4UZUA

Three-dimensional structure of a variant `termamyl-like' geobacillus stearothermophilus alpha-amylase at 1.9 a resolution
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
479
structure length
479
Chain Sequence
FNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGTVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGKAWDWEVDTEFGNYDYLMYADLDMDHPEVVTELKNWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYITKTDGTMSLFDAPLHNKFYTASKSGGAFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGGTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structure of a Variant `Termamyl-Like' Geobacillus Stearothermophilus Alpha-Amylase at 1.9 A Resolution
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 182
structure length 479
sequence length 479
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4uzuA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uzuA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uzuA01
2E9MA 3WDIA 1ZS2A 3WNOA 5JUVA 1OGSA 3AIEA 1OIFA 4MJ4A 3L4TA 1CBGA 2VL4A 4K68A 1WDRA 2ZUUA 4Q7NA 1CPUA 4OGZA 1R33A 4AW7A 4HOXA 3D4YA 4AY1A 1V3HA 1V3MA 2BY3A 5ABHA 2Y8VA 2CYGA 2ZICA 3MI6A 2WM0A 1XH0A 1B1YA 2WCSA 4DWSC 3RILA 3L4XA 3PZMA 3U7BA 4JFTA 1JL8A 2J7BA 3WD0A 4F9DA 1KR0A 3W29A 3DC0A 3VD9A 1V02E 2YL8A 5DO8A 1C93A 5A6BD 1GOWA 2G41A 1XCWA 3FW6A 4L4PA 1NM9A 3WY3A 2WVVB 1EH9A 4PSPA 1KCKA 3EMCA 2FHBA 2D24A 2VZUA 4AZ7A 1CYGA 2DT1A 4YPJA 1E3ZA 4FLSA 4HMEA 3VIHA 2VURA 1JYXA 4HPHA 2ZOXA 4D6HA 1EDGA 5EB8A 2C0HA 3RM9A 5BXSA 1OSEA 1UKOA 1FH9A 4JHZA 1OINA 4GQQA 3VDAA 1PPIA 2FE0A 3ZQ9A 5IFTA 4PSRA 4CD6A 1ZBVA 3DDFA 4W87A 3T08A 3CHFA 3O9NA 4UQCA 1UQZA 4GPNA 5JBEA 5D8WA 4QCEA 4NF7A 3CLWA 2WC4A 3I3BA 1UKSA 2QF8A 3WDRA 4W7WA 1LWHA 4DUVA 1SMDA 2F7RA 1GOIA 2PWDA 1VENA 4D1IA 1J18A 4JKKA 3UETA 2OYMA 2YLLA 3PZVA 1DEDA 4ZFMA 5E70A 5A6KA 4W86A 1V6WA 2NSXA 8CGTA 4Y7EA 1XH2A 4MADA 2PI6A 4MTVA 4L4OA 5I0DA 1H09A 4LQ1A 4BCEA 4FLQA 3VD4A 2PF0A 3L2LA 3RJYA 2E3ZA 2RGLA 1J9YA 1OT2A 4PMDA 3VIIA 3ZT7A 3SCOA 5HDRA 2DH2A 1OCQA 2BHZA 4CN6A 1MW2A 5IXEA 3WD3A 3KZSA 3SURA 3RDKA 3VOCA 1F4HA 1MXDA 1HJVA 4EKJA 2VMFA 3NUKA 1CGWA 4F66A 4HTYA 5BWFA 3BLPX 3N12A 3AMCA 5GNYA 1XD1A 4U2ZA 1Q6EA 1UYQA 5I5RA 3CZJA 3CC1A 4CD5A 4NI3A 3WL1A 3VGHA 2WWCA 1R85A 1V03A 1JD7A 1J11A 4J28A 3BH4A 4UR9A 1HTYA 3M07A 4AZIA 4CVWA 4M8UA 1HXKA 2C7FA 2EPOA 1UR9A 2FHCA 4PMVA 3W53A 3HMCA 5JIPA 3KLKA 3AXXA 4CU7A 2JF7A 1BG4A 4N0RA 3IJ7A 4B16A 2J4GA 3ZJ8A 1E6SM 1CTNA 1R47A 2O9PA 5E09A 1HL8A 4URIA 3SCVA 3WY2A 4C7GA 1W3LA 2OSXA 1LWJA 4W88A 2VCAA 3A3HA 5TD4A 4AEEA 2XVPA 4M80A 3WH6A 3TONA 3AIQA 4JCLA 3VNYA 3ARZA 3TTSA 4N42A 5HXMA 3A21A 2WZHA 1I1XA 1WAWA 3W26A 1FP9A 2OWXA 1MW1A 1BPLA 4QLKA 3OG2A 4GZIA 3DECA 3CUFA 3VM7A 2CETA 5DF0A 3MSGA 4CVUA 1GQIA 2J62A 4R5EA 3ZSSA 2WKLA 3NSXA 4OOZA 3QHOA 3VSVA 1E43A 2WZEA 3LX9A 1KBKA 1C7SA 4B3LA 2NT0A 5D8ZA 3AROA 2F18A 3L4YA 5BXTA 1LQ0A 2ALWA 3WMSA 3HU7A 5HOSA 3W81A 2VUYA 1E0WA 2CKSA 3ALGA 2D0GA 4W89A 3WY4A 3MKKA 1R7OA 1QI5A 3CUJA 2CIPA 3M46A 1H11A 1MYRA 1UHVA 2D0HA 4EAMA 2ZX8A 3UCQA 3WMCA 4DM1A 3AS3A 1HVXA 4PEEA 5LA1A 4M56A 4W93A 3VGEA 1J01A 4D72A 3IK2A 4PUDA 2VZSA 3POCA 1QI0A 1UWUA 2Y5EA 2BS9A 1Q6CA 1YQ2A 4Z2GA 1JZ5A 4DO5A 4MNJA 4XUYA 3HZ3A 2VRJA 3JUGA 1KGUA 2D0FA 4FMVA 1FHDA 3DX1A 2V3FA 5BYWA 2OWCA 1GW1A 1V3KA 3D5HA 1TE1A 3KE0A 4GO9A 4LPCA 5I79A 1U33A 2VJXA 2J79A 4QCFA 2J7EA 1E9LA 3VD5A 1BFNA 2RGMA 3MV01 2EABA 3DDGA 3TV8A 1C8QA 1DP0A 1US2A 1W1TA 3W27A 1TQVA 2WLYA 3L4WA 2VRKA 3AIVA 3FHQA 4J3VA 3BUDA 1UOKA 1TFVA 3BVXA 4ZEPA 3KLLA 4GI6A 2A3BA 2A3AA 1R75A 1GOMA 4CGTA 1US3A 4GIAA 4AIOA 4NSBA 2VVNA 1G0CA 1C3FA 4PRWA 4BQ3A 3BSHA 1M04A 3N15A 1CGTA 3AZRA 4OJYA 4P8VA 3MUAA 2G3IA 1HX0A 1EA9C 4J7RA 2WVVA 3EMQA 3N9KA 3BAYA 2O9OA 2WMHA 3VNZA 1V0LA 1PS3A 1JG9A 4S3JA 5IHSA 3UEQA 4AD3A 4PCSA 1O7AA 3CHEA 4AC1X 1KTCA 3UG3A 1FH7A 4AZ5A 4PMOA 3D52A 3PZIA 4D6JA 1PZ3A 5FL1A 1JDCA 4UQEA 2O92A 1QNPA 1EO5A 5BXPA 1NARA 2G8ZA 3WF1A 1DWJM 2G3NA 4JFUA 1UR0A 1WO2A 3AYRA 3DYMA 5I2UA 3T2PA 3N1AA 3WEOA 3UESA 1FH8A 1B3XA 3VMOA 2WMJA 4F9JA 4QLLA 5DT7A 2V38A 1ZBKA 2J78A 3KL3A 2VX4A 3AYSA 1VFOA 3CZ8A 1CWYA 4YN5A 5BCAA 1XYZA 1E56A 1V6UA 1JFXA 1XD0A 1E71M 2PWHA 1I1WA 3ARSA 4PMNA 3UR8A 1QVBA 4E2OA 5A94A 3EJPA 3PZGA 5EFFA 1KGWA 3AIRA 1GQKA 1KQZA 2PWGA 1JI2A 2VTFA 1UH3A 2ZXQA 4AMXA 2E40A 1GORA 1QNSA 4UZSA 2JEQA 1DWGM 1JXKA 1RP8A 1Q6GA 2XVGA 3VGDA 2FGLA 3LXBA 1VRXA 3SUWA 2F7QA 2FDMA 3FHAA 5CLTA 3E1F1 2WC3A 3VX1A 2EAEA 4ACZA 3ZT6A 3U57A 1VJZA 1V02A 3OLEA 2A3EA 3BMVA 2PBOA 3WIJA 1JZ8A 3PZOA 3EJUA 3BVTA 3QOKA 3VIFA 3BC9A 2ZUVA 3RPMA 5BXRA 1OGGA 3CH9A 3WNLA 2BY2A 1H49A 3A23A 3NSMA 1K6AA 1UWIA 3WUBA 3ARWA 2ZX5A 2WHLA 4BZYA 3CV5A 1QHZA 1PEZA 1Z32X 3EDJA 2BFGA 3AS2A 4UQBA 4H04A 5CZKA 4PMXA 3L4VA 1CXEA 3AZTA 1HNYA 1EQPA 2VR5A 1UASA 4ZXLA 1F4AA 3AIBA 3VTRA 3PZNA 2DPEA 4HZ7A 4TTGA 5A6MA 4MNMA 3WY1A 1GQLA 1ISXA 4C7DA 5AC4A 3BXWA 1G1YA 4UOZA 3MUY1 3HG4A 2VCCA 4AD0A 1GJUA 3N17A 2GJRA 1NWRA 1S46A 3EMZA 4Z2LA 2ZUNA 4AZBA 3VX0A 1VB9A 1LL7A 1W1YA 3BSGA 1BPLB 1B3VA 1QWUA 1E5NA 4AD4A 4EE9A 2IXVA 4WJXA 3WD1A 4E4PA 3LPFA 4TVCA 1JNDA 1W9DM 4ML4A 3LPPA 3LPGA 2EBNA 