4EG4A 3CVXA 1NUUA 1JGTA 1U7XA 3BNWA 3IOBA 3CVUA 2QUHA 5JBNA 4ZCPA 1NP7A 4JXXA 1ZH0A 3H9BA 1R6TA 1R6UA 1KQPA 3FIUA 1OWLA 3H97A 3KT8A 4U63A 2BYTA 2GOYA 5J58A 1N78A 2QUIA 2QTNA 1JMVA 1J20A 1WZ2A 4MW7A 5FNZA 3HV0A 2EL7A 3KT0A 5FO1A 2QTRA 5BNZA 2GM3A 4MW5A 3ZXIA 2VTBB 1UFVA 4DDKA 3CLUC 2H2AA 1KP3A 2CFOA 2J09A 4CDMA 1P4MA 3SEQA 4EFKA 1F9AA 1M8JA 1Q15A 4ND7A 3RFFA 2ZUFA 3AG6A 3DLAA 1T9GR 3AL0C 1M8KA 4XSVA 3FHJA 1WXHA 5AHWA 4KR7A 3X1JA 3VU8A 3D6VA 4ZT6A 2AZXA 3RJZA 3COWA 1OWMA 3COYA 3FDXA 1VBKA 4MVWA 3SEZA 4G5FA 1EJ2A 1IH8A 1N75A 4QREA 1MBZA 4MULA 4S1OA 5TEVA 5KWVA 2X3FA 1YIAA 1H1TA 1TYBE 1VBNA 2XRYA 4MW1A 4OUDB 2NSYA 3CLRC 1EUYA 3I05A 3HZRA 1WXIA 1GPMA 4JXZA 3A4IA 3CLSC 2O8VA 4EG3A 1K92A 3A05A 5KHAA 5DB4A 3Q4GA 3FI0A 1GTRA 1Q19A 1Q11A 3M5WA 4JYZA 2E0IA 4ZCSA 1M8GA 3N8HA 1NZJA 4OUDA 1T6YA 3MXTA 4EF6A 5HUHA 2DERA 3P52A 3JXEA 1JHDA 2ZP1A 1V47A 3MUEA 1ZUNA 1WQ3A 4KPUA 1J70A 4NDAA 1PG2A 2HMAA 4MUJA 3CVWA 1R6XA 3IOCA 1J09A 3LCJA 4EG1A 1XNHA 3MMXA 4H3SA 3A04A 3CLTD 1VLHA 1T9GS 1H3EA 1V8FA 4J75A 2QUKA 2J07A 3CVVA 1MB9A 3CTAA 5LM3A 2C5SA 1EXDA 3BL5A 4R2LA 5DASA 3IMEA 2YWBA 3C8ZA 4EG7A 3UMVA 4YMIA 2RD2A 1D2RA 4ZT2A 4DDHA 4MW2A 1N2IA 1TYAE 3QE4A 1I6MA 1P7PA 2I1LA 1NUQA 1JEEA 3GUZA 3RBAA 1FFYA 2OYNA 3TZEA 3DPIA 1T6ZA 3FH0A 3RK0A 1G8FA 1KAQA 5TEWA 4CT0A 1TYDE 1GZUA 3ZUGA 3FOCA 4ZT4A 1VBMA 5J59A 3NBKA 3TS1A 1NUPA 1N08A 2CV2A 3G5AA 1QU3A 4YBRA 4F3RA 5DK4A 1G8GA 2A7XA 2D5BA 2TS1A 2VBVA 5FO0A 1EFPA 2A86A 1EE1A 3KFLA 1O95D 1ULHA 3LE8A 1IFXA 4NAHA 3E27A 2B7LA 1KQOA 3KT3A 1A8HA 5A89A 1YULA 2JA2A 4F4HA 5IHXA 4R2MA 1ILEA 3IOEA 2CSXA 4FZJA 3KT6A 4MWCA 1PFVA 1XNJA 2V0GA 3CLUD 1N06A 2O5RA 4MUEA 1JILA 3AKZA 3ZJVA 1KH3A 2E18A 1U0BB 1MJHA 5DEOA 1PFWA 3RK1A 1IQUA 3F3MA 2HGZA 2J4DA 2CV1A 3IMGA 2QJFA 1N1DA 2VTBA 3HL4A 2XRZA 2IP1A 2CV0A
chains in the Genus database with same CATH superfamily
1TKRA 5HK8A 5JRZA 3SNHA 2E3JA 4GWKA 1I32A 2AZMA 3U0BA 3A9CA 4IHKA 5F52A 1KMIY 5FBWB 2Q1YA 1T43A 2I22A 4N6GA 1D4AA 3I2IA 4GKKB 2QM3A 2ID8A 3MTGA 2D5AA 1Z62A 4CM9A 5TGZA 3SYTA 4CL3A 4BQSA 1OXSC 4LUCA 2AN1A 4CGYA 1E1LA 1W1IA 2A5GA 2JNWA 2AXQA 2WG1A 1YMVA 3UJ8A 4FYJA 3NTQA 4PZEA 4R68A 3PDIB 4YUVA 4F6CA 3KQOA 2OKGA 2XT9A 3IHLA 1WCYA 5MGBA 3VNUA 3JAWB 5SZJA 5K05A 2C5AA 5K2OA 1N3YA 4YTEA 2QE6A 3LY5A 2WJAA 4CV1A 1VTKA 2QVZX 3R0VA 3PC3A 4DSOA 5AP9A 2PUGA 1OU0A 2HBYA 3SXUA 2Q1TA 3VPFA 7MHTA 1CRQA 2PNJA 3BIOA 2NUAB 5KJCA 1CY7A 3D4BA 1SO8A 4OF4A 1XMPA 5JVDA 3BGIA 3IAEA 1QZXA 3Q7EA 1CLUA 3U40A 3W1VA 5MN4A 1PL7A 3IS3A 1VIDA 3K6SB 3LHFA 1D8TA 3ND6A 2GHTA 3QKSA 2QN9A 1LK7A 2MU1A 3GEHA 2JJ1D 1E3WB 2M9MA 3ILVA 4FZRA 3EHDA 3ZCPA 1W47A 4J49A 2G88A 4U7WA 1R8YA 3L41A 1PV4A 3A9VA 4DM3A 1EWKA 4F3CA 3FNEA 4WBNA 1B73A 1XDWA 1ZD8A 4D0LB 1VYTA 3Q0IA 4DUGD 4IS3A 2AN4A 1K89A 3N2EA 3WB1A 3ZWWA 4DCPA 1G17A 1Y42X 2H1FA 1QVZA 2UYHA 1WXWA 3CF4A 4LW8A 1FLNA 2I87A 2XQJA 1E60A 3EXG2 1HNWB 3BFPA 3DJYA 1XSEA 1JPJA 3OEHD 1R6AA 4QEDA 4HDKA 1LTQA 1IEXA 2NXNA 2YJ4A 5DTJA 1JH8A 3PNSA 5C4MA 4DPKA 2ZE6A 1RAAA 1Z4OA 3EG9A 3LHDA 3KVYA 3PQCA 3RG8A 3W5BA 4N0PA 1QGUA 4EKGA 3AO0B 2WUGA 5CLFA 2VF7A 1OLOA 1QGYA 3WNBA 4XDZA 3PXAA 2GM9A 2PWBA 2V8OA 3HCPA 4MRVA 2ZI6A 3LIPA 1Z35A 3HCBA 5DBGA 3VKGA 3AR8A 3F49S 3HN6A 5CA1B 5JDCC 4DXDA 3VNVA 2LWIA 4BB6A 2AXEA 2FUG1 2ODNA 2HTFA 3FR8A 3OETA 3OMXA 4CF6A 5IF9A 3DD1A 3NGMA 2JB9A 3OE7D 2B8WA 2I4OA 2F17A 5JIBA 1GGFA 3P20A 4F4FA 5CUQA 3OZUA 3SHWA 2ZRHA 2MYNA 4XM3A 1AKQA 4F1KA 1QU2A 1LX7A 2WTUA 1Z5GA 4AMYA 1IHOA 1WBBA 2Z4SA 1QOZA 4MQEA 3RQIA 1JMYA 4IHAA 4NSNA 3RS4A 2J1LA 1AZLA 2BMAA 3B9QA 3U44B 1X7ZA 2YWHA 5ED0A 2QMHA 5ADUS 5AW9A 5FBHA 2XZPA 7REQA 3DMGA 2PR2A 2Q5FA 4ZOQI 2GA8A 5NLLA 1UAGA 2FNAA 4Y9TA 2O05A 1BMDA 2H9YA 4IWNA 5AM5A 2JGLA 4I14A 4OEHA 2F4VB 4E22A 4YHHB 4LYJA 1R9GA 1PWZA 4Y2SA 3P9PA 1IRIA 1C1XB 3GXBA 5EG5A 2C4KA 3AOGA 3DE7X 4IYJA 3CA8A 1VJDA 2F1HA 2SECE 3AHJA 2FEMA 3R6GA 4G09A 3UATA 1L1FA 3T4UA 4TYWA 3TR6A 2C2BA 3UWKA 5AKEA 1MUUA 2O2ZA 2AYYA 2VHTA 5DHAA 3G2QA 2F00A 3QPVA 1HWYA 4O2RA 3OA0A 2ZZMA 4IPTA 3NHYA 1RXUA 4O4JA 5J4YA 3DFIA 4FOOA 4YELA 2A1TS 3F6YA 3JQ9C 2VPQA 2OO5A 3IVMA 3T12A 4M9RA 1TT5A 1Y4AE 3IBYA 3BJEA 3KK0A 4X60A 1ZJZA 4YR7A 4ZCRA 1GO2A 3FDZA 2YS7A 3G8AA 3L0CA 2VSXA 4R1LA 1N9GB 1R0YA 3DUWA 3ICQB 1ODIA 1B23P 4TMVA 1BQ4A 2QWXA 2Y77A 1QC5A 5IVPA 4ESVA 3WNDA 3NTXA 3A4LA 3IBGA 4BMXA 4K6CA 3GNTA 4E5DA 4MWEA 3CE6A 1LDNA 5DNAA 2BFPA 1IMJA 2ZYTX 5IPFA 1RRKA 3KELA 1DIRA 4R0NA 4TTSA 1RRFA 2ZRQA 4OD0A 4QHSA 4OQYA 4NCAA 2XMGA 1MX1A 1U9JA 2ZJBA 2EJCA 2ILTA 2GN0A 4UCQA 1EDDA 4B2IA 5BQ5A 3UICA 3ZV4A 3PU6A 5KDLA 1T5EA 1KVTA 2ODQA 3PC8C 3MINA 1CR2A 2QGFA 4YFYA 2AA3A 3NDPA 3MRVA 4DC0A 3D6FA 2FGJA 4IIJF 2R8RA 