4UZEA

R66a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRAAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Quaternary Organization in a Bifunctional Prokaryotic Fad Synthetase: Involvement of an Arginine at its Adenylyltransferase Module on the Riboflavin Kinase Activity.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 97
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 4uzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4uzeA01
3FY4A 3CLTC 4XSVA 4AS1A 1PFWA 1M8PA 5J58A 4MWEA 1KKUA 1MB2A 3QTTA 1KH2A 1WXFA 5FO0A 4MUEA 1IQUA 1O96B 1MRZA 2R5WA 1R6UA 2DR2A 3FH0A 4J76A 4EG4A 2CV1A 1GTRA 3P0IA 2J09A 4DE5A 1MB9A 2QUIA 2DPLA 4BWVA 3CLRD 3ELBA 1OWPA 1O0CA 3MUEA 1UFVA 2VXOA 3P52A 4ZT4A 1KAMA 1KP3A 4AQ7A 2XRZA 3RFFA 1EUYA 3CLRC 4NAUA 1PG2A 1VLHA 1WOYA 2A1TS 4RPIA 5IJXA 1NUTA 2GKSA 4ZCRA 1F7UA 4MW0A 3DPIA 2AZXA 1O0BA 2G36A 5K0TA 4ARIA 4Q93A 3PNYA 5H7XA 2XRYA 4F4HA 1EE1A 2A1TR 5TS2A 4PBTA 2CUZA 2TS1A 2Z3VA 2A1UB 2DUMA 1F9AA 2E89A 3FG9A 1ZJWA 3E27A 4EG3A 4MWBA 2RD2A 3GUZA 4HPWA 4MUGA 3TZLA 1JIIA 2JA2A 3TNJA 3HGMA 2AG6A 2X1LA 2WB2A 2HGZA 4CDNA 2BTEA 1IH8A 1VL2A 2ZUFA 3MMXA 4J75A 1GTSA 1IRXA 1YULA 2DEUA 2CV2A 1JZSA 3MXTA 4JXZA 1WKBA 2PIDA 1VBMA 3AKZA 1IHOA 1J70A 1CT9A 5DASA 3IOEA 4E1AA 4MVWA 1JIKA 3ZUGA 1OD6A 2YWBA 3ILVA 1OWNA 3COVA 5LLTA 3VGJA 1G59A 2GOYA 3SEZA 2OYNA 1T6ZA 1O6BA 1WQ3A 3K9WA 5DEOA 1M8FA 3JXEA 2DXIA 4HJRA 3KFLA 3KT8A 1WZ2A 1Q9SA 2JAXA 1K92A 4KR6A 2A7XA 2V0CA 2A86A 4DNXA 1J09A 4XFDA 3ND5A 2VBTA 1QRTA 3FWKA 4G5FA 2B7LA 4MAFA 3COYA 1PFUA 1N07A 4MVCA 1MJHA 3P0HA 3RJZA 1IQ0A 3SEQA 3FHJA 2IELA 1Y42X 2CSXA 4UZFA 2J4DA 3VRHA 2WSIA 1N2GA 2DETA 3AL0C 4U8HA 4MWDA 3KT3A 3SZGA 5BNZA 1KAQA 1VBNA 4U7JA 2WQ7A 5H16A 3G6KA 2Z09A 4KR9A 1N08A 1TYDE 4G5YA 4KPUA 3ZJUA 1JEEA 2WQ6A 3IMEA 1O5TA 1O97C 1SURA 3D6UA 1H3NA 1M8GA 2DERA 3ZJTA 1LI5A 3LOQA 4X0EA 4DDHA 4JXXA 3NV7A 4YP5A 4YP7A 4DDKA 5F23A 3H9CA 1GLNA 1NI5A 4NATA 1GPMA 1ZH0A 4MUHA 1NUUA 3AFHA 3PNBA 3S3TA 1J1UA 3ZXIA 3UC5A 3HL4A 1N78A 4K0RA 3SYTA 1OWOA 1N77A 1Q11A 5FO1A 1P7PA 3CLUD 2HZ7A 4R2MA 4EG6A 2AKEA 3QE4A 3A05A 3VU8A 1T6XA 4PY2A 4RUKA 2YXNA 3CLUC 3HFJA 3FOCA 4MQ6A 1MOPA 2HMAA 1QRSA 1N06A 4ZT2A 3H99A 1MBZA 1N3LA 1WJGA 3P0JA 3TQIA 4WSOA 1X6VA 1N1DA 2A4MA 3CLSD 1G8HA 3G5AA 4I6JA 4DDMA 1G8FA 1JEDA 1XNHA 3CVVA 3CLSC 2C5SA 3G59A 3ND7A 1V8FA 1FYDA 1ILEA 2Z08A 3ZIUA 4YMIA 1WXEA 3IMGA 1KP2A 4EG5A 3ZJVA 3N9IA 1H1TA 3KT0A 3F3MA 1H3EA 1BS2A 2O5RA 2DLCX 4EGAA 1QQTA 3HZRA 4KPUB 1QNFA 2A88A 5DB4A 1S4MA 2PFSA 1JIJA 3UOWA 3ZGZA 4EF6A 2QTMA 4ZCQA 1QU3A 1COZA 1PFYA 1K4KA 3IUBA 1NUPA 1N2OA 1NB0A 4L2IA 1KORA 2D13A 5A89A 3C8ZA 4U63A 3X1MA 4MVYA 5KHAA 1OWLA 4R2LA 4CQNA 1Q19A 1XNGA 1I6LA 3MLAA 3FIUA 2JANA 1J21A 4ZCSA 2QUJA 1U0BB 3UY4A 3RK0A 1B6TA 2QJFA 3FI0A 5IHXA 4ND6A 3IDFA 2YWCA 4MW9A 4UZEA 2H29A 4NDAA 4ZT3A 3CTAA 3N8HA 4CDMA 3IODA 3Q12A 4HJXA 3CVYA 5A8AA 1KQOA 4NZPA 1JGTA 3UK2A 3RHSA 4P2BA 1PG0A 4MW6A 1YUNA 1U3CA 1TFUA 1O94C 5DK4A 1PFVA 1OWMA 3K32A 3CVUA 1N05A 2E18A 1U7DA 4MVXA 3QTBA 4MW4A 2X1MA 1KQPA 3RK1A 3COZA 1RQGA 1O97D 4MLPA 4XFJA 1FFYA 3BL5A 1P4MA 2E0IA 5KCMA 1JMVA 1YIAA 2CYCA 3H97A 5EKDA 3CA8A 2RE8A 4MULA 1NB9A 2BYTA 3IUEA 3IOBA 1LI7A 4PBSA 4ZT5A 4EG7A 3DLAA 3AIIA 5HUJA 4OUDA 1IQRA 1A8HA 1GN8A 4MUKA 3X1JA 4ZCTA 5JBNA 3AG6A 2OV4A 2QTRA 4MW5A 1XNJA 4DJAA 1I6MA 1NSYA 4MWCA 4YBRA 1QRUA 5TRDA 2D54A 4NAHA 3U1VA 4F3RA 1IFXA 1N2IA 4K03A 1TYCA 3LE8A 5LM3A 1F4LA 1Q77A 2QTNA 4L2IB 5HUHA 1N2EA 2IJGX 5FNZA 3IVCA 1KR2A 3DO8A 3OTWA 1F7VA 1EFVA 4WNYA 4CT0A 3FETA 3ND6A 3FDXA 4EG1A 1M83A 1I2DA 1NYLA 5TEWA 1EFPA 2PZBA 3AG5A 1LW7A 1KQNA 4JZYA 2VBSA 5A88A 2V0GA 2OQ2A 1WXIA 3INNA 3IH5A 3BNWA 1KH3A 1N75A 2X3FA 2I1LA 3HMQA 4YP6A 1JILA 3I05A 1K4MA 1XJQA 1YIDA 4R0NA 1J1ZA 4MUJA 1JHDA 2QUHA 1Q15A 3FNRA 2QJTA 1WXGA 2VBUA 3SDBA 1EXDA 1H3FA 5J5AA 1X8XA 2CFOA 3IVXA 4QREA 4KKVA 2H2AA 5K0SA 2J5BA 1JECA 1NUQA 1U3DA 3IMCA 4JFAA 2P3MA 1MC1A 2VBVA 2NZ2A 1ULHA 1TYBE 3UMVA 5TGTA 2VTBA 3IVGA 3D6VA 2EJCA 4GRIA 2YY5A 1NURA 4MUNA 2A84A 4MW7A 5KWVA 3PNVA 1I6KA 1VBKA 3A2KA 4G6ZA 3A4IA 3Q10A 2O8VA 4KR7A 2J08A 1YUMA 3PRHA 4OUDB 4PBRA 2QJOA 4A91A 1MAUA 3PXUA 3SZ3A 4ZT7A 4TS1A 1GZUA 1QTQA 3ZXSA 1N2BA 3L92A 4HK4A 3H9BA 5LFAA 1EUQA 1TYAE 1V47A 5J59A 3TS1A 1O96A 2EL7A 3LCJA 4ZT6A 4Q16A 5TEVA 1EJ2A 3CR8A 1EFVB 4S1OA 3MLBA 1M8KA 2X0KA 4OJMX 4QBTA 5HG0A 1TQ8A 3KT6A 4MW1A 4EG8A 1EFPB 3SP1A 4EFKA 3H05A 2J07A 2PZ8A 1MAWA 4MUIA 2E21A 1O94D 4I6EA 3CVXA 1M8JA 1OBCA 2QUKA 3M5WA 1ZH6A 1WXHA 4GU5A 3OP1A 3HV0A 1OBHA 3N05A 3DV2A 4MW2A 2CT8A 2GM3A 3A04A 1G8GA 4H3SA 2ZP1A 3ISJA 3RBAA 4FZJA 1R6XA 1YI8A 2CYAA 4I6GA 1T9GS 1QJCA 2PZAA 3L93A 4ND7A 1R6TA 4ARCA 1GAXA 1NZJA 2CV0A 3COWA 1KH1A 3X1KA 1WY5A 3GMIA 3NBKA 1TEZA 2A1UA 3IOCA 1O95D 1T9GR 1ZUNA 2NSYA 1N2HA 4MUFA 4NX2A 1U7XA 2VTBB 1O95C 1K97A 1WQ4A 4QRDA 1NUSA 3NBAA 5AHWA 2PXHA 1D2RA 2PG3A 1HYBA 1M1ZA 1NP7A 1JZQA 3CVWA 1J20A 3Q4GA 1T6YA 2IP1A 1DNPA 2ZUEA 3CLTD 1IVSA 3GLVA 3TZEA 4ZCPA 4DLPA 2D5BA 4JYZA 3TQOA 2CYBA 3N2YA 1N2JA 1QU2A
chains in the Genus database with same CATH superfamily