1MXGA 2VT0A 1WDQA 1L8NA 3WF2A 4PBGA 2Q8XA 4IPLA 1SR0A 3IGUA 1E55A 2WHMA 2W67A 1ZJAA 3IANA 5KZ6A 5LA2A 4CD4A 3K8LA 3N18A 4RE2A 4J3TA 1NWUA 1ZB5A 1JGIA 1R46A 4CN4A 1CEOA 1NQ6A 1JYWA 1HT6A 4J3UA 2FH8A 3CZSA 3SCRA 6A3HA 3GXIA 3MS8A 2BXYA 3BAKA 1KR1A 1OB0A 1ZBWA 1M7XA 3GZAA 2D20A 4A4AA 1UR4A 1PX8A 4HOWA 1QX1A 4WKFA 1HKIA 1MW0A 3L4ZA 1CGUA 4UQ9A 4XB3A 4Q22A 1A3HA 3S5YA 1UUQA 3MMDA 3VIKA 4DUXA 3VUPA 4W7VA 4XZWA 1V0NA 4JL2A 3A4AA 1BG9A 3AOFA 2J7CA 4M81A 1PX4A 2CHOA 2IXUA 3BMWA 1K9TA 2DQXA 5DT5A 3CPUA 1UA7A 1W9BM 3W82A 1EGZA 3RJXA 3GM8A 2XSBA 4AZGA 2XFFA 1UKQA 3GBEA 4MB1A 1UQYA 1E40A 5AYIA 2WZIA 3F4VA 4FLOA 3SCSA 2CBVA 2OSYA 1JI1A 4WSKA 3RM4A 1KXQA 4KMQA 1EOMA 2W5FA 1UD8A 2X0YA 2DT3A 4UFJA 3PTMA 2WMGA 4GINA 2XVNA 3I3EA 3T0AA 4D6GA 4UTFA 4WF7A 1ODUA 3GXNA 5C71A 2V3EA 2GSJA 1H5VA 1BVNP 4J3XA 4UNIA 3VIJA 1MVYA 2E9BA 4E8CA 1MFUA 4EK7A 3BUPA 5CJ5A 4GZJA 5C70A 1VEMA 1JNEA 2WVSA 1R87A 4JKLA 1QBAA 1HJSA 1C92A 2EJ1A 3AS0A 3HG2A 3MUIA 1CXIA 5A8MA 3WL0A 2WBGA 1JAEA 1QI4A 2MANA 2WLZA 4MJ2A 1NH6A 3VDHA 3L2MA 3VDCA 1PZ2A 4CKQA 3ARVA 1BGGA 5CSYA 2J25A 2XHYA 4CCCA 3WKZA 1H4PA 4U33A 5GNZA 4HA1A 3ZJ7A 2XTKA 4NZJA 3ARRA 4Z2HA 1ISYA 3LRMA 5AC5A 5IHRA 2VOTA 5KEZA 2J47A 4V28A 2UY5A 2G3JA 4IISA 1EQCA 1B9ZA 1W32A 4W5UA 4WKHA 3OGSA 2E8YA 4ZE5A 2O9TA 1JYVA 2XWDA 4TVUA 3FXYA 3AJ7A 3FAWA 5A95A 5CPTA 1SYTA 3U7VA 3K46A 3D3AA 1B3WA 2JE8A 2OWWA 5A8QA 1XSKA 3OGVA 3GYCA 2AMGA 5A6AA 3DX0A 4P7NA 3O2LA 1JFHA 2Z1KA 2CEQA 2WMIA 3OZOA 4UFMA 4TVDA 2XG9A 1RH9A 5CQ1A 3UG5A 3NDZA 3OIHA 5A6LA 1C8YA 3W25A 2W91A 4ACZB 4UZUA 3H53A 2XFRA 4AMCA 3RIKA 5CLWA 4OOUA 1E1EA 1DWIM 3ARXA 3WF4A 1B3ZA 1NOWA 1LF1A 4NRRA 2BHYA 3I3DA 1CLXA 4FNTA 1WZLA 3VGFA 3HN3A 3SUUA 3VO0A 3WH8A 6TAAA 3QHNA 4AZCA 2XWEA 5I77A 4OUEA 4GO8A 3WNKA 2XIBA 2JIWA 3IAPA 4JFSA 4GZEA 3U5UA 1GONA 1TVNA 4FNRA 1Y7VA 2Y8KA 2CERA 5A8OA 3SUTA 3DX3A 1TG7A 4OIFA 3W0KA 1JAKA 1GVYA 1E4NA 2VZOA 3AHYA 2ZUWA 2ZXDA 3WUFA 2E9LA 2GJPA 1WDSA 3EDKA 3T0BA 1UKPA 2ZWZA 3CUHA 2QPUA 3U5YA 4PYSA 1A47A 2WXDM 1OBAA 4JIEA 3THCA 1R34A 2VCBA 3VDBA 2CITA 4BF7A 1HJXA 2O9RA 1FP8A 1H0IA 4XZBA 1K9DA 1XCXA 1KCLA 2QPSA 3VMPA 2CKRA 1E73M 3ZIZA 3SUVA 3ZR6A 1B3YA 2DSUA 1H0GA 1Q4NX 3O6AA 4MDOA 3D50A 1DWFM 4CD8A 2NW0A 3GNPA 2JIEA 4PN2A 1TQTA 1G94A 3MO4A 4KWUA 2GVYA 4UQAA 3ARYA 4LX4A 2J7HA 5HNNA 2WHJA 2DSKA 1W2VA 4TTUA 4CN1A 3HG5A 3WENA 4D71A 1WZAA 2DIEA 4CD7A 4MPKA 3ZM8A 4D6IA 2JEPA 4JFVA 1PAMA 4GQRA 3GTNA 2DGAA 2BV9A 3VILA 3VU2A 2GDUA 3S5ZA 4M1RA 1HF6A 5GQBA 4LYPA 3KEHA 3WUGA 3DX2A 3NDYA 4ZXOA 1CENA 1AQMA 3SCNA 2ZXAA 4QLJA 3DHPA 3WDJA 1EDQA 1H2JA 4A3YA 2EQDA 2VZTA 2OW7A 2B31A 2DT2A 2QMJA 2EO7A 3BVUA 1XHGA 4H8VA 3NSNA 2J7DA 1JDDA 2GFTA 4TUFA 2WBKA 5AYBA 2ZUSA 1O7DC 5JBFA 4PTVA 1B2YA 2PWFA 1BGAA 4U3CA 2D22A 2EPMX 2J74A 4R27A 4FNQA 2IUZA 5A6BA 1BYDA 2WB5A 5A3HA 1W3JA 2VZVA 1KXVA 3S6TA 1TCMA 1E3XA 1UR8A 2WAGA 3VIPA 4EANA 4H8UA 2WCAA 3F5KA 1HKKA 3T2OA 4H41A 1UD4A 2WYSA 5FL0A 3TTQA 1WZKA 1J0YA 4IUGA 2QV4A 5E0FA 1QNQA 3S2CA 4AISA 4FNPA 3RO8A 3B8SA 1CXKA 1R7AA 9CGTA 1XRVA 1CZ1A 3WFZA 3IJ9A 2W63A 1LG2A 3VD7A 3GXFA 3GH4A 1ISVA 1QPKA 3DYPA 2WSPA 1TA3A 3SIMA 3CGTA 2EPLX 4JL1A 1B31A 1PBGA 3F5LA 4WIWA 4MAZA 2XFYA 6CGTA 4M24A 2CXGA 3WNNA 1HVQA 3W6LA 4Z2JA 1BAGA 4OBSA 4P7RA 2XSAA 3QR3A 4ATDA 2DSWA 3QOMA 4P7LA 3GNOA 3AHZA 1QI3A 1H3GA 2OYLA 3ARQA 1FFQA 1LL6A 3A24A 1BSIA 1B90A 2ZUTA 4JCMA 1C7TA 1EHNA 1HJUA 3WBAA 3BLBA 2WKGA 4ATLA 3CZGA 4UFKA 1O6IA 3ZSTA 3LXCA 2EPKX 4FNSA 1XSIA 1WB0A 4OZOA 3A6OA 1NP0A 1NP2A 5DMYA 2E8ZA 2F7PA 4E8DA 1KBBA 4V27A 3GH7A 4V2XA 2YJQA 1OT1A 5E1QA 4NXSA 2ESCA 2DT0A 3AS1A 1E5JA 1VAHA 5IFPA 2DSZA 3MMWA 1B30A 3WDPP 1EO7A 1PJ9A 1EHAA 4S3KA 3KL5A 2CBUA 3EJTA 3GBDA 3PZQA 1BYBA 5D9NA 1CDGA 4LGXA 2IGTA 1GOQA 3G6MA 2QMKA 3ZO9A 3WQ6A 3VPLA 1WCGA 1BYAA 3VGGA 4MB5A 1HL9A 5CG0A 2WPGA 1FFRA 3PTKA 2ZE0A 2GK1B 1GJWA 3TOPA 2WMIB 4D6DA 2J77A 2VVSA 2CPUA 2DEPA 3FY1A 2WCGA 5ABFB 4XV0A 3VD3A 3BCDA 1GCYA 5M17A 3AI0A 5ABGA 3GXMA 2EADA 1JD9A 2JF6A 4B15A 3GH5A 1JZ4A 1JZ6A 3WF3A 2XYLA 2DH3A 2X0HA 4NRSA 4UOJA 2XPKA 3OZPA 2UY3A 2WVTA 1OWQA 2GK1A 1IT0A 3N11A 4AZCB 1KWKA 3BLKA 5FKYA 2V3DA 1UZ4A 4J3WA 4DO4A 5ABFA 1BF2A 3VKKA 3PTQA 3D51A 5DEZA 3B9AA 2VR4A 4JFWA 3CMGA 4ACYA 1H41A 2WVUA 1PIFA 4U5KA 1R86A 5A6JA 4J3SA 2Y4SA 1EDTA 3CUIA 1RPKA 2XN1A 3SCQA 4AD5A 3IAQA 2WSKA 2QLYA 1TZ7A 1ZBCA 2ZX9A 3PZTA 2FH6A 1N82A 1QW8A 1D3CA 3LRKA 3LPOA 4GXPA 3WNPA 4UCFA 1E6XM 2VI0A 3WEZA 5D9OA 2CBJA 2ZXBA 3APGA 3MMUA 1CXFA 5BRQA 3L4UA 4P7QA 4PMUA 1D7FA 2X2IA 4HZ8A 4RE3A 1GHRA 1TMQA 2YA2A 1E6NA 1W2PA 3WBEA 5A69A 4PMQA 4AIUA 2YOCA 1HKMA 1MW3A 5I6SA 1HJWA 1KXTA 4AIEA 3CHCA 4KRTA 3SUSA 2WMKA 1JZ2A 2X05A 2BNJA 4HMDA 1RD6A 1HJQA 2CHNA 4XX6A 1C91A 3B9EA 3HJEA 3AMKA 3BUIA 1GZJA 3BCFA 4KGJA 1WKYA 2D3LA 1DHKA 2XVLA 3OLGA 1ISZA 3QHMA 1E15A 5BRPA 1BVZA 2OW6A 4C7FA 1LL4A 2UY2A 3VGBA 2ZUMA 3AQUA 3VVGA 2YFNA 4QAWA 3VSUA 3AXHA 1MQRA 1CIUA 2A3CA 1ODZA 2PC8A 1GUVA 1GQJA 1OGBA 5M3WA 3G6LA 3ARPA 2F1AA 3OA5A 4AD1A 2CNCA 1IZKA 1HP4A 1UWTA 2HVMA 3T2QA 1LLOA 3WEMA 5IDIA 2WANA 1FA2A 1CGVA 3K8MA 5A1AA 2OSWA 1E4IA 5EFDA 2GDVA 3CHDA 3W28A 1W3HA 2BY1A 3BGAA 2YFOA 3LXAA 2VX5A 2YDQA 4HZ6A 