2EDCA 3G13A 4ENWA 2OYSA 4QJBA 4J0EA 4N12A 2F67A 4F12A 4WWHA 4PLPA 3TLKA 1NM5C 1HR0B 1QM5A 3PWSA 4PLZA 2CLOB 2QTFA 2O4CA 3MS2A 2DH5A 1OPRA 1NPYA 1B14A 4XN0A 1P1RA 2GESA 2G9UA 2ZVJA 3BQMB 3NKLA 3CY6A 4V3BA 5G53C 4BX8A 3IL2A 4U2FA 2P7HA 4J0DA 1A9TA 1SUPA 2HIGA 2OEPA 2RG1A 3N2ZB 1JAXA 4ZYLA 2HHHB 4ZGQB 1PT8A 3HUDA 4HS9A 1M90D 2XRFA 3O7MA 1V37A 2ERXA 2WUVA 5T64A 4KO4S 5JI2E 2ZBPA 4TZTA 4QUJA 2ZYAA 5BUSA 1GN8A 2CJFA 1Q6ZA 3ROKA 4LMBA 3PIIA 2XQFA 4Y2XA 5DHRA 2HA5A 1E20A 4J0FA 2CD7A 1YCHA 5E9JA 1JYFA 2I80A 1RE1A 3DP9A 1PEKE 5CNKA 1ZCJA 4P8RA 3SBDA 3V32A 1RC8A 1G5HA 1U3WA 4EHIA 5DYIA 2PXHA 4CMGA 4Q9LA 3MTIA 2E1BA 3T61A 5FI5A 1E18A 4OH1A 5AW0A 2H0QA 3G9ZA 1WCWA 1IPHA 2OBTA 1LSSA 1RWVA 1BWPA 3IQGX 5L3ZA 4R41A 2EQAA 3LY8A 4FR0A 4JFAA 1V8DA 4X66B 2R85A 1DCFA 1F2DA 4J0JA 4CYMA 5JANA 3KKNA 2XNSA 1NOJA 5TDHA 1NP6A 3HVJA 1P60A 2Y8EA 3DA8A 1U99A 1X1TA 4NG4A 3M3DA 2IIBA 4DLXA 1JFRA 4Q6WA 1RMYA 3K9HA 2G06A 4P3XA 1C0KA 5TRTA 5A5FA 5P8WA 2ZBVA 2DBZA 2R47A 2WD7A 3EZFA 3ODGA 2ZBQA 4X9XA 5AW5A 4ZOAA 4Z4VA 3R5SA 4FR5A 3NS7A 4NCHA 4YQYA 2ZRNA 4Q15A 1L0BA 2VQ3A 4DR3B 5CFPA 3NDIA 1B3BA 4JI8B 3Q1LA 1JIKA 4UJ3A 2ILVA 1RYDA 3WIUA 3OJWA 5CJPA 4HGZA 1FYWA 2HDWA 3KP1A 4MV5A 1AX9A 4AKIA 4NCIA 1J8YF 1JB1A 3UV6A 5IKPA 3IXLA 1N0UA 5HF6A 2D3TA 2XWBF 3C14C 1V1RB 3E18A 4RXUA 4UMEA 5PGMA 5JJBA 1XZGA 2YW2A 1T34A 3G05A 3QU2A 3VV2A 5CTJA 4DJEC 1OYVA 2P67A 4XLAA 2O8DA 1E6MA 1RM4A 3GP5A 3ZPXA 3IKLA 3F7NA 2JDID 3T9CA 4WOPA 5F3WB 3A6JA 4YRRA 4WD3A 3F97A 4V2IA 1XZAA 4R6XA 2G09A 3RKSA 1FS4A 2AMFA 3RSQA 3E5MA 1KZHA 1GQFA 4EHLA 2VRNA 3W6NA 2QUHA 4MVJH 4C0KA 1NP7A 4CFYA 4ZA2A 3HJGA 1FJXA 4RTRA 2P1ZA 1R6BX 5GZ1A 1Q1ZA 2DQYA 2L18A 4BVGA 2P2LA 4RLZA 1QFYA 4ZVUA 1DAOA 2JGDA 4NMXB 2YV2A 4Z3KA 2PPLA 4ON9A 3QG5A 4JQCA 1T0BA 4FYYA 4DYHA 5KYTA 5FBLB 3TN7A 4CXMA 5BRNA 4P86A 4Q5IA 4A0HA 3TDMA 4GC9A 4DCMA 1TIBA 3A9WA 4XCVA 1IL0A 4O02B 3GUYA 1OLXB 1P4HA 4PZCA 1Y8QA 3KG2A 2YV4A 4P2GA 1MG0A 4J0HA 3WICA 1N0WA 2H1RA 3OC6A 4INAA 3LA8A 2C2KA 3T38A 1Q81D 4RC9A 2JPDA 4YAJA 3USES 1G18A 1O4WA 3GFFA 3DAYA 3CRZA 1PL0A 2P6PA 4Z49A 2BP7A 2BJVA 1QP4A 2IPAB 4BLUA 4KITB 1ZJJA 1N1GA 2D3WA 1TMYA 3INTA 4BLPA 4DKJA 1T9AA 2YHSA 3BHNA 2X0FA 1IBKB 2PX3A 2OM2A 3QVUA 4JN6B 3L6RA 1VKRA 3QBVA 5DRYA 1M1YE 3SSMA 1ZAKA 5D6NA 1UK7A 1XR3A 2EBHX 3UG6A 2A9RA 4W5NA 3G2IA 5IYZA 2D1FA 3IKTA 1QH8B 2B5VA 1ZLYA 2BUBA 3FR7A 2AH5A 2R0QC 2Y1CA 4MP3A 4P3KA 1EFTA 1N75A 1SUFA 4QUEA 1RIIA 5A0FA 5KMGB 3FOAA 5LMNB 4BP9A 2CL5A 1VBNA 3T5TA 2Q6LA 1NJID 4HLUC 2Q6IA 4IKPA 4MB6A 2VSNA 4Y8VA 3KJHA 4MW1A 3GLRA 2Q4OA 3K5PA 4H6XA 4CI0B 4F72A 1R4MB 3GFVA 4R5MA 2UAGA 1Y1TA 4CIVA 2QNIA 2PWPA 3SI7A 4YUAA 2HJGA 2QN1A 4MVJI 3HXKA 2WJJA 1K92A 5BO5A 1NBOA 4CCWA 5B7GA 4NV1A 4FGKA 1N2XA 4JLMA 4E2ZA 2HYIC 3FOZA 4LJ4A 8ABPA 2JGFA 5LYJB 1XPRA 1ZIXA 3AKYA 1E2UA 4G4JA 1A50B 3BH6A 3NBYC 2CF4A 3ACCA 3L1IA 1P4GA 2GB4A 3VVMA 4CBVA 4DSUA 4JOCA 3UJPA 3VR5A 1Q20A 2GILA 2J6CA 1PGQA 2HYDA 3ZHTA 4EF6A 4QUHA 2X22A 1JI0A 3RGGA 2P0AA 1VB3A 2Y4OA 3K6SA 1U0LA 2V0NA 3VV3A 1RFLA 4NAVA 3UJCA 1QH8A 1UMBB 2XYVA 1B00A 4TN5A 5K0FA 1UBUS 2Q3DA 5KINB 2IHUA 1TM3E 3RSSA 1JRLA 1N5OX 2PK3A 4TMXA 3JYQA 1YR2A 5SY4A 3FPPA 1SGWA 2WTEA 3EDMA 3IE0A 1ZXBA 1EP1B 5HPYB 1A72A 4EI8A 1CQJB 3DDOA 2QN8A 4LI0A 3ZTWA 3FVVA 1REQB 4QYXA 3REFA 3TOSA 2RH9B 1ORDA 4HNSA 2VRBA 5CJ2A 4A0GA 1OX5A 5CB4A 4BDSA 4TRJA 1KGDA 5K0LA 5BXYA 4GPBA 2AUNA 2ZAGA 1MFZA 4O33A 3DT6A 1FS6A 1U2GC 3E2IA 2J3DA 3KR2A 3MSCA 4FQ5A 4EITA 4URVR 3GLGE 2QZ9A 2G0AA 3DG9A 5D3MA 4G3XA 2HADA 4IIVA 2V98A 3R6TA 3WHPA 1V4NA 1A97A 1DQZA 4F6RA 5B7NA 1D07A 2OILA 3JTMA 4LDQA 4AIIA 1QX4A 2HD4A 3CNLA 1T91A 4HY3A 4NYMR 2HA3A 3HKCA 4E2XA 1OZHA 3I2JA 3FE2A 4OHXA 1NWHA 2EGHA 3AUKA 4YA6A 2I54A 3OHPA 3U4HA 3W7VA 2ZANA 5FUXA 4Y1RA 3FH0A 2E85A 3D4LA 2RHGB 2Q0SA 1K7EB 3IUYA 4IF4A 2HSZA 3UJAA 4DLKA 1NBMA 1JQ5A 3ROGA 1XYYA 3JWEA 4BUZA 4RK1A 3HPQA 3BFXA 1IXYA 4ZAGA 4ZT4A 4ZDKA 2EWVA 5A7GA 4ZARA 2G1KA 5AJHA 1XLVA 4A8TA 4ZAXA 4DEYA 4BGDA 2XOXA 3CEMA 4MRRA 5FHRA 4NBNA 3S1AA 2HJSA 3SE7A 3OFNA 1U11A 4QUAA 4U6NA 3W6ZA 3M6FA 5BUZA 1QU3A 2H9IA 4WNAB 1F48A 2W2QA 1KFCB 4BYGA 1G8GA 2QW1A 1Z5NA 2H1WA 1NT4A 2R6ZA 2Q1WA 3ZNPA 4KE6A 3SOZA 4B76A 1SB8A 1RJDA 3KU4A 1ULHA 4RJ2A 5DWVA 1Z0DA 2P4SA 1OVGA 1FXSA 3FVQA 3K2QA 3KT3A 3G7SA 3GGCA 4KRYA 4GZLA 2YRWA 4R54A 5K0NA 3V46A 4YONB 1F6DA 2D2FA 2OENG 3WZ2A 3ZEAA 2H5IA 3N7AA 3S2FA 4I46A 3K9NA 2WIGA 4RLSA 1C1DA 5CX1A 4DA0A 4GP9A 4UMFA 4Q3OA 1N06A 1F5SA 3HY4A 3IUMA 2O23A 3LX6A 5ES3A 4CM5A 1D1SA 1KJNA 1JN0A 1KI1A 3DMPA 1Y8RA 1MJHA 2PE3A 2GK3A 1W2WB 1MV5A 1XP8A 3L02A 5DEOA 3RUIA 4RD6A 1KYZA 2OV8A 3K20A 4HRVA 5JAPA 3R3SA 4K88A 3RRMA 2WW8A 2HGZA 4NZZA 2BC9A 2ZZNA 