4UZUA

Three-dimensional structure of a variant `termamyl-like' geobacillus stearothermophilus alpha-amylase at 1.9 a resolution
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
479
structure length
479
Chain Sequence
b'FNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGTVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGKAWDWEVDTEFGNYDYLMYADLDMDHPEVVTELKNWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYITKTDGTMSLFDAPLHNKFYTASKSGGAFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGGTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
molecule tags Hydrolase
source organism Geobacillus stearothermophilus
publication title Three-Dimensional Structure of a Variant `Termamyl-Like' Geobacillus Stearothermophilus Alpha-Amylase at 1.9 A Resolution
pubmed doi rcsb
total genus 182
structure length 479
sequence length 479
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4uzuA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uzuA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uzuA01
1O7DC 2GDVA 3AMKA 1E6XM 3WF2A 1UYQA 4NRRA 2DT1A 4AISA 3N12A 1ESWA 3CLWA 4GZJA 2X1IA 4M81A 4AD1A 1TQSA 2A3CA 2VX6A 3O6AA 1JD7A 3SEPA 4AZHA 3KZSA 5CPQA 1W91A 3VD7A 3A4XA 1UR8A 1UWRA 1VEPA 4Z2LA 2Y8KA 3CBWA 4AZCA 1J0HA 4PSPA 3ARPA 3CZNA 1XHGA 3CMJA 4GKLA 3WUFA 1C92A 5A6JA 3D4YA 2CPUA 3DECA 1Y7VA 1W2PA 1HTYA 4W93A 3MANA 4H04A 4W87A 2IGTA 1TVNA 3EDKA 5CXPA 3PZNA 4P7OA 2BY1A 1V6WA 3PZOA 2XFFA 2RGLA 2A3EA 3N13A 1EDGA 3PN8A 2YIHA 4NX0A 2E9MA 3GNOA 1MFUA 1E3ZA 4U5IA 3IJ9A 3NDZA 2EEXA 3GXDA 1J10A 2BHZA 1BGAA 5E0FA 2BVTA 2JE8A 4AIEA 3EDDA 3AOFA 3T0BA 3ZIZA 3KE0A 1JZ5A 1LG1A 1OT2A 2JEPA 1LL7A 3W37A 3H54A 4S3JA 2PBGA 1UWQA 4DM1A 2UY4A 1ITXA 1W3JA 1X6NA 4DUWA 3LRKA 2YDQA 3S6TA 1MVYA 1JNEA 1WCGA 3VNZA 3HN3A 4AIUA 2GJXA 4BQ2A 1D2KA 2VRQA 4U31A 3ZSSA 1KTCA 1H41A 3D3AA 1L0PA 1MW3A 3SUWA 3VKKA 1EQCA 2VC9A 1AQHA 5I3DA 3BC9A 1Q6GA 4WIWA 4FLRA 2D3LA 3MS8A 1VFMA 1E43A 1SR0A 3W53A 5CGMA 1WAWA 3K4DA 2YL5A 1MXDA 1PS3A 3NYDA 3CHFA 5KEZA 5JIWA 3RILA 3BAYA 4NZFA 1FOBA 1WZLA 1GVIA 4UZSA 4Q22A 4MJ4A 2JF7A 2D22A 1H5VA 2UY5A 2PWGA 4HA4A 3VGBA 1E71M 4ML4A 5LYRA 1UH2A 1B3XA 1NOWA 3VM5A 4TX6A 4CD6A 1B2YA 1H09A 1CGYA 1OWQA 1UR0A 4BCEA 3W25A 4UTFA 3ALGA 2QMJA 2ZUTA 4HOWA 3ZOAA 5GQBA 4ZXOA 3WY4A 3U57A 3BAWA 1NWRA 1ISWA 1DWGM 4AZ5A 3T08A 2ZWZA 1UWTA 2DIEA 2X0HA 1W9UA 1CEOA 1UOKA 1M04A 5AYIA 4V27A 1OT1A 3K8MA 2WMJA 2WMIB 2BHYA 4ZE4A 4JFTA 1OSEA 4FNRA 3IANA 2G4FA 2XPKA 1FFRA 5IFPA 4KRTA 5DFAA 1UD2A 4E2OA 1B3WA 4GI6A 2XSBA 3GXFA 5IXEA 4JL1A 1CXKA 5A8NA 1DWIM 4PYSA 1CGXA 1KXTA 1A3HA 1UA3A 3CV5A 4U5KA 1UKSA 5A8MA 2C8NA 1H0GA 1MW2A 1UG6A 4AD4A 1R46A 4GO8A 1OIMA 1ZU8A 3J7HA 1O6IA 1NP2A 3TTYA 1G5AA 1OB0A 2VTFA 2ZX5A 1EDTA 4J7RA 3VD5A 3BVXA 4CCDA 1J11A 3ZJKA 1BG4A 4JFUA 4D6FA 1GHRA 3M6DA 4UOJA 3T2PA 3W24A 1W9BM 2W63A 4AY1A 5HPOA 3BH4A 3PZQA 1M03A 3WBEA 2AOSA 1OD0A 5LA1A 4MB5A 1MQPA 1KCKA 1K9EA 1WZKA 2YA0A 1NARA 5I24A 3GXMA 2AMGA 1XYZA 5C70A 2F1AA 1VFOA 1LL4A 4PTMA 1HT6A 2WLYA 3TTSA 2VQTA 4HA3A 5FOOA 3A23A 3POHA 4F66A 1GNXA 1R7AA 5BRPA 3PTQA 2ZUSA 1DWAM 1MQRA 3QR3A 1V6UA 1PPIA 1KBKA 3VSUA 3NSXA 3L4XA 3EBVA 4AD5A 4ZENA 2J7CA 3WDPP 3AHTA 1EA9C 7A3HA 3VDBA 5A2BA 1H1NA 3FAWA 2VZUA 3CZKA 4P8VA 4JFVA 2GSJA 3DX2A 3AHXA 2PWFA 3BLPX 4QFUA 4RE3A 1E6ZA 3U5YA 3WEOA 1UA7A 1KBBA 1QHOA 2XWDA 2XG9A 1K9DA 3DYMA 3BLBA 4JKLA 2CETA 2WPGA 4YHEA 3PZ9A 1E4NA 2WWDA 2CBJA 1RH9A 4X0VA 1UD4A 3VMOA 2VR5A 1NQ6A 4AXNA 3LPFA 4H41A 1PX3A 4MAVA 4PUEA 1HL8A 1B3ZA 2QPUA 4AMWA 3VIMA 3N1AA 2DH3A 5A94A 1V02A 3MO4A 1PJ9A 1VFUA 3NJ3A 4HPHA 3L4VA 2X2HA 3THCA 3WY2A 3EJTA 2ALWA 3NIYA 3GH7A 4FNUA 1RPKA 1TQVA 3GXPA 4H2CA 1KXQA 1GOKA 1PX8A 4CD8A 5ABHA 3WNMA 3BAIA 1UQZA 2CCRA 3TONA 2WLZA 3BVTA 3CHEA 1CYGA 3SCRA 3EJPA 1KR1A 3L4TA 2VCCA 4PMNA 3E1F1 4MB4A 4D6EA 5DO8A 1FHLA 3BSHA 4NRSA 1JI1A 1CXIA 3GXIA 4UNIA 3U5UA 4HOZA 7CGTA 2E8YA 3BXWA 1MW0A 3AHVA 4AD0A 1H0IA 3AIEA 4WKHA 1GOQA 4MDOA 2UY3A 2PWHA 4CCCA 1KGUA 2C0HA 1CGTA 3LPPA 2OSYA 4IPNB 2QF8A 3IJ8A 1G9HA 2CKRA 2ZWYA 1ZBKA 3PZVA 1UZ1A 1E4LA 3VILA 1V02E 2J7FA 2FE0A 4XX6A 4OGZA 3T2QA 3UETA 1EOKA 4J3TA 2J77A 2E4TA 1HNYA 5CGTA 1QBBA 2O9PA 3L2LA 3VGHA 4W84A 2EJ1A 1VFFA 1KWKA 1QI4A 3K1DA 4N42A 1WDPA 1BYAA 2CHNA 4H8UA 3EMCA 5A8OA 3BUPA 5GPRA 5AYBA 2EPNA 3VDCA 2JFEX 4YN5A 4W5ZA 3L4ZA 3AS1A 2FGZA 2YL6A 1JFXA 3SCWA 3WQWA 2PBOA 1R47A 2WHLA 3MV11 1TQUA 1LQ0A 1R33A 3VSVA 2HISA 2W62A 1V3LA 4D6DA 4PMOA 1KGXA 3VNYA 3MMUA 1QNOA 2ESCA 1NOFA 3AI0A 2A3BA 2CESA 4AZIA 3N04A 3APGA 3PTKA 4CD7A 5A6BD 1WKYA 3GTNA 3VGEA 4UZUA 4PEEA 3NSMA 4JIEA 4MTVA 1KXHA 2CNCA 4D6IA 3UCQA 1UH3A 1Q4NX 3WF4A 4U3AA 4HMDA 4JZ5A 1EQPA 2J25A 4E8DA 1HX0A 1WDSA 5ABFA 3OIHA 1AQ0A 1UR2A 1QW8A 4J3SA 1XYFA 2HVMA 2W67A 3A4WA 2DT2A 5D9PA 1B0IA 1WO2A 2YBUA 3A47A 4CVWA 3B9EA 2DIJA 3UERA 4JFWA 1GZJA 2WC3A 3SUTA 1TA3A 1EO7A 3A5VA 2XN2A 3QGVA 3CO4A 3WDQA 4JL2A 4N0RA 1JGIA 2WWCA 5HPCA 2WANA 3PTMA 2WZHA 2BVDA 1XH2A 5A2AA 2YOCA 1R75A 4U3CA 4AC1X 4QCEA 1J0ZA 3SCNA 1P6WA 1OIFA 4V2XA 1C7TA 1E5JA 2BFGA 2ZOXA 5E70A 5EMYA 1WDRA 2OYLA 4JHOA 1GQJA 4PN2A 5CSUA 5E1QA 1QI3A 5EB8A 4L4PA 1J0YA 5ABGA 4RE4A 3VD9A 