1H1NA 3VSTA 1E0XA 2CBIA 3ZJ6A 1AQHA 1Q6DA 1ITXA 2EXOA 1UWRA 1UD5A 4W5ZA 1V3IA 2OLHA 4D1JA 4U2YA 3TTYA 1E6RA 2XN0A 3W38A 3K4AA 3CTTA 1KB3A 3AICA 1TA3B 3WQWA 1NOUA 1SZNA 1BTCA 1ESWA 5BROA 1LJYA 1UR1A 5CGMA 3OLIA 3M6DA 4QDMA 3GXTA 5HPOA 4GKLA 4YHEA 2JALA 1B0IA 1G5AA 2XGBA 4M82A 3TP4A 4HU0A 8A3HA 1BYCA 2G3MA 3DYOA 1CECA 1D2KA 5E6ZA 5A2CA 1Q6FA 4RE4A 3EJSA 4HP5A 3B9DA 3A47A 1CXHA 3VIOA 5HPCA 2BVYA 1TR1A 1JIBA 1DWHM 2PWEA 4FF5A 1NOFA 4MB4A 4BA0A 4DO6A 4HA4A 4X0VA 5I3DA 2VO5A 1VIWA 4CU8A 2V3GA 2ZIDA 4H7VA 1UR2A 2VQUA 2G4FA 3WH5A 1LG1A 1W1VA 3LMYA 1HIZA 4UFLA 4CU6A 1CXLA 3TTOA 1J0HA 1E1FA 4MNKA 1C90A 3T09A 4W8AA 3HG3A 3N04A 1M01A 3WH7A 3CIVA 2YLAA 2GJXB 2XIIA 3AZSA 2VC9A 1T0OA 5I24A 3AHVA 2F7OA 4WK9A 4FLRA 5CPSA 2Y24A 4CUCA 1QI2A 1W9XA 5I23A 2JFEX 3ARTA 3PZ9A 2FYVA 4GI8A 1W1PA 3VIGA 3WF0A 1MQPA 2J8FA 1KFWA 2YL5A 5FOOA 3EBVA 1V3LA 4BQ2A 3BVWA 1GOKA 2BHUA 1X6LA 4F79A 1W91A 1GOOA 2GJXA 3H55A 5LA0A 1WNOA 2ZX7A 1GHSA 1UD3A 1KQYA 2A3HA 4A3HA 1DTUA 4U3AA 4HU8A 1YHTA 2YL9A 3EYPA 4X9YA 2CCRA 4W84A 4AZ6A 4PCTA 4AEFA 4WLCA 1EXPA 3NYDA 4P8WA 3AFBA 4D6CA 3MV11 4F8XA 3WD4A 4PTXA 1KWGA 2ZWYA 4FK9A 1WE5A 2X8RA 3AHTA 5M03A 3BVVA 4P7OA 5EBAA 4U31A 4H8HA 3N13A 5AY7A 2FGZA 1JYNA 1HXJA 3WD2A 3WDHA 3AIWA 5HBFA 1I75A 3AHXA 2WW5A 3K4DA 1W9UA 1VEOA 2XM2A 2AAAA 4ZENA 2W62A 3AXIA 4B9ZA 1E6PA 3UR7A 5FIPA 2DIJA 2X2YA 2NT1A 2X2HA 1U2YA 2DDXA 2BVTA 4AYSA 2WMFA 4AXNA 1E6ZA 1HKJA 3PN8A 1XYFA 5CPQA 5M5DA 1E0VA 2V5CA 1VFMA 1V0MA 3AISA 4BQ4A 2TAAA 2YA0A 4OKDA 3F5JA 3WN6A 1J0JA 2E0PA 3CUGA 2YDSA 1UWQA 3BAJA 2X1IA 2GUYA 1V0KA 2VQTA 2VX7A 1V6YA 3D4ZA 2XVKA 1GVIA 3ZT5A 2X09A 4TX8A 1J10A 1MQQA 2HISA 2XJ7A 1M03A 1QWNA 4RL3A 4JHOA 1AMYA 4AZHA 3WNMA 4W85A 5GPRA 4BS0A 4KGLA 4CCEA 3SCWA 1VJSA 1MWOA 1QW9A 2F61A 5EMYA 3WSUA 4UFIA 1XV8A 1JZ7A 3AMLA 1K9FA 3T0DA 3DX4A 1TQWA 1VBUA 2WHKA 4Z2IA 2PB1A 2ZX6A 4WSJA 3EDFA 1ZU8A 2W4XA 3KWXA 3BAXA 3WUEA 3THDA 3ZMRA 4W8LA 4WKAA 2BY0A 4LXFA 1HWWA 7CGTA 3VIMA 4YHGA 1RP9A 1QNOA 1PX3A 1UWSA 2C8NA 2YDRA 3MUZ1 3BAIA 1X6NA 2V5DA 1OM0A 2EEXA 3ECQA 1UD2A 4HPGA 1J0KA 3MU7A 2CESA 2VX6A 3UERA 4IM4A 4UQDA 5LYRA 1VBRA 1C8XA 1E6QM 2XGIA 1XC6A 2YBTA 1TVPA 2XM1A 2F1BA 3KL0A 4JKMA 4M29A 3W6MA 4H2CA 4DWSA 3PHAA 3K8KA 1UH2A 1KGXA 1KTBA 3W37A 4U5IA 3BAWA 1CGXA 4W8BA 1ITCA 1JF5A 3WQ5A 3VINA 3ALFA 4MNLA 4CCDA 4IPNB 5ABEA 3AIUA 1TQSA 3LRLA 5F7UA 2EPNA 4QP0A 5D9MA 1JF6A 3WFLA 7TAAA 7A3HA 3CBWA 1UKTA 4PTWA 4DWSB 5JIWA 2W92A 3UG4A 1UZ1A 2J7FA 1WZMA 2XN2A 2WNWA 3QGVA 3EJQA 3CMJA 2YIHA 1IV8A 3RCNA 3DHUA 1TQUA 2AOSA 5I78A 4ATWA 1XH1A 1E70M 2UY4A 3IJ8A 1WDPA 4D6EA 1EIBA 3NCOA 4D6FA 3W4RA 1CGYA 3EJRA 2QHAA 4PMZA 3WQVA 4PTMA 3EDEA 1V6XA 3GNRA 4OBRA 1UG6A 1G9HA 1V3JA 3FNDA 3AMGA 4Z2KA 2YBUA 4PUEA 1KXHA 1QOXA 1NWSA 4W7UA 1J0ZA 4BQ5A 1M53A 5E0CA 3WQ4A 2D73A 1HP5A 4X0NA 4LYRA 4DWSD 4HMCA 1L0PA 1OIMA 3AMDA 1WP6A 5CGTA 1R8LA 3GXPA 1WPCA 1E4LA 2WK2A 1G01A 3A4XA 4KH2A 1SMAA 3CO4A 1J0IA 3II1A 3PBGA 3GDBA 4NZFA 1CLVA 4NZCA 1QHPA 1QNRA 3BUQA 3CZNA 1FOBA 1NWTA 3OLDA 4UOQA 4PMRA 2YKKA 2F2HA 1ECEA 2D1ZA 5GNXA 3PZUA 4AWEA 4B3KA 1IZJA 4TXEA 5E9AA 1VFUA 2Z1SA 3ARUA 1V08A 4TX6A 4HA3A 5A2AA 3A22A 2Y2WA 4MDPA 1GNXA 3CZLA 5A8PA 2BVDA 2J8GA 1OD8A 1BLIA 2W61A 2YL6A 1XSJA 3WDQA 1JDAA 2FHFA 5CXPA 2W66A 3SCPA 3SCUA 2J7GA 4AD2A 3VM5A 1FHLA 5A2BA 4AMWA 3FAXA 1W9VA 2WWDA 4ZE4A 1SFSA 2DSVA 2E4TA 3ZR5A 3MSDA 3WH9A 1XGZA 5A8NA 3M7SA 4P8XA 3BUBA 5JBDA 3CZKA 2X2JA 4NXKA 2D2OA 2F8QA 3A4WA 3ZJKA 3EDDA 3OBAA 2UWFA 5C8BB 2J75A 1UA3A 2VRQA 3SCTA 1W3KA 1PIGA 1JXJA 4FNUA 1DWAM 5E6YA 4DUWA 4P8UA 5D9PA 4KRUA 1J12A 1EOKA 3NIYA 1ZJBA 3A5VA 5DFAA 1BHGA 3WQ8A 2VNCA 3MANA 5D4YA 5CSUA 1ISWA 1W9PA 1AVAA 4NX0A 1JZ3A 3OGRA 2OYKA 3VMNA 1P6WA 1V6VA 1QBBA 2YA1A 4DM2A 3TA9A 2D23A 3J7HA 1TUXA 1QHOA 3FN9A 5FD0A 3OB8A 4LYQA 1GPFA 2BXZA 4JAWA 4MAVA 5FCZA 4MB3A 5A6SA 1OD0A 3POHA 2XUCA 3GXDA 1VF8A 1E72M 1ZL1A 1MFVA 3WELA 3NJ3A 3K1DA 4QFUA 2EACA 4B9YA 1AQ0A 4TOQA 1X1NA 4AYGA 2D3NA 3RMEA 1K9EA 4J27A 1UD6A 1U30A 3W24A 2PBGA 1VEPA 4UFHA 3CZEA 3ZOAA 1E4MM 3WMBA 4JZ5A 1UH4A 1BQCA 2WC7A 3H54A 4PMYA 4GI9A 1CNVA 3RM8A 4HOZA 1HN1A 1VFFA 3SEPA 5ECUA
chains in the Genus database with same CATH superfamily
1NDGB 4ZB0A 5JPNB 1XEDA 1ZS2A 3EXRA 3FHEA 5KN5B 3UAEA 1AD0A 4P2OD 2JWYA 3MJ8B 2O5YL 2ABAA 1OIFA 3R10A 3L4TA 4MJHA 4LAJH 4BK8A 5CLZA 5FYKL 2IALA 1XXXA 3E02A 1ZLVH 4S3DA 4AW7A 1H1ZA 2ZRWA 4M6OH 1J5OH 4AY1A 4M7JL 3RWIA 4KWWA 1Q7YD 3C8FA 2APXA 3VXRE 1AO7E 4JKNA 1GVEA 3M43A 4HCRH 5HHVH 2YD7A 2ZICA 4KHXH 2HVOA 3D09A 2P5WE 4C6LA 3IGLA 4C59B 2V0AA 4GSXA 2DERA 1I7TA 3DIDA 3HN8A 4OJFH 2QVHA 3FFCA 1LILA 2YX0A 4V11A 1AOHA 2DQFB 2MRYA 1GRWA 2IH1B 3QR0A 4TNWK 1ZT4B 4ZSTA 5B38A 2WCSA 4S38A 4PB3A 2PP8A 1FORL 5CEZD 2J7KA 5IT2H 1WFMA 3PZMA 3U7BA 1JL8A 4AG4H 3AAZB 4M7LT 2KI6A 4U1JB 2CQVA 1P5VB 3GB7A 4XN8A 2BFVL 2F1EA 3O3AA 3ROLA 4KV5F 3DOPA 3H1ZA 1E42A 1B4JL 1O12A 4L4JA 1FWRA 1U8QA 4MD4A 1C5DA 2YL8A 1IEXA 5A6BD 3ZE1F 4WV1A 3X1BA 2X40A 3FW6A 4YSQA 1GOWA 1WDWA 2E4FA 4MCYA 3CFBB 2XOKA 2EIZA 2V9QA 1GTNA 1VQKB 3BGJA 3ATAA 4NRYA 3QRHA 1PF3A 3RWCA 2PLTA 4S1SL 1ACYL 1J1OH 2ITCA 2KLRA 3MN8A 4UU9A 3EMCA 3MUXA 4AZ7A 1ZAHA 1CYGA 4BFIA 