2GCOA 3VSAA 4EKNB 4TLEA 1OLUA 4YFVA 4OVKA 4UC0A 5IJ0B 4YT5A 1YDHA 2RAUA 4QUBA 3ZKAA 1UMBA 1DC3A 1F0YA 1FSFA 2OCYC 5CT8A 3BMNB 3U49A 1WXFA 4X05A 2O2ZA 3A9VA 2WF5A 5EE1A 3FJOA 2ERCA 3GUCA 1G6HA 4MLZA 4AM8A 3O8NA 3WKDA 5BQ5A 1Q44A 2VDWB 4RTKA 2PU7A 3TQRA 3I9FA 4EHLA 1RWKA 4JBXA 4KV7A 4M6WB 4DAEA 4AN1A 4ZK2A 5KC9A 4XDZA 3CLRD 1XKQA 1NASA 1FPQA 3OKFA 3RS3A 1J0CA 2JAWA 3K0FB 3V8BA 1JPVA 5AW9A 4P6YA 1A1SA 3DHEA 1GQOA 4QXMA 2K7ZA 1RWVA 2FG5A 5I8WA 3PUNA 2OCLA 2XV1A 4MVJI 4FS3A 2ZB7A 2REXB 3GVKA 2DUWA 3PXCX 3UAZA 4RXMA 4XKWA 4CIAA 3PR1A 4UARA 5AOBA 1C8LA 16PKA 5HF5A 3SMQA 2VNHA 4HB3A 4LX8A 4OAQA 1JQKA 2OO5A 1Y8QA 3VR2A 3JWGA 1QWSA 4OQQA 3PXEA 4ZQBA 2CDAA 3K2BA 4Q4AB 5HE9A 1QVVA 3JZAA 4O0MA 1TCCA 4ENUA 1RBQA 1C1XA 1DIGA 2Z3VA 2NPOA 4J3JA 4ZALA 3NC1C 2QXYA 3WIUA 1DHRA 1L8OA 1KK2A 4ZVOA 1D0IA 1I3KA 3CEHA 3DWEX 4KXYA 4LSGA 1ZOSA 4MWBA 1TL7C 4GZ5A 1A2QA 2CVPA 3MBIA 3PDUA 2OGUA 3SK0A 3PEWA 4HVLA 2ZYTX 3LP8A 1Z82A 4RDIA 3WJ7A 1PZNA 1XZFA 4RK6A 4BVBA 2AFHE 1R3UA 3QMMA 3PHBE 3HGMA 5CR9A 2G5PA 4RK1A 4MAMA 4XONA 5A4DA 3GLIA 5IFKA 4FTWA 3Q6MA 4X1OA 5TVGA 3GQBB 1UAYA 3ZZNA 3C0KA 4E33A 4XSHA 1RACA 1YULA 3IAFA 5AW8A 4CN9A 1OH5A 3A9SA 2P6UA 1WKBA 4QVGA 1OHHA 2INGX 3S8YA 1C7JA 4PSKA 8LDHA 3C15C 4IV8A 4WLFA 4U2CA 3V7FA 5BN4A 2XXBA 4TYWA 1KEEA 3RNOA 4WBNF 4F04A 3PGMA 1KU0A 5HMLA 2B98A 3BPSA 3JRXA 3L8DA 3T9AA 2B5VA 3ENQA 521PA 2J9XB 3EYAA 3P19A 4OAPA 5FDFA 4J1TA 5KQRA 3BB4A 1NMSA 1G8KA 3B5IA 4RIFA 3HYLA 1T6ZA 1U2GA 3ETJA 4H7FA 4YRMA 1UAAA 2PZGA 1L7NA 3LY8A 3F0TA 3I62A 1EUDA 3BZWA 3QVKA 3GVPA 4G84A 2IOFA 2B61A 2HCBA 1KR5A 3W2IA 4RA9B 4LNUA 4YMUA 1CYDA 2IY8A 1LBEA 1J09A 1ZN9A 2A57A 1WPGA 3EZFA 2O8EA 3ELWA 3VR5H 4WINA 1G8AA 1JHXA 2JAPA 2LDXA 2D2FA 1BX1A 1T9DA 4H9GA 2GRAA 2ZAGA 4MJ3A 4X3PA 3KQVA 1GGJA 4FMCF 3UK1A 1BG6A 3JD3A 5AO9A 5DN6A 1UKVY 1DE0A 2MINA 4PSUA 1X80B 1DIHA 3QX9A 4KO4S 4Q48A 1JDTA 2DMRA 1QV7A 1T4BA 1JE0A 3EZYA 2OESA 4EJ0A 4JYAB 3IHTA 4Y2YA 3AL0C 3VHQA 2P69A 5GIPE 1EHYA 4ZVUA 1CUJA 3BCHA 1JPJA 3DOIA 3EIWA 3K05A 4I55A 2PMEA 1VBNA 3NTOA 4G9BA 5JMTA 3QEJA 2PN1A 4NOKA 3ITNA 4LHWA 5CTJA 4HH4A 2WP0A 1YRWA 4PZEA 1V8BA 3G1WA 3AF2A 3NDRA 5DW3A 2JIMA 1DWQA 2VHUA 1WIWA 3PP8A 5D3ZA 4AY5A 1I13A 2IRWA 2O3RA 3ZHYA 2QD5A 5JH7A 4RD3A 1SUEA 4QOHA 5DTQA 1GGFA 4H6WA 5DULA 5CFMA 3M5CA 1MOSA 3M2TA 2WQ6A 2R68A 1Q17A 4XUGB 2RGNC 3NBXX 4KPEC 3OM1A 1JU4A 1U2PA 1X92A 3WWCA 3LT5A 5FQNA 1FYWA 1EBBA 4M8NE 4MYCA 4R9VA 2PMFA 3ONYA 2NVOA 3QU2A 1PTJA 3JPYA 2NGRA 4RXUA 3RVBA 5BPFA 3OQ1A 3BCDA 1CHNA 4V0NA 3SDSA 5IM4F 3WKBA 3KZ1E 4K26A 2BI4A 3GA5A 4PWYA 3EPRA 4OUKX 5IVKA 3RE1A 4X7FA 4I99A 2X2PA 2ODPA 3JQ8A 3J80A 2ZJ5A 2O2GA 1T8TA 3G5TA 5CVEA 3W5AA 1VLYA 3T52A 2GM9A 4JYBA 5DHFA 5EJFA 3EUFA 4KP7A 3HJGA 2HZ7A 1HWYA 3V48A 4MKZA 4MPRA 4TM7A 3F7TA 4PHGA 4L4XA 3DOUA 1JR3E 4PY2A 3TD9A 5DBEX 4WOBA 5DM0A 2RHMA 1RHJA 2JH3A 2QW1A 1VOTA 3T9FA 1US8B 1LSOA 1T4MA 4TT3D 1FFBA 1LUAA 3UA4A 1RYMA 4RHFA 1JDPA 4DOMA 2HWWA 3KRTA 3L0PA 3C6ZA 1KC1A 3CLSD 3NDPA 3FGZA 1J0AA 1WLSA 3HABA 4QICA 4ZVPA 1OAOC 1IMJA 1XCLA 4HGPA 4E5PA 1M6VA 3BULA 4ZCIA 3DAFA 4DMHA 4YDQA 2OBSA 2WAMA 1B2RA 3GFGA 1UZUA 1SIBE 3OLYA 1UK9A 3SC6A 5F4JA 3TNDA 4BJ6A 1JT2A 2YW9A 1DRWA 1II8A 4MWGA 1G60A 5D6OA 5CXQA 2H1HA 5BVHA 3NWBA 3DKPA 2IOYA 4KXQA 5AHRA 5KYVA 3K3PA 3WBBA 3WL4A 1XMJA 4FXUA 4LZWA 4EG5A 1E1QA 1IBCA 1KETA 2GKOA 2QMZA 4RH1A 2ODEA 3VTAA 9ABPA 4YACA 2XYRA 1H1TA 3D26A 1XDGA 1E1NA 4QUKA 4CKXA 4D5EA 5HRAA 2HV9A 2VAMA 2ISSD 3O4FA 5LUBA 2RCNA 4I3FA 2QU7A 3M9XA 5ALVA 1NI3A 1BJTA 1ZL2A 5CB8A 1IG0A 4X3OA 3HXTA 2GAOA 5SZHB 4PC6A 2C59A 2RHDA 5HILA 2XYQA 4QTTB 4QHSA 4YCSA 3UYKA 4RULA 2O8BA 1CZOA 2Q5IA 2FPRA 3D6HA 2FTKE 1KMNA 3IUBA 1ZH8A 1JLSA 1BU8A 4EI7A 2VK4A 4L2IA 1JG3A 1Q84A 3RTAA 2DKOA 3G8YA 1P31A 3O8BA 3Q2IA 3WS7A 1Q7BA 2ALJA 5DIFA 4UAVA 1XKTA 1UBRS 3RS5A 4BB0A 3I72A 3H9EO 4WCFB 1WR8A 3ETCA 4DYHA 2J0UB 1ZMXA 2OCPA 5IBQA 1CNMA 3CPSA 4RF2A 2JIBA 3C1UA 2X2OA 4HAYA 4HNHA 5E6SA 1TJ4A 2BFDB 2RK4A 1LB1B 1XU7A 2YWJA 3JRNA 3PIIA 4RKFA 1K27A 4ZO6A 5ALMA 4CE6A 3WWPA 4N01A 4QG3A 1O3YA 2GFQA 4A3SA 1X19A 4HI0E 4UMVA 3KZKA 2DBRA 2JIRA 4DG8A 5TX7A 4NJOA 5K1ZA 4L4SA 1KRHA 4WLOA 1D0VA 1IUKA 2P2SA 4F8JA 1YVDA 4WZBB 1OT3A 3HU5A 5AW7A 4F21A 4DMLA 2XCOA 2V4UA 2W2LD 3HEMA 4D82A 1MOQA 2RFLA 4CM6A 5LMZA 1TJ5A 1QNLA 2FN7A 3ORYA 1OWMA 3JAKB 3FFWA 2I4OA 4OJNA 4ZKEA 3MWFA 3JASA 4ZJPA 4JDUA 1BXRA 1CRWG 2CK3D 1K2VN 1JKJA 5KNCH 1ZSVA 2VP3A 5ICFA 2X42A 2A35A 2C94A 3EARA 3HMKA 4Q1BA 3EUAA 5IN5A 3HJNA 4RV4A 5K6TA 3SZLA 2H07A 2RGRA 3ONNA 5LNK6 3H2IA 3UUEA 1ZMBA 4GICA 1P1RA 5C7IO 3I1IA 5KJCA 3TIVA 1E43A 3GMSA 2OBTA 1GR0A 3CNOA 3NTUA 2E4XA 1FTQA 3X2EA 1RPJA 1E2UA 2ETXA 4P34A 2HY7A 1EP1B 4JC4A 3PI7A 3SLRA 2OCBA 5DDIP 4A1FA 4N6GA 4BWYA 3WDKA 3WGQA 1PJ7A 1MEJA 1IQRA 2QL5A 3RRMA 3HN7A 3TN7A 2P6PA 3ZIAA 3GNTA 3VV2A 4O25A 3USES 4H4DA 1M90D 2D9RA 2EGGA 3WKCA 4YJDA 2D1SA 3KYDB 3JVEA 3GGGA 2ZEJA 3QKIA 1KYIA 1XXHB 3I0ZA 1N2IA 3TLGB 3Q9UA 3VPBA 3WWOA 3ZIDA 2WV7A 5FORA 2OHOA 2FUNB 2QTNA 1UPFA 1N2EA 1W1UA 2AJTA 2DSNA 2IU3A 4OSEA 3ZHTA 4EI2A 2VJMA 1J24A 2FR8A 3EF1A 