2YA1A 4UQCA 5I79A 5DMYA 2BY0A 4P7NA 2WC7A 1R87A 2VOTA 3VD4A 2X2JA 2J7BA 3CUJA 1C8YA 1RP8A 2QLYA 3L4WA 4PMQA 4A3YA 4X9YA 3LXBA 1QNRA 2W61A 3AS2A 1C8QA 1UR1A 3WQVA 2J74A 4PTVA 1E73M 1WP6A 2TAAA 5BWFA 4PMZA 3GXTA 4ACYA 1HJQA 1QVBA 3WEMA 3WFLA 3WH5A 2WK2A 3PZGA 4M82A 3WH8A 2CHOA 1CENA 3U7VA 2XUCA 1YQ2A 4AD2A 1JZ4A 2YBTA 5DT7A 3GYCA 4CVUA 3EJRA 3M46A 4V28A 3BUQA 1B30A 3ZMRA 2WSKA 5A6KA 4WJXA 5D9OA 3PZUA 1WNOA 2GJPA 5FL1A 2JEQA 4CKQA 1T0OA 2VNCA 5E6YA 3UG3A 1GOWA 3VINA 1GHSA 4FLSA 3AXHA 2DSUA 1IZJA 4GI8A 4PCSA 3TOPA 2YDSA 3A21A 2YL8A 1NH6A 3EMZA 2EACA 3A22A 2ZUWA 1WPCA 5HDRA 1ZJAA 3AIQA 4FNTA 2WMFA 3WBAA 3WF0A 5TD4A 1VIWA 1V6XA 4P8XA 2WVUA 1JZ3A 1ZBVA 1KFWA 2CEQA 1H3GA 5IDIA 5M17A 1TA3B 4KRUA 1GW1A 5JBFA 1OGGA 2WAGA 5BXTA 2XFRA 4JKMA 4AZ7A 3N15A 3VIKA 4RL3A 3ARRA 1JIBA 4MPKA 1NWSA 1ODZA 3SCOA 5IHRA 3II1A 4BZYA 1EXPA 2XVLA 4F9JA 2VX4A 5CG0A 1KR0A 3AJ7A 3D50A 4D1JA 4GINA 4DM2A 4UR9A 5FCZA 3NUKA 4CGTA 1R86A 3DHUA 2VCBA 4BS0A 4XZWA 3H53A 3GNRA 5BROA 4ZEPA 4NXKA 1W9DM 4PMYA 1HKJA 3ARWA 3GM8A 1RP9A 1BFNA 3WF1A 4GQQA 7TAAA 3N17A 2GDUA 1JG9A 3AICA 1UD3A 2DT3A 2V3GA 3QOKA 3IAPA 2IXUA 1J0IA 3BVWA 3DX3A 2EPLX 1US3A 3O9NA 4CN4A 1VBRA 3DDFA 1YHTA 5IFTA 3DYOA 1UH4A 4AZGA 2BY3A 1C7SA 3VUPA 3OLGA 4QDMA 2OSXA 2WHKA 3WDRA 6A3HA 2FH6A 4PTWA 1W9VA 4W8BA 1JAEA 3AIBA 1CGWA 2YFOA 1HXJA 2WM0A 4IUGA 1PAMA 2CIPA 4LYQA 3BSGA 2XIBA 4K68A 1HL9A 1F4HA 3WNKA 1B31A 2J7DA 8A3HA 2Y2WA 3JUGA 1H2JA 3K8LA 1XD1A 1I75A 2GK1A 4TVDA 1W1YA 3BMWA 3M07A 1V6YA 2OWCA 4WKAA 1E1EA 4CCEA 3AMGA 2GJXB 2BS9A 3RMEA 1HIZA 2XJ7A 5A3HA 3CUHA 3EJQA 1V08A 2E40A 3AMDA 1ISYA 1HXKA 5EFFA 1H11A 4OOUA 3BGAA 2DEPA 1E6PA 1CGUA 3VOCA 1E0WA 5A2CA 4P7LA 3WD1A 3MSGA 4AYSA 4W89A 2VRJA 1B3VA 1XH1A 3VDHA 3F4VA 1B3YA 3W6MA 2WVTA 4HP5A 4OKDA 2G8ZA 1VBUA 1JZ8A 1X6LA 2EO7A 3OGSA 1KXVA 1CIUA 4UCFA 1OCQA 1CXHA 1QNSA 2PF0A 2NT0A 2D0HA 2Y24A 2X2YA 2Y5EA 3OZPA 5I78A 1SFSA 1GOIA 3OA5A 1XC6A 2UY2A 1TVPA 3CTTA 3OBAA 3THDA 4B9YA 4F8XA 5FIPA 1PX4A 3QHOA 2YDRA 5GNYA 1WZMA 2PI6A 4L4OA 2Y4SA 5ECUA 1GVYA 1O7AA 3LRLA 1UKPA 1I1XA 2VX5A 1ISZA 3VIJA 1K9FA 3WL0A 1JDDA 3GBDA 4HTYA 2ZX9A 1D7FA 2YKKA 3T2OA 3VD3A 4M80A 3B9AA 2V5CA 4Z2KA 1Q6DA 2WMIA 3ARZA 5DF0A 1KB3A 2WB5A 2V5DA 3S2CA 2VI0A 2VL4A 3WL1A 5AY7A 3VDAA 4UQEA 1E6NA 4PMUA 2D3NA 3WF3A 1JYWA 5A95A 3MMDA 2W4XA 2VZTA 1J01A 3SCSA 3W4RA 5A6AA 3WELA 2VQUA 1V6VA 4M24A 4DWSA 4M8UA 2IXVA 2WBGA 3HMCA 2XWEA 1W3LA 4IM4A 1KQYA 2OWWA 4OJYA 2VZOA 2VRKA 3VSTA 3T09A 1AVAA 3WQ8A 4AYGA 2W91A 3HJEA 4HMEA 4ACZA 3A6OA 1JYXA 4PTXA 4KMQA 2D0FA 4CD5A 3FHAA 3W38A 1EHAA 4FF5A 1QHPA 2EPOA 2GK1B 2X8RA 1NM9A 5CPSA 2WMKA 2CYGA 3LX9A 2VMFA 3W29A 4QLKA 2BV9A 1JYNA 1V3KA 1H49A 3WDHA 3VMPA 1Q6EA 4MJ2A 4J3UA 4NSBA 1TR1A 3ZR5A 4JHZA 1VJZA 3B9DA 1HJXA 3HZ3A 3KLKA 5A6BA 1LWJA 2J7HA 3KL5A 3I3EA 3AS0A 3VIPA 1ISVA 1A47A 2OYKA 3FAXA 3K46A 3ALFA 3L4UA 3B8SA 4S3KA 1J0JA 3LMYA 2F7OA 1UD5A 1PZ3A 4ATWA 1SMDA 4AD3A 2GUYA 4NF7A 4J3VA 3UG4A 1CZ1A 4XUYA 3CZJA 3L2MA 3DDGA 3CZSA 6CGTA 1DWJM 2CBUA 2J7GA 1BSIA 3WH9A 3ZJ8A 4OBSA 4AW7A 3A24A 1PIFA 2XN1A 3K4AA 1UUQA 4B9ZA 4KGLA 3EDEA 1EO5A 4W7UA 5BRQA 3PZIA 3AQUA 3TP4A 1QNPA 4EAMA 1B1YA 1TQTA 3WD3A 4D6CA 3VM7A 3CZEA 5A6SA 3OLIA 4HOXA 2EPKX 4KGJA 2E9LA 4LX4A 3CMGA 1OM0A 3GNPA 4ATDA 4HU8A 3WMSA 1CTNA 4MNLA 2JIEA 1C93A 3RM4A 3WUGA 1VENA 2XM2A 4W8AA 2YFNA 4TX8A 1E1FA 3BCFA 1EIBA 4D72A 4Z2HA 1UD6A 3AYRA 5I2UA 1QPKA 3VGDA 2D24A 3O2LA 5I23A 4BQ3A 5A1AA 4EANA 4B3KA 2XVKA 3GXNA 3WY3A 4FLQA 1MWOA 2VZSA 1TUXA 3FN9A 4DWSB 1XSKA 1E0VA 2ZIDA 4X0NA 3ARSA 1QI5A 2XVGA 4GIAA 1QBAA 1HKMA 3LPOA 5JBDA 1HF6A 4QAWA 2E3ZA 5CLWA 1JAKA 2WZIA 4D6JA 2J79A 3SCTA 2GFTA 2F1BA 2EQDA 2WSPA 3HG3A 1LF1A 3ARUA 2J75A 1ZL1A 4BQ4A 1MW1A 1GUVA 1W2VA 3ZJ7A 1UWUA 3OLEA 1U33A 1LLOA 1UQYA 3WFZA 1BLIA 3EMQA 4URIA 3BUBA 2WXDM 1SZNA 4GXPA 3AROA 1JFHA 4D71A 5HBFA 3KWXA 4IISA 1XH0A 3AMLA 2WMGA 4P7QA 5CPTA 5BYWA 1QHZA 4C7GA 3SCQA 1BHGA 3MMWA 1WZAA 1DWHM 1R8LA 2OW7A 2D2OA 4CN1A 5D8WA 1W3HA 4DO6A 1CXFA 4PBGA 2EBNA 3VGFA 1JZ2A 1V0KA 1CNVA 4LPCA 1M7XA 1UKTA 4ZFMA 2F7QA 2D20A 3HG4A 3EYPA 3VX0A 2C7FA 1E6RA 1BYCA 1JYVA 4JCMA 4WSKA 4F9DA 1CDGA 1G94A 2GJRA 2CXGA 3SUVA 3BMVA 1W1VA 4AEFA 4M29A 2XM1A 1UWSA 4UFJA 4NZCA 5CZKA 2DSZA 3F5KA 1J18A 3GBEA 1E6QM 2O92A 2ZX6A 3BAKA 4GQRA 3WNLA 2VVNA 3WQ6A 4Z2GA 4TXEA 3BLKA 4DWSD 3FY1A 2PB1A 2VJXA 3RJYA 4A4AA 2FHFA 1J9YA 1CLVA 1V3HA 3AIVA 3W0KA 5JUVA 2D1ZA 4P7RA 3MKKA 3ZQ9A 4JAWA 1B9ZA 4F79A 2YL9A 2F7PA 1GPFA 1BTCA 4BA0A 1NWUA 2FH8A 2WHMA 3U7BA 3OZOA 1UASA 3OB8A 5FL0A 1GOMA 3FW6A 5E0CA 2J78A 3DX1A 4AWEA 4QLLA 1EHNA 1BAGA 1WDQA 5C71A 1SMAA 1TG7A 1XD0A 3VX1A 5ABFB 5IHSA 3AIRA 1QWNA 4B16A 2CBIA 4FK9A 2WZEA 4EK7A 4JFSA 4WK9A 1HWWA 1WE5A 4OBRA 2A3AA 2BXYA 2DQXA 4LYRA 1F4AA 3MUAA 3W26A 2BXZA 3S5YA 3T0DA 2QMKA 4LQ1A 4H8HA 3AYSA 3L4YA 3FNDA 4IPLA 5A6LA 3WUBA 3FXYA 2WVVA 1M53A 1ECEA 1C8XA 2V3FA 5E9AA 3CC1A 5EBAA 3WNPA 1GONA 2V38A 4UFIA 3ZO9A 5BXRA 2W92A 3OGVA 4ZXLA 5LA2A 3VO0A 1EOMA 1W1PA 3UESA 1RD6A 4DWSC 2E8ZA 2AAAA 2WW5A 3WIJA 3SCVA 1CGVA 2WCAA 1LL6A 2CERA 1TCMA 3AIUA 2F61A 2XGIA 1E55A 2Y8VA 4D6GA 3VIOA 3QHNA 3D51A 4E4PA 3PHAA 1J12A 4OOZA 2G3JA 3HG5A 3BUIA 3UG5A 1HKIA 