1ILSA 4RFEA 4WHCA 3FO0H 5JMOC 4GRLC 5AKVA 1IHMA 3K6OA 3QG6B 4XCCL 1N5AB 5DZAA 5C0BB 3NABH 2C6QA 2VURA 2BP3A 2PCPA 5DUBB 1LK2A 3ZLQC 2ZOXA 4A55A 1EDGA 2KQNA 5BXSA 3U0TB 3AVEA 4KX8A 3ZKXB 1P84K 2CMRL 4JDYA 1U2RA 1R5IA 1UKOA 1QOQA 1TYEB 2J55A 3BICA 1ZM9A 4ZCIA 3O0RL 1KFBA 5K4XA 4GQQA 2H3NA 1N2RA 1YYML 3EADA 4QWWC 5K5YA 1KB5B 1NBYA 3KPMA 4ZS6D 1XJBA 3DO3A 4DVOA 2VAAA 3T8XB 5JIIA 1TUPA 1OWRM 5E08L 1IXPA 1XF4A 2GJZB 2O4QA 4Q8PA 2OTPA 1EWHA 2NNXA 2HJFA 2FB3A 3TNMA 1YMMD 3B2UC 4S3EA 5JR1L 1NDTA 3CHFA 1I1AB 1WFNA 2IQ9H 3S46A 2X6MA 1JNNL 1J9RA 4GBXC 1G7LB 1UZHA 2V5LA 4QCEA 4ZJ9A 5FGBA 4NF7A 3ARDD 2RFXA 3TWCH 4I0PB 4PJ7F 1NWOA 1VQ6B 5DRZA 1LWHA 4W7WA 1GW9A 3WDRA 4LCVA 4G6FB 5TQ2L 1SMDA 3P11H 4V2BA 1XISA 4QRRB 2DJ4A 3AABA 5KZCD 2VP8A 1N4XL 4X8JB 2V7NB 2AI0H 2WCPA 4IK7A 3GWQA 2EIMB 5DJDB 4MLSA 3KPRE 2G0LA 4L4VA 5MERA 1Y5XA 4RV3A 4ZFMA 5E70A 5JHLH 3S5LB 4BKSC 3D34A 3V4VB 1TELA 1V6WA 4HB7A 4W86A 5CPLA 4P2QE 2YEZB 2NSXA 1XH2A 3FRPB 4WDIA 4Y1AD 1KJMB 3QJXA 4P23C 4TSBL 1MQKH 1RAKA 3RWCB 4QM1A 4F0HA 2QHLA 3THQA 2I60L 4EQ3A 3QC3A 4LQ1A 4YBQC 1EX0A 4L18A 1QSVA 4NO3B 1WUFA 3WLOA 4FLQA 4QHKJ 2PRMA 1BFTA 2QEJA 2ETWA 3RJYA 4NC0B 2XA8H 4HXBH 2E3ZA 2PP3A 4RCZA 1YEHH 5TPWL 4C60A 1AXSB 4MA1B 4LU5H 4NYLA 4Y16C 3QLDA 1JPST 5D7IE 5ES4B 3RIFK 2BHZA 1DQDH 2X30A 1MW2A 5GZOC 4D3CH 2JQMA 3CWGA 2HPMA 4WW2A 5SWZE 1I2QA 4XMUA 1AIFA 1NM4A 4M5SA 2ISSA 4HYVA 1HC1A 1RU9L 3MBEB 1ICSA 5JW4N 2IO5A 1W3TA 3QO1A 2NQCA 1MXDA 2F43A 2LQRA 3BRGC 3ROOB 2Z93B 3TF4A 3HRZB 1XZWA 3VOJA 2JKXA 3BLPX 2PDBA 3ZU8A 3I75B 3ULUE 3N12A 5GNYA 1H15A 4IGMA 2NYYC 1QUPA 1R5WA 5J89A 5XIAA 3AXLA 1IILE 3AZUA 4XAWL 4A7UA 1BWKA 2BOCA 2H7WA 1A0EA 3CZJA 1LEIA 5ELIA 4O9HL 1A4BA 1SN5A 1ETA1 1P2CB 2XZAL 3C5ZA 4G9FD 4UZEA 3UO8B 1KELL 4PJEE 4IGBD 1PFOA 3N85H 1KNOB 4YDIH 3UTZA 3IKCA 1R85A 1V03A 4IJBA 4Z76B 1JRCA 2HTMA 4CQJA 3QKZA 1MCRA 3G77A 2IGLA 2F9BT 4GJJA 4P5TA 4FFZL 4Y5XA 2V4DA 2ICWJ 2PYFB 4NENB 3O45A 5GGVL 4AQAA 2FPTA 2NXHA 3CEUA 4IU2B 3BH4A 5F6IB 3CHVA 1AFSA 3IGSA 2EDBA 3HAEB 1M9WA 1HTYA 3KVPA 4HTBA 3XIMA 1VFSA 1MFMA 1TETH 3ZY7A 2Q8BL 4AZIA 1N8ZB 4K23L 4CVWA 1MFNA 2DQCH 1FNSH 4O0ZA 3SHSA 3GXUB 4C6FA 1LNUA 4PMVA 4TMPA 5D71H 3WAKA 1Z9NA 4TS6A 3C12A 4LEOA 4P9HH 5DFWH 1TPUA 3GS7A 2ON3A 4AWTA 3F6JA 2C9QA 3HMXL 3LSOA 4MY1A 1ML1A 3V5HB 4OTKA 1R19A 4N0RA 3ZDZE 4I0PD 5ACZA 4X4KA 3PQYD 3G6EB 3QIUC 5C2GA 3RLVA 4HS3B 4NLHA 2Z91B 2X4RB 2YC1A 5C08D 1I3RB 4QYAA 5C7XH 4W6YB 1E6SM 4IJCA 2CZ5A 3M1OA 3MBXH 1G84A 1CTNA 1JUFA 3R19A 3G04B 4HWBA 5JIDA 5DQJA 2F84A 1HYSD 2C15A 3FONB 3MNWA 1QEWB 4U6HA 5HHMD 5D7LE 3SCVA 5F1IB 3WJYA 1NGXA 4HCDA 4L8JA 2OQJB 3WY2A 4PUBL 4C7GA 3NP3A 3GHEL 3QE2A 2FQGA 3TO4B 1S9YA 1QR7A 3FA3A 3VKDA 2CDGA 2OSXA 4FDWA 4YEEA 3SZKC 3GG7A 1KYAA 5IUSA 1YA5A 3Q65A 1HKVA 1C1EL 5AW0B 1U8KB 3K72A 5ESAB 4JFZL 4PJ6A 1M1XA 4OPVA 4CVZB 4YZWA 2PTZA 3BV7A 3DX8B 4LSBA 3A3HA 1D5BA 3WHXB 5TD4A 1L2UA 9XIMA 2IPKB 2VFEA 2XVPA 1MVUA 1A21A 1JTTA 3QUYB 3NZSA 5DD3L 3BH8B 3TH3T 4X5XB 4X9FA 5CZSA 1WHPA 5FNZA 1PZSA 3HR5A 1OF2B 5EZJA 4YXLL 4IQLA 3LLXA 4KH9A 2WXFA 2OMTB 3EH4B 2A0LD 4I89A 3QDAA 1UP0A 3BLEA 4N6RA 1I9JH 3L4CA 2WZHA 4YH6A 2YD0A 4NN7C 3S4SA 1VIZA 2YYTA 2E6YA 1COWA 3F62A 1FP9A 3SE3A 1BPLA 4TLKA 3E8UH 4MVBC 3EFFB 1O0VA 4F66A 3OKKA 4JPKL 4KTGA 1DHPA 2W0FA 1NCTA 4GZIA 1RSYA 3LKQA 3RWEB 5JOPE 4ADSA 1U8PB 3N3EA 2IPTH 4MAYC 2ARJB 1H8LA 4QRUB 4UV7H 5FF6B 2CETA 2JB6A 2OTLB 2X1UA 2R1WA 4OLYH 3WKML 1H8HA 1QFJA 4CVUA 5CS7A 4ZFFA 3LEPA 4MIMA 3WS6A 1DQJB 2NUPA 1OKEA 2YAPA 4HIIB 5FR3A 3TH6A 5JUEH 3KXQA 2VEGA 2BSEA 4LLWA 1RERA 3QEHB 5EBWA 3Q44A 3P80A 4HAGA 4KESA 3QHOA 1YEKH 3F5WA 3DK2A 4U1GC 1KCWA 1E43A 1MWAL 2WZEA 4RDWA 1C7SA 1A9EA 2NT0A 1AZRA 5IP4A 5I1GL 2QLVB 5IMLA 3GMRA 2H45A 5FECB 4Z1BA 4DQAA 1RI8A 2ALWA 4LPYA 1LQ0A 2OTJB 2RJGA 3BCJA 3X3GH 1D5MA 1SM3L 5HOSA 1E0WA 3QIBC 5DZPA 3GJFA 2RIKA 4NN5B 1PO9A 3E2VA 1KGCD 3VH8G 3DSNB 4H6KA 4HS6A 1XLGA 1NAKL 3MKKA 5FEXA 4XMZA 4WY0A 1CDHA 2DMBA 1MUMA 4HXAH 1FYTA 1X7FA 2E6JA 3EYQC 1L4IA 4M3JA 5EIVA 2OB3A 4Q6JA 4EOUA 3S48A 3NYKA 4EAMA 2Y3NA 3N40F 2YAMA 1Q66A 3WMCA 1R3SA 3TFKD 4AJWA 3MACH 1HVXA 1EVUA 4I6KA 1GHFH 4DPQA 3HC0B 2C18A 1DVFC 2FUQA 2OT1A 5AYUH 1PZ5A 4HKJA 4RM0A 1T7LA 3SI9A 1YI2B 1IQDB 1MRCL 2YYUA 5A8GA 3CHRA 4M4RB 3BN9D 1FH5L 3SD5A 1IM9D 5AHIA 1X5FA 1PG7H 4G8EB 3BPNC 5E2UH 1T21B 4KKLD 5I71C 1T4KB 3VG9C 1Q6CA 4M02A 5D6DC 5FB8B 4IJTA 4MNJA 2DJMA 3FIGA 5M1TA 1GKEA 1TTBA 4BKNA 1OGPA 4P5MA 5H37H 1KGUA 1Z9PA 2CKBA 1IGML 5HJ3A 4ZGQB 4WUKH 1MELA 1ZANL 3GUFA 4YFLI 4XCFH 1EQWA 1HE7A 4IRJD 2G2PA 3I74A 4H6RA 1UZ8B 1SDAB 3T0ED 1M57B 5T3ZL 1JPGA 1Y0YA 4O58H 1V3KA 3QXBA 5IMKA 1AD0B 1JVKA 5C0FA 4GO9A 4LPCA 1BD2D 4CNIA 2ZOLB 3B97A 3RFZC 4QHMB 4JM4H 5FDWB 3FJNA 1Z6KA 4HNCA 3VD5A 3IV3A 5I75B 4XGZA 2FBJL 1A5UA 2RGMA 4JFFA 1NANH 2N1KA 2EABA 2XGZA 3TV8A 4PJAA 3I10A 3G9VA 7XIMA 3RWIB 1NAMH 3VNVA 1C16B 1C8QA 1X5JA 1DP0A 2NYYD 1KV5A 2DLGA 3VRLF 1EV2E 1IJEA 2QADD 3F1QA 2DQJL 3ANVA 1TQVA 4MNHB 3VXUE 4C6PA 3C9NA 3L4WA 4X98B 2VRKA 4M5YH 4AMAA 1O9WA 1TFVA 2DQFA 3I6GA 2HT2C 3KLLA 2A3BA 4WDUA 1EK3A 1AH4A 5D05A 1R75A 3HNVH 1ETZA 1OAZL 1ZVYA 3KBSA 3T0TA 2B5IC 2QSQA 5H94A 