4V03A

Mind cell division protein, aquifex aeolicus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
236
Chain Sequence
AEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDADRNLDMILGLENRIVYDILDVLEGRVPYEKALVKDKRGLSLWLLPVIDIEKWNKTVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLESMDKRNYKVIVNRIKWEMVKRGAMLSVEDIVDILKAEIIGIIPEEPKLVDFTNRGEPIVLDEKFPASQAIIDTARRLMGESIPLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 82
structure length 236
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v03A00
5FUXA 2GXSA 2XSZA 5FPKA 3T1TA 2Z4RA 4MKHA 3U7GA 1AA9A 1FOEB 3ETLA 4NYJQ 4EKDA 4OL0A 3WMGA 4ARZA 3RRYA 2D4HA 4BGDA 3TUZC 2QBYB 3RNLA 5H1YA 1N3BA 1C1YA 2BM0A 2PCLA 3KJHA 4Z8YA 2QN6A 1MABB 4YMUA 2ECKA 1M74A 1XJ0A 2DHRA 2BV3A 4OI4A 4IEIA 4JLOA 2F1IA 1KAOA 3LX8A 4Q02A 1JXMA 2ZUDA 2QGZA 1BIFA 4M22A 3K0AB 4E03A 3NTUA 3CX7A 3BS4A 2J7PA 4D2IA 4QRHA 2ATVA 2I3BA 3ZIAD 4JBYA 3BB3A 4PQYA 3PUVA 3SJCA 4RVCA 1YR6A 5DISB 1FNMA 3VFDA 3EPLA 5EUMA 3IGFA 3U7FB 2JDID 1Z6AA 3MCAA 4MDFA 3K09A 1ESMA 3OESA 1DO0A 5E4FA 2X8AA 3KQHA 1ZU5A 1QF9A 4K8OA 4MYTA 3ZZ0A 2FSFA 5HR5A 2AWNA 2O52A 1G291 3IO5A 4HSEA 3UATA 3SHWA 2RB4A 2ZE5A 1GOTA 2YOHA 3T35A 1ZD1A 4JSYA 4RKEA 1HA3A 2FSIA 3HJNA 2BKEA 2QROA 1JECA 1MO4A 5CB6A 1L2TA 2BM1A 3AVOA 3K0CC 1ZNWA 2NPFA 3C15C 1N6HA 2GA8A 3ZYCA 3MWKA 1ZNXA 4QBIA 1KK0A 2PLRA 1PUIA 1UDXA 2GKSA 4L5BA 2WKQA 2J59A 1A4RA 1XJCA 4MRRA 3T1QA 4WZAE 2OAP1 2EFCB 4Q4AA 3DO6A 4EPYA 2OCBA 3NIBA 3DMDA 3AGQA 1W4RA 1KZ7B 1N5KA 4IFEA 3QKUA 4Q1FA 3MWLA 3NBZC 4Q4HB 1NBMA 1U90A 1OE0A 2GJSA 4FCTA 4LJ6A 3VMFA 5IHPA 1RYFA 4EPVA 1R6BX 4AG5A 2NIPA 1QVRA 4B2PA 4A0RA 3CKLA 5FTJA 3EC1A 1RE0A 2AHOA 4B6FA 4IDPA 4N3NA 4IJMA 721PA 3CPJB 2Q3HA 2C04A 3NWJA 4G0NA 1VIYA 5DO9A 2BMDA 5DI9A 2V7QD 1JEEA 1KHTA 