3AISA 3CIVA 2WKGA 3VIHA 1QX1A 1XRVA 1CWYA 2DPEA 3WD2A 4TVCA 2F18A 4AZCB 4C7DA 1OGSA 5E6ZA 1OBAA 1BPLA 3MUZ1 1PZ2A 3ZJ6A 3TV8A 2G3MA 4GI9A 2ZX8A 1ODUA 3IJ7A 2DT0A 4GZIA 1V0MA 1UD8A 2E9BA 3SCUA 5DT5A 1BVZA 2Z1KA 2G3IA 5I6SA 5BCAA 3N9KA 3RIKA 4UFLA 3BAJA 2WC4A 2WMHA 2V3EA 3POCA 1CPUA 3T0AA 3EDFA 1HJSA 2X0YA 4J27A 5E09A 4DUVA 1XCXA 1V3JA 2G41A 2QV4A 2OWXA 3DX4A 2XSAA 5CQ1A 2V3DA 1C3FA 1JI2A 1E72M 4LXFA 3ZSTA 2W66A 4WLCA 5CSYA 4W7VA 4CU6A 1KGWA 3EDJA 3AMCA 1QW9A 4W85A 1VJSA 2YLAA 2XN0A 2O9RA 5ABEA 1HVXA 1UKOA 4WF7A 1MXGA 2BHUA 4H8VA 2X2IA 1BGGA 3DHPA 1H4PA 2DSVA 1BVNP 1NOUA 3CPUA 1XCWA 1B90A 1UZ4A 1I1WA 2BNJA 3WMCA 5JBEA 1Z32X 3SURA 2J62A 2FHCA 2EABA 2ZXBA 1G0CA 1J0KA 3VPLA 3D4ZA 5I5RA 3D5HA 2ZICA 5GNXA 4EKJA 1KWGA 4R5EA 2VZVA 4UFMA 2Z1SA 3DYPA 4UQDA 1JZ6A 2YLLA 4CU7A 1GORA 4WSJA 2WVVB 3WUEA 4HMCA 3W6LA 1VRXA 5A6MA 2XIIA 3ARTA 3ZT5A 3LXCA 1JDCA 3NDYA 2XTKA 1MYRA 4B15A 4NI3A 4J3WA 4JKKA 4FLOA 4PSRA 4JCLA 2XVNA 3IK2A 1HJUA 1JD9A 4D1IA 3AXXA 3HG2A 1BG9A 2VCAA 2ZUMA 1BYBA 3HU7A 3OGRA 1UHVA 5LA0A 3CGTA 1CXLA 2JALA 2DSWA 1CXEA 4XZBA 4HZ8A 3WQ5A 2EXOA 1ZB5A 8CGTA 4FNSA 3MSDA 4XB3A 3OG2A 5I0DA 2VVSA 2VUYA 2PWDA 4NXSA 1XGZA 4LYPA 3RPMA 3SUUA 1W9PA 4MNKA 4FMVA 4CU8A 4DO4A 1GQLA 1GJWA 3LRMA 1E15A 1QOXA 1HP4A 2QHAA 4UFHA 3K8KA 1BPLB 3LXAA 1U30A 4ATLA 3RCNA 2ZXQA 1JXJA 4J3XA 4OIFA 3IAQA 1EGZA 3WNOA 1TE1A 2J8GA 1E5NA 1N82A 5FD0A 3W27A 3CZ8A 1IT0A 2YA2A 2ZXAA 2FYVA 1GOOA 1ITCA 1TFVA 3RDKA 4U33A 1AQMA 4UFKA 1WB0A 1FP9A 1AMYA 3NCOA 1LWHA 1DTUA 1VEOA 3UEQA 2MANA 2J8FA 1PEZA 1SYTA 1HN1A 2J7EA 3CHDA 1IZKA 3BAXA 1JDAA 3ZT7A 2YJQA 3WH6A 3VGGA 4KWUA 2JIWA 1TQWA 3G6LA 5M03A 1L8NA 1V03A 1HJVA 1HKKA 3CHCA 3KL3A 3ZT6A 2XVPA 1E3XA 2X09A 3W28A 4MNMA 1W3KA 3M7SA 4HU0A 2ZXDA 3ZM8A 2WNWA 3AZSA 3DX0A 1ISXA 3AIWA 4PMXA 4UOQA 5D8ZA 3A3HA 2BY2A 1U2YA 3MUIA 2WVSA 2G3NA 5F7UA 2D0GA 5BXPA 2CKSA 1QWUA 1JNDA 4W86A 3VIFA 1GCYA 2NW0A 2E0PA 1OINA 4U2YA 1US2A 3S5ZA 1FFQA 4W8LA 4W7WA 2FHBA 3KLLA 3TTQA 1KQZA 5CJ5A 4FNQA 2QPSA 1XSIA 4KH2A 3BUDA 1ZS2A 3CUGA 4OUEA 2XYLA 1CLXA 1X1NA 1R7OA 3VIGA 4PUDA 3AXIA 3AHZA 3MV01 2ZUVA 3TTOA 3MUY1 4W88A 4XV0A 3ARYA 1E4IA 4WKFA 2XFYA 1W1TA 1ZBWA 2WCSA 4TOQA 1K6AA 9CGTA 1NP0A 5GNZA 4PMRA 4P8UA 4DO5A 4M56A 4BQ5A 3ARQA 1CECA 1ZBCA 1JZ7A 2WCGA 3GH4A 3VU2A 3WDIA 2VR4A 5HNNA 4AIOA 4R27A 1MQQA 1UKQA 3UR7A 2F8QA 2ZE0A 3FHQA 2VURA 1S46A 2PC8A 3AS3A 4MB1A 3QOMA 3WD4A 2ZUUA 1FP8A 4CD4A 5D9MA 3H55A 5JIPA 1HVQA 1QI2A 1Q6FA 2DDXA 1HP5A 1DP0A 1K9TA 5FKYA 3SIMA 4QLJA 4NZJA 4C7FA 3BVVA 3IGUA 3WKZA 4HZ6A 1FH8A 3WH7A 4ACZB 1V0LA 1DEDA 1KTBA 5A69A 3WEZA 4UOZA 3ARXA 3RM8A 6TAAA 1HJWA 1GQIA 4MB3A 1GQKA 4E8CA 2A3HA 5BXSA 2FDMA 3PZTA 1ZJBA 1VB9A 1IV8A 2FGLA 4TUFA 2JF6A 4AZ6A 4J28A 3QHMA 1TZ7A 5AC4A 1E70M 3ECQA 2OSWA 2Q8XA 1EDQA 2F7RA 2EPMX 4HA1A 1NWTA 3A4AA 1PIGA 2VX7A 4BF7A 1EH9A 4TTUA 3ZR6A 3RJXA 5AC5A 3EJSA 3W82A 3BCDA 1BQCA 4PRWA 3EJUA 4GZEA 2DSKA 4H7VA 1E6SM 1MFVA 2XHYA 1LG2A 2IUZA 1E9LA 2VT0A 4PCTA 5M5DA 1D3CA 3MU7A 4DUXA 2PWEA 1FHDA 5C8BB 4MAZA 1W32A 1UR9A 4AZBA 1R34A 3NSNA 3GDBA 3D52A 2BVYA 1VAHA 4MNJA 3LPGA 1FA2A 5D9NA 4UQAA 3UR8A 2D73A 1W9XA 2UWFA 4AMXA 2W5FA 4RE2A 2GVYA 4MADA 2F2HA 4ZE5A 4A3HA 1G01A 2VO5A 2ZUNA 1PBGA 5DEZA 1QNQA 1BF2A 4M1RA 1C90A 4HPGA 2NT1A 4PMVA 1GJUA 4GO9A 2CBVA 5CLTA 3WNNA 1E0XA 3CUFA 3WQ4A 2XGBA 2WKLA 1CBGA 1VF8A 5I77A 4B3LA 3WENA 4MDPA 1BYDA 3WD0A 3PBGA 3AFBA 4HZ7A 4AEEA 1VEMA 1JF5A 1E4MM 3AZTA 1OGBA 3AZRA 1KCLA 3KEHA 3WY1A 2O9TA 5A8QA 2OYMA 3PZMA 4UQ9A 1UWIA 2OW6A 4TVUA 4CN6A 2O9OA 5HXMA 3CZGA 4QP0A 1OD8A 2EAEA 3I3BA 3OLDA 3WMBA 2ZX7A 5HOSA 3KL0A 1XSJA 1LJYA 1Q6CA 4PMDA 1DHKA 1V3IA 2RGMA 4GPNA 1DWFM 2WBKA 4QCFA 2X05A 3RO8A 2EADA 4W5UA 4TTGA 1V0NA 3SUSA 3GH5A 1FH7A 4YHGA 5D4YA 2D23A 3F5LA 3N18A 3W81A 2DH2A 4YPJA 3DC0A 1G1YA 4Z2IA 3VVGA 4EE9A 5KZ6A 2CITA 1E56A 2J4GA 2B31A 5M3WA 3ARVA 4Y7EA 4D6HA 3G6MA 1XV8A 3TA9A 3F5JA 1V3MA 3CZLA 3I3DA 3WN6A 4Q7NA 1QI0A 3N11A 2NSXA 3GZAA 3RM9A 1M01A 3WDJA 3WSUA 2J47A 1JL8A 4OZOA 1FH9A 4Z2JA 1C91A 4LGXA 1JF6A 2WHJA 4UQBA 1TMQA 4P8WA 1E40A 4U2ZA 1UR4A 2DGAA 2WYSA 4AMCA 3VMNA 1R85A 3SCPA 4CUCA 4FNPA 2OLHA 3VIIA 3CH9A 3MI6A 3CUIA 5A8PA 3AHYA 5EFDA 3VTRA 3BVUA 1JXKA
chains in the Genus database with same CATH superfamily
2WSDA 3K2MC 4ATTA 3NOYA 1BQHG 1O7DC 1U58A 4W9FC 2HPIA 2Q8ZA 4A38A 4DAIA 4HA0A 3ABGA 3QKEA 3E2HB 3HB3B 2RDWA 3GC5A 4L4LA 3N12A 3PNUA 3CD4A 2X1IA 4M81A 3KTXA 2NQLA 2VX6A 1FDZA 3BFQG 3IFLL 4LT7A 5CZ0A 4C6DA 3TA3A 5A3ID 1JD7A 4LCWA 4AZHA 1K8AD 2A6DB 3D18A 1BX0A 3HUJB 1BZQK 4Y5XA 3B4YA 4FRWA 4RMQA 2YRZA 3UXLA 4X9SA 2AOSA 3OKDA 4CMMB 1LT8A 2H6PA 5I1IL 5IR1B 2ESVB 3FUNA 1FRGH 2L0DA 4LARL 1ZCOA 5IP4A 3OMAB 4JPVL 4YXHL 5CFHA 2O6DA 2ONEA 1KIUB 5INCA 2O56A 4CMHC 4PS4H 2EDDA 5C08A 4JPWH 1A14H 2GITB 3HRZA 1C16A 1K7FA 3BDBA 3QAZB 4YDVB 3B03A 4P5TC 3CBWA 3LGEA 2XYCA 3HHMA 3P54A 5H35B 4LEOA 1J0HA 4B3FX 4PSPA 4N3TA 1WWBX 2DMGA 3NN8A 5DUBA 1PU0A 3S8GB 1Q6OA 3HNVH 4MJ6A 1XHGA 2KAUC 2V5KA 3KWVA 4K2UL 3W2JA 3VNUA 3IDUA 2QUTA 3CS2A 2KQMA 3GDLA 5AVNA 2YK1H 2DWEA 1Z9SB 3MJ6A 4ZUUB 1MFCL 4A3UA 2XWBA 3D4YA 2CPUA 3EF4A 4OWGA 1RZKC 1Y7VA 4AQAB 3QPEA 1N06A 4XN1A 1U8CA 1YE6A 4AQZA 