2QSCH 4AIOA 2I60H 3GLZA 3GQFA 4KKQA 1MCWM 4N5EC 4YDMA 4Y2DB 5AG8A 5JQ6L 4FEMA 1LQAA 1E0OB 2NY2D 4OCSH 3WFHB 1M04A 4A6YL 4HCHA 2PD9A 5GRWA 1QGAA 1BQKA 2MOVA 4A7TA 4AGNA 2F08A 5E7FA 2B3RA 1FCBA 3FYPA 4YN5A 3WLMA 4C6BA 2VQ4A 1WSVA 4JFXA 4DZBA 2C71A 2EG8A 3NEVA 4GZ7A 4K2UL 3VI4F 3AYTA 1D8WA 1KDJA 2H32H 1TV8A 4OJYA 3UMNA 1M6UA 1T1ZB 4JQAA 1A0QH 1ETB1 1ZHNB 3GZPA 4NHUA 4P2RA 2X4SB 1EA9C 3V0JA 3EMQA 2ED6A 3N9KA 1S6NA 1HI6B 2FX9L 4NKIL 3SQOL 1MCSA 3F6IA 3C6SA 2VISB 1OGTB 1R0MA 4YVVA 2CKNA 4LS1A 1ADQL 1IEQA 3IRSA 3MRBB 1H3XA 1IEAB 5J1SC 1PS3A 1JG9A 1S38A 3KVJA 3ATFA 4S3JA 2YW3A 4DP0X 4JDEA 3UEQA 2IAMD 4AD3A 1E0UA 5F2IA 3QG6A 2E56A 1O7AA 1TPH1 4HE6A 3HE7C 4KKAD 3VXNB 2ZRYA 4FSAA 2EDMA 4WWOA 3ZL1A 1EUAA 3DV6A 1AKJB 1QPOA 3UG3A 4UM9D 4M8RA 5CINH 5FJUA 5JYMA 2ICEC 2BWIA 3AB0C 3D52A 3MV7B 1KKRA 4PMOA 4D6JA 5DHDA 3N2OA 5FL1A 1HOCA 1DVZA 1JDCA 2AVFA 2I9LB 3S96B 1BQSA 4O8AA 1EO5A 1OW0C 1RJLA 4LUJA 3HZVA 5BRBA 2EE2A 5LO7A 4YSSA 3APNA 2X1WL 4CVXB 5T3ZE 1FNEB 1HWGB 3DX5A 3SKBA 2VAAB 1ORQB 2VDNH 3T8XA 1DWJM 1G9MC 3B6SA 3O9WC 4NT6B 3SE9H 5G4HC 3ZWTA 3NAAL 5JORA 2OMAA 3I9GL 2ZCZA 2PTVA 5A2IH 3IGFA 4NP7A 3W7HA 3UPBA 1Q86D 3U9UA 3QUHA 3VI3F 1MAJA 1H60A 3HG1B 1K5WA 2WGNB 3CXCB 2FO1A 1B3XA 1YJDC 3NCEB 4BZ1A 3ZHFA 1Y5VA 2HVKA 3B05A 1OAYH 2AKZA 3BLLA 4R84A 1QO3A 4RISH 1LO3H 4HWEL 4F9JA 3S9IA 3DHFA 1PKOA 3G5XA 1T1XB 4NBZB 4PJCF 2PDHA 2V38A 1MCLA 5DT7A 3EUDA 3FQNA 3P0YL 3PWJB 3KL3A 2VX4A 2VN7A 2V7NA 3QUMA 4AWUA 4EDWL 1VFOA 2BOFX 4PC2A 3RB7A 1XG4A 3G1XA 4REQA 4I5BA 3TYGH 5M94B 4L4VB 5MERB 5BS0E 4JPVL 4LGSB 3B40A 5GZOA 3EH5B 2XV0A 1LM8V 2VDRH 3CU1A 3FRPA 1Q6OA 2EIXA 2NDFA 3KTSA 3LKOA 4X60A 1FAIL 2VXUH 3ARSA 5C86A 4QHNB 1O1HA 1J9SA 1OPGL 4JTFA 3IE9A 1M90D 4K9JA 3L9CA 4B5XA 4PB0H 1OTUC 2H2PC 5FJOA 2BS71 4A2HA 3BDBA 3D6NA 3B2VL 1OV8A 4U3XA 3OZVA 3ZIAA 1UB3A 4IBYA 4KX7A 5BW7A 1KGWA 5EFFA 5LXGL 1QK2A 1KQZA 2VTFA 1N3NB 3PVFA 2Z7UA 2ZXQA 3KYMA 2HKFL 5F7WC 1JOIA 3RTQA 4MTMA 4YFDB 3SGJC 3L81A 3WIFB 1RHHB 1IXQA 1I6NA 1IZCA 3TSMA 3TN0B 4UZSA 3QP3A 2BDQA 4HHLA 1T7XA 3U30C 4AH2B 3FUEA 3LQZA 1U58B 4MS8D 1MRFH 5IYPA 4CEUC 2NR6D 2UZIL 2Z93A 1W0VA 3T65B 3ZQXA 4ECLA 3VGDA 2GQAA 3LXBA 1G9NL 5IDZA 2F7QA 1Q82D 2ZPKL 3E1F1 3LQAH 3VX1A 2JK5A 3WNBA 3U57A 4NKOB 3PSWA 3PP3H 2Z6FA 1XEUA 2AK4A 3KVKA 3EAUA 3T07A 2DZUA 4X6BA 4M6OL 1J5OL 3BMVA 1XGYL 3DO4A 4S0HA 5FSDC 1E5BA 4PJCE 3GSVB 1CI5A 4G2DA 4ZQOA 1OCCB 2E7CA 1EC8A 1E8WA 5FUZL 4HG4K 3C8KB 1EYWA 4QXUH 3BVTA 1HCZA 4YDJB 3SE4C 3VIFA 1TZHA 2VLMD 2DEWX 3GBMH 4WK4B 3HAEA 2ZUVA 3OP2A 3C75A 3SKMB 3M8OL 3IEBA 1BM3H 1SY6L 1JNNH 4UNKA 4C6NA 3DIVA 1KGYE 1OGGA 4B0MM 3CH9A 1OHZA 2BSRB 3REQA 4XOPA 3UBHA 1BZ9B 3OR6B 3RX5A 3B7SA 5TGBB 4QRAA 3A23A 2A1WH 2X16A 4NPKA 3NSMA 3TCTA 3H9SD 2GSIB 3BG9A 1UMKA 3MRDB 2JI2A 2YXFA 2W1NA 3V5HA 4OZIE 3ILQD 5CILL 2AXHA 3CV5A 1QHZA 1N9PA 4E0FA 3EDJA 2BFGA 4UB0L 1E1RA 1XSOA 2C2WA 3NJHA 4M1GL 15C8L 1MIEL 2VDOL 2LVCA 5EIIB 1Q3NA 4I9MA 4BFAA 3D6GA 4C6MA 4PR4A 4EIVA 1CS6A 2BSTB 3V0UA 3AZTA 1PJ5A 3LN5A 1Y0RA 4MNQE 5IBTH 1A8ZA 3AC0A 1V93A 2G4JA 2GLKA 4OFCA 4AFYA 2VR5A 3QORB 1YIJB 1EFQA 4OD1H 1CB2A 4PGBA 1YAZA 4MCZA 1RV8A 2UZ9A 5I6LA 4YSPA 3H4WA 2MEJB 4OZHA 3DUSB 4N4PA 4ZXLA 4NO5B 4M7SA 3GTFA 3OAUL 1F4AA 1VF7A 2YUZA 4X8IA 2IKGA 4DKTA 3PZNA 2WJ5A 2DQTL 1SJXA 5F9WB 4HZ7A 3Q2LA 3QUXD 4GW5B 4K4KA 4L3CB 4DPAX 4FADA 1AW1A 5D5ME 3OW1A 4CVZA 4Z7AA 3RL1A 3UFIA 4LFHG 1GQLA 2P45B 2NPLX 3ZDYF 3MCKB 2JKNA 4UOZA 4S3GA 5DCEA 4PGDA 1MVUB 2CO4A 3HG4A 1Q6RA 4X5WB 3QSTA 3FPKA 1BM7A 3WBWA 1ZSHA 4UR7A 1J87A 4F2EA 4RZCB 2GJRA 1IQWL 2OL3A 5IESL 5GZNA 4NYYA 1UFUA 1S46A 5LIXX 2R6HA 2DZPA 2EUVA 5EU7C 1SYVB 2X1OA 3WS3B 3GSWA 4LZKA 3QV8A 1A6TA 2BP0A 5CG7A 3VX0A 5LJYH 2RD0A 4FHBD 1KB9J 4EIZC 4JTAA 4Q7BA 3RHGA 1T6ZA 5J6GA 2YO3A 4HGKC 1W1YA 3SKJH 3NZQA 1KFJA 4ODUA 5DD6B 5CEWA 1QSFB 3N3MA 3AYVA 1TEYA 1MJUL 2NNCA 3R0NA 1QBML 3B9KA 3L3HA 4YSUA 4KHXL 4HPOL 4AD4A 1JV5A 2QCNA 3HV9A 2IXVA 2DTSA 1JF1A 4XPGH 1JNDA 4ML4A 4YGVB 4ONHA 3VFCA 4C6OA 2LTQC 2ZXHA 4YXWA 3LPPA 4FQIL 5KVDL 4WJ5A 3NCMA 3UC0H 3LPGA 4ZFFB 2ZD0A 3BARA 3QZ6A 1ES0A 4G8AC 4C56B 3EWWA 2X89A 1TJGH 2D3JA 2ZOUA 3QEHA 1PLCA 1L8NA 2WBJC 1WDQA 2FL5B 1XIEA 3VNUA 1ZHAA 2PE3A 2PUZA 2BM0A 1J1XH 2Q8XA 3GVRA 2FVKA 4H9UA 4O1BA 4WEBH 5HMSA 5AZEL 3V0WH 5EUOA 5C0DB 3IANA 5KZ6A 5EBUA 2Y7OA 3JVGA 4B47A 2JI1A 3K6FA 1AI1L 4JFEE 1WV2A 5LA2A 4CC1A 1TFPA 4JDZB 4GH1A 4M1BA 4BEQA 4NO0A 5IOKA 3CSGA 3SIKA 3TA3B 4RE2A 1QFWH 1FFNB 1G6CA 3C6LC 3MRQA 1PL9A 1WDDA 5C92A 3CB8A 4JZ5A 4DF0A 3EYOA 4CN4A 2QHRH 1G7QB 1JYWA 3JTTA 3EO1B 3SJVB 2ISVA 5AW6B 4Q4EA 4K7VA 2FH8A 4OIIL 4N2GA 3BZDA 2CRIA 3IXAB 4XXCC 1IR1A 1J8SA 3E0LA 3H22A 2UUDK 3GXIA 1FYTB 2GIMA 4MAYD 4R5VA 1BQUA 3SDYL 4Z77A 1M9HA 3JBG7 2BXYA 3BAKA 3QCTH 5GGVY 4ELME 5D2WA 3NPUA 4I5RA 1FXPA 3M1ZA 1M7XA 4XAGA 1F4XL 5FEPA 3FQWA 1S7TB 1ZK5A 2D20A 5AKTA 3QORC 4P59H 2EIJB 4M3PA 3S37L 1PX8A 4PUBH 1AGDA 1QX1A 1ZSDB 4DJDD 3D3VE 2WJ7A 3H7VA 1ZHKA 3LKPB 3ARDC 5LBSL 3VGAC 4FZ8L 4FI4A 3L4ZA 1CT8B 3C5ZD 3MRFB 2F19H 5DMJB 4XB3A 4UM8A 3DI2B 3KPOA 4Y2DC 1IQDA 5KVFE 3S34L 3VD2A 1UUQA 3WQPA 2JJ2A 2AQWA 3U2ZA 4ANWA 2JKEA 2FB4L 1EZLA 1U93B 1WAAF 3D30A 5EZLA 