3TUJC 5FBRB 1AM4D 1RRPA 1X1RA 2QPTA 4M1YA 4POAA 1CU1A 4FXPA 1EG7A 3QNUA 1FP6A 2P2LA 1XBTA 1XD2A 1LVGA 2CCKA 2OBLA 2ZE7A 1AS0A 4DB4A 3QJYA 1HT1E 5BN4A 1XCGB 2KI5A 4A6PA 1EESA 4G5SA 1US8B 2CVHA 3CBQA 4QGAA 4NCKA 2IK8A 5ANRB 1G16A 2YYZA 4NONA 1UJ2A 3GLFA 4DKXA 2DWQA 3G5UA 1II8A 3KL4A 1KSFX 5ELXA 1DARA 4CEJA 2IF0A 3UPUA 3IPXA 4TN1A 1A1VA 2PL3A 1NN0A 1U8ZA 3H0KA 4NE2A 3PV0A 3SYLA 4D4LA 1SVLA 4Q21A 3W34A 1Q22A 2JLXA 1VYTA 1TUEA 1WBBA 4RD6A 2XB2A 4JLKA 1W49A 1E79A 3K8YA 1R4AA 4LBZA 4OI2A 3U44B 2J87A 1SVKA 4RZ2A 3MWJA 5H8WA 3C5HA 1RVDA 2GXQA 3CPHA 2ZS8A 1L4UA 1T3LA 3N70A 4WA7A 1W36D 2QP3A 3KB1A 4OI0A 5EP2A 1T8UA 4A9AA 4LGMA 4JLJA 2J0UA 3VTKA 3WBKA 3THYB 1KO1A 5TVKA 3BAFA 3QF7A 2Q0HA 5JEEA 4LBVA 1VTKA 1KK1A 1KY2A 1E9SA 2EWVA 3H84A 2FDCA 2J1LA 2QP9X 4HAUA 1DO2A 3CONA 4B47A 1OXUA 4EJSB 1BH2A 5DHFA 2FSHA 1SKYB 2QMHA 4ZCIA 1VHLA 1UFQA 3SN6A 1KI1A 2XXAA 1X86B 2IF2A 2YVUA 2OM2A 4KYIB 3TSWA 2AK3A 1NLZA 3OIYA 2RMKA 2HV8A 3ND9A 2FZLA 5FTLA 3LQQA 2YWHA 5SZHB 3PUYA 4BPBA 4XIGS 1G64A 1NY5A 1W0KA 3GLHB 2G1JA 4JYBA 1OFUX 3MAAC 1UKZA 2QA5A 2XITA 4M9XA 4DUGA 2Z5FA 2KBEA 2Q9BA 1M7GA 1MKYA 1PUJA 1R8SA 3BB1A 1GVNB 4UKDA 1KMQA 4PSAA 1VCIA 2FWRA 4B33A 5EP3A 1KAGA 2QGNA 3B13B 4X8HA 4H1VA 4F93B 1F2TB 2VP6A 4JJKA 4KBFA 3HYRA 4BRUA 1XEWX 4C0BA 1FX0B 1JAHA 1EFHA 1K5DA 3ASYA 4QBGB 3W6OA 4PZYA 4HEJA 4Q1CA 3SYKA 4US0R 3JZMA 2ZUBA 2VIIA 1AZTA 1RRFA 1NSFA 2Y8EA 4ERNA 3UKDA 1E2IA 3WMFA 1FPMA 2F1RA 4N1AA 3L0IB 1NMYA 5KNBA 1XD9A 2F43B 5FL3A 1LF0A 4YMSA 2XGJA 2D3WA 3BFVA 1OXXK 3O47A 4OHYA 3EZ2A 2E87A 2OBMA 4GZLA 3QEJA 4CVNA 2ONKA 1IY0A 2VSXA 1T5LA 1YE8A 4MA4A 1QZXA 2VHTA 2UVQA 1AZSC 4MRNA 4Q7KA 4I99A 4HAVA 3PQCA 2ZJ2A 4BLQA 3IILA 1ZNZA 4LUCA 3ZVRA 2CK3D 1XEXB 2V3CC 1P5ZB 3Q8XB 2ZYUX 2JCSA 2NOAA 4PAMA 5K8UA 1Q1BA 