1ZJ4A 5GGXA 2CVFA 4A8JB 2WILA 4Z86A 1V0FA 5TDHA 3PNKA 4PZLA 1QIJA 4M9UA 4AUMA 3ZGYA 1QQAA 3C74A 4RFVA 1NXXA 2RGYA 1U7TA 4RKQA 5G02A 3IPXA 5A88A 2GEDA 1LEHA 2H7VA 1KQNA 3QXCA 3M3DA 3ZQJA 4EAAA 3IH5A 3HP1A 2HO4A 2TMDA 4L8JA 3QV2A 5EPOA 3GLGE 3NWPA 2P2ZA 2GI4A 4L3VA 3YASA 1Q1BA 4E13A 1LZLA 2O8CA 2Q9AA 4Q9LA 2IEYA 5TQ2A 7REQB 2WVHA 5IK2D 1H5NA 1GSAA 2BFPA 3DE1X 3LA6A 4PNHA 5A5DA 1MGPA 1Z45A 2XYPA 3T9CA 4CM1A 1Q1GA 2PLWA 5JNRA 3ZX4A 1FP7A 1U5BA 2LTAA 1QP0A 1QTRA 1EXDA 2FF7A 1HVXA 2CFOA 1UT5A 4X62B 2P3SA 2ZSUA 4QEZA 4WZTA 5CB6A 1EK0A 4MS3B 3WL8A 1U4OA 1YACA 4BZXA 1CHDA 4LE1A 4Y98A 4KDEA 2FJUA 1KY5A 4BGEA 2Q3FA 4XW2A 1JQAA 5HS6A 3RFVA 4D46A 2IVFA 2AJ8A 3BJMA 4D9HA 2X14A 5C81A 4PO8A 3WWEA 1XA0A 2J0EA 3GA7A 3AP2A 2P0EA 2C2OA 2C7RA 4JS0A 5LOVA 4RD0A 2LW7A 3IVGA 2X58A 3ABRB 2VZ8A 3RS2A 3FOZA 2BGMA 2HH9A 2BAGA 2X40A 2ZANA 2ZTUA 3DTNA 1O9HA 2KBEA 2ZYWX 4XJXA 3VDMA 3VKHA 5KWVA 1J8YF 1J9GA 4IZOA 4I50A 3DP9A 4HFJA 4EIWA 1HETA 2WYUA 2BMAA 3QIVA 5CHEA 1BA3A 1Z2OX 1CUUA 1NVGA 1BE1A 1FRZA 4PNZA 2Q7OE 1PX0A 4EQZA 3NHUA 3L7DA 2FWAA 3HB0A 4ZV7A 2QYTA 3HXQA 1JF8A 3ZVNA 2F4NA 1ORVA 1Y1PA 4M1YA 1SC9A 4R2XA 2RGXA 1GU7A 1X7YB 2QP3A 2NUAB 3SFZA 4NCHA 5CVTA 3SFTA 3PA1A 3AB8A 1FW8A 3VNUA 3O9VA 4QVIA 1FSSA 1LDNA 2DLDA 3VA7A 2HPVA 1KJZA 4HGOA 1VI5A 1NKTA 3PJDA 3NW9A 1VXRA 4QXQA 1UMCB 4AJ9A 3QEAZ 3GGJA 5LUAA 2XNDD 1XRLA 2DHRA 2JFNA 1EJ2A 4CMHA 4DIMA 4H6XA 3FKJA 5GJCA 2RH4A 4N82A 4X7BA 4GXRA 3OO1A 1TTTA 1YB2A 2IYFA 5IP5A 1R9JA 2Y4OA 5DFAA 3TDMA 2JLCA 2FAXA 4EG8A 1FB5A 2A3NA 3EVBA 4ED9A 5BSWA 2IYAA 3QH4A 3EFHA 1MAWA 2C2XA 4MUIA 3S70A 1P33A 1QGYA 2QZPA 3HCOA 1YDWA 2PX8A 1FDOA 1M8JA 1BKYA 4S04A 3CVXA 2V1UA 3EXHB 1NC1A 1NXWA 3TI7A 2YC4C 1UXGA 4OX9Y 3W8RA 2QTCA 4J0JA 4I8IA 2NMVA 4FM9A 2H7XA 2EGUA 3TIIA 1ATZA 3ZHUA 1JYFA 1M1KD 1IY0A 2AMJA 2IY7A 4Q3AA 2D5AA 3O4VA 1R6XA 4WNAA 3GEHA 2XUQA 2H0RA 5IYWA 1DAMA 1ESEA 1HYHA 3CE9A 3LFTA 4L8FA 4EP1A 3PUHA 1GAXA 2R1VA 4KQWA 4X91A 1LC3A 1KAGA 4NH4A 2R1ZA 5ELLA 2Y0BA 4FYVA 5GVRA 3IE1A 1XK6A 4I5DA 5BR7A 3QKRA 1L8XA 4BFTA 3UUWA 3RFUA 4J9UE 4LK3A 3FVRA 3TRKA 3WLPA 1S2IA 2H85A 3QKTA 1JDJA 2YFHA 4BBZA 2HA2A 4HB4A 2FSPA 1JPUA 1CR6A 3E9CA 4OA8A 4RDCA 1WQ4A 5AVTA 5JSHA 4GSLA 4LRTB 4C14A 4GPD1 4I81A 4RF5A 4KRXA 1WEHA 3T95A 1W52X 4FCVA 1C3VA 5D6NA 1JZQA 5GJBA 3IVMA 5K20A 1J20A 4P4GA 2IHJA 4CMEC 1RW4A 1OXBB 1WCWA 3ORSA 4JKOA 1V96A 3OQOA 3V7NA 4EVRA 3GX1A 4OI0A 4A03A 4N3AA 3CH6A 4BL5A 2PQMA 3BYZA 1N2ZA 5JSZA 2HYDA 2JIZD 2P2CA 2F1LA 1ONSA 2RHRA 3PXBA 4XSVA 2GLTA 1E9DA 4W4TA 2ZJ3A 1DZIA 3KD3A 3CV3A 3NRBA 1ZHFA 4NULA 3MJTA 2QL9A 2QY9A 1NVXQ 4JQSA 5IABA 2Y92A 4PO9A 4HAZA 4IFEA 4KI0A 4X0CA 1QYWA 2C0QA 4E5MA 4EMSA 3PNOA 1UXKA 4OXIA 3VUFA 1XAJA 1U99A 2P77A 5IXSA 1MO2A 1MB4A 1P81A 2PCJA 4GI7A 1ZN8A 2XGJA 3I6MA 2XBMA 3LA8A 3LWNA 5E8RA 4LECA 5ETJA 5D5HA 5U1PA 2WJYA 3FRHA 4LTMA 3F3KA 4D0NA 3K71B 4N7JA 1Q12A 2XMQA 4RQTA 2BEUA 4G0ZA 4KLAA 5TSDA 4QEKA 3WXBA 1DOZA 4A2WA 2BISA 1DO8A 3WP0A 2GK3A 3OEHA 1Z5VA 2XE4A 4MB0A 4X3CA 1JYSA 4BP8A 1C1DA 1M1YB 1IJEA 3D8TA 5J5CA 1FFAA 3OT1A 4M49A 4NS1A 1TTHA 3OOYA 4Z2YA 1A77A 1ZZGA 2AR9A 1T0HB 4GXNA 4M89A 4UHFA 5L3QA 2CLFB 3TEMA 3R9WA 1SQ5A 3E7DA 4NCXA 2FPSA 2GKSA 4KO2S 2CFCA 4ZCRA 4W5NA 5A03A 1O0BA 3NASA 2X19A 3LWZA 4F38A 1NE7A 3ZLJA 1UUFA 1TZJA 3MWEB 3QF4B 4HNGA 3K1YA 4OREX 4EPXA 4EW6A 4HATA 2IYTA 4P6VF 2J3IA 3P9ZA 3K7EA 3CKYA 2ZW9A 5T8KA 4V0MA 2EG9A 4BFLA 3L7BA 1IOWA 1H4SA 1E2MA 1U8TA 1ZD1A 3EDYA 4MS4A 4QNNA 2Q5HA 3E3NA 1F3LA 4GNKA 5H3LA 1FZTA 1QRRA 1PK7A 1CSEE 3HWSA 4FIZA 3WIOA 1NNUA 2CWWA 4BP9A 3HKCB 3U3RA 1A9ZA 4LHZA 4B81A 1YHNA 1L7XA 3ZD9A 3AJ9A 5BNTA 3O2QB 3EC7A 3HKBB 4E5UA 1PTKA 2UKDA 3E48A 2C3PA 3UH1A 1Q0TA 2IT1A 1ZK0A 1EM6A 1HMYA 2CVZA 2KX7A 3SBEA 1GZ5A 4Q39A 5EJMA 5G1OA 1HFEL 1IH8A 1Q0UA 1A9XA 5K03A 4LXYA 3ADKA 1VFNA 1XEWX 3KU1A 5DBIA 1V9LA 1ZNQO 5AJZA 1MNQA 2FF5A 2IV3A 3IV7A 1KDVA 5J4YA 5AVJA 3PR2B 1DAPA 4PRYA 2CBXA 1NIJA 2CNWD 3PX7A 2HJHA 2GCOB 1CV2A 4OPSA 4BAUA 1OLUB 2VSQA 1CB0A 4FYPA 5ITZA 1MU0A 1ZGBA 4LXUA 1WUKS 3S5JA 1UMBB 1GQSA 3MC1A 2R8BA 5D5QA 3B2EA 3B9QA 1OBOA 4J4HA 3MELA 3ZE8A 4HEJA 1NOJA 5J5VA 2F1KA 4BFCA 5LA6A 5DGTA 3JQRA 1HF3A 1PEDA 3PHLA 4PZAA 3UXHA 5FBRB 3RWBA 3UT5B 4DWOA 5DEOA 2NW6A 4B87A 5C3MA 3MOIA 4DXHA 1MORA 1LPPA 1R8XA 4ZK6A 2OM2A 1RC1A 3GBPA 4B83A 5KMGA 1TM3E 3BFXA 1E79D 1ZR4A 2BFWA 4YRBA 3ORHA 2WI8A 4EPRA 1QWOA 1ZGGA 3VR6A 4AZTA 4UXIA 1Z36A 2JHGA 2YRFA 1GGEA 1JR4A 4DR6B 3TCNA 1QRTA 3FWKA 3MWKA 3LC0A 5CK5A 3D4IA 4KQ9A 4J43A 4LWQA 5DH9A 2IXBA 4RLZA 2XX3A 3BX1A 4MVCA 1W6UA 2PGIA 2WRZA 1MJHA 3DVAA 4GQNA 1T9CA 4PYQA 3AHFA 2W5UA 2ORWA 2H5JA 3EMVA 3LGAA 4X7RA 2PSEA 5AIBA 2CSXA 2Z1NA 2N0SA 3UYLA 1N2GA 2DETA 2HU2A 2IXTA 1Y8QB 3IGFA 1N6KA 3L7MA 3LQKA 3II6X 3HN2A 3IQZA 3OJEA 2IDJA 4S05A 5EKSA 1KAQA 4Z4TA 4FMDF 3ZY4A 3SJUA 1ZGAA 1C1XB 2H7YA 1SIUA 2CRVA 4I5IA 5IF3A 1PT6A 1UKZA 1AV6A 2VOJA 3V3TA 4LDZA 4H7HA 3J81A 4RH3A 3N8NA 1U7UA 2GZ1A 1MA0A 5CB4B 1OXSC 1VB3A 1ZBQA 2PJDA 1N0HA 1JEEA 2VYVD 3PIRA 4GYJA 4XUEA 3FPFA 3S8MA 4RTRA 2JA1A 3KCQA 3LUFA 2OTJB 1O97C 1Q7EA 3D6UA 4KAJA 5FTMA 2DF8A 