4LF3A 3BH8A 3BLOA 1O12A 2XNAA 3CFTA 4RZBA 5E2VH 4H04A 3R94A 4Q56A 1AKJB 4OW6A 1IE5A 1WH0A 4LUTA 2HJKA 5G4NA 1V6WA 2PGWA 2XFFA 3DX9A 4PWFA 1UWXK 1EYEA 2A3EA 2R1YA 1IKFL 2BG5A 4DLMA 2VC6A 1NIAA 3HR5B 4WHCA 4EPEC 4F91B 1FNMA 4PH8A 5I74B 2DQUH 3GNOA 3WK1A 5C9ZA 1R9ZA 1DBJL 4M6MH 4DWHA 4Q89A 4EXKA 4HHGA 3W2KA 3MVSA 2EEXA 2XPZA 2DZSA 4LAKA 1W0KA 2WUBL 4JEGB 1RFDL 3VFPA 1OLZA 2XGJA 2RACA 3KPLB 2V9DA 2DEWX 3B6SA 4AIEA 4P12A 3S8HA 3AOFA 1QQDB 2RUSA 1Z6KA 3TH6A 1FCUA 4M6NL 5C9RA 5JYMA 3SPIA 4MNGE 2Y5SA 1OT2A 2JEPA 3UZYA 2UWEE 4BFNA 2DBLH 3JWNH 3MUGA 4X4XA 4YE0A 4ZMGA 4KCUA 4JFEE 5D4QA 3LD8C 2AAMA 4F8NA 5I7GA 3DO7B 4R83A 3VFNB 4KXDA 2UY4A 2ACQA 3QVQA 5LNUA 1HZLA 1M2VA 2JLLA 3LRKA 4NNAA 3P84A 2BMKB 4WJG3 1S7VA 4L4MA 3QUKA 2E6FA 1SY6L 4AYFB 4P25A 2I60H 1TJMA 3PGFH 4G2AA 5ITFA 4BQ2A 1D2KA 2C3WA 4Q7DA 2VRQA 2KPNA 2PLFA 1JZEA 2RQ8A 3AXLB 1E4WH 3MZ2A 5LJYH 3GVLA 3CESA 1KN4L 2R51A 2ZPKH 5EA0L 3OXRB 5H4ZA 1H41A 3DV6A 3QY6A 1KPUA 4YC2B 2VBVA 2IGFL 3KPSE 5CGBA 5C7XH 3ZC3A 1WV2A 2CLHA 3VKKA 2XWXA 3MJ9A 3S3DB 4DEPB 1F18A 3DSNA 5D6CB 1AQHA 3EAKA 3EBGA 5J13B 2B20A 4TNFA 3EW3B 4LF2A 3UPRB 3ML9A 4WIWA 4FLRA 2D3LA 1ANUA 4NNXB 3ULUD 2B7QA 4JGDA 1VFMA 4OV6F 3L9CA 4EDXA 2H2PC 3PWAA 1U3ZA 3QNXB 1ALDA 3QUMA 1JN6A 4UT6L 1LO0L 5DVOA 4TQPA 3HKFA 1KJ2A 3CXFA 5D8JL 4JX0A 3QZWB 4WEVX 2G2PA 1PKNA 3N13A 3R7RA 4TMWA 3JV4B 3B9NA 4OTXH 8TIMA 3BAYA 5D2TA 4EVNA 1FOBA 2Y1HA 3OO2A 2BIHA 4UZSA 4OP7A 4MASA 5AYYA 4MJ4A 5FWRA 2JF7A 5AVQB 1S5MA 2A79A 4MA1B 5EZIL 1ADQH 2PWGA 3BP5B 3CHOA 3VGBA 4EI6B 1ZSXA 3LBCA 1PG7X 1WICA 3OR7B 1PV8A 5LYRA 2LU4A 1UH2A 5GISH 3GAYA 3S1WA 4H0LC 1PTDA 1PYMA 1YPZA 2K6WA 4GMSL 3QFWA 1WTHD 4JFDD 3IMVA 4CD6A 1E4JA 3FN3A 4JFED 5C0CE 2OYPA 4O1DA 5IW6A 2ZSWB 1M9WA 3UZQA 1GJIA 1YX2A 1KN2H 4JKNA 4UWQB 2ZUTA 2BNQD 5E9DB 4IOFD 1H60A 2UXGA 2XG4A 4GAJL 2H0PA 2C9RA 4AIUA 3ZBUA 4G8AC 3TFKD 1ISWA 4L3AA 1TX0A 2OP4L 3D39A 4PJGE 3C6LD 3KPMA 5IMKA 5DY3A 2X16A 3T08A 4AZ5A 3AWOA 1GZGA 3D07A 3BWUC 3LN9A 5D7KD 4YR6A 1JWMB 2IAND 4HD9A 1FO0L 4W9LC 1PB0A 2PP0A 5CU9A 2X0HA 4UC5A 2CA4A 1BFSA 2O5NA 4B5WA 5KZDA 3IS1X 3KPNB 4O1CA 1EFUA 4FI8A 3MPCA 4WFHE 3ZDXF 3N55A 3SJVE 1M57B 3K30A 3LCHA 4N3UA 2EJAA 4O1BA 1OT1A 1T3FA 1BV8A 1SOKA 1SYVB 3QW9A 4U4IA 5K59E 1S2VA 1I7UA 3CYJA 3JZEA 5T3ZD 4P2YA 5K9DA 3HBPA 1QA9B 5GHWL 3N2TA 1HXMA 5F89B 2FJGB 2AEPH 5JQIB 1ZHBA 3ZUNC 2ZQKA 2O30A 1N08A 2P53A 1FFRA 3R06B 3DWTA 1UD2A 1D9KD 1TUFA 3ZVHB 4YS4A 4TIMA 1BBDL 2J20A 3Q0HA 1LO5A 4GI6A 4DKFL 5MEPA 4DP0X 2NW2B 3GXFA 3DJTA 3JUZA 1AUSL 3U6WA 4AL8L 5IXEA 4NQEB 1T2QL 3QUYC 1LK2B 4P59H 3SBRA 4XBMA 3LJ3A 4DH2A 1ET5A 1PVNA 2VISB 4PYSA 4II3A 4JPSA 5J06A 1XF2A 2WUCL 2JBMA 1PAZA 4YSAA 3CHPA 3TWCH 3BAEH 2ABAA 4GG9A 3CV5A 1AH0A 1UKSA 1Z44A 4U5KA 5EU9A 1RULL 1FY6A 5DQDL 2PCQA 5DFVD 5DSZA 4W70A 2YZ5A 2LLLA 1UG6A 4RFNC 4H9VA 1YJ9B 3L48A 3VW3H 4I3GA 2FTYA 4F0LA 3CX5K 1FL3B 5BMXA 1T99A 4WSHA 4ZFCA 1TTUA 1ZU8A 3J7HA 4HU4A 3FUKA 1O6IA 3STCA 3CQQA 3UPBA 3MCKB 2BW5A 5T91A 4QTIH 3P0XA 3PP3H 3N41B 5CN2A 2VTFA 4CNPA 3VD5A 1EDTA 2BWDA 3GS0A 3VYLA 1FG9C 3ZJKA 3O3DB 4A39A 2WBXA 5SWQA 2EKSA 4OM0L 4OLEA 4XPTL 1T6VN 3V6FA 3ZZSA 2Q2EB 4CQJA 1FGNL 2DQGH 3LS5H 3T2PA 4CEUC 2ZG2A 1W9BM 2W63A 4GYFA 2B16A 1A25A 4LAJH 4B7LA 5KVEH 1AFVH 1QFOA 3K3QA 1CURA 3QFJE 1K4GA 2F84A 3C8NA 3KXFB 4P23B 4YLWA 3BH4A 1O5KA 5C0DA 3VWJD 3OG3A 4B5VA 1ZWIA 3TO2B 1OD0A 3N9GH 4L4VA 1MVUA 1L5GB 3Q44A 1MQPA 5C7VA 2A7BA 1K9EA 1LM1A 1WZKA 2QQ6A 2R9HC 5LSMA 2GJNA 1IXOA 4MA7H 2F6XA 3GXMA 4JRXE 1AGFB 2AMGA 4ZR8A 4E68A 1Q1JH 5C70A 1IEXA 2E28A 4X2UA 3JT2A 3DSNB 4ZODA 1BVOA 3FCPA 1LL4A 1VFOA 4NQDE 2Q7NA 1HT6A 4XAYA 4N3NA 3KAAA 2WLYA 3MNZA 4LB8A 3TTSA 2VQTA 3WEXB 2VXVL 4L18A 4GRWF 3A23A 3V4PA 3DH7A 4YYFA 3D0LA 5FOOA 3LIUA 3MMPA 3MRHA 3ZE0F 1ZT7B 3Q6QA 5I1IH 1NCAL 5JUEH 1XGUA 2X6XA 1I8MA 1A49A 3UWVA 3QR3A 1PVHA 3WLMA 3U0HA 1S3TC 4RXFA 4QVAA 4YAQB 3QK0A 4G9PA 4QRQA 1PPIA 3C0SA 1KBKA 2DZPA 3GKZA 2BP5M 4HAFA 4Q8UA 1GGTA 3EBVA 2ED6A 3M0VA 4G8GD 2XETA 3W7LA 4ZENA 1MEXL 2JCCA 2J7CA 4XR6A 4KY1L 4JY9A 5FJOA 3WJYA 1IVTA 1QXLA 2PFHA 2MMXA 2F54E 3WO8A 2Y72A 4MKNA 1S6NA 1QJWA 3T51B 1XDJA 1TVLA 5CJMA 4C6IA 3DENA 2DM4A 4N5EC 4UNUA 1VQOB 3OQRA 4D3CH 2NY4B 1H1NA 2YB1A 3PK7A 5C54A 4X05A 1TRDA 3CZKA 4YZFE 5B3SB 1HZHH 4P9HC 3DJSA 1LD9A 4GSDH 2NY3C 3EH5B 1WEJL 3LEVH 3A6CH 3QXAB 1TTCA 4R9HA 4UT9L 4RDZA 3V7PA 3DGBA 1P5VA 2AEWA 4Z7VF 4YDMA 5E9DA 5J11C 4HJEA 1A4JA 1TENA 3NBNA 1OADA 2DJXA 2F74B 5CEZL 2HXAA 2XWDA 1P4LB 1N26A 1J8SA 1K9DA 2C4UA 1XRTA 3RPBA 1Q7MA 2CO2A 1NCJA 4C47A 4YR6B 2OX4A 3L5XL 3KOXA 2IPKA 3U6RB 3ETSA 3NA9H 1E4NA 2QHRL 3P73A 1IL1B 2EYRA 5SWZA 4ANXA 2FO1A 1PDZA 2CBJA 2P44B 3E6EA 2J21A 2ADGA 1XWVA 3V0DA 4NRXA 2ZBUA 4NBSA 2GQAA 2EC9U 1IT7A 4NDMA 4PUEA 2I9TB 3C5QA 1U91A 3OVQA 3PABA 5AVWB 2DBLL 4PI2A 4GFSA 1I8IB 2DH3A 3E6FA 1ZHBB 3EOYG 1SJHB 2IH9A 1X5ZA 1X96A 1RUKL 2AXWA 3OPUA 1F1AA 2OI9B 2HX8A 5AKSA 1LQ2A 3GHEH 3O4LE 4IH3A 3Q2LA 2VMEA 4KDTA 3SDAA 4HPHA 4QXGH 4DQLA 2J1KA 2Y1AA 5D32A 4RD3A 3UFYA 2X2HA 3CCHB 2XTJD 3W0WB 3CN4A 5JA8B 4KY2A 2NWRA 2VISA 2Y06L 4BWUA 3EJTA 3QIWB 3G5ZA 3WO4B 3GMLA 2IQAA 3PPEA 3JU2A 1OTSD 1WGOA 3NIYA 4RLIA 2YSSB 3ABSA 4OLZL 