5EP4A 3GCGA 2EQBA 4QGGA 4CT5A 3FE2A 4NPHA 5HCNA 3FMOB 5J5CA 4LHWA 4ZI2A 1N0VC 1O87A 1GILA 2G0TA 3P26A 1LS1A 3MGCA 4M1KA 4FMCF 1GL7A 2C9CA 4JLVA 2QQ0A 2ZETA 1YZQA 1W4CA 1XPOA 2P5TB 4Q66C 2D2FA 4PSKA 3UWKA 1KO4A 5JBQA 3U7EB 1W4AA 1A2KC 2H18A 1G8YA 1W46A 5AJXA 4C0AC 3ADCA 2EU8A 1CXZA 3HU1A 1ZD8A 3Q7PA 5CM8B 1P2UA 5JHGB 2VP4A 1Q44A 1FNNA 2EWWA 1DPFA 3QXSA 1ZMXA 1G7SA 2B8WA 1ZINA 4D4MA 3LQRA 5FFMA 4XTRA 4JLMA 4A0HA 1JXOA 1II9A 2B7BA 1SVWA 1SGWA 4HB3A 3WXMA 4TSFD 1XRJA 3A8TA 4MRVA 2OESA 3V00A 2ZRFA 5CJPA 3W8RA 1P7CA 4URUR 5FPHA 4Q01A 3VHLB 3TGPA 4KV9A 2VEDA 5JSZA 2W58A 4GBMA 1D8TA 2RKOA 4LHZA 4UJ3A 2RGGA 3KJIA 5HCIA 2J45A 4F4IA 1EFTA 2VBCA 2XTNA 3U61B 2ZR9A 1TQ2A 4Q18A 2A3RA 3U3JA 4B44A 1CF4A 4BEJA 4PC1A 1OFHA 5SZKB 2ZRLA 4YC7A 4BZQA 4Y0AA 2ZI6A 1IN5A 2OG2A 3OF5A 1BYUA 2YZ2A 3DKPA 5A4JA 5H70A 4XOIA 4L16A 3PEUA 4DHEA 2XB4A 4TYNA 3AVPA 3VAAA 3HR7A 4LJ4A 5AJWA 1G8FA 3U3MA 4FW9A 2I1VB 5FPSA 4E09A 1KI4A 5E7IA 3DM9B 3T5GA 5E7JA 2WKRA 3CRW1 2ZYVX 1U9IC 4DCNA 2FGKA 3VR4A 3B9PA 4DCTA 2D06A 2ZSAA 1RFLA 4C2TA 2FJUA 2ZQ5A 3NBYC 4CF7A 1PVOA 4YONB 2O0HA 1SKYE 3FB4A 4KO8A 4QJ4A 1QRAA 3AF2A 3W5JA 1R0XA 4A82A 1PV4A 5JJLA 2EFDB 3U6KA 1Z0AA 2GHIA 3RSLA 1SXJA 5FL7D 4B3GA 1T5IA 2XZLA 2IWHA 1HURA 3RLFA 3SFVA 4S2EA 1PLJA 3UMRA 1NLYA 4IRUB 2ZM5A 2P6RA 5GJBA 2WIBA 4PTLA 1NJFA 2A5FA 1OB5A 1ZNYA 3RRNA 1OJLA 1UBFA 3WRYC 2RGXA 2YWFA 3ZLJA 2WSSA 3VNUA 5FH9A 1CR2A 4MGIR 5J40A 2AN9A 4GP6A 1W5SA 2WKPA 4R9UC 4GPTA 4RZUA 4WAUA 821PA 1FUKA 3SBEA 1IHUA 1U0JA 5BWMA 3LVQE 2ERXA 4RD1A 4OQFA 2WWGA 1P62B 3IIKA 1L4YA 2O8EB 3RVBA 4A92A 1XD8A 3P32A 1DAHA 1R2QA 4M1OA 3ZVMA 2ZJ5A 4J0QA 4LRWA 2IS6A 4Q7LA 3UMFA 3WHLA 2UZ3A 1W5TA 3B60A 1SVSA 4HB2A 3LLUA 1W1WA 1EWRA 4MDEA 2H1LA 4KFUA 3N2EA 5F9FA 1VCOA 2GAAA 4NCJA 2C98A 3DOEA 