4F92B 1RJCA 3TYFB 3KBMA 4O9HH 4W7VA 3QEQE 5ACLA 4AVJA 3F7JA 3MYPA 4GH3A 3PF3A 3A4AA 1HXMB 3G08A 1EFRA 1QX4A 1FC2D 2X2UA 4N8VB 3AREC 3CV1A 3ANUA 4M81A 2CHOA 1NPUA 3QDJD 1TIUA 2NXZB 2HTKD 2W6IA 3QIWD 4F0MA 4RCAA 2G50A 4Z3GA 2PN5A 3O6KL 5IKCB 1CJYA 1U8NA 3WYAA 3G4SB 3RWHB 3G6AB 4LOEA 2KDGA 2ZOLA 1YC8A 4QO1B 3W82A 3P11L 1W9BM 3RJXA 1B6UA 3FUHA 3BFOA 4RGNB 4R71A 2SEBA 2IPTL 4DZ8A 1DIEA 4LCSA 4AZGA 1OD7A 5C9JA 3IMVA 3VC5A 2QTLA 3PIQB 1OSYA 1G7CA 5AYIA 1OP3H 3MLYL 3MHZA 3FRUB 5F21B 4MNHA 2NW2B 3B82A 1CLOL 4WDTA 1YN6B 1X96A 1TO5A 7FABH 1K4CB 3P9WB 1E4JA 1II4E 1JK8B 4WSKA 5FYJH 4C47A 1KXQA 3IJEB 5IB1B 1EOMA 3MOAH 1YDOA 2W5FA 4KO9A 5A2LH 3C8NA 1UD8A 4MZ2A 4TUOB 3V52L 3R0KA 3IXTB 4W9TA 5LNRA 1X5AA 3D06A 2X0YA 3D2UD 2XISA 4EPKA 2RKXA 2XVNA 4GINA 4W9CC 4A7GF 1OX4A 4WF7A 3N4EA 4LAUA 3JWDC 2L3BA 3GI9H 4LCYA 4ADTA 4JFZH 3KYOA 2N7BA 2QDXA 2EUXA 2ZONA 5KSBF 3M41A 1H9VA 3FUDA 1LE9A 1YBQB 2OBTA 4OV9A 1ZHNA 4ORZC 1LEGA 4IMCA 3VIJA 4AK1A 5F44A 1GVQA 4ICWA 4HF5H 3UZJA 5B80A 7PTDA 3EEGA 1R3WA 1MFUA 5F89A 5D2LA 5DD5L 4WEVX 2HCVA 1HIML 5BQ7B 1OHLA 3K91A 3ERPA 4IRZA 4N2IA 4G1EB 4DHGA 5D8JH 3GIQA 5I1KL 2XDFA 4G72B 2CUHA 2FBRA 4CBZA 5ADOL 4PRHB 4QXTB 1R87A 3TWAA 3NFUA 5L88H 3WFCL 1YEEL 5GHWH 1A0DA 4M7LL 5I17B 1HJSA 1C92A 2YB1A 5JW4M 3MBWB 2REQA 3R6IA 1P4LB 2Y85A 5F7MC 2XSXA 5ICZA 3QPKA 5BRZE 2ENYA 2WBGA 1XGYH 3P0VL 1HU8A 3WQGA 5I03A 2WLZA 5L2KA 4MHBA 1WYIA 2AQSA 5HNTA 4XCFL 4XI5C 2L8AA 1DBJH 1I85C 1O5PA 4Y16A 3CBJB 4ELKA 3W7JA 5D1QE 3VDCA 2Q3RA 4FQCH 3RWFA 3UTTA 4CKQA 2ZP0T 5T3ZH 1A4JB 4KROD 4IIEA 3B0UX 1NGZA 5CSYA 2DBLL 1J5DA 2JJUA 3DVFA 3EBAA 4N0CD 1GW6A 2DD8L 3E1YE 3DI0A 1FWAC 4JM2A 1TB3A 2JGQA 4HA1A 1H6UA 3MV9E 1ZKAA 4FERA 4FZEL 4HEPA 4PJBE 3GMMA 4AH7A 3G3MA 1IBBA 5TY0A 2EYRA 5DZOA 4HK5A 3TOYA 1ISYA 5I2IB 2CK2A 5CUSL 4DF1A 3G5XB 3EYVA 4JO2L 4XP1H 5AC5A 5IHRA 3NJVA 2RHGA 3OP1A 4ZO6A 2XQYK 5JW3H 4JTRA 2QJDA 3W2MA 3MFFB 3JWNG 4K7FA 1YIXA 2G3JA 1GKQA 1B9ZA 1OAXH 2PSNA 3HI5L 5E1AA 2E8YA 2ZFAA 2ENJA 3RTQC 3EWXA 3OGSA 1XF3A 5MEQA 1FZOA 3N44B 4XMKH 5BV7B 3SE6A 5IREA 2A2IA 1FDJA 2XWDA 1TSIA 5HYJA 3REVA 3N1QC 3SCMA 1LLZA 1XCFA 3O2VH 4NO2A 5I66B 3FOMA 1ZLWH 3RPKA 4DESA 1SYTA 4MOZA 3D3AA 3E2RA 3WMPA 3U7VA 3VNJA 4F1SA 4JTEA 1HFUA 3P4MB 2EVIA 3MCAA 4KK5C 3FQ4A 1XSKA 3SSJA 3OGVA 2UX6A 4KJYA 4IIBA 1EUUA 3RVVD 4ODTL 1KYUA 3GYCA 1A5AA 4J3OC 4L8BB 3F4DA 3GHPA 5FOBB 4XTDA 3D25B 1WGOA 2ESVA 3OJGA 3RKPA 3N6JA 4QOKA 3UY7A 5IESH 4TNFA 3EPMA 2HLFC 3P02A 1UW9A 3I9IA 4RGMC 3LQZB 5BXFB 3WG6A 4M6PA 3PB0A 4IKLA 2CEQA 2JELL 4AYDC 4G43B 2IADA 4KRNA 3PVDA 5DX7A 3EA1A 2AERT 5LNDA 3UG5A 4OW6A 5G1TA 3OIHA 1E4HA 3HE7A 2YCIX 2A73A 1U36A 3BJFA 3EJZC 4ACZB 5JUEL 1DZ0A 4YOKA 5ACMA 2AK4B 3HMWH 1YLBB 2Y62A 4GT7A 5CLWA 4IQEA 4FX8A 3GSNH 4UZFA 3WF4A 3P2VA 1B3ZA 2OGYA 3NSFA 2GI7A 4Y2DD 2ESVD 3QJTB 1Q45A 1KTLB 2J72A 1WORA 1ZE3H 1JWSA 4FHJA 4Y8AA 5ENWA 1ZJIA 3FH7A 4YDJA 3QIUB 4HH9A 3DV4A 4IMFA 3IYLW 4P5RA 3TV3L 1YY9C 2H6UA 2E77A 4XN1A 4WUIA 1WZLA 3KH3A 1F05A 8PAZA 5ID0B 5C0EB 2OP4H 3HN3A 5BVJA 2D2JA 3FPXA 4NERA 2JKTM 1IM3B 5I6XB 3BUTA 3F6LA 4LSDA 1LLAA 4WJG3 2QQLH 1GYLA 1IC5L 2DQIH 3WNKA 4X4YB 2JH2A 3X1EA 4GSDH 5T5NG 3TIDA 4OM1H 3CPXA 2NY5H 2IOIA 1Y7VA 3KLQA 3CYVA 1HZLA 2HKHL 3VTMA 4XCCH 3IARA 5A8OA 2HTLD 4AF0B 3TJEL 2PDFA 1PCXA 3MACL 1TG7A 2GTZB 5EC1B 4EPEC 2V2XB 3UCDA 3W0KA 4CA4A 5L8JB 5D2LE 2GC4C 5E24E 3EGDB 3E74A 4FP8L 4HNVA 1ZLWK 1T1YA 1DE6A 4RDLA 1A65A 2Q1EA 2ZUWA 4MCZB 4P59L 1XUZA 5AHMA 3BPCB 3SB3A 1BJ1H 4HSHA 4GXMA 4AF6A 2AK4D 4JHBA 2XDHA 1WDSA 1K8CA 1VYRA 1AG6A 4XO9A 4GW5A 4DK3A 1YJDL 2ZWZA 4OZFB 3QBTB 3VQMA 1UKPA 3HJZA 2NX5B 1VADB 1MSSA 3U5YA 4Z1YA 1A47A 2NUXA 3M0HA 2JV6A 4NEHB 4DEUA 1R2SA 1MFBH 2ENSA 4AGMA 3KG5A 3EO9H 2Z7GA 1DL7H 5AOLA 4B3FX 2HK0A 4BF7A 2KT6A 4RZCA 5IYQA 2X0UA 1UTDA 2PTTA 6PTDA 2DKMA 3CAKA 4OFPA 2Z92A 3JZYA 4TKOB 3ASQA 5E8NA 1SYVA 2V9UA 3UABA 1GSKA 1RZGB 3VR6A 1T5XA 1OTSC 2JDIA 1XCXA 2WXIA 2QPSA 1FFOB 4MA8L 5SX5H 4AGLA 1KSRA 2EXSA 2DQEL 1E73M 1S2WA 2PURA 1GTEA 3QEQD 5BOZG 3KPLA 3HTWA 3ZR6A 4KPHH 3WO4B 1W5QA 4DVRL 2E25A 3ESVF 3VNDA 2R2BB 3US0A 3SGKA 4LALA 1GC1L 4YHPB 3E5BA 1JV5B 1TPXC 4MDOA 1Z7AA 5GGSY 1BIIA 1XYMA 2R56H 3G1VA 4P1VA 1BWWA 2WQSA 1BMZA 1KCRH 4J1UB 3DERA 1B0RA 4KWUA 3MO4A 2GVYA 2DLEA 1IT9H 1OARL 3J81k 1XH3A 3V5OA 4WZ9A 2IH8A 2X10A 3PP4L 4GAAA 1CICA 2WHJA 1J8VA 2V9RA 3K81A 3VWJD 1GOXA 3D9AL 2V5SA 1G67A 1W2VA 3P6LA 4CN1A 4RDVA 3U6KA 5D1XA 3HG5A 5IMOA 5CAHA 1AP2A 4O5LH 1U6AL 2QTZA 4PB9H 1WZAA 4XB7A 1VRSA 4FL4B 4IU3B 5BZXA 2VR7A 1KF9B 2V7UA 5D96B 3U36B 2JEPA 12E8L 3QQXA 3IS1X 3HFTA 1J2BA 3CFDA 2NQ9A 5I16B 4JTHA 3EF4A 3N41F 2VDRL 2DKUA 5FO2A 1URLA 4KQNA 3ULAB 3SQSA 4WVXA 4NO0B 3QJOA 5CGYD 3PNWB 4WJEA 2A6KB 2AXFA 2VXQA 4E0RB 1RAMA 4O4WA 5D2YA 4L29A 3MRQB 3B7UX 4YJZL 1BXNA 3PB2A 4P3WA 4H1LH 5C2BH 5HGHA 1FHNA 3T8LA 1R3KA 3DX2A 5T1MA 3ARGC 3WEBA 1FWJC 2HXTA 3NDYA 2XWRA 3S8GB 3VFRB 5AYXA 3E6HA 4ELDA 4KEUA 4UUJB 1EEQA 3SY8A 1QRNB 3BOVA 5HSFA 3IXAA 4BCZA 2EUZA 5EO0A 1AQMA 3T6QC 1H7NA 2D9QB 1PEWA 2FQDA 1H85A 2NY7H 4N2LA 5D7HA 5DJ8A 3C2OA 4P6YA 2O0TA 5FA5A 4X6DB 1S7TA 2BGNE 2Y06L 2HT4C 5T5NF 5EPMB 3DO7A 3NO1A 2EQDA 1MG2C 2OW7A 