1NBAA 3AY7A 5DI3B 3ZDFA 1VPWA 5E6UA 5K45A 4IO1A 4LZAA 3KQWA 4QXAA 2XRZA 1NXXA 2IP1A 2GN2A 2XLCA 3WGVA 1BDHA 4M1YA 3PXEA 3IUSA 2ZE5A 4GI1A 4IQ0A 1Q12A 4D57A 4MTCA 1E0JA 4RK5A 1TM1E 4N3GA 4JC8A 3PT9A 3ZHRA 1XFAA 3K0KA 3NONA 2QV7A 1QIIA 3V1MA 2JIQA 1NFQA 3VX4A 4WPGA 2EFHB 4LMAA 3VYTB 5CT6A 1ES9A 1NE2A 4MRPA 3VH4A 5KQRA 2F43B 1QQBA 3EB9A 1RC1A 5TF4A 5MHTA 4QBFA 4GP7A 5BV0A 1PHRA 1NI5A 2RC5A 3F5DA 4IUYA 5SYNA 1MABB 1OFGA 2J9GA 2ZUUA 2FGKA 1XEXA 1A7AA 3MWEB 4AK9A 1N0HA 2CNLA 2R2AA 5T8KC 3TFWA 3V1TC 1H6DA 4E32A 3NM4A 2I2AA 1NT2A 2C95A 1G4UR 1Z68A 2Z9BA 2P2ZA 5DYTA 1P0FA 4FOTA 4V03A 3A2MA 2NACA 1C14A 1ONSA 3AOEA 4UUOA 5BUCA 1YIOA 4ER7A 1KJYA 3DVAB 1TYEB 1N2OA 2YL2A 3SU8A 3SY8A 1P5HA 4KPUB 1K3FA 4BASA 5B4UA 2EFDB 1R0LA 1EJBA 1MA3A 4OTZA 4Q3LA 4FE3A 3QF4A 3NHMA 5FYDA 3ZE0B 1MB2A 4J0CA 3WNQA 5KNLA 1JBKA 1E3QA 1Z7WA 4Q37A 2I8AA 3N2IA 4TWAA 5EUCA 3RC9A 3I23A 2CLSA 2ZBUA 1E9CA 1OAOA 1CUWA 2EIHA 4JJGA 5J3JA 2ZJ3A 3K53A 1L7XA 3WHIA 4ZKDA 1X86B 5K01A 1NMEA 1HEUA 1LBTA 1JU4A 1H3FA 1Y5NA 1QAMA 3W04A 1YBMA 3RI3A 1EUCA 3AFHA 3KJZA 2R8OA 4R01A 3WGIA 2R6HA 4K1XA 1E0KA 1G60A 1WIWA 2WVHA 2XCOA 3IC5A 3ONDA 5LZ8A 4U7HA 1JQ3A 4XOPA 3DQZA 3ESQA 2RGEA 1LY1A 2XMBA 5KTKA 4FP9A 2QU8A 3EZNA 4L2IB 3SZ3A 4IKEA 3MT0A 3UUFA 1UBKS 2O3UA 3EPRA 3KXPA 4US2R 3CUSA 2XA1A 1D0IA 4J2HA 2QJWA 4R69A 4UUAA 3EGIA 2DBYA 2YXLA 1Z37A 3TLGA 1K7FB 1DCTA 1EVLA 2PFKA 3HWSA 1K5GA 2PQ2A 1N8KA 5H7XA 3F6BX 1ADGA 4N18A 4XFKA 5JXGA 1PJ8A 1ACMA 1Q1BA 2NXWA 1AMUA 3A1EA 3HFSA 1U0EA 4BFWA 1NQXA 2NW6A 3LBFA 1ESNA 1Q3HA 3QJ5A 1WJGA 4M38A 2J9FB 1KSHA 4FSXA 4YP7A 1ACLA 1OX6A 2VZ0A 4F6LA 4YV0A 3H04A 5BR7A 2P90A 3TW4A 1DP4A 5AVYA 4ZVRA 5IK2D 5HNKA 1IN1A 4OG2A 4YI3A 4EA7A 4XJTA 2WK1A 1T5SA 2I3AA 4DC9A 5FNVA 4Q4CA 5KSOA 5TPWA 1QFSA 3Q9SA 1JXOA 1FF9A 2R4TA 3QBDA 1RQLA 2Q99A 1O08A 4R3UC 1KEKA 1QG6A 2O2XA 1HYGA 3LY9A 1DDOA 1GGMA 4OJQA 3OU7A 3CC7B 1M1NA 4FCVA 1FFXB 1VMIA 4XVCA 4MUHA 2RH4A 2XE8A 1J1ZA 1F60A 1E3DA 2CMGA 3ZIAD 3K0BA 4ECEA 4UQPA 3D7LA 4LNUB 4ERNA 4POOA 1EQUA 1BROA 1HDIA 4OP1A 5BYJA 2YUIA 4JZYA 4LCBA 1V4BA 3IDFA 5CAEA 4HNTA 1QP0A 2GAJA 5A5VA 2PGIA 2QM8A 1TFUA 4I2NA 4JIMA 1ENZA 1XELA 2PKWA 2BDTA 3L9XA 1K0UA 2IUTA 1L5GB 4ZDIA 4RDCA 1KI4A 4IDDA 3NDBB 1L7BA 3L8GA 4DQ0A 4HDOB 2CMFA 1KYTA 4M36A 3BXHA 2ARKA 4E5VA 1NTRA 5BSEA 1SRQA 3P2YA 5CPFA 1OB2A 5JJCA 1H8ED 3DBHB 1NY6A 1G21E 3BKWA 1QNLA 3D8RA 2BWJA 1CR1A 3DTTA 3IHTA 1Q1EA 1HFJA 3DO8A 4ZVVA 4JLUA 3ZH2A 4MVJE 1QHYA 5I7OA 5C53B 2EG5A 1TD9A 3QVGB 3WBBA 4QPCA 4X1IB 2I2CA 3SZGA 1A71A 1D2EA 2EBWA 2FRDC 2H63A 1O96A 3F4KA 3H8VA 3KSRA 4PZ9A 1ML3A 5BN4B 2AX3A 3IVXA 1Z16A 2OQ2A 2ZIZA 3TIIA 5ANRB 4KUEA 3R2JA 2AB0A 5KYNA 4C4PA 2F90A 5AVXA 2GYVA 1J56A 1X14A 1FBTA 4HDKB 1BRTA 1YKSA 2Y1EA 4P5PA 4PYOA 4XZ3A 3UK2A 4IICA 5AW1A 1SWWA 2VQEB 4UM7A 3RS0A 3R3ZA 3REQB 3OJ0A 4RIIA 5DOVA 5MN5A 2J7KA 5IVDA 1VQ7B 3IEIA 1UR5A 1XTSA 5EN4A 3VZRA 1AM4D 3UCXA 2DFKB 3TNYA 2WWXA 4Z4GA 3M89A 2EFYA 4UNQA 2FSGA 3JQPA 5YASA 1LPSA 4OMCA 5IAGA 4W5TA 2FDXA 4R2KA 1OASA 1IJFA 1H42A 5FQNA 3ROMA 1G8YA 1V7QA 3WWZA 5ALDA 2VT6A 4J2OA 4DJJA 3ID6C 2I7DA 3JASA 4P9SA 4GNKA 4MITA 3REGA 2ZKIA 3UBMA 4YRGA 4Q4HA 5M7EA 4JLOA 4Y2QA 2X6QA 3CCUB 3CX8A 3LBNA 4TKLA 4ZC8A 1SM4A 1RQGA 5T4FA 2X9NA 2WAYA 1ELOA 3Q39A 1EE9A 4KNWA 4F71A 3N6XA 4I9GA 2WZCA 3O5AA 3ZJ4A 4X7PA 1Z3IX 3KQSA 3EF3A 5HVNA 2GPTA 1U3TA 4DQLA 3CF6R 3E23A 3UY4A 4J91A 1IYZA 1VCMA 5DM4A 1YDFA 3H6HA 4QVJA 4YV1A 1P33A 1E2FA 2IZZA 2XXJA 3BZUA 4QOJA 2Q4BA 4B71A 4L4RA 4DHWA 3FYUA 1E2PA 3H0CA 2QJOA 5K0SA 5DCWA 2HWWA 4OMUA 3TXXA 4QELA 2ZRIA 3LYHA 4YRNA 3K16A 3TJRA 1GXSB 5KKCA 4AVYA 1G6OA 4KLNA 4R71A 5BRJA 4J16A 4RZUA 5T6MA 3U4AA 1GZ6A 3R9KA 3VZBA 2OTJB 4MUFA 3DBLA 3E48A 3OIUA 2IS4A 2CFRA 1X8XA 1J2YA 4LHXA 4JJFA 4N3BA 3S2YA 3GPBA 3P94A 4QG3A 2ZDQA 3IBSA 3PUYA 4Y0AA 2VDWA 5ARBA 1V95A 2WKPA 1R3DA 4JVLA 4PLWA 1VL1A 5FWYA 2B1JA 1E3JA 4LE0A 2UDPA 3ZY5A 1QG4A 3D1LA 1Y81A 1UBGA 1QF6A 3UWSA 4AY4A 2NSDA 3I2KA 4XWAA 3T5AA 4OK5A 1N6HA 4Q1VA 5TGTA 3WDSA 1I5RA 3QEAZ 1XAGA 3U4DA 2J3QA 3EIUA 3MMPA 1YB1A 1CDZA 2C2MA 1GZ3A 2HXSA 3C2QA 3WK5A 5EHXA 1OXKB 3Q9LA 4PX2A 3GROA 1HDEA 4BO6A 5HMMA 4OGGA 4MR9B 4MRMB 3GLGB 2IUFA 5B58T 4UE3S 2I1VB 2VPXA 3HV2A 2P4EA 3UUGA 4QXMA 3EIWA 1THMA 4B73A 1GXSA 3I4FA 5JNUA 3KVNA 4AL4A 1PDWA 2I4MA 1F3LA 2XZOA 3H99A 4LOLA 3T5DA 3T7IA 2O2IA 1QFJA 5K0EA 1FQKA 2DPXA 1B4DA 3K0AB 5FAXA 2OBRA 2VJNA 4BVAA 1PU2A 3SJAA 5K4HA 3NGLA 3ICCA 4QJ3A 5AW4A 3ZWXA 3SXPA 4EG0A 3QX3A 1MX9A 1R0WA 3HUFA 3NUQA 1G55A 4ZT3A 1YXMA 7YASA 2HUPA 3RSFA 2OFFA 3T99A 3ZI4A 1KZGB 3W06A 4LX8A 4Z4IA 3E9RA 3PNKA 5AVVA 1JBQA 3CSDA 3DEZA 5ICCA 3RK4A 5B2FA 4KE7A 3B1JA 3OCWA 1KDVA 4YPOA 3C3DA 3IPRA 3LBAA 