1MRNA 2C8VA 1NP6A 1ZD9A 3SC3A 2IS2A 1SHZA 1G8GA 2H7VA 4WIAA 5BN5A 3I61A 3SQWA 2HT1A 2FFQA 2A2ZA 1QG2A 4PSVA 1X1SA 2AXNA 2GVDC 2O8BB 3AUYA 2BJVA 3OAAA 1MR3F 1TUIA 4Q48A 4IKEA 1XZQA 3K53A 2JLZA 3RRZA 1I4DD 1XTRA 2WMNB 3HYTA 1JR3A 1KO7A 3PITA 1C9KA 3DZDA 1EXMA 3VR5A 1NBME 2QI9C 3A1VA 2G1KA 3ZVNA 2PJRA 1TU4A 4BQSA 4JLAA 4HAYA 4Q4JA 4YLGA 5JHHB 3NKVA 1ZUNB 4EPWA 4M1WA 3Q9LA 1GRNA 3R7WB 3WNCA 4ESVA 3CZPA 4HZUB 4DDWA 2IUTA 2O0JA 1ODFA 1EFUA 3EWAA 3KJEA 1W0JA 2WWWA 1P2SA 4DLWA 5EE9A 2ZREA 4MRPA 2ZAOA 4B3CA 1S9DA 1NN1A 3EAQA 3KZ1E 1JR6A 2JLSA 2Q3MA 2ZS7A 3BRWD 2HXYA 4LJ8A 3PFIA 2QY9A 1KKLA 3D8BA 3TR5A 5DN6D 5M04A 5EZ5A 4CT4B 4V0KA 2YNMA 4QNMA 1Q57A 2ZYWX 3B82A 1E4YA 4NYMR 3A37A 3RDPA 3KXKA 5K8TA 1X8JA 1LS6A 1ZM4A 2GEVA 4QHSA 3EIQA 2FFAA 3QBVA 1VKJA 3U60B 1M7HA 3A4MA 3KQNA 3VKGA 4C0KA 2PBRA 3GLFE 4NTZA 2GAOA 1FUUA 4GFDA 1LB1B 4OHXA 3DOFA 3L0SA 1XCPA 2VL7A 1H8ED 2ZSFA 4M9SA 4Q19A 1OW3B 1OF1A 4U02A 4B6EA 4HZIA 4H1UA 4KU4A 4NYMQ 3AKCA 1MH1A 1R0ZA 4DJTA 1XZPA 3UG6A 2F9MA 5TMPA 1CRPA 3REFA 3NH6A 5EJEA 4Z54A 2O8DB 2IYXA 1N6KA 3WYFA 1AS2A 3AVWA 2DWOA 3JVVA 1MO5A 3EPKA 3SJAA 1KSGA 2PEYA 5FTMA 2ORVA 4R7ZA 5L3SB 3QG1A 1K8RA 2QU8A 3VKWA 4LOAA 3TSZA 4Q1DA 1G7RA 4TLCA 2AL7A 5FBVB 4G3XA 2B21A 4BFXA 1E4VA 1ONBA 3U4QB 1RJ9B 1G20E 4U00A 4R2HA 3AKDA 3CM0A 1DS6A 4AYXA 2XJ9A 2WWIA 1R7RA 3KKPA 4XVQA 1GITA 3LVRE 3UG7A 5LDDC 2IBMA 4G5GA 4KFSA 1E1QD 1GUAA 5FI1B 1HE8B 4EQ6A 1EK0A 3KTAA 2V4ZA 3B7GA 4RD0A 1YR9A 1Z28A 3KDSE 5BYJA 4C7OA 1IN7A 1KSJA 2B92A 3TQCA 1KO5A 3GP8A 1G21E 1XWIA 4A8JA 2MSEB 5CK5A 1HQYE 2X1VA 4PR0A 1Z29A 1JB1A 1KI3A 1N6RA 4ZDKA 3IO3A 5AUNB 4R98A 1E9AA 1BMFA 3CR8A 2IEYA 4DLZA 2YINC 3WP1B 1P4SA 2IYTA 2QRNA 4UQOA 4NZYA 3AVQA 4URYR 2EFGA 1Z08A 2QT1A 1P60A 1IQPA 2O8FA 4GMDA 4FN5A 1DAMA 4LX0A 