2VZTA 5D93C 3ZFHA 1YEJL 4KUCF 1AGDB 1ZSDA 4OCYH 1W8SA 3PWNB 3B3BA 3LKPA 3NDZE 1NFPA 1XHGA 1X9QA 3OJMB 5ISZA 1QFUL 4N8PA 1SXZA 2J7DA 3KPOB 4JIQA 1JDDA 5GGTL 1D7BA 4TLSA 2V7WA 4M7LH 1VLWA 1U93A 4JN1H 4RMRA 4K23H 4BK5C 1W17A 3KOFA 4OCLC 4PTVA 3WIIH 1N8IA 5F1SA 4YQXL 3GMPB 2ICEB 1BW8A 1IB0A 3JWOH 4JPWH 1Q7ZA 1JWMB 3NAAH 3G08B 5EZIH 4GUGA 5DN6A 4PJ7A 4N8VA 1IL1B 2ZA3A 2X5PA 3MUGA 3VFSB 4ZTOH 1BGAA 4IJ3B 1A9BA 1TKWA 1TX0A 1XWYA 4MJIE 2JKIS 1KM6A 4PGEA 4JY5L 2ZKYA 4RNRA 5M7QA 2NY6D 1EFUA 1I8DA 1MHHB 3F7YA 1KC8D 3FYIB 5TQ0H 3OJVC 4IMKA 4DN3L 2JKPA 4BRVA 2WB5A 1NRKA 1XIDA 5D37A 4JO8A 4DZ5A 5IBLD 1BQLL 1NSNL 1SN2A 2WNQA 4GNVA 4FXFA 1UR8A 1EPXA 2WAGA 1TPXB 4H8UA 2WCAA 4GLRI 3F5KA 3MLWL 5DHYA 3HFFA 4DZ8B 4R4BA 3IDMB 5FCSH 4H41A 1BX2A 2ZSWA 4LP4A 1T22A 1BJMA 2ZZUT 2HJKB 4GAJH 1H61A 2WYSA 4Y8FA 1ZD6A 5E1IA 2Z4TA 2PU0A 5DZVA 1OC6A 3CHQA 3UJRA 3ZYJA 1HINL 1W6WA 2CC2A 5DRXB 2Z7ZA 2G75A 4AW4A 4FI6A 2KZ1B 1F02I 3HKFA 3S2CA 4PP2B 3KM2A 5DHEA 3RO8A 4AISA 1CXKA 1R7AA 3R11A 3A8JA 3G5ZA 2ATPB 1CR9L 4N9GA 9CGTA 5LLIC 4U10A 4BDVA 4MDJB 3A6BH 4PCFA 4N1HB 5KG9B 2W63A 1LG2A 4GQBA 2GEEA 3GXFA 3PREA 4NGHL 5EEWA 3DYPA 1N8OE 4N0CC 5B22A 3LOWA 4KJPD 4N0UE 4QKXB 4LNRA 4OZIF 2RH9A 1HQRA 3CGTA 1RALA 4P2OA 4FEIA 1EB3A 3ABMB 1FCUA 5BMFL 5J7CC 1VJIA 4JL1A 5F7EL 1B31A 4PJHE 1U3HD 1L2QA 3NIDB 3FSVA 1F8TH 2XG4B 4I13B 4M9OA 4DWHA 2YD4A 6CGTA 5BOEA 1MCWW 1PD6A 3V0AC 3M88A 1YBQA 3WNNA 2AP2A 3HC3H 2J6VA 4Z2JA 3FB6B 1TTIA 3KVDD 3KVQA 3FN0L 3P77B 2XSAA 3QR3A 2KZKA 3ZE0B 4KQ4L 4DGYL 1DQKA 2BJML 2H3XC 1JGUH 1FE8L 1T80A 3K6NA 1WBXB 2NY3C 3LD8C 3LEVH 4UQ2A 3VTAA 5GRVK 2QFPA 4H8WL 4OE7A 1JQVA 5HJDA 1YMYA 3CPRA 4IISA 2P42B 2CCWA 3RTQD 5E8PA 4XVJH 2WQDA 1I8MA 3WG7B 3HQNA 1KGJA 2BN4A 4QV2A 1UC6A 1MJUH 2FZ3A 2CLZA 3R06B 1CZ8L 4KO6A 5I5JA 1GXEA 1NL0L 1CCWB 1IAIL 3M0JA 3NAVA 4WKHA 1EHNA 2WKGA 1KBGH 1KCSH 1Q38A 2YARA 3CZGA 4QF1B 1IQ8A 3VE7A 2RFGA 3KRUA 3VXGA 4ATLA 1WB0A 2EPKX 4XNYL 1TZ9A 4OZOA 4LVGA 2PIAA 1I2RA 3CAQA 5D7LB 3UTTB 4R90L 2XC8A 4DJMA 2W3ZA 5JU6A 3MC0A 1NP2A 3GZKA 5HI3D 1XBVA 1BFVH 5LXVA 1JGDA 1D7KA 2V5JA 2F7PA 4MWAB 5F0MB 4FEZA 4JM2B 1RZKL 3LG3A 1YC7A 1ZUAX 4IF2A 4Y9RA 3G1YA 2FZMA 2XWJB 5I19L 1NC4A 3Q8EA 1UP3A 2R39A 4V2XA 3RFZB 2YJQA 4K3HA 5E1QA 1PW3A 3P84A 2NXIA 4Y1AB 3QUKA 3CNYA 1I18A 1D8CA 3W1MA 2O93L 4UMSA 3O11A 2NQDA 1WA0X 4PWEA 1FHGA 3VFTB 4K7FB 4ZUWA 1WK0A 3EJZD 4HFUH 2AQ2A 1VAHA 3I6SA 1EFCA 5FWRA 2A0NA 5BVPL 2V2CA 4JTJA 3OAUH 5E1AB 4LL1A 1PG7L 4ZSOE 2C77A 2ARWA 3HUJE 4DYKA 1B30A 1O7DE 1E2VA 3RUGE 4N24A 1GVFA 4JG0H 4HLZG 1E5ZA 4LKCA 4U1LB 5D2LF 4OTXH 4IICA 5F6IC 4I1RA 3GBDA 3PZQA 3NGFA 1IC7L 1OAJA 1PKQA 3RVTC 2XFGB 2A9NL 4NFCA 1NEZA 5GS1A 2BP5M 2IGTA 3KRZA 2HV5A 2J88A 2H6PB 5FYJD 3V4PL 3FTXA 3PUCA 5L2KD 2NY0B 4RNHA 1WCGA 1E79A 3H85A 4B9KC 1RUSA 2F8XC 4YPGB 3V6OE 1MDTA 2UXGA 4LSPL 2A7BA 1WA1X 2BMBA 2ODIA 3BH9B 4E9YA 3K30A 4MB5A 2WXMA 5I26A 1EANA 1HL9A 1QKZH 2A99A 3KJ6H 4Y5YA 3CC2B 2WPGA 5SV4A 1I8UA 2FSDA 2P4AB 4MNGA 5BUAA 2Y61A 3WK1A 4QX4A 3DVGB 4AZUA 4X22A 4UBDC 3OPZH 3PJSB 4D6DA 1G0YR 2IADB 1DQMH 2EH7L 1JDEA 2CUAA 4LKXB 2Y88A 1B9KA 1OE1A 4FA7B 2DEPA 2VVSA 3FY1A 3BVNB 3NO3A 3VD3A 3BCDA 1S7RA 3VYPA 1EUNA 2HNHA 5M17A 3AI0A 2QR6A 3GXMA 3S6DA 4YLWA 3FSZA 1F3DJ 3IGAA 3IUHA 5AOUA 3ULSA 1KPRB 3PRZA 5J12C 3M17B 1CF8H 4EN3A 2ABBA 3V0WL 3QFDA 3WL9B 2F5BL 3WJWA 3WF3A 1E67A 1A25A 1AUSL 3P0WA 2BWQA 1NTDA 5ANMA 1IEBB 2XX1A 5G55A 4TRPL 2XYLA 5H4YA 4KPLA 1ZUNB 4R7JA 4XBKA 1MH5A 2YMTA 4Y9EA 2X0HA 3VCLA 2DIAA 5D03A 4UOJA 3NGBC 2XPKA 3AJXA 5DFVC 5SWUA 1YTKA 2UY3A 5C0EA 2GK1A 1CG9A 2AGJH 2E75C 3ZTJH 2B81A 4AZCB 4NBSA 2DQMA 5FO7A 4WY7L 5ABFA 4J3WA 4DO4A 5LGKA 1BF2A 5HYQB 4W9DC 4AL8L 3VKKA 5BRZA 5KSAB 4WFHD 1U1JA 4U1IA 3RX2A 2QV2A 5HWMA 2VR4A 1N0XH 3SYOA 4JFWA 3CMGA 4AF0A 1NVMA 4KIRA 4LS0A 2IXQA 4XWOC 1Z0MA 5DRWA 1PIFA 4ZCMA 4L3AA 1PVNA 1R86A 4AEIH 4WV1C 1LP6A 1FBIH 3XINA 3PDOB 1BWLA 2IPUK 1I31A 1RPKA 5HHPA 4L3FA 1AGBB 2CBPA 3GB6A 1D5IH 4NN6B 3SCQA 5LZLA 2V8ZA 1OE2A 1JK9B 4P23D 3WXVH 25C8H 3V6ZA 4BF9A 5KSUA 1FQ0A 3OZWA 1I4FA 2DKSA 2Q8ZA 1S4IA 1HJCA 3A1PA 1BZ7A 1IX2A 3HAEG 2MCG1 1ZBCA 3C2VA 3TN3A 2CK0H 2OLDA 1IGYB 2FH6A 4OY9A 3TNNB 3LRKA 1JCJA 3LPOA 4GBXB 2F6AA 3DRQA 3GVWA 2WZPP 1NDMB 4FA8A 4LCUB 2FGWL 5D9OA 1RZJH 2ZXBA 4MZ1A 5HQEA 1WFOA 5LN8A 3L3OB 4Y96A 4KHTH 4N2MA 4AWSA 4JGUA 4B3XA 2FEEI 4Y4FC 3OQ3B 1BM3L 1DQDL 1UROA 4PMUA 1I8KA 1FFOA 2YLKA 4NOBA 4B7IA 3TNBA 4RE3A 2NLIA 3OKXA 5B7MA 4Z7WB 1GHRA 1TMQA 3FO1A 4OFVA 5D93B 5JO5B 2OK0L 3RVWC 5CU5A 3LIZL 4OZFG 1GYAA 1AZZC 2IQ9L 2R2BA 3FTYA 2WLJA 3WBEA 4PMQA 3WHE1 3WIHH 1ONWA 2R1MA 1WHOA 5FJPA 1O5XA 1NGPL 4AXWA 2YOCA 4QT5B 4PCYA 4BWWA 4OWGA 2ZG2A 3MROA 4GRLB 3X14B 2WSQA 1P9MA 3C2YA 4MRCA 2OMBA 5I6SA 3X13B 2Z2AA 1GPOH 4QOKE 1EWYA 4PTTB 2ICSA 2B4CL 4IHOB 3PBVA 1JZ2A 4KRTA 1NIFA 1PZBA 3EKZA 3SUSA 2MCAA 4XLEA 1KPVA 3RNDA 3LZ5A 2BNJA 1NJJA 3CU7A 3KOWA 1RD6A 3UCRA 4MZ3A 2OMXB 1HJQA 1T7VA 1C91A 3WY9A 3A12A 4XX6A 3G8EA 3LNNA 2VXQH 4LQFL 2GKIA 3CDCA 3U36A 3QJFB 1WKYA 4ZZ9A 4HUNB 2DQTH 3OLGA 4QHLB 2ZRVA 3VWKB 2H8ZA 3WE6B 5LAXA 2AF2A 3I50L 4EUPG 3JYBA 3QFEA 1HUVA 1K4DA 3BEVB 3MSRA 2VXVH 5BRPA 1UURA 1XGTA 