3CW8X 2H7CA 3X2EA 3SR4A 3A8JA 5AUPB 5CDHA 3TSCA 2FK7A 1ID1A 1PK8A 3H8SA 2BHTA 1AZTA 1A8SA 5IH3A 2O1WA 2HGSA 4LOJA 1QHNA 3UENA 3QVSA 2QAGA 3A7DA 4Q3BA 1JEQA 1PT7A 2AZDA 3H97A 3KT8A 1OWLA 2VT7A 5EIBD 1XD8A 1JHYA 2RCNA 3TTXA 2X6XA 2WF8A 2G5TA 1SC1A 1T5LA 1W93A 3LA6A 5LKAA 1HEIA 3EG9B 4AWAA 1M2EA 1JMVA 2X85A 3QE2A 1T0JB 2D1YA 2XF2A 4MI3A 4US0R 4BQRA 4JSTA 5KNBA 1VQ6B 4EKDA 2EL7A 5JMOA 2Q3EA 4X54A 5AOBA 3TRDA 5ALVA 2VQ6A 3CZMA 1L3BA 1NTOA 1U0GA 3DBRB 1XTZA 3RPEA 3V1YA 3KQLA 4AN1A 1UJNA 2A2ZA 1XRQA 1XXLA 2R1TA 1J5XA 2Y1WA 4R6WA 4L8FA 2FVYA 4G1BA 1CDOA 2W6QA 1ADFA 2GPSA 1GU7A 3GEBA 4INOA 4Q34A 4UEOA 1DXOA 4QEKA 2ECOA 3QXHA 1IEVA 2FZ4A 2Z56A 5T6BA 3WDMA 3OLWA 2MMCA 5C1DA 5ED4A 3A4NA 1Z6TA 5FR2A 2PAAA 3B6EA 2GWHA 3G3EA 2C9ZA 1DJOA 3HWWA 4OHBA 1AKYA 1CF2O 3NHJA 2V74B 3HCWA 4ZVQA 3CS3A 4JU9A 5GONA 2BEKA 4S3MA 1KE2A 4CN9A 2TECE 1TPZA 4OKNA 1EK2A 2PPVA 5BURA 2WI8A 4RH1A 3COWA 1VIYA 2BKUA 3G0IA 3OICA 4FFBA 5CHEA 4E4YA 4WBNB 1V5EA 3OTGA 3AEZA 4JMPA 3H2GA 2RFLA 3AEUA 2AC2A 5DBFA 3HI4A 4F46A 9MHTA 3GD7A 1Q95A 4MULA 3TSAA 4N5DA 2P9YA 5C52B 2W8BB 2NP6A 1C30B 2ANCA 1C81A 3LX4A 4HDRA 4KX5A 3WRYC 2NU7A 2FW6A 3NC1C 4WLEA 4OY3A 3C3CA 1CY1A 4JAVC 4O4LF 1A8PA 5HZMA 2ZJZA 1PD1A 2R6FA 4GUAA 4TV8F 4UMVA 4QTYA 2EP5A 4B9AA 2QPTA 3E6AA 4ZQCB 4X97A 2LE0A 4AN0A 5M5BA 2IHKA 4JT4A 1CDEA 4MYDA 5DTMA 2CHEA 3GJXC 2J9XB 3STVA 2Y92A 4C06A 3ICOA 5CGQB 4TL7A 1T15A 4JUIA 3WV4A 4CLRB 1E5XA 2BH9A 2A3RA 4CM1A 2OHOA 3A6FA 5AK5A 4BXOA 4MWZA 4I5IA 5ULLA 1VFNA 3AERA 1JR6A 3FNGA 3BXFA 4IAOA 2CDAA 3FNQA 3SJUA 2JIDA 4WZTA 5FPSA 2ZZGA 3K0HA 2PDAA 3M49A 1L4FA 5I4IA 5IC4A 3UVEA 5I7UA 1XLWA 2Q2VA 4DCTA 5GJBA 1LW6E 1B16A 2BE9A 1HBJA 2JCBA 3PUIA 1QP8A 1CETA 3MUFA 5JYDA 3PL1A 4L4YA 1BDMA 3BMNB 5FWAA 3RVSA 5A3RA 1NRXA 2O3JA 2QT1A 2VDVE 5IAJA 1J06A 3AVTA 2EU8A 2JVIA 1IK6A 1E8MA 4XLEA 4CKZA 5LA6A 3RCBA 3TINA 4KODA 4BO1A 4EENA 1Z15A 3C1TA 1J8DA 4J75A 4ZQBA 3EIEA 1MB9A 2D4AA 5EXXA 5F4MA 3WXMA 2IRWA 1ESCA 3S7ZA 1U8EA 4KIJA 3BL5A 1NULA 4TGLA 1SPXA 5H9VA 3I04A 5IT4A 3K72B 1QG0A 1PJ4A 3K9LA 3PGXA 3R5KA 1VI2A 4KDCA 1PW5A 3TZ6A 3JQGA 2GSWA 4RH0A 4BFZA 1CY8A 2Q6TA 5U4XA 3S55A 2Y6UA 4ARZB 4IOMA 1JIQA 1NKVA 3G82C 3L0YA 4IO0A 3OQJA 3UEOA 3DWFA 4U9UA 1JEEA 2CXNA 4L85A 5IFLA 3CEJA 1A95A 4B7ZA 3DP7A 3VSDA 4XUGB 1L8AA 1YR7A 1EKXA 2VWPA 2DJIA 2XE7A 4Z4SA 3FYCA 4HDAA 3K73O 4NNOA 4P93A 1G5IA 1G8FA 1RBYA 3RK0A 3KRTA 3SQMA 3UJHA 4HNQA 1I10A 5DU2A 1QPGA 7MDHA 2Q27A 4OB7A 3ZUGA 1Z18A 4TXNA 4BVKA 2QLTA 1F8XA 1ZM4A 4DNTB 5AHXA 4RPDA 3RYHA 3SJ7A 5FTWA 1H1DA 5JISA 1QZUA 1SMKA 4P08A 3QWIA 4X1OA 3RH0A 2C84A 1WCXA 1PS9A 5HA5A 5BSYA 3GLFB 4JBYA 4WLOA 3OAAA 1HPLA 1MGOA 3A9TA 1ZSYA 2NSHA 3M83A 3NPMA 4PR0A 4D4JA 2QTHA 4A7PA 4Z1MD 4U7TB 4OOXA 1NVBA 2A7XA 1XG5A 5CURA 5IAEA 4DCGA 4GR9A 4BNNA 3AI2A 1ICEA 4BBAA 3CB2A 1HA3A 3OOJA 5EWLB 4HQOA 2UUBB 1NI4B 3BEDA 3J7AC 2YWJA 3ZI0A 2VUHB 3BBLA 1AJEA 4NAHA 1BXKA 1KEEB 2JCGA 1YS6A 4HYEA 3FROA 1LPNA 4TT3D 4RDKA 1BWRA 3LW8A 5BOVA 1OU4A 4CTJA 2ANBA 3OZAA 3ZCVA 5KNDH 1E5DA 2YQZA 2W4IA 3OZDA 1VJ5A 2BEWA 1EM8A 1QIHA 3RTGA 4GAEA 3BFKA 1VZ2A 4F7WA 3EH2A 3EIHA 4YCCA 8MHTA 5E0OA 2DBRA 3GW8A 4JWKA 3BE4A 3NBQA 3GO4A 4WN3A 1KI3A 1FRFS 4DRYA 2QN6A 4F2GA 1UD6A 1C1HA 2DHCA 2ZWVA 4M6WA 3FTFA 1R74A 3ICPA 3MBIA 4LE1A 3DS8A 1GL6A 1US8A 2P69A 4KX3A 1PEAA 4Q03A 1REQA 1XXHE 3EOZA 2RAVA 4HL6A 5H81A 3B5IA 3CEAA 4B34A 3FHTA 1LNZA 2CZQA 2CXRA 2V9CA 3GVPA 4JC4A 3H2ZA 4H60A 4PYRA 5AVSA 3GQBB 1LDMA 4J3FA 1RZ3A 3ZR4B 3QOXA 4UTNA 4LSZA 3B5EA 2FEOA 3NT2A 4FJ1A 2X15A 4E46A 4RHXA 1GSIA 2C9MA 3KB8A 2WZQA 4IIDA 2HF8A 4RKFA 2X76A 1O87A 1KS9A 3FZQA 4LQ4A 4OOFA 3EISA 1SUSA 2RB5A 5BSKA 1KHTA 1VGVA 4EYEA 4WUVA 3QQ5A 2J31A 5AH0A 3TZKA 1RYYA 4GZ6A 4CCYB 4NBSA 4QDZA 1TM2A 4Q4JA 1Q77A 4IHJF 4NYJQ 1JTEA 1WU7A 3WHKA 2RHOA 4HGQA 3BCHA 3W5IA 3UMJA 1RWXA 1YJ9B 3OPYI 4B1FA 4DLBA 3P2MA 3LQQA 4RVHA 3SHOA 5KPJA 2TRSB 5LJLA 4YLGA 2GPBA 2GJ9A 2YC4C 4F2DA 5HW0A 2VXCA 2Y1DA 4GHWA 1ZGGA 4XVUA 5CLJA 1JJAA 4LDAA 3VR3D 1XTRA 2VVTA 1XTQA 1E2BA 1KVQA 3R3WA 3WWPA 1U8TA 1FSGA 3MTQA 2RHDA 1KMNA 3GRCA 2AEMA 2WSSD 3H2IA 1I1HA 3OD5A 3PGMA 1QRUA 3G0BA 4UZFA 3K09A 5ALSA 2L19A 4ZVTA 4G5SA 4D7AA 3THWA 4GPAA 2L2QA 3VZPA 5K0JA 2X0JA 1UKYA 3TSOA 5KNCH 4C5CA 1LZKA 4PQFA 4RO0A 4RFVA 3WMRA 1VQKB 4O0MA 3F8TA 3O26A 3PPWA 3ZVLA 6Q21A 3QA3E 3WGJA 1M2OA 4D82A 3BY2A 1H2EA 3SC4A 1UDXA 3DEKA 4PLCA 4BV2A 5K0BA 4KREA 3OE7A 1ZC4A 1NXOA 3QM1A 4RDHA 1I4WA 5BNIA 4Z2YA 4KRGA 1SUCA 2CC2A 1NRJB 4I2VA 1ZSNA 1UOPA 3PNYA 3PKIA 3GCZA 1W4BA 5T3UA 1HOTA 4JH0A 1YHNA 3D4PA 3FBGA 4MIYA 3KEQA 3CD6B 2V59A 1EXWA 1J9ZA 4X3OA 1S2MA 2G36A 1Q0ZA 1JECA 1G21B 5IJ9A 2VJPA 2PKCA 3KB6A 3HYNA 4XRRA 3SSAA 1JSRA 5DN9A 