5JLJA 3GLIB 2L0XA 3GCGA 1LI5A 3LDGA 4MAAA 3TLMA 1I2AA 1ZZEA 4S3MA 5F23A 5KTMA 2C07A 2FN9A 3IP5A 3IQGX 1P73A 4ZEXA 5AIAA 3ZDAA 4G1BA 4P33A 5ESRA 4MVJH 1I2BA 1LWOA 3K8ZA 1X9HA 1NATA 3AFHA 3WSTA 3C7TA 1JR3D 4WZKA 4CRWB 2IOHA 1C7RA 1U65A 2XH8A 3HL4A 4KNWA 5BN4B 1KEEB 4D4HA 5BQ3A 4XQGA 1PL7A 1PE0A 4LOLA 3N58A 5IAJA 2EOAA 5C1PA 1G1AA 3JU3A 1N77A 5JFOA 5EGSA 2AEEA 3UM9A 1EINA 1UBGA 1RQNA 1I1QB 2XGSA 3IP1A 2C7VA 4DTCA 2EKQA 3IBYA 4IDQA 5DLEA 4UOZA 5AK6A 3FWPA 4PICA 3K70D 1YR6A 4HGZA 4NNJA 5BSFA 3DDUA 5C8XA 4V0LA 3JVUA 2Z2IA 3PVZA 3A8KA 4INJA 1I8DA 4M98A 1EUDB 2XNCA 2EZ8A 2Y2UA 3UMRA 1KFEB 4E5DA 2WG2A 1U4SA 1P1JA 1E0SA 1H5QA 5FLKA 2HQSA 3H99A 1JUDA 5ERXA 3SNKA 2O8DA 4UUBA 1VIAA 1RJDA 1RIFA 4QZVA 1OH8A 4EYSA 4AZSA 1HL3A 1LLDA 2O8EB 3I2JA 4ZJZA 1YLOA 3KAQA 5CXUA 5IRCD 4D41A 3PQEA 1F2VA 1RQLA 1N8KA 2AZTA 2WG1A 2X86A 4TL8A 3RJ5A 2XWJI 2AI2A 5KTOA 1ADJA 2QAGC 4IYJA 4MKFA 2C5SA 4FYWA 5EUQB 1WVIA 2F6RA 2MINB 5CH5A 3LCRA 2P2LA 5A0VA 2ILVA 2E3JA 3KS9A 3H3XA 2VQ6A 5B4UA 4JJ7A 5JAOA 3LCCA 2AHOA 4LHEA 2CL0X 4FI3C 3D31A 5LD2B 1NN0A 2IHZA 3L9XA 1TZKA 3OZAA 2X6YA 5EMMA 4BE4A 5GZ3A 4I55B 1FP4A 3GIWA 4B74A 1NQ5A 1HTTA 1HLFA 1B73A 1G3QA 1OGYA 1QOPB 4QGHA 4UMFA 4GW3A 1YL7A 1MTOA 2RKWA 3L8YA 4H77A 1BS2A 1EK5A 1N7GA 4WDRA 4ANFA 3QJYA 3JYOA 5JH7B 1WSDA 1SWWA 2J9YB 2XUJA 2V7QA 1L4EA 1SBHA 1JVNA 2XCUA 1B93A 4YRFA 3KZXA 1ISHA 4FQ7A 4MEJA 3A3BA 1LBSA 3D3KA 4URUR 3ROMA 4KDFA 3PKZA 4WGGA 1L1RA 3N2IA 5HIMA 4R5HA 3WISA 4N76A 4V0QA 5I7SA 1M2GA 4JBHA 2WINI 4XB1A 3VH2A 4F97A 3HSYA 4NZ9A 4EABA 2J3EA 1JLRA 2NWQA 1JIUA 1N8NA 1U0EA 2D13A 2JNWA 5T4HA 4DLBA 3I2HA 4O4JF 2J5QA 3C6QA 4AVZA 4U63A 5LQJA 3I5XA 1IEXA 3DCYA 2IFTA 2QMQA 4R2IA 2QRPA 2I7DA 3F6SA 2XF2A 3JQ7B 3OCUA 3JQ8B 4DQXA 1D09A 5BWCA 2XUHA 4CV1A 2X9NA 2ZK7A 1NJ1A 1SBYA 3C6KA 1RSZA 2XGGA 3CXCB 3OHMA 4F4CA 1JHUA 1KI6A 4I9HA 4LZNA 4A8HA 3MM4A 4R1OA 4AY6A 3H0KA 2C42A 1SOWA 1XN4A 3WL7A 4EDHA 2QPTA 1NVDA 3T9BA 2DPGA 3W9BA 3I1JA 1SCKA 1RYEA 3C3AA 4BVGA 3L6UA 4EATA 1RAEA 5B7QA 3DO5A 1G6KA 4PYJA 3H1GA 3PLRA 1YZYA 3MUNA 2DHCA 2EJUA 3GJ7A 3D7LA 2AG0A 2NV6A 4AJ1A 1FTGA 5EZSA 4IDNA 1TT5B 1SB9A 3NCHA 3FOBA 1P39A 2YQ4A 4TTSA 3HJFA 2A0XA 3ZDBA 2VCHA 3RYIA 2JARA 4FXOA 4CIBA 4MKRA 5IDXA 4QASA 2CXOA 3HVJA 2E4AA 3QTBA 2IF2A 4R31A 4ZGBA 4Z6KA 3FMVA 1HNZB 2MSCB 2VPWA 4D9IA 1NG9A 1II8B 1Q1ZA 1BFKA 2AC7A 1C1HA 1O97D 4IP0A 3WZ2A 5KJ6A 1ENYA 1IDN1 2P2YA 1M54A 3ASPA 3KVVA 1YTLA 3HVHA 5JVDF 2HK8A 4FDLA 1K28D 1U3WA 2PFKA 3ANLA 3Q1KA 2FSFA 5JSQA 2ZWMA 4YQZA 2EFGA 1PVVA 4NARA 3V1UA 4PBSA 2PGDA 4EJ2A 2GX6A 2RGNA 2DJ5A 2B4YA 4CU2A 1Z13A 4LJ5A 3CGWA 4CKYA 2CVHA 2Z3ZA 1EZZA 5IAKA 4ZGWA 2WMYA 3WX0A 1UZAA 2Q21A 1KI9A 2GEFA 3AOGA 4KIUA 3OW7A 3AVXA 4MW5A 4PR0A 1T2EA 1VLVA 4RMGA 2WPDD 5LQSA 3NHBA 3A35A 4QDUA 2JIQA 2HA6A 3SYRA 1SVWA 1M6NA 3OSZA 2PGJA 4QUHA 1VECA 2AF4C 1DO2A 1WABA 3KSMA 3MYYA 4BNMA 1WHSA 4L2IB 5AKXA 1FTYA 2CJPA 4NABA 5B6PA 1F7VA 3OTWA 2HO5A 3A0RB 1AKNA 1EFVA 4TYPA 3HXLA 1RYHA 4R2JA 1T5SA 5HVNA 4L7QA 3SYLA 4FIDA 4UD2A 4ZIRA 2L19A 1EFPA 2G4CA 4JLVA 4N5NA 2XQGA 4LYEA 3A70A 2I2AA 4ON9A 1NFFA 4PFJA 1ABEA 4N5MA 5E6SB 1Q3TA 5C7OO 4G89A 1VA5A 2X1HA 3ZH9B 4OPMA 1WMEA 1XTVA 4RZUA 4B7CA 4YAJA 1RLJA 4X8OA 5GVSA 1UBHS 4QWMA 5DX1A 3KQWA 4XIYA 2G1PA 2C7GA 3K0CC 1GUYA 1XMPA 3WMFA 1U7ZA 2CZCA 4F0JA 5JU6A 1CC1S 1NLMA 1WXWA 1WPRA 1Q15A 4IQGA 5F5NA 1YJAA 1GU0A 1VSVA 5EIEA 2GQFA 1MP0A 1OAOA 4G86A 4DPMA 7MHTA 3CC7B 1SCUA 3V4LA 5JRJA 1RCTE 1IWBB 4XKJA 5JPIA 3OO0A 2HB6A 2NG1A 5HR5A 3F6YA 2IE0A 3JASB 4M88A 3DR5A 3LDHA 3MRXA 1BXRB 3L4BC 1JKJB 4FDAA 3EIOA 1DV2A 4L57A 2NZ2A 4A0SA 3QYPA 5CEJA 4D81A 2ZVQX 2CLOB 1IUPA 4H59A 1Y8ZA 1WX1A 4R1MA 4DFDA 1RXIA 3FHOA 3FR7A 4F93B 3FLMA 1GQQA 2GNOA 1FTWA 4MPDA 3DLHA 1FRQA 2BGRA 1E8MA 1EYZA 4A5SA 4D6XA 4RPDA 3ZK9A 3DBIA 3A2KA 4AI6A 1DLJA 3A4MA 4KMRA 3Q10A 1OOEA 5J9FA 1FZQA 4RDXA 1NVAA 2J08A 1UANA 4AFNA 4JL5A 3RYFA 1NL3A 3N70A 1UBNA 2QA5A 4BFZA 4Z4QA 2WU8A 3NG1A 1RXCA 1EWKA 3W7VA 3OQMA 2ID4A 1XXLA 3EJ6A 5JRDS 5CMLA 1P62B 4G1UC 5BRAA 4AWBA 4H1WA 4UBKA 1QG2A 1TKCA 4BJ1A 4HK4A 2Q1YA 2PYIA 5H81A 2HXGA 1Y3CE 3DZFA 3QKSA 4Y30A 3VJLA 4C0HA 4Q02A 3SN6A 1NBWB 2Y0CA 3PYXA 1J5EB 1NOKA 4L50A 2I6FA 3DTVA 4E6EA 1T6NA 4X7DA 3LCJA 3Q3VA 4Q16A 4ZT6A 3EIQA 4BV9A 3MLBA 3DEIA 2H1VA 3CQ9A 3S29A 1I3MA 3B7WA 3PGKA 4G5XA 1G0NA 1E0JA 1AN9A 5K3AA 3TAUA 3H2JA 2H5LA 3IIMA 1NXSA 4NQZA 3T5MA 5LQAA 2Q6VA 5L51A 1S7CA 5FUVA 1LX6A 2QUKA 2OQRA 3IQHX 1C7IA 1G4UR 3D1VA 4CIVA 2G6TA 2O8CB 5TQ2B 3LVFO 5LJLA 3C3JA 4B3HA 4IDBA 4JT4A 1YVEI 3AF4A 4IIVA 3WLQA 1U5BB 2BE9A 2QTFA 3TOZA 3KOYA 4N0EA 3L77A 4S35A 3V7WA 3D3QA 2IL1A 2WSYB 1ZSNA 4NZYA 2PZAA 5IULC 4RAQA 3V8QA 4B35A 1RJWA 4GPEA 3B1VA 4M7WA 1ADFA 1P44A 2O20A 3A2LA 3H5LA 3R5SA 3BREA 4S2EA 2G0TA 3DAHA 1EUCB 4TWAA 4E88A 2QMOA 1X1BA 3ZJ4A 4N8EA 4IQ0A 5J2TA 3TRIA 1FFDA 1M1XB 4J0KA 1XDUA 4R8RA 4IHKA 4LZZA 4NCBA 1OKKD 1W76A 4MUFA 2N42A 3AUXA 2W4MA 5LOVB 1TC1A 3CR7A 3W2HA 3CESA 1CK4A 3O8QA 4LYJA 3PA6A 1X1DA 4NG4A 3CG0A 4O59O 1UH5A 1Y89A 1OREA 1X42A 3VYUB 4HMQA 1QE3A 4ITVA 4IV5A 4TN5A 5CA0F 4G0XA 5F4BA 3DGFC 4I50B 