4BEIA 4DYKA 1AC6A 4LCIL 2NX5B 1KXQA 1COBA 4HLZH 4NP4H 3RWCB 3RUGA 3UA4A 1CD9B 2PO6C 1KYDA 2FT7A 3HAEH 3QUMH 1A5UA 2DZTA 1CNFA 2E74C 5LIWX 5DD5L 3HE6B 2CCRA 3T42A 2CSPA 2YPLE 5FW6A 1R5YA 4JX4A 1ZUNB 2ZZ7A 3CHEA 2V2HA 3EZ4A 1O6TA 1CG9A 4M93C 4DGWC 1AJ0A 1ESOA 3NIFB 3PPGA 3CFJB 3L4TA 2X2UA 1ADSA 2VCCA 3NJGA 4GRMB 1A3ZA 3LZFH 3S96B 2IOOA 1AL7A 4D6EA 1SVCP 1MJ8L 2GWGA 2HN7A 1UP2A 5DO8A 4YGVB 1FRNA 1CYWA 2VFDA 5G4WA 1U8MA 4KJYB 3VTMA 2D7NA 4CMHB 1BD2E 1ONQB 4NJAH 3QXVA 4HUKB 1CXIA 2H1XA 5CHNA 1RI8A 3UC0L 3U5UA 4UNIA 5C0EB 1SW7A 4HOZA 1MCOL 3QEGH 1FRGL 5LBGA 3TOYA 4JTIA 5AB0A 4LTSA 1GW6A 4XO6A 3SQLA 3CDYA 1QPNA 4MGGA 2X38A 2V0TA 3Q6GL 4AD0A 1SO4A 4DJED 3Q65A 5TF1H 3SGEH 3AIEA 4PJEA 4CSZA 2DDQH 4GXFA 5FYLH 3SN4A 1XLIA 4FULA 5EORH 2UY3A 4PC1A 2XWJA 3HIZA 2W6RA 4HSOA 1GYMA 1SHSA 3JU4A 1QD0A 2K1MA 2C0HA 1CGTA 1VGEL 3BXNA 2G3FA 4IGNA 4XB8A 2QF8A 4QE1A 4FHJA 3Q1SL 3PZVA 3OAUH 3FB5A 2J8UE 3CN1A 1E4LA 1WAUA 1GAFH 1DZ0A 2FJFA 2XPYA 3BX7C 5L4MA 1Q45A 2IANA 4ONHA 3ZRSA 1TQBC 2FE0A 3QPQD 4YHLH 5CEZH 2X2GA 4OGZA 3RLSA 3T2QA 5F93C 1DQUA 2HJFB 2Z4GA 4XX6A 4TM9A 3D39D 1LEIB 3IDXL 1CE6A 3GK8L 2E4TA 4L61A 2VQ1A 2Z2AA 2AJSL 1AW1A 5F1OB 4E5TA 2C9UA 2EIDA 4FQ2H 1OFAA 2NY5L 1MELA 1Q6FA 3PV6B 2WYIA 1T80A 1S5NA 2H8PA 2VEPA 3BARA 4O19A 2EJ1A 1SM3H 3B8DA 3I6LD 3OG6B 2PPEA 3DVNA 1KWKA 5KNLA 3EWBX 4Q8PA 2V9QA 1SLUA 5SWSB 4XI5D 2FR4B 1Z2KA 4GEIA 1WDPA 1S39A 1ASPA 3UYPB 3OBEA 1ZTXL 4FXJA 5IRPA 3II2A 3LEYH 4WZKA 2W6JA 3EMCA 3FK3A 4KZEL 1IKNA 4C6CA 3BUPA 2NY6D 1OZUA 1U3YA 2VE6B 4QF1B 4JEQA 5LAXA 4P2NA 4I0PD 4U1GC 1DN2A 3FU5A 2IVFC 4FHBD 3NJMA 4ZS7H 2P1YA 4POUB 4AUUA 3VDCA 1A6WL 5L6YH 3DX7A 4BSWA 1G7LB 1RJLB 4MLJA 4YN5A 3QQ4B 2EG6A 5F3BB 3NRFA 5HINA 1C08B 5TE4H 4JHVA 2YAFA 5C2BH 3AS1A 2A2QT 4I9XA 3W39A 2A4AA 3WJWA 3SPGA 5GSRA 2Q02A 4RETB 3W1TA 5CJBA 1QVOA 1R47A 5SWZD 1G4TA 4DF1A 2PYED 1U2RA 1ILSA 4OI7A 1J6OA 2UX7A 2XG5A 2XBDA 3D4GA 3FFCB 1E4XL 3JTTA 1SM4A 4J8QA 3QH3A 4ONGL 4KKZA 4JNXA 5LGYA 4NBXB 2OBRA 4PMOA 4PGLA 1KRHA 2Q76B 3QJUB 4LDOB 3CFBB 2PUQT 4NSKA 3IPFA 5C07E 2YX0A 4S3AA 3MMUA 5D2YA 5EDSA 3QDJB 4GKSA 2ESCA 5DYFA 4O4YH 4IGSA 1I3GL 1OD9A 2BCKB 2CRVA 1I8AA 4XP6L 2AJUL 3L21A 5LXEA 3EHBB 4AZIA 3AU6A 3LN5B 4RGMC 1I3VA 4WW1A 1NAL1 4W4QA 3N04A 1PYWA 3N6YA 3K5SA 4YO0A 1GT8A 3JV5A 4X7SL 1GOXA 3APGA 3GNXA 3VI2A 1R19A 1E7UA 4OCRH 4QXTB 1LRTA 5C07B 2AEIT 4H5SB 4UT6H 5JHDD 4QEEA 2G97A 2FVKA 5G2WA 4XN9A 5E99L 2LV4A 5B1JA 2GTQA 1CFVL 1P9MC 4HWBL 7ENLA 3KYNA 2CPCA 2J55A 4CVXA 2HJLA 3I6LE 3QJHB 4O15A 2N7BA 1F3XA 3D25A 3LQGA 4X83A 3RNKB 3FFDA 3NGBB 1I8JA 2Q86A 5E23A 2XBZA 1AACA 2QPFA 1L4IA 1ORSB 1UH3A 2ATKB 4J6RL 4HQQL 4PU2A 3WFHA 4MA7L 2XICA 1MDRA 4L6OA 5A16A 2J71A 3NCYS 1BQUA 3ES9A 1QLFB 1IEHA 1LOQA 3L08A 2J25A 2BTMA 2PURA 4JZ5A 2NQ9A 4Z1CA 1S3KH 1GPOL 3X13A 3X14B 2HRPH 1QRNE 4P57B 2SODB 4F15C 3NK3A 3IS4A 2NNXA 3RMJA 5JMOC 4GS7B 2PW1B 5K9KA 1W35A 3OIHA 3HRZC 3GR7A 1QW8A 3T1WA 4Q33A 4NZTL 3MXWL 4HUCA 4XR8C 4JQIL 3IBEA 3WAJA 1L6YA 2HQAA 3EA3A 2A0LD 5HI3D 5BOPA 5KVEE 3FT2B 4YFLF 3TJLA 5FO0A 3BP4A 1GVEA 3NZRA 2YBUA 4JHWH 2ZZGA 1E1CB 3B9EA 4XP4H 2DQCH 1D2EA 3QIBB 2DIJA 1ONQA 3F2DA 1QYGL 3CE1A 4JFWA 3L3DA 5BS0B 1PKVA 5DUPH 2ID5A 1TQCC 4H7CA 4YDKH 3A5VA 4WNJA 2R23B 4Z1DA 3QGVA 4XPBL 1XUUA 5J1AB 2I9LB 3WDQA 2PYEE 2CUIA 5DMGD 1YIJB 1JGIA 2AITA 2VMJA 2WXGA 3IDYC 4N5UA 5T1MB 2KZBA 3GQFA 5HPCA 2WANA 2PE3A 1M3UA 5GJPA 1A7NH 1WUZA 2BVDA 1MI5D 3G1AA 1XH2A 1KIRB 4XPHH 4H44C 3LEYL 4KKLD 4F0RA 3S9ZA 2CH8A 4BCZA 1AYRA 4XWOC 3KCPB 2GUUA 3GIZL 4XMKL 4FP1A 4M5ZL 3X1BA 4A2EA 5D70H 1FP5A 4H4NA 4HS8L 2EDQA 3QRFM 1OIFA 3HC3H 4YHNB 1MDAA 1RZFL 2PMZA 5E70A 1WDRA 1X5YA 4HYVA 3FCGA 4RA3A 1Q9OA 3OKLB 5XIMA 1RUPL 1F4WH 2XU2A 5JLZB 1OP5K 5C2BL 4U05A 5E1HB 1QRNB 4Y2LA 4KTEL 1VPOL 2DI9A 3IMTA 4I48A 4L4PA 4ZCWA 3I9GH 3L5MA 3H9SB 3WY9A 3ILPB 4AL8C 1BYPA 1UWAA 3WFBL 2PP9A 2HLFC 1UMKA 3B0VC 5EUOF 2ZOKA 4UQCA 1RZPA 4PJ9D 3NPVA 4AKPA 1QBML 2VELA 4WO4D 1I1RA 4I5UA 3INUH 1IR1A 1MAML 1LK3H 3PF3A 2PCFA 4MMWA 5IMOB 4IF2A 3O8XD 1GZQB 1OTTD 3NSYA 4HCRH 4XNQB 3S3PA 1IBGH 4XOAA 5C0RH 4ZX4A 5FB8A 3C2RA 2R27A 2WKOA 4K55A 3WXVH 3C2OA 1G7JA 2W9MA 1EEQA 3Q94A 1YN6A 3E9TA 2VE6A 1MZZA 2W8CA 4YXKL 3UNDA 4NGHH 3B3BA 5LAXB 3A4JA 3EFDL 5GGTH 1EJXC 2YMOA 4X9YA 4DZ8B 1RQPA 2QULA 5FOJA 1M7JA 5I0XA 1UR1A 1WDDA 2E6DA 3WQVA 1WFUA 4GBXA 2DTSA 3IJYA 4GAJH 4Y8AA 3D08A 4NWTH 3MI2A 3SHSA 3VFUA 5DK0A 1NRKA 4IGBD 4KQ0A 2TAAA 5BWFA 2CR6A 1WA0X 4C4UA 4PMZA 1R24B 1UEYA 1LM8V 3U6KA 2NNRA 3FU6A 5CJOL 1BXNA 1FYTA 3RGVD 3UG8A 4P6VF 3VO2A 5L2JA 4I8DA 3G18A 3PS7A 1NFDE 2UZPA 4G6KL 2I07A 3HM7A 5IBXA 1OCOB 2ZKWA 3QFDB 4JGUA 2Y7DA 2OLAA 4M82A 5H8PA 5T1KB 4YBQC 4RPQA 2DETA 1J5OL 5TRDA 2WXLA 5I8KL 2HK0A 1RALA 4PULA 4JFFD 3MYPA 4ZZ9A 4FXTA 2JNZA 1CICD 1YQ2A 4GKSB 3FRPA 4X4ZA 2R69H 1T1ZB 5F1VA 1Z0NA 2ZF8A 4KEUA 1OP4A 3GNMH 3ZKXC 4DVRL 4GG6E 3D0AA 2NR6C 3B9KC 2REQB 1A66A 3MBFA 4L56A 3TNBA 1P2CA 2PTVA 4S1QH 5HDBB 2ZZFA 3WBJA 1MOEA 2WV3A 4JAMB 4K4KA 1OM3H 2CRMA 2WSKA 4JUSA 4LLYB 43CAB 4KTDH 2FTAA 2DEXX 2EYSB 3CL7A 4Q0XH 1WNOA 4R3UA 3EYQD 3HTLX 3JVFC 2CDGB 4L8SC 3KYNB 5F3HA 5C86A 3VCRA 5FL1A 3QJHA 4CKQA 2EVJA 1GTEA 5AOIA 4R7VA 3SJ3A 