2DYKA 2ZRFA 1G2QA 4FMDF 5LZ5A 3L7KA 3OFSA 5K2MA 1SVSA 2JLAA 2BFOA 1FX0B 2ERYA 3L5KA 2NU8B 1U1EA 3MQ4A 1X2BA 4Z4HA 3FI9A 4TLDA 2Y1OA 3CJRA 5KQGA 5A9SB 4XLCA 1JFLA 2XVYA 2YXBA 3D2BA 4G9BA 4UE6A 4ZO6A 4F9EA 3WKEA 3VA7A 1M0TA 2RHMA 1G0OA 3M1YA 1EX9A 1K3UB 3V6MA 3K05A 3VDNB 2O52A 5EZYF 3UOWA 4DMRA 3CLVA 3JYPA 3R7DA 3F2IA 3ZK7A 2WTAA 2GKSA 5FFFA 1PNRA 4ROXA 3K92A 2E4AA 2HLPA 4GYWA 1OGJA 2PMEA 4ZAVA 1GG2A 3I01A 4HNAA 1IE3A 5DNUA 4RK4A 2VH2A 3CINA 4XPZA 2ZJ5A 1N0IA 3WZMA 4CG0A 4K2HA 5FTLA 1DX6A 5CLQA 1N2BA 2CWDA 5IYRA 1Q84A 3HBLA 4GSYA 1UK9A 5HS4A 2GMWA 1II0A 3M6XA 4Y2RA 2B9VA 4QPJC 4TV9F 1UM8A 4D96A 4EY7A 4AC9A 2QL5A 3N8DA 4YREA 1O6BA 1UWCA 2WP0A 4BZWA 1RPNA 1P0IA 3NXKA 5LL6P 2WM2A 3V4SA 3L93A 4IYRA 3TZLA 1Z28A 3Q8MA 3FTEA 3P8ZA 2QN2A 3K8ZA 3JD0A 4KAAA 1VHLA 4IHQA 3ES9A 1E3ZA 5IK2A 1YJ8A 1JE1A 1KJ8A 1R4ZA 3CO5A 3IMCA 1RI2A 3LT4A 1A88A 4OA8A 3H8WA 5BSXA 3I58A 4GT1A 4NCKA 5KVSA 1NSTA 1P81A 1U8YA 5FOSA 1XTIA 3OBBA 4DMKA 4NRDA 3A1WA 3VYUB 4MS4B 3LDHA 4B3IA 2RHRA 4B3XA 2Z08A 3IQFA 4FNOA 4DVGA 1Y3DE 4R9NA 4FK8A 4C01A 4KOEC 3EZLA 1SVWA 3T5CA 1JIVA 4LF7B 4JR0A 2FZEA 1TFRA 3TO5A 3U9LA 3V1NA 4DJAA 3A1FA 5JW6A 2A5JA 4WDQA 5IHPA 4RM0A 2BDEA 4ZZIA 1Q1GA 5FRDA 5BY2A 2ZRLA 4LVOA 3ZX4A 3QSYA 3BRQA 1ZUD1 2GCOA 1NASA 3KJIA 5DNVA 1AS2A 4K03A 4CMCA 2G82A 5IXJA 3H5RA 4KIWA 4RTSA 1I3NA 1A7JA 2O57A 3AONB 1H85A 3LT0A 4MQ4A 1GUFA 2ZL5A 4FW8A 3INNA 5AI4A 2V9PA 1N3IA 1I2DA 3VYSB 2D7DA 5CM9C 4RX1A 3LBHA 1KDOA 1U8CB 5U1PA 4FFRA 4N3NA 2GZRA 4A36A 4G1EB 2O8EA 2XJ4A 1WHTB 1Z8FA 4I1UA 3MJCA 4CEJB 5LYJF 1M2VB 1RTKA 3WX0A 4QJ4A 4WMLA 2QIPA 2WJ3A 3MLAA 4CF4A 3NH6A 4DQUA 2YV5A 1FUUA 1ORVA 5BN3A 2IS2A 4D3FA 3T7KA 3U62A 1BH2A 4NEQA 1ULUA 2CHUA 2EZUA 2VP9A 4I5DA 3EAQA 3NVDA 2H2DA 5KDDA 2XUOA 5DYWA 1IULA 4S35A 2DIEA 3KWMA 4W6QA 4OPSA 1BJTA 1ZJ6A 2FQQA 3DTNA 1W34A 1XKTA 1CIPA 2W2NA 2J5KA 4LTDA 1NMXA 1K8QA 3H7IA 2JJMA 5EZ5A 1X39A 2D74A 1E6KA 1G9TA 3GBPA 4G1UC 4ND6A 3KB1A 4URWR 2H65A 3OZTA 4Q9NA 1U2DC 5HCUA 1IM5A 4RLQA 5TB5A 5HZAA 1UEIA 1N8TA 4M54A 4LBVA 1W0JD 2IY8A 3GBVA 2CXTA 2XY4A 2ZQ5A 1ENPA 3EPHA 1L7PA 1ODJA 1UUFA 2J3LA 2WLTA 2H4HA 1VCHA 5L9AA 3AFNA 1YZTA 1MJFA 2CBZA 4HK4A 5FBZA 4D3SA 4IX1A 4ZALA 3HE3A 3L07A 3PX7A 1QZZA 4MW0A 3I5UA 2I5PO 2IU3A 2IA5A 2PGAA 4CLOB 2VJJA 4BFLA 3L0ZA 1CUFA 1THTA 1TM5E 2PZ8A 4JOQA 4JYMA 2FPKA 1L5OA 2WF9A 3HYCA 3NVKI 1G38A 4D9CA 1QCZA 4UNRA 4YP9A 2OAEA 3T3PB 3ZDAA 2CRVA 1O4VA 3COVA 1KFJB 1CNMA 2CLMB 1A5TA 2ZUVA 1P31A 2HZ7A 3ZTYA 2P9QA 2XYRA 2OFOA 1WO8A 1SD2A 1X0XA 4UXJA 2UZ1A 1QRTA 3BA6A 4ZAFA 4WOBA 1E96A 4MKGA 1W9MA 3N87A 1TT5B 1LSJA 2CLIB 2VAWA 1QTIA 3UC5A 2JANA 5IYPA 4REOA 5J2UA 3RLIA 2OZKA 5KCZA 2G1AA 5GVRA 2WHRA 3W7AA 1LW7A 3B6MA 3M7IA 5AVTA 4QECA 4Q9KA 1E3LA 4BQFA 2P6OA 1Z2OX 4JBLA 2Z2IA 8ATCA 1E8DA 2AV6A 2R60A 1Y33E 2G72A 2G6BA 5I7RA 1KWKA 1E8NA 4NZNA 4B7UA 4D4MA 2CLCX 3BILA 4POAA 1RJWA 2A1UB 2ZB7A 3D3WA 2ZI5A 3EW7A 3H6KA 3TLAA 3WGMA 1AURA 3CF4G 2WG0A 4C88A 4EGCB 2IXEA 4EL0A 1FL9A 1XKLA 1BLIA 2QSYA 4UD2A 5FT9A 4DIUA 1MKYA 5FUMA 5IN4A 3WVNA 1EUDA 5FOWA 4XGIA 2Z2YA 3VSBA 2ZS7A 1DTWA 3F3SA 5C8YF 2VK4A 1DAMA 3UAZA 4BZZA 3KEFA 2C3OA 2NVUA 4X85A 5A0VA 3OFND 3AINA 5E4JA 3FWHA 5DLQC 5CA0A 3QFRA 1E0DA 4OFBA 2GBLA 1EYZA 4HUQA 1ISHA 5IJWA 5KTTA 3GEIA 4Z4YA 1BCRB 3OEYA 1SXGA 1W87A 1F2TB 3QHQA 3TUJC 1H2YA 1D09A 6CHYA 1QMGA 3O3NB 1GFZA 4BJ3A 3A6LA 1TM4E 4X7FA 1LF0A 2HK9A 3T52A 3T5MA 1KPGA 5GAJA 1NQUA 1KVRA 3KTAB 4TROA 2WV9A 1RM3A 2PL1A 3D5TA 5HFJA 1CQIA 3O9MA 2WRZA 3QBTA 1N9KA 1ZO8A 1EP3B 2B25A 3GIWA 4RENA 5H80A 5H9WA 4L50A 4UHKA 3W3AA 2FEXA 4ME6A 4UPDA 1E69A 16PKA 4Q7MB 5HGXA 4QQRA 1J20A 2D6FA 3AILA 2Y66A 3S2GA 4B2YA 4EJMA 1Z36A 3ZGNA 2YJGA 3D7RA 1TAUA 3O1LA 3QVTA 1YZVA 4GC5A 5A3VA 5BNZA 4U8GA 3EXEA 3LX5A 4TVOA 1TVMA 4BV9A 4X06A 3L8YA 2VLIA 4W5QA 4GKBA 4P83A 3F3KA 2IXBA 1T4BA 3TI9A 1EH5A 4Q3CA 4BNFA 4OA5A 3TBKA 4CF3A 2PX8A 3TOXA 2OFWA 2GA9A 4QVIA 3HDHA 1FP7A 2FWJA 1STOA 4OP3A 2NV0A 3RBZA 4RZ2A 4KN5A 4J0QA 1T9GR 2DBVO 1QHSA 3NJ4A 5JC1A 3FMFA 4B47A 4E21A 1P2GA 1JA9A 3KTAA 4HGNA 3KKPA 2WWTA 4G0YA 4MUMA 5EKTA 5LQMA 3BRWD 5HQJA 4P80A 4L9SA 4LRQA 4TV8B 4PC2A 5CA1A 5I8WA 3WYBA 1GQSA 3LI2A 5HDBB 5JQGF 2W7TA 2UYOA 3FM9A 4GBMA 4P5EA 3HXMA 4KC0A 3KR1A 3PLNA 4G65A 4DJ5X 3SEZA 4CMJA 1MBZA 2UYGA 4F38A 5U4QA 5IXSA 4CIDA 1UK6A 3RKRA 2R66A 4LCJA 1DC4A 1GZHB 2IE8A 3CTMA 3NG1A 4ALNA 4E30A 1WUJS 2QVCA 4EB0A 2WA1A 2NSYA 3GLFA 2EFGA 4N8EA 4M7OA 5AJYA 1G8KA 2OK7A 1KS2A 3LUHA 3VQTA 3G2NA 3I1JA 1GPMA 5J2UB 2HWKA 2XHZA 3N53A 1A27A 1F4VA 2QRUA 3B3QA 3F7OA 3OX3A 2B4QA 4GECA 4HWOA 1OXMA 2R8ZA 4EO9A 5D8DA 5DT9A 3BK2A 1HL7A 2BY4A 1ZI9A 3FPHA 1HV8A 3VMMA 4EVSA 1KA9H 2UUOA 3MXTA 1F17A 3R3VA 3GLFE 