3V1LA 1QV9A 4OOFA 1YQTA 4S0XA 4CR7A 5LP1A 1FUYB 3LLSA 3LY7A 2XVMA 1E9AA 3EGXA 3Q87B 1VE3A 4M7OA 4PIVA 3TLJA 3W5SA 4B32A 4YMGA 5HPYB 2J5XA 2C97A 3CLTD 3O84A 1CKEA 4C01A 5AM3A 1AMUA 4Z51A 2EEPA 1R8QA 5JJLA 4NMWA 3RVKA 2FRVA 3D7NA 4CQMB 2OXCA 3KUCA 1JQBA 4G0QA 4C30A 1IN1A 1IEVA 1AVTA 2J48A 3DD1A 1M8PA 2XA9A 4WLUA 3ZY3A 2J87A 5KVQA 1KZ9A 2BGGA 4ZI2A 1KH2A 1TQ6A 4P2GA 1IQUA 3I83A 3VVMA 1CNFA 3RLIA 1LNQA 3OOEA 4BMYA 2EX4A 1OLXA 1YZ3A 4D99A 1TJNA 4HZUA 4TGLA 2Q0XA 4N8SA 5CAEA 4YAOA 2DY0A 2J33A 1RM5A 3CS3A 3QY0A 4HMPA 3KSBC 2CB0A 3T7RA 1I3NA 2SCUB 3CNHA 3SIXA 3EHEA 2QAJA 2IU4A 3AIMA 4J2TA 1KAMA 2JLQA 1J0EA 4H1UA 3BCSA 1C3JA 3N28A 3RFFA 4IXTA 2PL5A 1W2WB 2JJ1D 2FPIB 1ZM2A 4B79A 4HZIA 4RTSA 5EA2A 1VLHA 3AKCA 3LYAA 3W5UA 3O38A 1HE2A 2UVPA 4WNAB 5BUZA 1RCFA 3R5HA 2NQ8A 2P68A 2XVXA 2N1MA 3QOYA 3PKJA 3T0FA 1LV7A 1Y7LA 5DNCA 2YC2C 5KSZA 4DANA 2UZ3A 1KMMA 2R1VB 1LWNA 3CCEB 4QYSA 3S5UA 4EH1A 1QK3A 2QTTA 2TS1A 4PC2A 3QKRB 2QX9A 4HDCA 1T4CA 1E3WA 3VBEA 3Q8XB 2E5LB 3ZC3A 1QX3A 3HBJA 2ZUWA 3KUKA 1BYUA 3GJ3A 2FX3A 1Y0BA 4I4IA 4Q4HA 3AZQA 2VHQA 1N7JA 3E27A 4GNRA 3LDUA 4L8VA 1SXJE 4O1MA 4AMYA 5CLQA 4EFLA 1QXSA 4RY9A 2V31A 3CPEA 4X1IA 3KKNA 1YE5A 2AFHA 3Q7SA 2GESA 3HYCA 5KPJA 4LSWA 4YJ2A 2XT6A 1QSGA 1AQNA 5KNDD 1V7QA 2OVFA 1X3SA 3PPIA 4UM5A 3VZDA 2HGZA 5K0ZA 5LNK1 1C0LA 1Y98A 4J75A 1LY1A 3OZDA 4JEMA 4DKXA 1JZSA 3CUUA 1FQOA 10MHA 3OZUA 4GH5A 2QRQA 5D87A 5HJ5A 3AKEA 2ZIFA 5AK4A 2P3LA 1JHPA 2QF7A 3Q72A 4RQAA 5JSZB 1J70A 1TIPA 4MJLA 4OGGA 2JLAA 3NTLA 3S27A 5ILQA 1VSUA 4XCVA 3MWDA 2OV2A 3Q41A 5TPZD 1YJQA 3ZCXA 4YJFA 3HVRA 3ZUGA 1Z7GA 2P7IA 3EH1A 5L4LA 4C2TA 4QXAA 6YASA 1V6SA 2JLSA 4M21A 1G59A 3SEZA 3BSYA 1H42A 3H75A 2OD7A 1EVIA 2JRLA 2CNWA 2EEZA 3PQ8A 1C81A 4JZKA 4HDNB 4RJIA 2R6R1 3HM9A 4Z4WA 1AZWA 5CW1A 1XTZA 2D1QA 3B85A 3DW3X 3P2IA 2BEUB 2ZBPA 2NSDA 4BGDA 3Q3IA 2OKGA 5AHKA 3KQMA 2Y6VA 4Q3OA 2UZ4A 3GJXC 1G17A 2A7XA 3JWHA 4FHZA 5EIBD 1ZRHA 5BN5A 5EMJA 1PG5A 2O23A 4XVUA 5K9ZA 4A92A 1TNDA 4DCJA 1BS9A 1C1DB 3ASTA 1E9SA 1FDSA 4UTXA 3LK7A 3OT1B 4XUCA 3UB3A 5HKAA 2BFFA 4KE7A 1VQKB 1N07A 1OH7A 4B3SB 3DZKA 2X0NA 5T4EA 5L3QB 2XR1A 4R9RA 2X23A 4GXTA 2V7WA 4E22A 3PGXA 4ZVVA 3VHRA 4P92A 1DC5A 2P65A 3G3EA 3RUDA 2GCNA 1E1RA 2Y4NA 2AG8A 5B3JC 3C5HA 5IG2A 3JYLA 4QDKA 1QKIA 3ZNQA 1R0CA 2IZ7A 3MTIA 5C7YA 1NBIA 2AEFA 3VKGA 3REGA 1SC1A 2XTNA 4GPZA 4JB8A 1XZPA 3G6KA 4MS4B 4XVRA 2XKAA 3PUIA 3W77A 2WM9B 3A28A 2VL7A 1DCKA 1LDEA 1N08A 2C9DA 2CW5A 1BVYF 4QYXA 1HQKA 1TI7A 1UD3A 2OCIA 3LHDA 3LHSA 2DFDA 4DQ0A 1VE7A 4CMEA 2WYRA 2JFXA 2MYTA 2Q2WA 2GHQA 4I9UA 3VOSA 4AL4A 3LQ6A 3IAM1 5G0TA 3AEYA 3F9RA 5K4HA 4C0KA 1JLKA 3C39A 3T3HA 3M33A 1MRNA 4OP7A 1A9XB 1I6WA 4YO8A 3GVHA 3AM4A 2C2MA 1VMKA 2G6BA 4MI6A 2CHVA 4Q3BA 4TMTA 2R79A 2JCSA 1SKUA 5IAEA 3BILA 1YBMA 4Q4JA 4BLOA 4YGXB 4A0GA 4EW1A 2BUAA 4J4TA 3WR5A 2WWXA 4MQ5A 3N8DA 1ISSA 3W5IA 1OA0A 4A6EA 3AINA 3G82C 2J7PA 5BMVB 4HVTA 1UL1X 2JBAB 1LVHA 4G0PA 2JZOA 2QN3A 3K31A 2W6CX 2RC6A 4F3YA 2PKQP 3WB1A 1MNAA 4OGWA 2AKEA 5LA6B 1CIVA 1JR3A 1Y6QA 3M1AA 5DV9A 4KMOA 1N5KA 1YHZA 2NT3A 1THMA 1OXKB 2EP5A 4PZ0A 1UD4A 1UMDA 1A8QA 5CJ2A 5AICA 3SIPA 4CKEA 2XXAA 5KMGB 2X3UA 3BEOA 4J94A 4HTFA 4IX9A 3PB3A 4NBUA 4XEHA 2BKXA 4BYGA 4O2RA 1BU5A 1S8AA 2C7BA 5FLEX 4E3WA 5F1KA 2G5CA 2QQGA 1GKLA 5JXGA 3RSHA 4OHMA 3G5AA 4JBGA 3ZE7A 4OLBA 5E3IA 1Z39A 1P5HA 4KV9A 5FKJA 3NXSA 5TGZA 3V1NA 1FW6A 3NHWA 3OD1A 4RBNA 5EIWA 3U37A 3U4AA 1O8CA 3PF8A 2H1OA 3ENWA 1NW3A 3DVAB 2OYCA 4Z3DA 3SQNA 2WWRA 4WWVA 3FBGA 1W29A 5EI5A 4DSNA 1CR0A 1SVNA 4B8ZA 2Q5QA 3V7AA 4G8JA 1B74A 2Z83A 4LYFA 4OY3A 1AIPA 2IP2A 1YDMA 2WIJA 4I19A 1E1CA 1L7VC 3GV0A 1UKEA 4O5AA 2PL9A 2PLRA 2DJIA 3CNBA 2ZDGA 4GYWA 1AUVA 4PG4A 5I8PA 2NT4A 4YEDA 1NA5A 1KS2A 1HFJA 3V00A 1Y8AA 2A5JA 2XTJA 5EE0A 5TC4A 3UHPA 4X90A 4BNUA 5KTYA 1H3EA 1IM5A 1CUXA 2Q2NA 4FVTA 2YMMA 4OX9B 1QQTA 5BN3A 1NFRA 3WB2A 1VE5A 1F4PA 1QNFA 2HBQA 4S1PA 4TV8F 2KW5A 3TD6A 4QL3A 1RHRA 3RSSA 4DV5B 4J49A 1SCBA 1W5BA 4I1IA 4ZCQA 3PENA 3VPDA 4E3ZA 1FU8A 1ZINA 1IZZA 5DM2A 3HDJA 4M4SA 2Q4EA 3QX7A 4C4YA 4EY5A 1ZNWA 3JX9A 2IVZA 4RHTA 5IM5A 4LCJA 4UNPA 2Q28A 1ACMA 3JYPA 2GYUA 2X8AA 1NC3A 3N0TA 1FSGA 2VDPB 4QJIA 5JJ5A 3FWNA 2FHPA 2ZJ4A 4TMKA 4N12A 4NE2A 1SMKA 4FBMA 3R6WA 4CQNA 3F7OA 5ALQA 1BDMA 4HS9A 4MR7A 1I7NA 3KOWA 2BFCA 3EFEA 1YZUA 1DUIA 1MEOA 3L0BA 3SFVA 4KHPB 4LC0A 5EJAA 2GASA 1ZLYA 1Z6GA 1TO1E 2KSQA 3A9TA 3KR9A 4Q9KA 2RGBA 1TGVA 5EHNA 5EQFA 5JQGF 1L7MA 5K09A 1BE8A 2JJQA 2FW7A 1FRVA 1K5GA 2QDKA 5CVCA 4E07A 1IHPA 3LKBA 2HIMA 3OQBA 3NVMB 3GPLA 2NQTA 3ZCSA 4EYKA 3HWWA 5ALSA 1NT2A 2RH8A 1I1HA 1K63A 2O8DB 4L76A 2DG2A 5AI4A 1SPXA 3RRNA 4G5RA 3IBSA 4BV3A 2O2DA 1FVXA 4UM9D 4M7RA 2X4LA 2Q1TA 4PC1A 3ASSA 3BJEA 3JARA 4XLCA 1EQ2A 3T1QA 5DK4A 3K9FC 3CVUA 1VP9A 1AKQA 3P2KA 1Q2UA 3SM3A 4BKQA 4CZ2A 1OU0A 4PLGA 3DG9A 4K40A 3KOOA 3UAGA 4D8XA 2GVDC 4Q18A 4EY7A 4M54A 1P2FA 2FVYA 3JQFC 5AVWA 1W36D 1TADA 2BW0A 2B78A 3CZCA 3PQ4A 5BOSA 4C29A 3CP2A 1C2TA 3RK1A 1XCJA 1YRYE 3N0VA 1FRFS 4EVQA 1GZHB 1MAHA 2QVYX 2VP2A 2P5UA 2EZ4A 4Y9DA 4F8EA 2Z9BA 1T3TA 4M0LA 4BMXA 3UZUA 1FP4B 4F6RA 