1A2YA 5E6YA 3UG3A 5B38B 4NJHA 2KI6A 3VTAA 1H9DA 4EIBA 1GHSA 1RK6A 3VKAA 3TZVB 1QUMA 2ALDA 2GTZB 1IZJA 4LAQH 1G0DA 1A6VL 1QLFA 2XZAL 2IH1B 2QV2A 2QVMA 2YD3A 1T89C 4GI8A 4PCSA 4PLKC 1HDMA 4X80H 2YB4A 4N7QA 3TFCA 4XAPA 3GQBA 2EACA 4PP1C 4XXDB 3A22A 5HDRA 1R0MA 3U2QA 3BVDB 1RCOB 2KLSA 2H45A 2WMFA 2XFWA 1FWBC 3FQYA 2WSRA 1RXLA 4F2ME 2BM3A 2GC4C 5ALCL 1VIWA 5T8GA 1UOWA 1V6XA 1KFBA 4IQEA 5LNRA 5DJDA 4P8XA 3GM0A 3ORJA 4HKZA 3WL9A 5F1NB 4MNQE 3CYVA 2WNNA 2XT1B 1BQLL 3CSBA 3FU7B 5GGUB 2CEQA 2NLJB 4GXMA 4N68A 5I3FA 3EXJA 2VDPL 2K8QA 2PTYA 3DK0A 2A1YA 4JFZH 3NA9L 5MENE 5GV7A 3TVMA 1OGGA 3WK3A 4C6FA 2NQCA 5E2TH 1SKYB 5J56B 1W1ZA 3N15A 3LRSA 2P5WA 4Z7QF 2A6JA 2Z24A 1EZVY 3ITTA 5EC2B 3II1A 3T0EC 2PTUA 3QO1A 1UZ8B 4JR5A 2Z3FA 4PY8I 3V0WL 1MZHA 3UWEA 2VX4A 3ZW3A 5CG0A 1Y6NR 4C4KT 1KR0A 2I5GA 4WHBA 5H8UA 2XYBA 3AJ7A 3ZPNA 5HGGS 1VQMB 5J57B 3F7LA 2Q8LA 1JCYA 1CIDA 2ZOLB 5B7ZA 1NGPH 3CQJA 4LRSA 3NUKA 4IIZA 2FYYA 1HC1A 4BINA 4FQLH 4NCDA 4QRRE 4QXUH 1K28D 5DMGC 5AVXB 2BVOB 1SEQH 1UMLA 4LSVL 3DHUA 4WQ6A 2VCBA 3IBOA 4XD5A 4WFGE 1PD6A 1FBIL 3NZHL 2C9VA 3NCJL 3RVTD 1IGML 5FR3A 1MFBL 3OTRA 4DHGA 1NCBH 4I48B 5HYJB 5I1GL 1DCLA 5I82A 1HOCB 2OZ4L 5EB9A 2XSXA 5DVMA 5H8DA 4TVPE 3IFNH 4YNGA 4XQFA 2DTMH 3BI9X 1WHOA 3AU2A 1YEHH 4DGVH 2OKMA 3S8WA 1TX2A 3MFGB 1H63A 4NXKA 4PREB 4QRRB 3BUYA 1GAQA 3MUUA 3PZQA 4NQCD 1W9DM 3PR2A 1JPST 3GM8A 4XP9L 5F0LB 1ZSDA 1ACXA 1BFVH 4D0DA 3QN3A 3WF1A 3DMMD 2VLME 4WVRA 3GFUA 5EOCL 7TAAA 3EKGA 3TPKA 5F4WA 2DT3A 2Z93A 3ABRA 1JOIA 3L3OA 1G1KA 1I4FB 1INEH 2ITEA 4OQ1A 3BVWA 3WGUB 5T33H 2EPLX 5IVZB 3KS0H 4CVZA 5HQMA 3VFOA 5J3HC 3DYOA 4Y5XB 2VLMD 2WOYA 1YHTA 3PWVB 3GTFA 2BOGX 2RH9A 3F2BA 1REQB 2P8PA 4N1HB 4IOTA 1FI8C 1AXTH 2UZYA 2PTXA 1C7SA 3L0KA 2WHKA 3HZVA 2RJGA 1HZEA 1U3JA 3D85A 3SJVD 2QVKA 1HE8A 4GP8B 4LZKA 5D1ZC 2QCNA 3M17A 4XP1H 5KAQG 1NTDA 3FPXA 3QEQA 3QQ0A 2WZAA 1RJRA 2IAMB 2IANE 3NN8B 3ZLFA 2PLMA 3BK0A 2V7UA 5HHXL 1SQ7A 2Z7WA 3G8RA 5FJRA 3KOFA 1XBXA 2BNUA 3PWPD 4NKIH 3VRIA 1ZGDA 1MJ7H 4NKCA 2A4EA 3B6SB 3RVVD 2ZCLH 2ZUQC 3P9MA 4KK5D 1QPOA 3I50L 1PAMA 2CLFA 4LYQA 3FRPB 1WFTA 3D3VD 1NAMH 1GIGL 1IGTB 1GGBH 1ZHKB 4TLUA 4QY8B 4RLZA 2UUDK 3DN5A 4IPPA 2J7DA 2OGJA 2Y2WA 3WIFA 3LHWA 4DO7A 4G5AA 4PRRA 3DOSA 4E41E 3KPQB 4N2BA 4HIJB 4NC2B 3BN9C 4XCEA 1XD1A 3F7KA 3LH8A 4F2BA 2NY7H 4QHNA 1XX9C 3VB8A 5DJAB 3RB7A 3S4SB 1GY1A 1LE5B 2W0FA 1X3DA 4WKAA 1HH9B 4NT6A 2RH0A 4TUOB 1NGQH 3F01A 4OF3A 5DZNA 3WS6A 4YSEA 2IPUG 1MVFA 3AMGA 2MQGA 3TN0C 2Y07L 1BPVA 4RISH 4JVWA 3TIEB 2XJ7A 1PXGA 3TZVA 4I0PC 1UM4L 2E40A 4QGCA 4WWKD 3D34A 3QQWA 3ICJA 4PRIE 4X8CA 1T66C 3WJMA 5EFFA 4GCXA 4YHML 5MKGA 3C5JB 1K8CA 3SE3C 4QQUA 4S23A 2E7FA 2C5HA 4Y2OB 5IJKC 1Y07A 4R7DB 1JJ2B 1E0WA 3TBTA 4A05A 4P7LA 1O95A 1FVPA 3TVAA 1HCFX 1LNUB 2VIRB 1J9QA 3HZKB 1K5NA 3UBXA 4JREC 3H3PL 4QWWC 2O5XH 4AVKA 3I9GL 3MO7A 4HU3A 4WUUB 1TTQA 1PMYA 1CTMA 1TXKA 2VRJA 3VKBA 4PRIB 3DRTA 1XH1A 3IGAB 5FYJH 1U1HA 3VFCA 3U30B 3FK4A 4YAFA 4IIQA 4AL8H 4Y4HC 3F7PC 1B3YA 2DKUA 1NKGA 3H7LA 3L3GA 4L8DA 3IWUA 4L37A 3U1PA 4ZTEA 1E4WL 5L0QC 2BGQA 3HQPA 3Q37A 5ITFB 1A4CA 1VBUA 4QOKE 2RA1A 1JZ8A 3P0GB 2D7MA 2WY3B 3GHBH 3GSNH 4LMQI 5FYLE 4CC1A 4PCFA 3O4LA 4YZWA 1B5TA 3HR6A 1QNSA 2NT0A 1KPUB 3AGWA 3ANVA 4S38A 2Y24A 3OR7A 1IE7C 2Y5EA 3C8KA 4AEOA 2HCZX 4I3RL 3UDWC 3O6MH 3L7EB 4ZQOA 3MYJB 4DF9A 2AK4A 3RDTC 5LNWA 1Y5WA 1EP3B 2OK0L 3QCTL 4Y16D 3DIDA 1EEUA 3UPRA 2KVOA 1QASA 1FN4B 5FIPA 3Q67A 4PY7A 5D1QD 4PA8A 3T81A 2OA9A 4IMLB 6TIMA 3VOGA 2E1DA 1H8LA 1GVYA 5DRWB 1INDL 4KZDH 4KXZI 1Q0YH 4CW1A 3LKRB 3LRLA 4JFYB 1I53A 4OZGA 3BOFA 4GQBA 3CVIL 2FEEL 1JPMA 4BHUI 3U2EA 2CMRL 2QF7A 1ISZA 2I5YL 2VX5A 3IVSA 1IIKA 1K9FA 3RYSA 1YEDA 1YI2B 4BFGA 4F2EA 4P61A 4MSWB 5CC7A 1JDDA 3KRUA 5HWMA 3FBKA 4JKWA 4AV4A 2WLNA 4QOKA 3M0IA 1D7FA 4PJ9A 2MCAA 3TH3T 4NZDA 4XH2B 2EUZA 1BD0A 1K03A 4JQXC 3CXDH 5DLMH 5E8PA 5ICUA 2EHHA 3FQ2A 3KZPA 3UY8A 4FYQA 4EI6A 5IQMA 2WZ0A 2VFFA 3CPRA 1U3HC 3EYUL 4ZW7A 5KYUA 3UIZA 4HG4K 1JPDX 1T8XA 2E1BA 5ECGA 1AH3A 4W68A 4YTQA 2HTKC 1KB3A 2OL3A 5ICXA 2WB5A 1E4HA 3CC5A 3S2CA 3R4RA 3G6DH 4TQTA 2PPCA 2IWEA 4FNLL 4ZMTA 5IW6B 4BBWA 1WYJA 4S1RH 3L3OB 3G08A 3TTEA 1JGUL 1E63A 1I4FA 5I1LA 4PMUA 3E38A 2ZAIA 3KPMB 5DJ6B 4ZFOB 2R29H 2X9WA 1CK0H 1DVYA 2P8PB 1DVQA 1S2WA 2GJLA 4ICNA 3WLRA 2VZTA 3SIZA 4POYA 1A65A 2P0IA 3KPNA 4M8UA 3PNWB 3TO4D 4Y7OC 1HQ4A 2XWEA 2UZXB 2C4FU 3F85A 1NDGB 4N2LA 3UTQB 4IM4A 2Z4QA 1U8OA 3G3MA 4D0CB 3C5ZD 1O5XA 4ANWA 2HXTA 4KXZH 2E7LC 2OTDA 1I7UB 3CIWA 2V5JA 3LB0A 2Z0UA 1BM3L 1XB3A 2VZOA 4YHMH 1A1NA 3FF7A 3EUDA 3SGKC 1GR1A 3SODB 1T21A 2VRKA 3ULVL 3ZLQC 4TQEL 3HVDA 5BVJA 4RZKA 3NAAL 1QPXA 1S5IH 1Q8AA 5DI8A 3M1ZA 4D9QE 2AKZA 1IGTA 1V0FA 3S5LA 3NL5A 1NFIA 1ZT4B 1J4EA 4IJ3C 3DUSA 4NQEA 4CD5A 4KMQA 2NY2D 3SM0A 3T9WA 4EN3A 2X85A 2AQOA 4WUUD 4G5GA 4IK6A 5FYJL 1FDRA 4Z7NB 2VR3A 3W38A 1R3HB 3ABQA 2BDNH 4OCWH 1I8LA 1E27B 4QHNB 2X8RA 1NM9A 2R2HB 5CPSA 4ICCX 3ALPA 4KO9A 4AVNA 1TCRA 4NN6B 3V6OE 1DBBL 3M0ZA 2FEJA 4QNPF 3MOBL 2F43A 5LO7A 1SEBB 4H26B 4TUOA 3SDDC 3K91A 2CM5A 3VFGL 2I16A 3WHE0 3FKRA 3U25A 1HIML 1H49A 3WDHA 3KDMB 5I16B 2NY3D 3V0WH 3FQTB 4NSBA 1TR1A 3MO1A 5JOFA 1CLOL 2FVMA 1EP1B 