4MDEA 1PBNA 3JXEA 3RTAA 2NTEA 3SCZA 3HWRA 2XZDA 1KY2A 4JKIA 1L7MA 3CUEF 5EGNA 2PKEA 4BS9A 4FGZA 5BOSA 5E7IA 4NBUA 4CN8A 3LSTA 5FTMA 1XZIA 3RGWS 1W48A 4ZN6A 4JIGA 3TX6A 5HE9A 5TGDA 3U81A 4R1SA 3RS5A 3UG7A 2QT9A 4IG9A 4UHEA 3K94A 4BLRA 3AXSA 4X1IA 3C7CB 3PITA 3UK0A 5AI5A 3ZV3A 1ATZA 2FF5A 4LGMA 3Q8KA 3Q3GE 3SSOA 4MR9A 4MR7B 4ZOCA 1ZHOA 3PR2B 3K1YA 1VSVA 2QLMA 1QONA 4NCXA 1NYQA 4RW0A 4PG6A 3T5BA 3TIVA 3KAJA 1YBVA 5GM1A 1SUWA 3NDRA 2EARA 2WINI 2W93A 2H5JA 3MGBA 3LQ2A 1LV7A 1P7VA 2ZDGA 1NYTA 2DFLA 4F45A 4PFJA 1FVOA 4JSYA 2NZWA 4ZT2A 3WP0A 2V7EA 4MW2A 2J85A 3U9TA 4OAPA 1PRYA 1RBMA 4N9QA 2PXXA 2Z83A 3D3NA 3FPSA 4I3GA 3UMSA 1HKUA 2QRGA 4CDGA 2OCPA 3OAAD 4P4SA 2X9QA 4OFZA 1FFYA 3OIGA 3AF1A 5IARA 2G70A 4XH9B 1Q5PA 4OL9A 3DBLB 2W6ID 3B53X 4EUFA 2KBFA 1FYXA 5HCIA 5LQKA 4X6YA 2CVOA 1BXGB 4Z5XA 2JI8A 1ARZA 3LNCA 4R2XA 5IAOA 4BE7B 4EJSB 1OI2A 1YACA 2NO4A 2PUHA 2F8MA 4HDQB 2QPAA 1WTHD 3KALA 1R4NB 4LOAA 1CEXA 5D84A 5HQ3A 2QSJA 2R3SA 3QE0A 4XJSA 4NCNA 1TTTA 2FMTA 3MCAA 2PAFA 4YEDA 4DLWA 3GRFA 1FBNA 4MZDA 2IDKA 4HSGA 2WKQA 2VBVA 3IUPA 5CA0B 1QCDA 8ADHA 4KYIB 3I61A 2YVKA 3WQBA 1ZGBA 2QLFA 2NUTB 3LE8A 3QUBA 5CVEA 1IFXA 3DW1X 3TLXA 1ZKMA 3G5LA 4KBFA 3V8MA 5L3SB 3TIFA 4LXGA 1DKOA 4IZOA 4K9RA 1YUBA 4M83A 2OYRA 3VJRA 4V0ME 1NMQA 2B2CA 2B69A 1AVTA 1P7WA 1LBEA 3PQ8A 3R44A 4MMYB 2ADFA 1C3EA 3Q3CA 4DT1A 3C8DA 3P9KA 2CUKA 2HSEA 4H1VA 3S29A 4OYLA 4DRXB 3AESB 4ZYZA 1PKXA 1CY4A 4OQXA 4B32A 2Q7OE 1AZSC 4F0JA 3U13A 4EW1A 2QQ0A 1U5AA 3LNNA 2PD4A 1V0FA 1TAGA 2R5FA 2RGNA 2VK2A 3CMMA 1V8ZA 1Z7EA 3LXMA 3MB5A 2FW9A 1BC5A 1FRVA 3L79A 4KLRA 2OZEA 5FTKA 1B26A 4H7JA 1UADA 3NNDA 1B8VA 3GJZA 4NY1A 5E8JA 3L06A 1D2MA 3BQNB 3F6EX 5BVGA 5IJXA 4FEGA 4G67A 2ZK7A 1O96B 3JYLA 1E7MA 1K97A 4I4IA 2WYWA 3RD5A 3GJYA 3T1NA 4RK6A 4E6EA 2Q0HA 2QAGB 4RTPA 2PG3A 2ZYDA 3E7FA 5IABA 3O75A 3R0XA 1ZN9A 3ZI7A 5LP6A 4FDVA 2AN3A 3LOPA 4CKWB 2OO3A 4QNRA 1OD6A 5B58C 1MO4A 4UDXX 4FGWA 1UMDA 4RKEA 4HLDA 1GKUB 1NC3A 2GAAA 2NYUA 1W1WA 2RGAA 4HMQA 4IQGA 2PKYX 3WGLA 3ZLUA 5TS2A 2JFFA 4LBWA 1V26A 5CBKA 1ABFA 2VTEA 5BV7A 1GEGA 4MQUA 2O4UX 4HNRA 4WXEA 2GDZA 5CT5A 4MLPA 3R7FA 2P5SA 1KRXA 4J9VA 4FCTA 3OCXA 5A7FA 5CH5A 1IBSA 5E3JA 4D3ZA 1CS0A 2CWWA 5CBPA 2JH8A 3U3RA 4P6VF 2B4TO 3C5CA 3T1QA 3RFUA 3JQAB 3LS2A 4KVFA 5JRDS 2REQA 1MAUA 4OPOA 1O5OA 1A98A 1W85B 3SHVA 4C7MA 1R00A 1Z4QA 1T1EA 1RLIA 3MQFA 2W90A 3L0IB 1JSZA 3C3PA 3LPNA 3EXHC 2RJ3A 3NP9A 2FN8A 2OXCA 2HQOA 2Z2KA 4RORA 5AJUA 1Q7BA 2PZJA 2YMQA 4LFBB 4AAYA 4GVXA 3KSAC 3M5PA 3NTOA 3PR1A 3UHFA 5IJ9B 2O19A 5FWXA 4ENPA 1ADBA 2GPNA 4DLVA 4DV6B 3EIQA 3DVRX 3QLUA 1EAMA 3FXAA 4W9NC 1ZK1A 2PGXA 2GM4A 1Z0JA 4M0PA 2HPZA 4L5CA 1Q6YA 1XP5A 3CP2A 1GQOA 2O7NA 3GXOA 1EFHA 1HQYE 4NPCA 4OL0A 2FEPA 3ZWCA 4Z0NA 4HTFA 1TCBA 3IEKA 4KSCA 4IIJB 1YRWA 1B6GA 1Y7HA 4E15A 3R9IA 4A2PA 3S3TA 3NTVA 1FSZA 1NHWA 3OA2A 2X6TA 3SQWA 1BVRA 2D54A 2IHVA 4G41A 3WLHA 2YY5A 3NE5B 1EFRD 1Z2NX 2X5NA 3K7EA 4DMUB 2FCAA 2HNKA 1BHO1 1RTTA 4RSHA 1ZJWA 5TQVA 4HJXA 1HRKA 3EEBA 2A58A 1M6HA 2PSFA 3N9IA 4IJ6A 2HJ9A 4S1TA 2NG1A 1IHXA 4ZO9A 5E1OA 1YQGA 2JLXA 2XTJA 1AMNA 1OXVA 2XJ9A 1BVHA 4N82A 1Z88A 1PI3A 1YL6A 3ENQA 4TTQA 4RNCA 5KYUA 3U19A 3UBTA 1JEDA 5BWMA 2X0KA 4MGZR 1G41A 4BHTA 1H0RA 3LZCA 2A7QA 3T5PA 4DV7B 2IGBA 3K8YA 5FLYA 3R3XA 3EFOA 2WHPB 4AUKA 4F21A 2AZTA 3UT6A 4I55A 4CLEA 1Z0IA 2IS6A 2PMDA 1RQXA 1M72A 1RZRD 5F9HA 3WL6A 1VM6A 1XQXA 3P0JA 4RIFA 4AULA 2CT8A 2JI6A 4TMWA 1HXHA 1OPXA 2PIAA 4B45A 3CEPB 3R6WA 3HJCA 1HLDA 3O2QB 1KAGA 1K8XB 1QAOA 5FI0B 4D4LA 1AKNA 3AU8A 5DIZA 5E1MA 4Q4HB 4KFCA 3PDHA 1YCGA 4W1QA 1WE2A 4Y1RB 5DPMA 3WLQA 1FDIA 1WSBA 1H9CA 4F93B 1GITA 3MCWA 2FN7A 5D3QA 3T3DA 4BX3A 3S1SA 3U5ZB 3MEQA 1CWUA 3K5HA 1ZJ5A 4G5XA 3A8IA 1SVMA 4CR8A 1KZ4A 5J4HA 4UEKA 1LPBB 3AG5A 1PQPA 1R10A 1CZUA 3GRKA 5KJEA 4H59A 3GLIB 3PNMA 4RKQA 3I5XA 3QPCA 3X1YA 4MARA 5C1PA 4LQDA 3SDBA 5GOZA 4Y2UA 4EEXA 1P3JA 5CFQA 1UXGA 1GZ7A 1DMRA 2I9PA 1GL9B 4QBHA 5CIQA 1T6NA 3HKDA 4XQ0A 4F06A 1YE5A 1IBMB 4EKEA 1FMTA 3V8PA 4S1PA 5BQOA 1GSHA 4OO3A 4YJFA 3AK4A 2C9OA 5TE9A 4CM4B 4QOSA 1SOAA 3DB1A 4UUQA 5BWBA 1O94A 4BNWA 4JMQA 1IBCA 5CLLA 4OYYA 5D00A 5EEGA 3EUAA 4D6PA 1ML4A 1GYPA 1N7IA 2PGLA 4ZCTA 3IPLA 3AIKA 2JJ2A 2VBIA 3GZNB 4FNMA 3RUAA 1OFVA 1RRVA 2DQ4A 4KWIA 3ZDYB 4TLMB 1XU4A 3AVPA 3SYMA 3ZW8A 3O3CA 3H1BA 4AZTA 4IGFA 1K73D 3IUQA 4YGYA 2YHAA 3RUCA 1ZG3A 3QEMA 2IGTA 1W5EA 4MCIA 3RJ9A 1QVVA 2VJDA 1TEHA 2WBLC 1GSOA 2MIIA 3KYCA 2P4UA 4ZZ2A 5KQLA 1O0BA 1AG9A 3LGXA 1B7GO 3PGA1 1C3LA 2CNNA 3WAGA 1XZFA 1YRLA 1ZRMA 1GA1A 3JD3A 1M2NA 2JIBA 2OFPA 1QQ7A 1IZ0A 1F4LA 3LDGA 3MF4A 5EIHA 3AETA 4TVSA 4P7FA 2ZJAA 1L5HA 2ZTNA 4C0SA 2G7MC 3OCZA 4YJHA 5ALMA 1PFQA 5EIOA 1O5IA 1UJMA 