1A7UA 2GN1A 3HJHA 1KO8A 1CU1A 3MIZA 4HSGA 3ZHCA 5T64A 3UMJA 2ZQYA 4ARUA 4E4RA 4ZT5A 1IYZA 4ZYLA 5KWIA 4MLDA 3OMLA 2GGSA 3C6YA 4RELA 1L7BA 2V5VA 5IYZA 2RGCA 4FZVA 2XB8A 5FT9A 1K89A 2RK6A 2ODNA 3SC3A 2RHLA 4G7XA 1L7RA 3WLTA 3AUAA 2DH5A 3NJ4A 4LQDA 1VHQA 2HNAA 4FZ3A 2X8JA 3OZTA 1DMSA 3EZ6A 4LOIA 3SEAA 1VLLA 2EP7A 1L4YA 4K03A 4KQXA 3LE8A 3RFTA 3WLKX 4ZRMA 1T1RA 1SG6A 4O4IF 3P20A 1XQBA 4UZUA 3KSDO 2I54A 3LBAA 3LX8A 3CY6A 3UCEA 1PO7A 3UKJA 4KXUA 3BRQA 2IIBA 1H2ZA 4QD3A 3LS2A 3CXRA 3ND6A 2GD1O 4WBSA 3JVIA 2LGJA 2PTHA 4RKRA 1FP1D 2YNMD 2R7NA 4M9XA 1OB5A 1A2KC 1DWPA 2AXNA 1DQPA 3BN3A 3I2YX 5E7QA 3WYFA 1ZK1A 3W90A 5AM2A 1ISJA 1KI6B 3KUDA 2OSBA 5FPKA 1XMIA 3OC6A 2A4KA 2G40A 1H8ED 3FSGA 2W6MA 4S12A 5B1SA 4E1VA 5LIRA 2YV2A 1UM9A 3A11A 4CNQA 3ME5A 3Q98A 4ARSA 3TW8B 2VYNA 2XE6A 4CKCA 2Q3DA 1QYIA 4C7OB 1TMGE 2X5NA 2CFIA 2GZHA 2WWWA 4ZXPA 1C9JA 3GCZA 3OEEA 2NZYA 4O6VA 5GONF 2WSLA 3TPZA 4DLLA 4POOA 1N36B 4JT2A 5K7SA 1HQYE 1X7HA 1NR5A 2ECFA 2QAGA 3IELA 1EE9A 1PJ3A 3L6EA 5A62A 5K0SA 4DIOA 3GPIA 5DNEA 3RYIB 5DOVA 1WLYA 1I14A 3HO6A 4R1NA 1JG4A 4BO3A 5BSGA 4WTOA 3MOGA 1GQFA 4MV7A 3ZY5A 5TQVA 4FGLA 5HTKA 3IQXA 2VTBA 1CY2A 1BEUB 1E2EA 3T54A 1BE0A 3EC1A 3SKVA 3LXXA 1YMVA 2NXWA 5K3BA 4YLGA 2YY5A 1TK9A 1W0JD 4U2DA 1VBKA 1WP4A 2PWBA 3OF2A 4ZAYA 4HDKA 3OA2A 2PBFA 2XNHA 4C2AA 2GDJA 1AO3A 4ERXA 3WK8A 2NN3C 3H0EA 4ZOQI 3ZCVA 4UNQA 1MAUA 1QS0A 1Z08A 1YMUA 2PS3A 4MRPA 1JBKA 4BU0A 1VPEA 2X0RA 3GDGA 3I8SA 5CVUA 1QTQA 1A69A 1C8VB 3G79A 2QTGA 2CLEB 1YO6A 4B09A 4S1WA 5B7GA 3B6EA 3DE3X 2A0YA 3JQAD 1NQOA 1GDDA 4EBBA 4BQEA 1BWSA 1WHSB 1CUGA 3TS1A 3ABOB 1RS0A 1VHJA 4OFBA 1OTYA 2PXXA 3C6MA 3Q0EA 1TYEB 2JFYA 1EFVB 1PL8A 1U1IA 3CR8A 1V4BA 3IPAA 1S8FA 3L3BA 3EVFA 1TEHA 3OUTA 3OPYA 3WK5A 1JHAA 5B36A 5JNUA 1L3BA 1VJGA 4RPLA 1TQ8A 4ZIRB 1ISRA 1EFPB 4H0NA 1IXYA 1E7YA 2HT1A 4OHWA 1QPBA 1WSVA 3OOSA 4LVUA 1GCIA 2JD2A 2GJ4A 4YJGA 3M6LA 1G9TA 3QOXA 4HBZA 4HQ6A 4RQBA 4DA7A 5I7OA 3NVAA 2JLXA 4KQGA 4LUCA 1GZ7A 3FTPA 3RSZA 3N59A 3RYTC 1AC5A 1WXHA 2Q5LA 3GK3A 2JLVA 2VTKA 1DSSG 3CINA 2WZPP 3TDNA 4ARBA 4B4OA 4KTTE 1OI4A 4QFCA 3G2LA 5B1HA 2BMEA 3RKUA 1RMTA 2GPSA 1TU4A 3D4OA 1C9KA 1V8PA 3KZOA 2X0JA 3DCIA 4KQ1A 3DWGA 2XD9A 1JIQA 2OG1A 4MK4A 5FBWB 4FYIA 2JGJA 4D3DA 1V16A 1SCUB 3CZMA 3PUWA 4C4ZA 3DULA 4PAQA 3PXGA 3JU4A 1P2VA 1XRRA 2WJ6A 3DR3A 3W3AD 1DGQA 1UBMS 3COWA 2R8PA 4FGZA 4LWPA 4QQFA 4BNXA 5BNFA 4YP1A 1G8JA 1TEZA 2LKDA 2PRIA 4X8HA 1FA9A 1O95D 3MWLA 3QPWA 3B1FA 1UWKA 3DEKA 3KHKA 2Q41A 1AGPA 4GVXA 1LTHR 1Y6ZA 5ECYA 4FHFA 1I9GA 3L6RA 3RVPA 1T5OA 4RIIA 4DUZB 2NIPA 3K5HA 1OLOA 4RORA 2PXHA 1A2BA 2DHDA 2ZT6A 1G20A 1M1ZA 2EWVA 2GD0A 4FC6A 5H5JA 3IUMA 3KR2A 4PHHA 4MWZA 5AQEA 3WAGA 4TQ9A 3LCUA 2JIOA 4N0QA 3WLHA 4ITUA 4C7XA 3GJZA 4DWJA 2HZBA 2R85A 3AFMA 2IZ1A 2XOXA 3RYFB 4ZTZB 2RB5A 3FBWA 3JPWA 2ET6A 1YJCA 4KH1A 4URWR 3RRBA 4G09A 4JH0A 2QQFA 1XZMA 1S72B 3A6GA 3FKQA 4WXHA 3OAAD 3G0OA 2P30A 3QSYA 1EWVA 3L79A 2FWNA 2Y77A 3QKSB 5JZ9A 2WP8J 4B3TB 3R1IA 5AKGA 3AM5A 2FA9A 1ZRMA 4HH1A 1BH6A 3AY3A 4P82A 3REQA 3DLTA 2ZR9A 3T3DA 2N47A 2H4HA 2VG8A 3DTVB 1CW2B 3CTMA 3CCCA 1KJIA 2R3SA 3CUSA 4MQLA 4TXLA 3LSTA 3U4QA 4GPIB 1E59A 2ONKA 5B53A 5HZBA 2GK6A 2I99A 1X1QA 1JXAA 1HMPA 1SVUA 3SSNA 1WMAA 1KK0A 3HXMA 1Y1QA 3EXFA 2QM8A 1HDYA 4TT8A 3K0CA 5G2OA 1L7PA 1N9ZA 1KP3A 3DOFA 3ZXYA 1ZCAA 1DRJA 1QLJA 4DN6A 3ANYB 3HCEA 2B34A 4JT8A 2BEJA 5KAPA 3SBDA 4DC9A 5KOJA 4NCAA 3R9XA 3BG5A 2CMGA 1U1FA 3RRJA 4H3HB 2YUTA 4WKGA 5CU7A 4ZTUB 1E2QA 5IJXA 1ESDA 1FDIA 3HRKA 1I80A 1RLIA 1X70A 4RZQA 1ML4A 1FFGA 3K5IA 1W0CA 4LJ9A 5H9VA 2CFTA 1SXJD 1V5VA 2JJ1A 2XAAA 2VUUA 3L4BA 3WIBA 3FDZB 4D02A 1DBWA 2HV8A 3DAPA 2Y99A 1CZLA 2AXPA 3VAZA 4E03A 1XEXA 4WIAA 1TUEA 2HOQA 3V5NA 3TINA 3T3EA 1H2HA 3D6MA 4PLZA 1VMAA 2AF3C 2QUBA 5FWXA 5G40A 5GJVC 3VR5A 4CUZA 1EH5A 4EG3A 4YAIA 1ZC3A 2WWFA 4JVSB 4AZ3A 1XZEA 4YI5A 2OILA 2WUFA 4FINA 5JAIA 2I2XB 1NJ5A 3B8EA 3H4IA 5LR6A 3Q15C 1E58A 1M1UA 2PNFA 3IERA 4Q0MA 1EG7A 3OECA 3TNJA 5KWEA 2UYCA 3SF8B 2B3TA 2KLBA 3OG9A 1QHIA 4IIUA 4O33A 3TTYA 4GF5A 2BTEA 1FJHA 4LF5B 3EGXB 4J3NA 3H94A 4QO8A 2W71A 3NP9A 4F72A 2PIDA 2IUFA 2TMKA 3AKZA 4EJ6A 3OTIA 1DKPA 4U6SA 1E7SA 4DZTA 3K2IA 3SXPA 4F1JA 1S2GA 2GN0A 3RWMB 4N9WA 1SQ6A 1YE8A 3SZUA 2IZ5A 4BZZA 3O1JC 3DKRA 4HQFA 1U9IC 2B7BA 3LUCA 1K06A 2Z2KA 5K3SA 3T7TA 2UXDB 4BB6A 1JLHA 5LLTA 1Y8RA 3OJCA 3O74A 1AUQA 2PX4A 1SHKA 1Z56C 1UFKA 3VGJA 4B40A 2NO5A 2XVYA 4H2DA 2AD5A 2XCQA 4MQBA 1PZGA 5BV1A 1PVOA 3SCZA 4EK9A 1GDHA 2J45A 3F4KA 4HZUB 1QAOA 2FEAA 2RSLA 3A06A 3KFLA 2ZDHA 2V8OA 4A6XA 2B8TA 3KT8A 5LB2A 5CAEB 3ZI4A 5COBA 4ZEMA 4G0YA 1Q9SA 1GVNB 1H2AS 4OG2A 1BEEA 2WJPA 4IZ6A 4YLEA 2W11A 4HNTA 2R8XA 2FWJA 3TVTA 3W78A 4IAOA 1M34A 2E1RA 2BF4A 3D81A 3LT1A 4NNPA 3X44A 3RIMA 4Z1OA 1MO5A 3RHFA 4DIKA 3F5MA 4QQNA 2PKCA 1JHRA 3DYBA 1B6GA 2UVPB 3PD1A 1JQEA 4FFSA 1FUIA 1TW3A 3BK7A 3C14C 4EF4A 3NUGA 1ECLA 3CNQS 4QSMA 4JCCA 1JDBC 4WUTA 2V96A 4F9EA 4JL6A 3R76A 3MA0A 2FK8A 5KQGA 3P1JA 1BMQA 4WKCA 4TMWA 1K73D 3W0LB 2WQ7A 1NNEA 4G5SA 1T4CB 1E3WB 3HG7A 3IRUA 4RE5A 4PGOA 4Q4HB 3HBAA 1XVIA 4LYDA 5TXGA 