1KGCD 4MYXA 4HNVA 1WKDA 5EZLA 2PXYD 1HJXA 1BWWA 2QZRA 3G24A 4Y2OA 4HTBA 4Z3TA 3FTYA 3SBWA 3KL5A 3G5VB 3U6XS 4HIXL 4NZ8A 2J7HA 4O0ZA 4AC9A 1TCDA 3L1FA 2OYKA 4ZSOE 2Y2YA 4NUQA 3MLRL 2VEGA 1J9ZA 2AP2A 5BUAA 1KM3A 3FN0H 1SDDB 2PCPB 4PRIA 3L4UA 4P46B 5A2JH 4BKNA 2H3NA 4JG0H 3F58L 4UTTA 2Z0BA 4TS6A 3MHGA 5IHZB 5J8OA 2GEQA 1P4CA 1B2RA 4L8DB 4LESA 3LMYA 1CU4H 4NM8L 3VCNA 3LKSB 5D4IA 4NF7A 1YYLL 2FQDA 3UG4A 3BDYH 3L5JA 3QXTA 4WENB 2E9JA 5DA4A 3TO2A 1CZ1A 3KCOA 1L5GA 5BRZD 3EYUH 4YNYA 3D8MA 2C26A 5B1JC 1NANH 3Q2WA 1A80A 4KMTH 3PU7A 1M41A 1XC4A 3CLFL 1WA3A 4JRYB 2TRSA 1JK9A 2VN7A 1DWJM 1AGFA 1I2QA 3GTIA 5EOQH 1BSIA 3NCYP 1T6WA 4LLDA 1J5OH 1LP9B 2DSKA 3KR3L 4AW7A 2F38A 1EP3A 3K4AA 1KG0B 1WF5A 3IFLH 5IUCA 4UU9B 4LB3A 2EXWD 4LSBA 1F4YH 4Q8QA 3RWIA 1XH3B 4KGLA 2CRYA 2ITDA 3D0LB 4PWJA 4Q6IA 4W9KC 5C3IA 2BOFX 2DW7A 3C8FA 3EDEA 3MNWA 5DHVA 3KS6A 4W7UA 5LCVA 2XA3A 1EUNA 3QYSA 3SJVA 5FNZA 5DHYB 3PZIA 2G5RA 4X2PA 2OMVB 3ELAT 3H0TB 3UTSE 3PP3K 2ZJSL 4EAMA 3KBVA 4OZIB 1B1YA 3JQOB 2DWXA 5FSEC 4WHYH 4O5LL 1MI5B 4D6CA 1PKLA 1DVTA 4KBXA 2C77A 5ANMB 4Q8TA 1ELSA 3LS9A 4QDMA 1X38A 1JRHH 4RMRA 4PGBA 2E9LA 4L1DA 3SQBB 3HPXA 5ESQA 1EEYB 5EIIG 4C6QA 1IMHC 3KXQA 3JWDL 4XWUA 3CTLA 4MNQA 2GSHA 1DSFH 1ZJIA 4RJLA 2WN2A 2Q6WB 1G6RH 4JFOB 4XNZC 1TPH1 4WOQA 1H8NA 12E8L 4GW4A 2AW2A 4YBHA 1C93A 3CC5B 2Z8RA 1ZLUK 5JXED 2R1NA 3WUGA 2XM2A 4W8AA 2NYKA 4DK0A 1NC4B 3P2BA 4D72A 4JB9L 2JELH 5DMLA 4ZFFA 1UD6A 3B78A 1PZ0A 2APSA 2Y25A 1BECA 2J73A 4M5YH 1WQ5A 1QFWM 3NA4A 3QAZC 2E1WA 2OMXB 2RHEA 3CCHA 3VQ2C 4YSCA 2MCPH 4BQ3A 4EH1A 4EANA 2WAQA 4PE8A 2KT6A 3IAGC 1EWEA 3WY3A 2JQXA 4FLQA 1MWOA 4G8FB 4RD6A 4MA3B 2G95A 4C6LA 4H83A 4ZX3A 4PB5A 2UYLA 1G7MB 4L1TA 5AVVB 3U30C 1XSKA 2VR9A 3DXAA 2UZXA 1PUDA 1CFTA 1E0VA 2CBPA 5ALBL 3H2OA 3LBOA 3C60B 1RFDH 1F07A 1H8EA 1T20B 1NBVL 4C6PA 3HBZA 5ACZA 1U91B 2YAPA 4QAWA 2BFVL 2E3ZA 3HMWH 1HZKA 5E7BA 3VI4F 1MDTA 3W9EA 4GUHA 1KB5H 5CSZA 2FLBT 4JS7A 4M6NH 5EF3A 5I18H 1IAIL 4MMZB 2WZIA 4D6JA 3NQIA 4L23A 3LM3A 2X53S 1BLNA 3GSNA 1E67A 3DAQA 4L8SB 1SW3A 3RL1B 2PGEA 1EHKB 4HS3A 1POJA 4MNHB 4QHYA 3QRBA 1NGYA 2AKRA 2DZBA 5IJVB 3QHZL 1N7KA 1R3HA 3TESA 2MNRA 5I3HA 2YEVB 4OAWB 4HCDA 1YNTF 2QUUA 1UQYA 1BLIA 4U6HA 1J05B 1FVCB 4JKPH 2YXFA 3GTTA 3RLHA 5C0FB 4B9GA 5MENA 3G5YA 3FCTB 5ADOH 4RD4A 1SZNA 3MGTA 4P4KA 1GO2A 1UM5H 4YDJA 3VWJB 3NJKA 4D94A 4XMPH 1JFHA 3IF1B 3TCLA 1MFDH 5EUOA 4X06A 1H3TA 4XZLX 4LNYA 3FVMA 4ZQKB 1FSKB 2XZAH 4FMKA 2P80D 2DLTA 3LKPB 3GZ3A 2F8IA 1L6ZA 4AJ0A 3V4VA 1EGVA 1Q9SA 2GSIA 4Y16A 4P5MA 3BD5A 4Q4SA 2TPSA 3M8OH 3PDOA 3MV8A 5F9DC 3T7VA 4C6EA 2DVXA 1DJNA 1CDJA 4HK6A 2N0KA 7PCYA 2DMKA 4MJIE 3URNA 3ZS4A 3QSKB 5HHQA 2VXTL 1U8PA 5T9CE 2ISVA 3KPRA 3QHFL 3EOEA 2X5PA 5F4MA 1SDDA 2V7WA 2EDMA 2PCPA 1IAOA 3K6SA 2EYTB 4HIIA 4PBXA 4UZGA 4ZFZB 2VQ1B 1ZHAA 1R8LA 3W1MA 3VQLA 5FGRA 2HKFL 1W3HA 3QDME 3NSCA 5C0AE 3O9WB 2EBNA 1QLEH 1AI1H 2Q2LA 2BLFA 1ZKAA 4PJEB 5DZJA 4APQC 4LW7A 4ZFMA 2H3XC 3FNKA 3GI9L 2ZITA 1DVFA 3CC2B 4YMZA 3BPNC 4DPRA 1BYCA 5XIAA 2IDTA 4XXWC 3PF2A 2QCLA 1L9NA 1YECL 3EH4B 1HEHC 1KV3A 1RERA 2X89D 4NJ9L 4K38A 5DR5L 1DANU 1KG0A 1NIFA 2GJRA 2FJFB 3GKAA 1T89A 2CXGA 1Q82D 3BMVA 1KGIA 3VTTA 1WIUA 1A1MB 4MGXA 4ACPA 1LEGA 1PY4A 3CPLB 1C12B 1GSKA 4GS7C 4QXUL 5H94A 5IHUH 3VNLA 1I7TB 1W16A 3ULUC 2AEOA 1ZAHA 2YXXA 4O0QA 3LV5A 4P4KD 2AQRA 1LUCB 4PW4A 2DSZA 4LOUC 1J18A 1W8EA 2QCMA 1Z5HA 1G43A 3GBEA 3JQRA 1B6UA 3HA0A 3BAKA 4GQRA 3WNLA 5A43C 5HY9B 2O92A 3IK4A 1QFZA 4PFEA 3WQ6A 1JVOA 1LDPL 3BSMA 2PB1A 1N0UA 5EWIL 4M7JH 4HJSA 4L2YA 2GQFA 2IQ0A 1P4MA 2GK7A 1G7QB 2VC2B 4WFED 4Z7QE 1G4EA 5ESQB 3UGUA 4ZG1A 4AEIL 5IJDC 3LCXA 4LLWB 3W2DL 5B1AB 4LS0A 4NSKB 5LGXA 3QCUL 5JUVA 3TAOA 3TVMC 5HJLA 3MZNA 4GGBA 3BPNB 1Q2RA 4U49A 3EO1A 2ZE3A 4HZLB 3OJDA 2X4SA 3RI5F 4JAWA 4B3ZA 1FWGC 2WNXA 2G2NA 3KYKL 3LN5A 1B9ZA 3CUPA 4B3XA 1CI5A 1R3KB 1GPFA 4O11A 4DZIA 4J4PC 1NWUA 4HGMA 2JJ1A 3FQUB 4L3EB 3OJWA 1NQKA 1RJQA 4GUQA 4U1JA 1DJQA 3OAZH 2NV1A 4MDJB 3UYRL 1YDOA 3AVWA 1EF3A 5AW6B 4Q4OA 2BN4A 5HQEA 1DR9A 1FVEA 3IE9A 4Z0XB 3LV6A 4NQCB 4QI3A 3HPAA 3SQOH 5EIIA 1MCWW 3KRZA 3U7BA 1H8OA 2AL1A 1G4RA 1SBBA 1GOMA 4F27A 1WA2X 2XQYG 3D9AL 3FFDB 3NFNA 3NVTA 4ABUA 3DX1A 1XMEB 4LSRL 2ZYFA 3KM2A 3W2GA 3BJSA 4GAGH 5KYYB 3JWNG 3C60A 4XNXH 2V5LA 2HDNB 2PEVA 4LKCB 4KKQA 1YN7A 5JOEA 1YDVA 4NAEB 1NEZA 2NY1D 3KDNA 4QEHA 4KCVA 4ZJ9A 1EJOL 1ICQA 5PTDA 1DSYA 5ENWA 2WSQA 4HJWA 4X5XB 5E2WL 1ME9A 4JO8A 4NUPA 3OKEA 3S8FB 2NQHA 4QTFA 4N9BA 3RNQA 4TX9A 2NPLX 4JMXA 4MVBC 3L68A 2PMQA 1NAML 1PD1A 3DFOA 3P5ZA 4DJMA 3SY5A 4JFSA 3RL1A 4LVNC 1XDTT 1HWWA 5I75B 2Z6IA 4WK9A 1CFVH 1KIQA 4QXTA 4OBRA 5C07A 3SO3B 5DURD 5L9DH 1E1CA 4C60A 1QFUL 3NJIA 3P69A 4YX2L 3HEIB 4YIQA 4MA8H 4M4SA 3FV9A 3LIZL 2ATAA 3L3OC 4J6RH 3ASTA 2PU0A 3SR7A 1F4AA 2NY1C 3L9RA 3MUAA 4FAMA 4P2QA 4J2MA 3IYLW 3RNKA 1Z9AA 3GSRA 2QGEA 3KXFD 2Q86B 4XCNB 4ZO7A 2I9LA 1ORSA 1DTNA 3L8QA 2CWXA 4RPPA 1NGQL 4KHXL 4XB7A 1AR1C 3S5YA 3KVKA 5FJTA 4BFIA 4AVFA 4C56E 3RGVB 2DQIL 4YDLB 3WFCL 1G1CA 4Z18A 3X13B 1KIRA 3X14A 3QXBA 4UILL 4G6KH 4P57A 4AHPA 3AYSA 3FNDA 3N2BA 3KLDA 1ADQL 2XWCA 2C1GA 4CQBA 2IAMD 3FBQA 3L54A 2G96A 3EWCA 4UDUB 1B4RA 4BR1A 