2WIBA 1E9DA 2R8PA 5E6RA 3E5RA 2WWWA 3MG9A 4FXPA 2EFJA 5KYXA 4YUWA 1MHTA 2YVAA 2ATVA 2R5NA 5MDHA 1R0RE 5G1OA 1V0EA 2FR8A 2L82A 2VQDA 1UD8A 4G8DA 3H5IA 5DM0A 3UQYS 3VU9B 2DFDA 1KSJA 2A9QA 5B6IA 1EVZA 5KOHA 1G8MA 2IJGX 3EA0A 2P9HA 4KYTA 1ENYA 2A3NA 2RGGA 4Z54A 3HXQA 1MQ8B 1UBTS 2VN8A 1NMZA 3C97A 3I5AA 3QLTA 5D5QA 3RUFA 1HYHA 3BD9A 1R12A 5DK6A 3UAGA 2QT0A 4EGJA 1VLYA 2VWHA 3CTPA 1NX6A 4DV2B 3AR7A 1HTBA 4EL5A 4WKBA 3EFOB 3PQ6A 4DMLA 1DT3A 4LPKA 4UREA 3R7WA 1B6TA 2VEDA 3E2PA 3K9FC 4Z4CA 3BTOA 4X7RA 5GJVC 3L2OB 5AWFC 1FVXA 4BY9E 4XUDA 2J30A 2EKLA 4B3RB 3DOFA 2ZYUX 4BWVA 1XIVA 5DGXA 4LC9A 1J7KA 1NUTA 3ZOZA 5KCMA 4PYMA 2VF5X 1KBOA 4FB4A 2RHBA 1NATA 2ZUCA 4TLBA 4U3JB 2AG5A 2CDCA 4XQ9A 3CGWA 4AIRA 3G71B 1Z6YA 3OMWA 2IHYA 1VQ5B 1TMKA 4G63A 1OROA 4NU8X 5J63A 2ZR0A 1DEHA 1X9HA 3UGKA 4BJ1A 2H29A 3FCAA 4V1CA 1H8EA 3EZ2A 1DOZA 2ZM5A 4G1MB 3E15A 3DKIA 3FDIA 1MAAA 4FGUA 1J42A 1RI4A 1OE0A 3WJAA 1H22A 4C76A 2W11A 1USVA 3JU4A 1PT9A 4IIJA 4L27A 3SFZA 4M1WA 1PUJA 2QPOA 4WJKB 3T8YA 5A02A 1WDWB 3AFIA 1VPTA 3W4JA 3GZ4A 3PLRA 3TM5A 2RI6A 4YT2A 4DCCA 3KKZA 1RZVA 2EW8A 5E6SB 2JH9A 5B7PA 1TQHA 1JYSA 3HL0A 4KHPB 4QOGA 2ZXFA 3I30X 3JQ8B 4TYPA 5DYNA 3WL7A 2N47A 4HCJA 4D5GA 2GK7A 1RMTA 5DISB 3RFCA 3FGNA 2H08A 2HA4A 4YRQA 1R8SA 5KVCA 1JQDA 2GH1A 2I3ZA 3R4CA 3DE2X 1EK1A 3D4OA 4AT1A 4P34A 4EB8A 4OX9B 3HXLA 5E9WA 3UJ9A 2IVFA 4BJHB 3OJEA 1Y0YA 1L7AA 3RTDA 3ZXSA 5C8ZA 3WK8A 2ZM6B 4WEQA 4CIBA 1XK7A 4HH0A 4RCYA 2W2OA 1H8HD 5IW8A 4F92B 1Y7IA 1SXJA 4K87A 2GFIA 4ZOLB 3S28A 1XQVA 1G2PA 5IZCA 5A62A 4UZEA 3CZ5A 3G6WA 3EGDA 3ZXXA 2DEUA 2VCYA 3ZGOA 1JKJB 1RQPA 3VZSA 1IM2A 1OQAA 5BNFA 4DJFC 4TM8A 2CE2X 1E1CA 2QI9F 3RQSA 4DBLC 3CRVA 5AKKA 3JWHA 2VJOA 4UU8A 1XVTA 2PT7A 4Y6GB 5ECWA 2GASA 3EXG1 1ZH0A 4CMEA 1S96A 4Q4LA 1L2TA 3H9BA 1MMFB 1KQPA 4U63A 5KYVA 1G5PA 1I4EB 5LQCA 2AF3C 1GNQA 4TWZA 3RT1A 1L4NA 4DCOA 1YASA 4MR8A 1DBSA 4KJZA 1GRRA 4R81A 3KT0A 4R1OA 3ZE6A 4YUYA 1GARA 3GJ8A 2M6KA 1ANKA 4DGSA 2CL0X 2PLAA 1BKDR 1BCSB 1E89A 3QLEA 4FNAA 2P9ZA 4NFHA 3O4RA 5DO9A 1HNZB 5GWXA 5K3CA 1GCGA 1U8FO 4OKSA 2IWRA 1OY1A 3VHRA 2XV1A 5CP8A 2NWQA 3A8TA 3ECSA 3HEMA 3HO6A 4NK4A 1UIRA 1SG6A 4Q4AB 5DHUA 1BPLA 5JCJA 1HFEL 1O95A 1EAYA 3JWGA 3K30A 4LK3A 4C89A 5EIXA 1QP7A 4DDKA 2H2AA 3L0OA 2J09A 3I12A 3LF2A 1KMQA 2EX0A 2AJDA 2ZIFA 1YZUA 4LBYA 1F9AA 2DSNA 4AMBA 3IV7A 2HB6A 4G0VA 2C3MA 2ZXEA 1FA9A 1FY2A 4AMUA 4ND5A 3T53B 1HDGO 4DDTA 1NQ5A 2P0YA 2YZNA 1W4ZA 4CWAA 4YAKA 4BBPA 3B3AA 3DLCA 3IP3A 3SMVA 2EKPA 2F55A 1F2UA 4I8IA 1T8RA 4LPSA 4HDSA 3D7MA 4P5DA 4HFMA 4LJ7A 3REOA 4F4IA 2Q5CA 5FUBA 3VU8A 4PTYA 4DXHA 3ED1A 5IJ0A 3UM9A 2QG9A 4TOIA 3VI4B 1TPYA 3PXDA 1PJTA 1X1RA 2AWOA 3HJNA 3ZZUA 1DC6A 4KFUA 4S1OA 5TEVA 3V34A 1H1TA 3O8DA 4BAUA 2VO1A 2IY9A 1KEZA 1ZGZA 3LCRA 3S44A 3AVQA 1MEOA 2O0JA 3EZXA 1TRKA 2G0TA 2IXTA 4E1VA 2GVNA 3M82A 1QVWA 1A4UA 1YFKA 4LE2A 2V7TA 3H9GA 2I6XA 3OPVA 3OU6A 1Y63A 1MO2A 3G1TA 1TNDA 4R3WA 4KO3S 2Z2JA 4B3CA 2QTGA 1UXKA 1Z26A 4CKXA 4EO4A 1FE8A 2XGGA 1I13A 2JIZA 1UBCA 1Z17A 2I2WA 2Q9AA 3CIOA 3WKCA 1MA0A 2SCUB 1CU1A 3FCYA 4PZ0A 3CV3A 4ZZ3A 3VUFA 3ZV5A 2NU7B 4R2JA 2P5TB 2YXDA 5C46F 1JWAB 4MKFA 4R9RA 2W2LA 5JZBA 3KBBA 2E48A 2VNSA 4TMYA 4M8NE 3VPXA 2ZP1A 1HOXA 4QDJA 1Z82A 4UTPA 5HM6A 4FYXA 3TBFA 5MF6A 2WJGA 2R6GA 1LH0A 1Z2PX 4IRMA 5I7AA 4B6JA 2WJWA 1PQWA 3GJ0A 1A3CA 1FXUA 2AFIE 4L28A 4MX8A 2DCUA 4QTTB 5DVZA 5FWYB 4C4ZA 1JFSA 1RKBA 2VP0A 3U7EB 4COKA 1RAHA 3FYUB 1IWOA 5AW3A 3IO3A 1UPBA 1ZCAA 1EXNA 1QVAA 3FDZB 3DZBA 4HUTA 4HGRA 1EM8B 2BEWB 3DR3A 1QK5A 1CY2A 2KI5A 3IJ5A 3AH8A 3MK31 1YQTA 4MR7A 5E2IA 5EZSA 4RY2A 1XJ5A 5F73A 4B6SA 3EQZA 3PCXA 3F4LA 4ZYTA 2NVUB 5E4YA 2R62A 4Q21A 4HRYA 5EYPA 5BYBA 1L5YA 4C78A 3PD0A 2N46A 2K7FA 2BEUB 3KL2A 1ORIA 1SXIA 3QWBA 1IXZA 1DCKA 3DHYA 3NIGB 4GP6A 1WW2A 1JDNA 5ENZA 2C59A 1W0JA 3O4GA 1ULZA 2ZTVA 1PDVA 3OBIA 4TXJA 1SWVA 3DZJA 4C3OB 4CU2A 3QKRA 4DLUA 4ZVNA 2IW1A 4U2CA 3UYKA 1CUHA 4EARA 1EWVA 3T95A 4CTMA 5TEWA 4Y30A 1AHNA 4GSLA 1RQNA 3QV2A 1HORA 3SX4A 3PLAE 3ENNA 1Z8NA 2I7XA 1GPBA 1TQDA 1FFSA 1I2AA 4Q24A 2H7YA 4LK2A 1V3VA 1N08A 3F98A 5AOAA 1AKEA 1PJSA 5A4MS 2VF2A 3ITKA 4F3RA 4P0PB 3PF8A 1PJLA 1ZVKA 4QATA 4KCGA 3Q3AA 2A0KA 2ONYA 4UAGA 4QFMA 1MVOA 5T5QA 4V24A 1KYWA 4YXWD 3NXSA 1EK6A 4KMMA 1KYQA 1BH6A 1FFCA 1ZCFA 4JBXA 2WJZB 4NKRA 4X8HA 4PLFA 3SF8A 3RVQA 1WUIS 2N75A 2FAXA 3B6KA 5B36A 2ZOSA 1SVIA 1G6KA 2KHZA 3G79A 2PHZA 1ODFA 1D1QA 1II9A 1RPJA 3KT6A 3FPBA 3A10A 2WAAA 1XNJA 3NRJA 4BBJA 3KC2A 4XKJA 3WMEA 1HQDA 2PS3A 4JU8A 1JWLA 4IR7A 4JDUA 2NQTA 4DRXA 1JILA 4WXRA 3WE7A 4BB9A 1KP9A 1WVGA 1NRWA 3PNPA 2WG2A 1K4YA 1BVUA 5G4KA 3QX7A 3O93A 1V9LA 1U3FA 2C82A 1PLLA 1PYOA 1MO6A 2Q2OA 3ASVA 3BHMA 2XBLA 