1NYRA 1H23A 4NJEB 4G5YA 1Z8HA 2Y0PA 3P8ZA 3VOAA 4M0PA 3ZJUA 2BFMA 4X1IB 4XX0A 2AFHB 2G82A 2FY8A 2YZMA 3IMEA 3NKFA 2WD8A 1UEXC 2AN5A 3BRWA 1JTFA 5FUQA 2LR0A 3RFXA 2FQYA 3GOHA 2PIAA 1VJRA 5ILOA 3BGIA 1UJBA 2FZKA 3PXDA 4EKIA 2RJ3A 1R00A 4BY9E 4B6QA 4PWZA 2DFPA 1PT7A 3RRFA 1E4YA 4UBNA 5A5EA 5KX5F 1YD7A 1GPMA 4R4JA 3BMQA 3R0IA 2GEJA 2H1FA 1NF2A 3A6JA 2FWMX 4NYMQ 5FUYA 4LJ8A 3I9KA 4EA9A 4CETA 3S1AA 1X2BA 3MWDB 1E1DA 3D9QX 4O4HF 4YJFB 5JJKA 1J39A 1LJ8A 2A9JA 3NAQA 1U7HA 2A5LA 2PZJA 5FO1A 4AQDA 2XW6A 3FTQA 3CLUD 5JAMA 1Z8NA 4GWGA 3OZBA 1CZNA 4NU8X 3E84A 4D9FA 3QE4A 2AWNA 1N8SA 2QTBA 3FVQA 2QRUA 3R24A 3CCMB 1BVUA 2BLLA 2P5YA 2WHEA 1VL1A 3M4NA 4LVNA 1YBHA 4OU5A 3U1TA 5IEBA 4AO7A 1H22A 2GNAA 5DBOA 3RS0A 5LP6C 2ZIUB 2XUDA 4RXTA 2GBCA 4DLKA 2YFKA 4UVDA 2YBDA 3WGYA 4AG5A 4UDXX 4MA4A 3I6BA 4MQFA 3WI7A 5F3RA 3HLKA 3FJ1A 3E35A 3FRIA 4GT1A 5DK6A 2ZI9A 3PKIA 5BN5B 2YY7A 4QO7A 3MUFA 1EI9A 1KSJA 2ZJZA 3JSXA 4L15A 2HJGA 5MN6A 2R9VA 1OZHA 5ILGA 3BXOA 2BFFB 2D2IA 4WXRA 1Q14A 4CTNA 3U7HB 1DTWA 3NAZA 1PJSA 5DEIA 4K05A 3GDFA 1JE1A 4H7IA 1V8FA 4PQEA 3VFDA 3A1UA 1M2HA 5AJWA 3I45A 1U0LA 2I2WA 3H83A 2VZEA 3FDFA 2VQ3A 1O77A 4MIYA 4NBNA 5IC6A 3V4SA 4F5WA 1KMHA 2LXNA 2EU8A 3WRYC 4CCWA 5J4KA 4DB2A 4MV3A 1XZJA 1PSDA 1LK0A 3GT4A 4OQDA 1B3RA 1EWRA 3AX6A 3OBIA 2QZSA 2C98A 1WW2A 3RTGA 3U31A 1T8SA 4OBEA 4GPAA 3TE7A 1JBQA 1LV8A 2J3QA 1TQ4A 1CUBA 2Y76A 2ZZFA 4QARA 4OHBA 2AIRA 4FEGA 3FCAA 1Y3DE 5F1PA 1N6LA 4LJAA 4TV9A 3WBFA 2ZIAA 1D2EA 2PFSA 1RMYA 3CCSB 3WY9A 5KNCA 1HA3A 5JO9A 5CB0A 1PZXA 4JU8A 1QZTA 2QSJA 3KC2A 3RABA 3AJ8A 3LNTA 4N7RA 3PC4A 2NO9A 3GLHE 5HCIA 5C51B 1QIKA 2H16A 1JQ5A 2ONZA 3ZNPA 4RV5A 3GXBA 5A89A 1G64A 2R62A 3LQFA 3QOWA 5D2CA 4LF7B 3F6EX 1SD2A 1Z0ZA 4Q4JB 1PBNA 3MFQA 4QU8A 5KHAA 2E4WA 2JD1A 3ELYA 5DGHA 3NAGA 2CLCX 1NQVA 1N1EA 3O3OB 4I2VA 2OCAA 3ZEAA 4BNIA 4YR9A 3HK2A 3NIWA 5C8YF 3DOJA 5BW6B 5A6SA 3S2ZA 4AULA 1WP6A 1E3TA 3SZMA 5D7BA 3DMNA 1CY1A 2A0UA 2FSHA 4BE7B 2VHJA 5AI6A 4DIUA 3BZUA 2ORIA 2YVUA 2PV7A 4UZEA 1ADYA 3DF7A 2C8LA 1E8NA 1MH9A 2F7SA 2G8NA 4L0CA 4LIPD 1D07A 4NDAA 2EX0A 1E4VA 1UMDB 1I18A 3N8HA 4HY3A 4J0EA 4IMJB 4L75A 4X92A 3U9SA 4AMUA 1RJGA 5K8CA 2XXAB 4HTFB 1H9AA 1JQJC 1K3FA 1KQOA 4KVFA 4F3KA 2JH8A 5GWXA 2B3DA 1ZJZA 5L7YA 3TIXB 4KUEA 1PG0A 2OYSA 1TTPB 4E21A 1FX1A 3VH4A 1FOEB 1CZHA 4ZU3A 1DBRA 5KSWB 1T5DX 4E2ZA 5IX8A 1VQMB 3L1UA 5LKRA 2ZQZA 1AUOA 2IBSA 4IDAA 3IAHA 4MVXA 4UU8A 3BH0A 4V24A 5B3JA 4NONA 3VU1A 3C7DB 2DX7A 2P9BA 2X1MA 4X1YA 4MV6A 2C04A 2VSXA 2WWHA 1PJQA 4IEEA 3VISA 1BHSA 4KAXA 2RGDA 3SHWA 2F9FA 1B23P 4N7BA 4UPDA 3TR6A 2J9RA 1ADBA 3VNVA 1E1CB 2CEAA 1QE0A 5F76A 5KYYA 2C00A 4ABTA 1JMVA 1O2DA 2AW5A 4EUHA 4M1MA 1GIAA 1E20A 1MOZA 1GOTA 1TAHA 1EVJA 5KW9A 1VKOA 1GD1O 4WCDA 3RT1A 2ZYUX 3U4GA 3IKJA 1UWVA 2IIPA 3A7EA 3BIFA 3E4CA 3EIUA 4F2WA 3QMVA 5JMWA 1AQ6A 5BN3B 5BOVA 1CQXA 3BZBA 1IZ8A 3PFHA 5GMOA 4DQDA 3TRHA 2ATIA 3WOHA 3AG6A 3CVOA 3BHNA 4IIFA 3G2IA 5D01A 3GZJA 4ZAXA 4ALNA 2Q3CA 4EFMA 3WNCA 3KQKA 1XZQA 1GTJ1 4ZVSA 1I1NA 1MZVA 4IHAA 4NAHA 2PZLA 1VRWA 3GYBA 3S2GA 3NT5A 5F21A 5EKUA 3ZZMA 4MDYA 3V33A 1FMTA 2FPKA 1HEIA 1NRJB 1RAAA 4BTVA 3CUWA 1PR1A 3MINA 4W5HA 2C2BA 2QMHA 3KJIA 3L8EA 4HAWA 3Q11A 3O5AA 3AEUB 1FRNA 4ZPXA 4Z4VA 4MR7B 4BKRA 3I64A 2VBSA 2JZNA 1BPLA 1N6RA 1J06A 2B4RO 3IT0A 4UU7A 4W1RA 3UWSA 3PGJA 3K4HA 4FILA 1VL0A 4KLZA 2HADA 4J7AA 3HXOA 2ON6A 1RQ2A 2XDAA 3EQ7A 4IJKA 1U3UA 4UUAA 1SR8A 5FBHA 4L9RA 2J0QA 2VRNA 3QF7A 3LKZA 2V7XA 4XCQA 5TRTA 1NF8A 1ZPDA 1C3OA 3KPUA 3M9LA 4V1CI 5CT9A 3UAWA 2QUHA 4LQCA 4YHBA 3FNRA 4XIFA 4DNRB 1B6SA 3B48A 4QREA 2YASA 2D7JA 3F78A 2WDPA 2ZWOA 1ZNYA 3JARB 3QPVA 4D1YA 2Z58A 4H7KA 4N5DA 2OBFA 3TRJA 4PLTA 3O91A 4Z5XA 4HEA6 1RRGA 3IMCA 1T2UA 3MMPA 2EW8A 2BM1A 4WKBA 4N9QA 1CJTC 3DDSA 2FE1A 1J5PA 2HBYA 3BWBA 4NE7A 4PPFA 5BOSB 3E1SA 3QA9A 3WWDA 4CMJA 1XD2A 2ZJ0A 4S1NA 2AI1A 2W6JD 1X1EA 4RJKA 1ZH2A 5D51S 4KVAA 1H1DA 3U3ZA 2DPYA 5EOVA 2PBRA 1WDMA 4J0DA 4PLCA 4MW7A 2CL6X 3EZLA 2H4FA 4ICIA 4F6RB 2BP7A 3RHTA 1JSXA 3H8JA 4TLAA 2QMEA 2IHUA 4YXWD 2GILA 4XWWA 1X39A 5J2UF 1ZISA 3L1KA 3R7NA 3GUUA 3PRHA 4OHXA 1DPGA 1SBQA 2H0QA 2BSAA 1J07A 2PX6A 2WPNA 2PH7A 3LIPA 2HLHA 3A8IA 4N3BA 2BTOA 4CM4A 3ZDXB 2X8JB 1RD4A 5ICCA 3DE7X 1H93A 1NMEA 2PUCA 5HIAA 1MKYA 4WY5A 4C4RA 2BKEA 1V47A 5EZ5A 1DT3A 2OCXA 3G0BA 1A72A 2AXQA 3X1ZA 2E5FA 1GM5A 1NBME 4UUPA 1U0TA 5FL3A 1XQVA 1ZU4A 4IIXA 3FPKA 1MV8A 4RMJA 3CCJB 2EBHX 4FNOA 2WYOA 1OYYA 1Z63A 4Q15A 1QAQA 2XYHA 3IUPA 4JYMA 4BVLA 4BPBA 5L8VA 4BX9A 4Q3NA 2PSFA 2GARA 2PZ8A 3O8CA 2X9QA 1A4UA 3AI7A 2HBZA 4I6EA 3H2KA 4KQIA 2QLJA 4OYHA 3OP1A 3MCVA 4ZRNA 3HJAA 2GD2A 1ATIA 3KXPA 2ZBQA 3TIFA 2KWIA 4PQRA 5JT1A 4D3YA 4E51A 1UM9B 2IC5A 2R8ZA 4IDFA 5CPBA 2NPIA 4N41A 4P22A 1VKNA 5EXTA 2ETVA 3FDIA 3IILA 4CKCB 3R9IA 3UMBA 4FHCA 1L5OA 5IEJA 2OZKA 3I4CA 5K8JB 1ENPA 1YI8A 4R1UA 5ALPA 3FTCA 4WNIA 2BC9A 2OOSA 4GSYA 4F5YA 8ABPA 1MN6A 1I2MA 1PW7A 1WWKA 2V98A 2E4YA 2QAGB 1PGPA 2WKRA 3D7MA 3JQFA 4Q3DA 2CV0A 3LPMA 2HHHB 4EHHA 3OOCA 1JEQA 1WY5A 3GMIA 4BO6A 1MPXA 4Z3OA 4LF8B 4IO1A 3LC2O 2EATA 3C87A 4NV0A 2X85A 1DQSA 