4IT1A 4JHUA 3MRPA 3B8VA 3MV8B 4HCHA 4K7PY 4WQMA 2WQAA 1T6YA 1JF1A 3NFPA 4WQOA 5IHHA 3OKLA 4FZEL 1W1A1 2DY1A 3UTOA 3T04D 1E9YB 1CCZA 2DJMA 3GZKA 1QRNA 5I3GA 3WNPA 1GONA 3C4UA 4UFIA 4XRCA 3RX7A 2DJLA 3HUJF 2ED8A 2W92A 2JK5B 3IPBA 1SUHA 4L48A 4WEEA 1ZTMA 3UZEA 1XQLA 4K1WA 3C5SB 3RLVA 1E9PA 3LD8B 4H8WH 5IB5A 2FPYA 1U92B 4G8GE 3TBWB 1EB3A 5FOBA 4ELMF 1TZ9A 1OGAE 1SY6H 3UESA 4EI5B 4JTQA 1RD6A 4IGMA 1AO7E 1BZ8A 4GYJA 2F6KA 4O4VA 2E8ZA 1MQ8A 4KX7A 3NFSL 3TT1L 1KGYE 1DVFB 1SUXA 2OQJA 2YD7A 3FUFA 4P49A 1XF3B 2YYTA 4BE6A 4DIAA 2QFRA 3KZ8A 2FRGP 3P02A 3F00A 1IC4L 4HBCL 2CERA 5HANA 2IALB 3W11C 2Y8VA 4PWEA 3BJFA 4ICMA 4MLRA 4I0PA 3KEWA 2AEPL 3RTQA 4B2DA 3TA3B 5CS7A 1R3JB 3B5GA 3VIOA 4Q8NA 3QHNA 3RWHA 1UT9A 3D51A 3V9FA 3SE3A 4LBEA 2O4QA 5IVOA 3T65A 1WBYA 3SN0A 1J12A 2GAZA 3TM6A 1KB5A 2BLEA 4OOZA 1I7TA 1OOWA 2H6PB 3BUIA 4XC1L 3UG5A 3RKDC 2KL6A 2B7OA 2FZMA 4OT1L 1EZWA 1CI3M 3MOAL 3PBUA 4YCPA 3DROB 5AHNA 5EU4B 5CN3A 4XBPB 3UJTH 1XLDA 1QX1A 3HAEG 4QRPE 3T3ME 2YKLH 3TBVA 1RUAL 5A2KH 2ODIA 1CWYA 3U2JA 3NPWA 2JIXA 3PY2A 1HHHA 3JTSA 2BVEA 1BVLA 2LVEA 1EX5A 1CQKA 2N56A 1BJKA 2QVFB 3NIGF 5CZXC 3EGXA 1MRCH 5EG6C 5A6IA 1OBAA 4LBYA 5CEZD 1KT2B 5DS8A 4AQ1B 4FFWC 1LWIA 1R3TA 3HGJA 4OBTA 3W2LA 2FB4H 4Z3GA 4Y8FA 1AHWC 2G30A 1ENUA 3G77A 1VCBC 2OV0A 1IQDB 1MLCA 2G3MA 2XC8A 3BH9B 2ZX8A 3EGSA 4AI7A 4HBQA 3EHBD 4Y1AD 5EN3A 4IG2B 3UWQA 3H8NA 3Q6RA 3PXLA 2YUWA 3RK8A 4Z1PA 1P2CB 4K5MA 3WTXA 3LNMA 3SCUA 4X4ME 4H7ZA 2OTUB 4U6XB 3MVIA 5I6SA 5FF4A 2PRMA 3BJ91 5E08L 1F3WA 2BGNE 3TLQA 3O6LH 3WIHL 2YQ2A 3RIKA 5BV7B 2JKJA 3BAJA 4KC3B 5AKRA 2EYSA 2P28B 1ZP3A 2WC4A 3POCA 1CPUA 1X5KA 4Q9QH 3AW5A 2R1LA 1JHLL 3ULUL 4KETA 4HKBB 4PFHA 3KYOB 3W7PA 2IV9A 4UYPA 3TJIA 3O2WH 2WJZA 1URLA 1KNOB 3MHPA 5FGBC 3S4SG 3V5KA 1XR9B 3ERXA 4DUVA 4WNQB 4DCQB 1XCXA 4LAMA 1QKZH 2QV4A 2FTPA 1EO8L 1NAMB 1TZAA 1CD8A 4NFCA 1ZLWH 2R2BB 3U7WH 1ADWA 2FWOB 2V3DA 4HS8H 4K3EL 2YGQA 5DWPA 5KUMA 1E72M 3MQTA 3V6OA 2J12B 4JD4A 4WLCA 4NILA 4QHKI 5CSYA 2BPBA 5F3FA 4MXVE 4S10A 1H6FA 3GMPA 3CFKB 3LZFL 2CLEA 1T03H 5LB1A 1VZHA 1RUSA 4W85A 1NOAA 4KV5F 2YLAA 4LSSH 3U3HA 5TF0A 1L9OA 3FOMB 3NH7L 4PD4K 3EYOB 4HKXA 1FX6A 1UKOA 3AY4C 1EBAA 3B83A 5HHME 4KEMA 3QY8A 1MXGA 4HG4J 2BHUA 2BGJA 2F5AH 4H8VA 2B7NA 4HFWA 4JTCA 2Q7AA 4UTWC 4HHAB 4BRJA 2NSOA 1Z7JA 3QUKB 1H4PA 2KZHA 1NOUA 4TUJB 5BRZE 2I5IA 3B7YA 2BRQA 3NIGE 3GI8H 1I1WA 5CF3A 2BNJA 3WLJA 1E2WA 3U8GA 2FHCA 2EABA 2V5YA 1S1PA 3H4HA 3SY0B 1H61A 4Q4EA 1S3RA 4UM9D 5HHMB 1C1EH 3MROA 2JCCF 4ONGH 4MMZC 5F0JB 5AD0A 4EPBC 3FQRA 3RE0A 3D5HA 2CNDA 5FJPA 2WINA 5IMMB 2L7UA 5IOKA 25C8H 1LP9E 2YPKA 3N4FA 2OZ4A 2Z1SA 3FYEB 1PGRB 2EIZA 4UAJA 3BJLA 3FUEA 1F5ZA 1KA9F 3ZGIA 1FFTB 2Z6BD 1OIOA 2VDLB 3IJSB 1RZQA 3JWDC 4N2EA 1GORA 4WSJA 4YWGL 4WJ8A 3ZKND 4X6CA 5KVGE 5AOKA 4EDXB 4EE2A 1ZHNB 2P3EA 3BQ6A 2XIIA 4E9QA 3ZT5A 4OKVA 4Q7IA 3NDYA 1GEQA 4GFTB 1KC8D 2JKTM 2Y1ZA 3TMQA 3HPJA 3O6FA 4J3WA 4ELME 4FLOA 3UJ2A 3FN0L 4E9VA 1LDPH 1CS6A 3IVTA 4JCLA 1ZK5A 1ETZA 2WQWA 4M4PA 5E99H 3RY6C 3VXPA 5TPWH 4EX4A 2WKJA 4EN3C 1JCMP 1KXQE 3VO1A 1U92A 2WLMA 1USQA 5LG6A 4IPIA 2YQGA 1OXYA 5KVEL 4WFFD 3A12A 1BG9A 4BPRA 2VCAA 3MRGA 4ZOAA 1OGTB 4K7YA 4OZFG 3VNDA 5LIXX 4DPQA 2A6JB 2OMNA 3PL6B 4ZTOH 3SDCA 4RMSA 2ZTGA 1FG2B 3CGTA 3O8XB 4X6BB 5DC4B 2DY2A 1YPZB 4AKOA 5I17B 3KBMA 1CXEA 4X9FA 3IIOA 2BZNA 5GRJL 4PJ8D 1XBRA 2EXYD 4NUMA 3I6TA 3MVTA 1D9KA 5E1AB 1AGEB 1ZB5A 8CGTA 5GS2H 5H37H 1Q2SA 2WNQA 3MBXL 3MSDA 3RTQB 4KV5E 1USZA 5B21A 3RZCC 1WFNA 1WBXB 3SJZA 2GHZA 2VUYA 2VM3A 4UTCA 1E4KA 2FK9A 4NKQB 1OCJA 1XGZA 3VFOB 5E00B 4DNLA 5ADPH 2W88A 4IGBB 4WKXA 1J96A 5IMKB 2RAGA 4IL2A 5HVHB 2V68A 1W9PA 4PP2A 3ATAA 2XJLA 4YDLC 4X9IA 1QSFD 2XZQH 2YUXA 1SO6A 3V36A 3CMOL 3ETBJ 5LG1A 1GJWA 4WJ5B 3SOTA 4XNXL 1OSZB 2QTZA 2J6WA 1G7RA 3NIFF 5KVDL 2R0LL 4MS8D 4I77H 3TBVB 2QHAA 1TWZA 5BOOA 4X8JB 3ZYOA 1E5AA 2PZNA 4KW2A 3X1EA 5HYSG 1ZSDB 5GRVK 3UZWA 3EGXB 3B7TA 15C8H 3QUML 1P48A 2FJGA 1VKXA 1RKRA 2NPFA 2FO4B 3I9AA 3IJ6A 3RCNA 1XIJA 5C55A 4R5XA 1EAQA 4BZ1H 4OIFA 4IKIA 3G5WA 3HFFA 1VACA 4EI0A 1Z48A 2ZBTA 4OLUH 4HV8B 1PNDA 4P5KA 3WNOA 4PWGA 5MEPB 5IVXB 1FWEC 3TCSA 1E5NA 5IVZA 1Z8AA 1S38A 3WIFB 1LQAA 5FD0A 1K70A 1FAIL 3DOSB 2ZL6A 3W27A 2PDCA 4FFTA 2WYRA 2OTUA 4U6XA 4Y19B 4HUVA 3AO0A 2WYTA 3R8GA 5F7HA 1ITCA 5DY2A 3R1GH 1T7ZA 4K9EH 2YXWA 3LRHA 3CVIH 4RCZA 3HZVB 4KKAD 4I1NB 2W0FB 4WFFE 5DZVA 4CA4A 1WXZA 2AK1H 1OAXL 3NCOA 2H47C 1LWHA 2RGSA 4HQQH 4M03A 4JTRA 1DTUA 3NCEB 3QEQB 3RA7H 3OPZH 3GR4A 3PPFA 3QFSA 2HH0L 3TIEA 3KP1A 2MANA 3LAFA 3SDDD 4E0CA 1LO2L 4YK4C 3R43A 3OQEA 1PZSA 5I19L 1TEFA 3WJMB 1T83A 1ZHLA 2X4QA 3CP8A 3FH8A 3C5JA 4FQCL 4RGNB 3CHDA 2D8KA 3RVXC 3ZT7A 2YJQA 4N9CA 4LVDA 4N22A 3VYNA 4PMEA 1IAIH 5C0ND 4Q8MA 1ZANH 1FF5A 1SY6A 3QI9D 1L8NA 1Q72H 5D30A 5M03A 2APBA 4HPYH 3NZHH 4R2GB 4MJIB 3LK6A 4M1KA 3OL2A 4G7YH 3ZLHA 3VABA 4PRHB 1K5NB 4HIJA 3UBXB 2GVEA 3WJZA 4F7CB 4R34A 3D69B 3D30A 4KKSA 1FL5B 1UA6H 2EKSB 4OCYH 4WI0B 2VLLA 2AJYH 1GVOA 3NJFA 1OF6A 3KUMA 3BEWB 3ZT6A 4B3VA 3VH8A 3O3UN 4QGTA 4H8WC 3P9LB 1E3XA 1W3KA 5HWJA 3S3GA 5JQ9A 1J1PL 3UVAA 3MLPA 2ZQ0A 3ZM8A 1KCWA 1YE4A 5ISZE 4PC8A 3IETB 3S5SA 5FW7A 4NQXA 2D3VA 4N0UE 3ZYJA