4ODHL 1RCYA 3Q8FA 3S5LG 1UZ6E 1BZDA 1LL4A 2J88L 5F7DB 3R7RA 2X9WA 4GIOA 2ZXGA 4JFDE 3E6HB 1KCUH 3MAWA 3AG4B 4PIRF 4AJYV 5IWLC 3IU3A 3FA4A 4ILSA 1G7VA 1S7VB 4YC2C 3HMXH 2I5YL 2DDQL 5K1JA 2V9TA 3S98A 4HULB 3AXHA 4IG2B 4K9EH 2HJPA 1ND0A 2Z35B 2ZNXA 1I7UB 3C6EA 4UBDD 4NAJA 4LNVA 4U0RC 3TVMB 4YHIA 2HVNA 1KLFA 1OAYL 5ESVA 1XIBA 4RISL 4I9TA 4MFEA 3R4RA 2ERJC 3H2WA 2Q0ZX 3BUYA 3IDUA 3QQ3A 4HVXA 1GZQB 3TBVA 1QO2A 3OA5A 3SBQA 4AD1A 2NWRA 2YWYA 3NRFA 4FQJL 4PJEF 1HP4A 3GR8A 4JM2F 4GYPC 2EEFA 4MASA 4EDWH 3GHBL 3L3KB 5HJGA 4YHYC 4TO8A 3O6ML 4GFXA 2WANA 3P1VA 3IDJA 4P23B 3VK5A 3RI5K 3RF9A 3IS4A 1YMHA 3FQUB 1OLZA 1N12A 1Q0XL 2J24A 3PGFL 1A6VH 4GACA 1CD8A 5CIPH 3K8MA 3O6KH 3TQPA 2DBLH 1JWMA 4XQFA 1EHXA 1AQKH 2F8VA 2Y5SA 2OSWA 2D7OA 3MUGB 5LGJA 1E4IA 4XP9L 2CUIA 4NCNA 1OXYA 2AEPH 4O0KA 1L3NA 2VDLL 5DLLA 2PP7A 4Y8EA 1NGQH 4E9SA 4HHPA 5HATA 4FFZH 5GGVH 3JQQA 2CA4A 2R4RL 2WUCL 5EH1A 1BAWA 4DN4H 1MHPH 4JRXA 2GDVA 5TQLA 1R3LA 2MH4A 2CA3A 3CHDA 3W28A 3MREA 3BGAA 4N3GA 3LXAA 3I7QA 3UROR 5E6UB 2VX5A 1G7TA 1H42A 1BAFL 3UZVB 2H9GB 1CK0H 2OTUB 1D7DA 4V1DE 4PJHF 4KK6D 4MQ7B 4NIKB 1U8MB 2UY7B 4DAGH 5IUCA 1O5DT 1BX2B 2ZSWB 3BGFB 3C08H 5EEVA 2LLLA 2AHIA 1HKWA 3DOIA 1N19A 2EXOA 1E9QA 2PYED 3VVVA 1NU5A 4JNMA 1PDKA 5I28A 1UD5A 2F54B 3N19B 2FECI 2Z8SA 2WSSA 4W5ZA 3GNMH 3N42F 1P0DA 4UWMA 2BVNA 2G75B 5ECJE 4JFEA 1ZV5A 3TJEH 3T0WA 5TFSL 3SLDA 3IT8D 2AABH 5DJ6B 3T0EB 5FHAL 3ZKMD 4AT6B 4D0CA 5L4FA 3EXTA 43CAB 2VRAA 3W38A 3K4AA 2Z4QA 4I2XE 1RA0A 1RBAA 2WZTA 4PRBB 1P4BL 1UACL 2C4FT 3CTTA 3NACL 1C8VA 1OEZW 4JO3L 3KHDA 2GIYA 1ZHBB 4NKMB 5AEAA 5I1GH 3QZAA 2MTAA 1SZNA 4CADA 2BG5A 3SFKA 1T1WB 1ZVHA 5K93A 3KOZA 3TASA 4IEFB 3HMJG 3LNDA 5IOPA 1BTCA 4DXVA 4W4NA 3US1A 1PCWA 2YD8A 3UO1H 2A74A 3OLIA 3SDCB 5J35A 4QDMA 1AYRA 3F12B 3GXTA 4TNVF 5DJ0B 5HPOA 4RW5A 5CG0A 4U4IA 3QMRA 3EO0B 2IANE 4YL2A 3HNSL 1U2HA 5F7KC 1D2EA 2M83A 3MJ9L 4K3EL 4PBVC 3GO2A 1HKLH 1Q9KB 2NTFA 3OAAA 2RR3A 3KNBA 4JAMB 4Z0XA 3DG6A 1WBXA 2MFNA 1GZ1A 2I16A 5AYYA 3ARBC 4AV0A 4XBSA 1YMMA 4XAKD 5MENE 3C60C 2C3VB 5E6ZA 4L3ED 3TWCL 1QFUH 4IRSC 4R5XA 3VFOA 4DQOL 2XQYG 5IJDC 1Q6FA 2GVGA 1RPXA 4PVBA 1DQXA 5KJ4A 2ZADA 1LJMA 2CLZB 5HZBA 4HCRL 4HG4J 1OAUL 1OYCA 4HP5A 2VITA 4QRTB 3HB3B 4PABA 5AVYB 1M65A 3FU3A 3OBEA 1USQA 3RVTD 1XIWA 2AJVH 4V33A 4WIQA 5D1XD 1TJIH 5EOQH 1KCRL 3UDWC 4ZXBA 3M47A 4OM0L 3PBWA 1OO2A 3HS9A 4PY8I 1JIBA 5DBTA 2KZWA 5A89A 3HA0A 3ITCA 3W1RA 2DUAA 4POZC 4MB4A 2E5CA 2VFGA 4WNQB 1IBYA 4G8FB 3E2SA 4N2YA 4WRHA 3VWKD 3LBOA 1Q81D 1ZM3A 1WS8A 4JZJA 4N9OB 4S3AA 1E50A 2PEVA 4MWAA 5I3DA 4PBWD 4JEGB 4RKAA 4IOFC 5EU4A 4CU8A 3MHPA 1PYWA 2ZIDA 1ZAIA 4H7VA 3RCMA 4NQSA 2VQUA 3VJ6A 1UR2A 4N2CA 1FNHA 3OMAB 1FGNL 3PWUA 4HPYL 3ZYOA 3HE6C 4TM9A 4KKZA 4OZIA 4W81A 1SM3H 3QUKB 5GS1C 4UFLA 1ZRUA 5KS9F 2FFIA 3RM4A 1E9PB 3LCYA 1HSBB 3TM6A 1JMZA 4FP8H 1NB0A 3CW2A 2D7MA 3TU6A 5I6OA 1O6VA 5E9DA 1NAKH 1OK0A 3T09A 4RUBA 5A6TC 3RQ3A 3FDGA 1NCDH 1L6WA 4XB8A 4LT9A 3HG3A 1FP5A 3SE8L 5JOFB 1RVKA 3F7VB 2BP8B 5IW6A 1M01A 5DUML 3K5RA 3CIVA 2IOOA 4Y1TA 2ONEA 2YLAA 5LNUA 2XIIA 1Q6QA 4LRIC 2IDFA 4H20L 2ADFH 3TWBA 3MBEC 3DJRA 5I24A 1OAZH 3P9LB 4Q2ZA 4ZMLA 1C9SA 2EHHA 3O63A 4O12A 4WK9A 4D8ZA 3C6LD 4HKZB 4C83B 4EJ1C 2RQEA 1JV2B 4J4PC 3VE0B 1QHQA 2WNGA 2EH8H 4I7WA 3GUTB 1W9XA 4AZ8A 2JFEX 3FSAA 1YY8B 4N7QA 3LIUA 3VNIA 4C90A 2OGJA 1W1PA 1D3GA 4M43L 4CSPA 3WF0A 3OMIB 5I73B 3DX6B 2YL5A 1P69B 4Y5YB 4X2PA 5D1QD 2F53B 1QR1A 3PS7A 3QGAC 4DQWA 4BQ2A 4IRJA 3L0KA 3BVWA 4NC2B 1GOKA 4YS4A 4TUKL 4NNBA 5HPMB 1TIWA 1TTQA 3FJ6A 3BY1A 1R9YA 3B2MA 1K9MD 4OUOA 3CB4A 1ROCA 4A05A 3Q37A 2GJXA 3SN6N 4C43A 1WNOA 4G8GE 3MODL 1GHSA 4K3DL 4D9RE 1UD3A 2GSGA 3NN8A 1MAML 3ARGD 1CFTB 5I9QC 5ERWA 1DXFA 4GC3A 1NGPH 2XZ9A 3APTA 3T3ME 3C87A 5F97E 3OEXA 1C12A 5EN2B 4EN3B 3M17A 5C3LD 1B0GA 5LMZA 4FXGA 3QQ9D 1YHTA 3PFMA 1I8LC 3EYPA 3RY6C 3OB0K 2GJNA 3CL6A 2J5WA 3VRLE 1JHLH 3BZ4A 4QRQB 3KS0H 2JVUA 4YZFF 4JE0A 4MQXC 2QJGA 3ARBD 1E5AA 3O8XC 4XCNB 3MUHL 3QCVH 4PCTA 3UEZA 3ZC3A 3IVKA 5CZ0A 3D0LB 3UTSB 3DBNA 1CN4A 1M3IA 1S8DB 4OLWH 1EC9A 4ACBA 5F7BA 3AFBA 5DDHA 1X9UA 4U1SA 2VERN 4KFPA 3EGSA 4BQ9A 3ZHKA 4WDWA 3E5PA 5I3GA 1MJ8L 1AO7A 2HVBA 3H9HA 4MJ5A 4HXBL 4JIHA 1MWAB 1KWGA 2BIPA 4FFVC 2ZWYA 2R0WL 2O6CA 3LS4H 4G80A 3WQEA 4K71B 3M0MA 1UMLA 1HL5A 1CU4H 4IMGA 1KN2L 3K2UH 5MEPB 2Z1BA 3UA4A 3FFCE 2P0OA 3SGKC 2PDJA 3EWBX 1PAZA 4M48L 4U31A 4KKBD 3IJYB 2DQWA 4MAUH 2BLEA 5AY7A 4KZ0A 1I82A 1E4WL 1XYLA 4NAEA 4EIGB 1RUAL 4ILDA 2IXQB 3IU4H 5DRWB 1NC2D 3WD2A 2UYLB 3OZYA 1AD9A 5FUOL 4ZX6A 3UZWA 1VGEH 1YXYA 3HF3A 5U7SA 4S2SA 4P12A 3TCXA 4X2UA 1W0WA 1CICC 1HFBA 3NIFB 1W9UA 5HA7A 3KGTA 4R4FL 4XP6L 5HHPB 5B7FA 4XR6A 6ALDA 5DYOB 4RW3A 4ZENA 4IIDA 5LGXA 5FF4A 3QJHA 2BGJA 2JIXD 5HHQA 2NQLA 1YNTB 2J4WH 2UWEB 3UIZA 5FIPA 4A2LA 1M6OB 1OQXA 2XZAH 3JWOL 5D7SH 3CXOA 1BZ7B 4DGUA 2GZXA 3ASOB 1KK3A 2A0LC 4XVJL 4XN2A 3TNNA 3GNXA 3ZLFA 3QUXA 4P5KA 1MEHA 3WLPA 1O75A 5GGSA 3IN2A 5D2NC 2WMFA 2QR0A 3VXQA 1E6ZA 2UXTA 1R5VA 1CFQB 2DQUL 4NNYB 4XTRC 2C1GA 2VOMA 1DARA 3ONYA 1W72A 1H8SA 1U8IA 4GG8A 1ZA6A 1VFMA 3D33A 4MMZC 4NPYB 5AW1B 1FWXA 3FGCB 3LJ3A 3NQ8A 3F5JA 4KWSA 2VR2A 1A6AA 1OW0A 3G6JB