1XKQA 3FDFA 3K9QO 3JQRA 4DV0B 5EJAA 1QHXA 1FEZA 5F33A 4BUJA 2DUWA 5IC6A 3J80A 3BCDA 1N1DA 5LD2B 3U4QB 5LQSA 5FL3A 4II3A 4TLCA 1FFXA 1ZD5A 4D56A 4FYHA 5HKAA 3QKTA 4IDPA 3TW8A 1M6WA 1X94A 3GRAA 1QC5B 4NULA 4WKOA 5ETJA 1CUVA 4WFKA 5AUNB 5JNTA 3IEMA 3VMFA 2DFPA 4KKVA 1F7UA 2WNIA 1RHKA 3O2SB 5JH7A 1GGVA 4NECA 3BQ9A 2WF7A 2IPXA 1S2LA 3IA7A 1QQ5A 3E58A 3JU3A 3OZBA 4UQOA 5E6SA 1FC0A 5B6JA 1UBSB 2GD6A 1EJ6A 4EG8A 3HWX1 3GDOA 4HB4A 1XDBA 3A6EA 1IQ0A 3IP7A 1JQLB 1M1NB 4PAMA 1VIAA 1KOLA 2PV7A 1W2HA 5HYVA 3R9WA 3KUCA 4DSNA 2QE7D 4HB3A 1C7EA 5FOUA 2OT3B 2Q4TA 4FB5A 2UYYA 4IXNA 3GGGA 3PQ4A 3ADKA 4G8JA 1F0NA 2GN9A 3MWJA 4C0JA 4KHZA 5KU1A 2QF7A 4MLDA 3CVYA 1MRNA 4PQYA 3LC1O 3U61B 1TTQB 3FCXA 3SX2A 2AFIA 1YS9A 2VPPA 2FVGA 2DG2A 1A4RA 1RLJA 2WTXA 3JYNA 2JFQA 3L7IA 1OREA 3MWKA 4ML3A 1C4XA 3BMOB 5IUKC 2ZUTA 4F8YA 3HTXA 3K96A 3WL5A 1DNPA 2BKVA 1W29A 4CLHA 5FPHA 3BREA 4CKBB 1NURA 3CX4A 1RP1A 1J2TA 4FC6A 2M1ZA 4LTMA 1EUQA 3E1KA 1J99A 2FA9A 1HURA 1MG5A 3C87A 3FZGA 3Q2KA 4X6UA 4CHGA 1C8VB 4B7XA 5KKAA 2ID7A 2BOVA 1SUEA 3UA4A 2GPYA 3HCRA 1IVNA 3M6VA 1VQOB 3T3MB 5I7FA 1EE2A 1M74A 4R2HA 3KKEA 4RULA 1VGRA 4I99A 2GPJA 4QAJA 4R8KA 2H17A 5EJMA 4DG9A 2FV8A 2C9YA 3PQ5A 2H07A 4F5DA 2GEFA 2GCIA 2NVWA 4BWGA 2YHIB 4FDLA 4INZA 2Q41A 4MS4A 2ZYRA 4Z53A 2NP7A 5KZMB 4L07A 3MUNA 4KN8A 3S6JA 5JAHA 2H11A 1DAGA 2A1TR 1DCMA 1HO3A 1Q82D 3DTVB 1FJHA 4IMRA 1RM5A 4GEGA 4JYBA 3UJBA 2F64A 1ZITA 4HAYA 3ABSB 2DYIA 4PV7A 4R3NA 3UB4A 2GZDA 4WBSA 2BONA 3K0FA 3KLMX 5EJ7A 4KI0A 1GRCA 3OQIB 1QB7A 1XALA 5H83A 4MV3A 4MYSA 1PT6A 5CLIA 5JZ9A 4CGZA 2OXRA 1E3MA 1VLJA 3RF7A 4D46A 1BOOA 4MS1B 4ER3A 4YUXA 1UKZA 4KPYA 3SVTA 1WORA 2FUEA 2OP0A 2E21A 3OCVA 4D9NA 1NW3A 3FWKA 4L5IA 4XB2A 3NIWA 2VRCA 3FWNA 4QSHA 1FDRA 4OIFA 5KX5B 3CZ4A 4OPMA 3ZBPA 1X9GA 3PFHA 1N77A 2WKSA 3LWDA 1Y9DA 1N6LA 5I9LA 2LCFA 3TTTA 3IKJA 1F4PA 3TK1A 1TT7A 3LKVA 3RSOA 1TAQA 3TR0A 4ZHQB 3GA0A 3PE4A 1Z2CA 4ZI5A 3HY3A 3CONA 2KYRA 3NBFA 5JEEA 3LOUA 3R09A 4PIMA 4F2PA 5J35A 4ND1A 4EHJA 5LIRA 4F9FA 4JD5A 4D99A 3BRSA 5L8VA 3K4HA 4GQIA 5DRTA 5TQ2A 3VPDA 2DFTA 3U3ZA 4ZJPA 3ELDA 2JJ2D 1IY1A 4A5OA 3PB3A 1G6Q1 1PJ6A 3DYIA 3LPMA 2XKKA 3Q8LA 3EMBA 1EIZA 4NBLA 1SKYB 1Q7CA 1SA0A 1NSYA 3GLIA 5LP6C 3D7SA 2QUBA 2XMRA 1MO5A 3ZQJA 3IUJA 2PBLA 2ORYA 3S5UA 2BI4A 2HMSA 3NGXA 1KJJA 2IODA 5IULC 2C9DA 4N5LA 5KVVA 4DANA 2DY0A 3ZKWA 2BJHA 4F2HA 4BQPA 2XYHA 3MT7A 4KDFA 1Z7GA 1OB0A 5IG2A 1M8FA 2XUGA 5LZ4A 4XCXA 2JLVA 4J90A 1JNYA 2BISA 5LZ9A 2PQ0A 1RJ9A 3FWPA 1O8BA 2A0UA 3BA1A 2DWOA 5JADA 5K99A 1JLSA 4QTUB 4WXPA 1WUYA 2GEVA 2JN9A 4U2EA 2WZPP 4MUGA 4N6OA 1ISGA 1U1CA 2J4CA 2HLDD 3H1AA 2NU9A 4CG3A 4NMHA 2X2PA 1SAYA 1QQ6A 1HL3A 3TXYA 2UKDA 2PRJA 4AY6A 2WMDA 4JV5B 2QN3A 1C9EA 2JFBA 5BVHA 1K8RA 3JQ8A 2AN5A 1X7GA 3TTYA 5KYGA 1EK0A 5AKGA 4PNEA 2JF0A 2A4MA 4GYJA 4LEIA 4DJDC 1AUOA 1ATIA 2QRZA 2D7JA 1EUCB 1C0EA 1WXEA 1UWKA 2ZG6A 3PSHA 1VI6A 1WHTA 1MGPA 2IFTA 2XYPA 3VR5D 1FDTA 1KNQA 2HXYA 3L7JA 5T41A 2XPCA 5I4BA 1OF1A 4J0KA 4UEJA 5I5GA 5KNCA 1H0KA 1DC7A 2YDYA 2M5SA 2D1TA 4OQDA 4XLTA 2BGWA 2FSFA 2GXAA 3CH4B 3EMKA 1M7HA 1U7HA 2FOLA 4DUPA 2ZJ1A 4XNFA 2ZRJA 3D3WB 3FMPB 4F1JA 4FJ0A 5DTEA 2QMZA 3DVAA 1QNFA 3ZGZA 1BE0A 1NSFA 4K6HA 4C0QC 4RA6A 2J5BA 3QLVC 1YU6A 4MQEB 5F1OA 1WEKA 4MDYA 4YASA 1FFDA 2VDOB 3AY6A 2HLDA 1UCFA 1X1EA 3ONEA 4LXHA 3K1ZA 3ZDBA 1ZEMA 3A6ZA 3C6QA 4RMGA 3BD6A 2Q4DA 2CNOA 4WZAA 3RC7A 2BGRA 1ONBA 2R79A 3SWWA 1SVKA 2VBTA 3NTLA 4WCFC 2QMYA 4HNUA 4EECA 3R20A 1RQ7A 1N5KA 2O07A 2OO5C 3IT1A 3OT5A 4MEBA 3WIDA 3QE3A 8OHMA 4F4DA 3JARA 1M2FA 4I1IA 4R8MA 1Z56C 1ZNYA 2OGWA 1BCSA 1KXZA 3STWA 4GFDA 1AY0A 1GQRA 5ESDA 2V5AA 4CZ2A 3ASQA 2KW5A 4Y2HA 3IGFA 2BMDA 1WY7A 3VBEA 3FCUB 4HDNB 3NHZA 2BBOA 1JJIA 3D8NA 4TWIA 5DTQA 5F21A 3PGLA 5LUBA 4UOZA 1AN0A 4A8HA 4OXQA 2ZETA 4WI1A 3CX3A 2JLYA 1JDTA 2UXCB 2BMWA 2BCGY 2JCVA 3A36A 1N2JA 2PX5A 1OX4B 1NV8A 2BTQA 4U7PB 4Q7KA 3MA0A 2G8LA 4ESHA 4MHOA 1BDIA 4AB1A 2H2FA 3BG5A 4FWBA 1UEXC 1YS1X 2WHEA 1U7PA 4PM4A 5CBPB 3CCRB 1ZMXA 1QO0A 2BDUA 3AI3A 4C14A 4I9FA 4ID3A 2WHXA 3CSUA 4R7ZA 1JX6A 3DDZX 2JGNA 1H0HA 1NV9A 1OYOA 2ZAYA 3R6LA 4K1LA 5T7BA 3LC7O 5EXDA 2V54A 2XOKA 4NHOA 4BKMA 3EPJA 3DBHA 3TCNA 1WETA 3VC3A 2OCXA 3DMTA 1DEXA 1Q9SA 2AMLA 2OD9A 1KR2A 2Q3CA 3CE9A 3L05A 4CLDA 1CJMA 1TUBB 1IOLA 3T7AA 1M3SA 3CXRA 1KY5A 1JKJA 3ZHQA 1ECCA 5A06A 3RIHA 5ALWA 3U7JA 2C29D 3C3XA 4RPKA 2D00A 1P1FA 3AR5A 1XAHA 4DEVA 5C37A 2XXAB 1UKEA 4EWLA 4Z2AA 1TZ2A 1H1LB 2ACEA 2EOAA 2FPRA 3DGEC 1NUHA 2HX1A 3H2BA 1NFFA 1DVRA 3M6MD 3PK0A 2GPWA 3VKVA 2AG6A 5TPWB 1MRZA 3BHIA 3P9ZA 2LV8A 4A9AA 2HCJB 1QJCA 2HU8A 5E8RA 1PO7A 2COKA 2RGBA 1B42A 4YJFB 2XVAA 2JH3A 4ENVA 4RQTA 4RY9A 3HK2A 5DGCA 1ZH2A 3W8RA