3ZBUA 1N2HA 1QP4A 2VTBB 4ECEA 5ESDA 1NUSA 3KOMA 4FFOA 1MC5A 2CUKA 2FPUA 1YJWB 2V5UA 1FU7A 3N2EA 2ADOA 3I6YA 2V4DA 3N2GB 5SYNA 3RTDA 3MGAA 3W8FA 2Z6UA 4MKHA 2F90A 3KQOA 2JZCA 4HDKB 1WDKA 3Q4GA 4GL2A 3TLXA 1NVEA 1TRKA 4GMGA 5KQLA 3A37A 3QPCA 2FRDC 3VR4H 5EMLA 4HR7A 4DLPA 3ABQB 1QS0B 4ZI5A 2HAEA 4TN1A 1QGDA 2XDQA 3CN7A 3BJRA 3G2KA 5CP8A 4AJKA 4Z54A 3Q8MA 2Y71A 4JC5A 4PTYA 2ZIXA 1J6UA 2V7GA 3P4UA 1VE9A 1S9DA 3FPLA 3WWZA 4MO9A 3RFCA 1NBOA 4X8IA 1XPRA 4K1XA 2XEXA 3OC0A 1IEQA 1MB2A 4X7EA 3GYGA 2Y1WA 1G2PA 1PNQA 1VQNB 4TZKA 4KKUA 2HSGA 2FMXA 2V1XA 2R5WA 3AVQA 3EXAA 3FTNA 2BR3A 3HY4A 4HN4B 3GJYA 3OI7A 3OPYB 4GECA 1D8AA 1GL3A 2YN4A 2IW1A 3ICPA 4MB2A 3TAXA 1G8YA 1W49A 1YC2A 1W94A 1NN5A 1UJ4A 4EG4A 1LA2A 2J3LA 5ADUS 2XQFA 2Y2VA 4AY3A 5ALWA 1Y6FA 4IR7A 5H4HA 1R0SA 3R7AA 2HSDA 4OI2A 2AG5A 2FKAA 4BWVA 1DJQA 3QLJA 1BZYA 1C29B 3LBNA 2Q4RA 2J3HA 1QF9A 4KGXA 1R10A 3TZQA 2XRZA 1ML3A 3PHIA 2OBBA 3TQCA 3QX3A 3JAWA 3PR3A 2CNLA 3PPWA 2C9OA 4JX8A 4W6ZA 3WHLA 2XSZD 4YLYA 1KTIA 4TX1A 4MA0A 1T15A 4FFWA 4V3BA 3EXG2 1SEPA 4V0KA 4K9LA 4MW0A 4B3XA 1IN8A 4DRXA 4ZD6A 3RARA 6CHYA 4D45A 1V16B 1QKJA 2GZDA 5BNIA 2V9CA 1ITZA 4IQ8A 5AUPB 1A9QA 1RM4A 2PVSA 5C4IA 4BVFA 1J2YA 2XMCA 5DVZA 4U7WA 1B41A 5AK5A 1MLDA 2F17A 2ZUSA 1VM6A 1F8UA 1I5RA 1UD8A 1Z34A 4RHYA 3JW8A 4LYGA 2DC1A 4JUBA 2JDIA 1F9AA 2WVAA 1H65A 2RIPA 2O4CA 4JK3A 4PPYA 3WK7A 4EW2A 2PKXA 1Z6XA 1B0PA 3KR0A 1GCOA 1GL9B 3AR6A 3QVVA 5IJ9A 2YN2A 4FUTA 5HM6A 1FFCA 1J8FA 1PBTA 2IDMA 4BNTA 4CTOA 2QRVA 3RIGA 3KQQA 3W5JA 3N8KA 1L5GB 3V8RA 1FNNA 1G20B 2QRGA 4UULA 5T3YA 2Q1UA 2X6TA 3WP1B 4AYWA 3H5TA 5AJUA 3AF5A 4KGVA 2ABWA 5KNBH 1KY3A 1WVMA 2HDWA 5GGYA 1MD9A 3OX3A 4QOGA 3OH8A 1RI1A 2M6RA 4R1SA 2H0AA 5GIOE 2VNSA 2ZAYA 1SCQA 2M98A 2NADA 1KDPA 2QRZA 5E1OA 1FMLA 4K87A 4B6OA 4JMQA 1WXDA 2XNJA 3MT0A 3ZVKA 1A5ZA 4J1QA 1U2ZA 3EISA 1JIKA 2WVGA 1CEEA 1VJ1A 2PMWB 2V6FA 5FEUA 1R0WA 1XAIA 4OOEA 4F4JA 1YV9A 1GGKA 1C0EA 3AUKA 3E0XA 2HNKA 4Q7EA 5K2OA 1B8OA 4LMPA 4Q7MB 1RZRD 1RM0A 2ILTA 3BAFA 2DT8A 2OYNA 2A5YB 3EUEA 4YRTA 3HBLA 3U4QB 2ZFUA 2EGHA 3I8XA 4LYYA 2M6KA 3I09A 2G08A 2DECA 3U3MA 2HCJB 1PS8A 3HACA 5B2ZA 1KIFA 5LLSA 1AHIA 1VLJA 5LQRA 1K92A 3OQPA 4B7UA 2WFAA 4MVJA 1U9CA 4EGFA 1XMVA 3GD7A 2GUWA 4P3XA 1QB8A 1U0OC 3QKWA 4JI6B 2VP0A 2OO3A 3PRYA 3NIDB 2GRJA 5TPWA 1QBKC 2ACWA 2VJAA 4MAFA 3DT9A 5FCDA 5KOJB 1RMQA 1EDZA 2C4NA 2JFHA 4XQCA 4TQUS 3UJ3X 3RJZA 4KOAA 1YOBA 1OXTA 5AM1A 3UT0A 2C1EA 4GOKA 4JDPA 4KH0A 2ONJA 4QFMA 2HLNA 1ECGA 3P5BA 1VKRA 1GZSA 1WO8A 2Z1MA 1DQNA 1ODLA 1PJLA 2CF5A 3U5ZB 1Y3HA 2X0FA 5HWSA 1P7YA 3BF8A 5FPHA 2AXEA 5B37A 3QWBA 4U7JA 1PNRA 4YUWA 4HN2A 1JKIA 3QNMA 5FOXA 1IN7A 3C3EA 2P6RA 4M53A 4JI1B 5FWXB 1S89A 1K2WA 3GEDA 1HEYA 2ODAA 2WWYA 2H2FA 2EQ5A 2V5AA 4ONEA 1C3LA 5DCLA 1GGVA 1R1DA 1GG5A 1Z6QA 3MBKA 2ZS8A 2GZRA 4XB2A 1W5FA 3V8EA 5JCJD 2PMCA 4RSGA 1JYEA 1SRRA 7AT1A 3D7RA 4XLLA 1GTVA 5IBRA 4O2AF 5KINB 4BO2A 1U5CA 2A67A 3AL3A 1N57A 3SVTA 2DU8A 2ZU6A 3G89A 2IW3A 3ITEA 3GN2A 5NLLA 2AMYA 3H5VA 3PC8C 3W5HA 1RRPA 4GIBA 4DW8A 3PNBA 4OFWA 4G1FA 1K9SA 4RMHA 3TRFA 4B3BA 1J1UA 13PKA 4PRLA 2UUAB 1N78A 4R9SA 3SYTA 5JUWA 1W30A 4X7PA 5B5SA 4IILA 4QODA 4DKJA 1C8KA 1NJGA 4RZ3A 1Y8RB 4HAVA 1JSZA 3A6PC 2X15A 3N8GA 3T5GA 4KNYA 1OX5A 2ARKA 1Y7PA 5ALTA 4A5OA 9LDTA 1UF9A 4PHTA 4BFSA 1H0SA 4UPEA 3IEMA 2C61A 4OD0A 4KQJA 2DPXA 4WZZA 3P9IA 3TQTA 3VDRA 8AT1A 4ASUD 4RSHA 1YI2B 4AO6A 3R8XA 4M9ZA 3W4KA 2NO7A 4LXIA 4TKMA 1NX9A 3TKAA 4EGQA 4JI0B 3B3QA 4YH1A 4EENA 1ORIA 2WNSA 6REQA 2FDCA 5CVJA 3B78A 1N6HA 3ZZ1A 1M34B 1ZI8A 4X45A 2AMFA 2XA2A 1OB2A 3RC7A 2C5BA 3IEVA 4UHCA 1ZEMA 4C0BA 2DHEA 1T8RA 4Q9NA 3FHCB 4RENA 1ZCFA 1TVCA 5EQJB 2D8AA 4DLYA 1XRJA 3QFRA 2NU6A 3DCJA 3KBOA 4IXNA 1BSVA 4JITA 4ZQCB 1E9FA 1YRLA 2GTPA 3U4HA 4XWYA 4MYUA 2FZCA 1JDVA 4QUDA 3CRZA 1SBTA 5BYKA 2XCLA 4LFAB 3INRA 1U3FA 4FSHA 3KYCA 2DLNA 2IGBA 2FB9A 1LPMA 2MR6A 4LJYA 2XAUA 1T34A 3P2EA 1CDDA 1R6VA 3K20A 4R1PA 4Z49A 3NKLA 4FNGA 3GMTA 3Q7RA 4K9NA 4R3NA 5CDYA 1EXVA 3U7EB 2GSWA 3F7MA 1DFGA 1NF3A 5JPCA 2IYQA 3AY6A 3U3JA 4GZ6A 1OGIA 1QVAA 3GEMA 3V4OA 4GDFA 5JCZA 4LC1A 3AI3A 2E85A 1GRNA 3LRXA 1SUSA 4BQRA 1BOFA 2HCTA 4PS0A 4X7MA 4OXNA 4RACA 1X38A 2P3QA 3PDWA 3AKYA 4IIGA 3AP1A 4RVSA 5GOTA 4DDTA 3UMSA 3FWZA 1EWTA 1EA5A 1TAUA 3R3ZA 2WM2A 3HRHA 1N2OA 3D2BA 2P6OA 2LCIA 3DSRA 5LWQA 3TAHA 3E61A 2F59A 2GQ0A 4K9RA 2RKBA 4Z4ZA 2WHQA 3BMQB 5EJ8A 2Z04A 1U9IA 4HFRA 3VH1A 1OWLA 4GI2A 2HFKA 1QCYA 1BQ4A 1P0CA 4PFQA 3S1AB 2O2XA 1JR6A 1I6LA 3JWJA 1EEXB 3MLAA 5BN1A 1WBBA 4PRZA 2X0IA 2HI0A 2VLBA 3CISA 3FUUA 4R69A 4B6RA 5IDWA 1U0BB 2R6CA 2CD9A 3PF9A 4HWSA 5A0TA 4N6NA 2BM8A 5CD9A 1CY0A 2XTMA 3M6IA 2WD7A 3EOAI 2JEYA 5EUBA 4BO5A 4XM3A 4KKTA 4O4LF 3QZUA 4P98A 1AGNA 1L1EA 4QHTA 1CVRA 2YVAA 4RCZA 2IBMA 3HCNA 1EKXA 4OAOA 5HKOA 4LBVA 4KQFA 4LV6A 4LV5B 5LZ7A 5BRNA 3FCOA 3SM9A 1EZ4A 5E1DA 1JGTA 3BB1A 4MQFB 1NTOA 4KE9A 3A6LA 3R6KA 3TQHA 2ZRMA 4KJXA 5F98A 1P72A 3DXZA 3PCTA 3QW4B 3NALA 3NB0A 3VTZA 2K4MA 4B8WA 3ACDA 5AUNB 1GPDG 3PUJA 2O2YA 3A9CA 3KQUA 2YYYA 4PO3X 5HA5A 2JGLA 4X95A 4YRNA 1DARA 1F0KA 2H1IA 5E4TA 4B9EA