2GBLC 3DKVA 4DLVA 4LPSA 2VPPA 1OXSC 2OZEA 3GFTA 1T8TA 2R62A 4AKIA 3CLVA 4HDCA 4P4UA 2F1JA 3VR6A 1E2JA 1NN3A 3OIUA 4QKQA 1Z8FA 3AGPA 5JCPA 4ACAA 4BLRA 2WSMA 4QG7A 1KZGB 1GDDA 1FW6A 3I4LA 4LJ9A 3E5HA 4BEBA 1R5BA 4ZV4A 3WYAA 3I72A 3U5ZB 2F6RA 2OO7A 5BXQC 1GKIA 1D2NA 3RWOA 2GVZC 1GFIA 1RKBA 3AUXA 2PX3A 2CHGA 5EP1A 4ZKDA 1BMFD 1Q1EA 4MH0R 1IY1A 3OEED 4CEHA 3ZIAA 1F48A 4W5HA 1E0SA 4HAWA 1RZ3A 2ZJBA 3PUXA 4MGKR 2R44A 1Z63A 2GJ9A 3A4NA 2ANCA 2JDIA 1JJ7A 2ZVPX 5FOSA 3SS8A 3LXRA 5B58C 4LBWA 1X6VA 2RH5A 4HUQB 4B2LA 2BHRA 2AK2A 1BO6A 3GFOA 3BXZA 1L8QA 3IHWA 4URXR 4AG6A 2A7QA 2CJWA 3QVVA 2AR7A 1UEIA 621PA 3KFVA 4US2R 1MT0A 2RGNC 2WV9A 3E1SA 3NBFA 2XOKD 2JLYA 4WZBE 4NBSA 3OIWA 3W3ZB 4TYYA 2ZRMA 2FNAA 4DT1B 4JLPA 2CCJA 2IUSA 4PC2A 4DRZA 3K1JA 3O8CA 3H86A 3WYGA 1GAJA 2OXRA 4HAXA 1G4UR 1F3OA 1WDTA 1GP2A 1P6XA 3ASZA 3QF4A 1IJEA 1Q1QA 4C0HA 3SJBA 2FF7A 4CEIB 3MFYA 2AXPA 1SULA 2G83A 4M4SA 5KYKA 2JA1A 4LI0A 1XDBA 4ZCLA 1JAIA 5L3QA 3GLIB 2GXUA 1OH5A 2Z83A 2JLQA 3SOPA 1B23P 3U2QA 4JVNA 1R5OA 4ZIRB 3L2OB 1FZQA 4KSBA 5HKKD 1WCV1 3QENA 4UJ5A 3BC1A 5CDFE 3KFXA 4YQFA 3P4YA 1Z0DA 1EGAA 1KIMA 2W0MA 1COWD 2XTZA 5JRJA 5DI3B 3H1TA 1P73A 1E1RD 2GK7A 4TL7A 4TTQA 2GRJA 1TF7A 5CLQA 3J81k 3S1AB 1S4QA 2VP5A 3PVSA 3TE6A 2Z0MA 2V7QA 4EIWA 1E2LA 1Z22A 3IBGA 4QBFA 5EQTA 521PA 3CIOA 2VQSA 4PO1A 2YKGA 3BJIC 2GZDA 3TVTA 1F2UB 2FPKA 1WBDA 4M1MA 1UBEA 4PAQA 4ACBA 2WPDD 3LV8A 1RRCA 2WICA 1QHNA 3AB3A 3RS5A 3CRQA 1FQKA 1G8HA 2AD1A 3CH5A 3QKSB 2ONJA 2BEJA 2ZEJA 4PPGA 1OYYA 3SHFA 1H8HD 4O2LA 2IEZA 4P4SA 5FUVA 5F98A 2KE5A 4P33A 2F43A 4F92B 1MRSA 4LJAA 1FQJA 2IL1A 3RSOA 2BKUA 1SXJE 3TSOA 2OE2A 1OXTA 4XSHA 2ZJOA 4P4TA 4FIDA 3QY0A 1ZRHA 4MKGA 2G77B 3IHLA 1A2BA 2F1HA 1ZIOA 3NC1C 4IDQA 1S3SA 4L9SA 2O5VA 4JL8A 2UZIR 5FOVA 2QUZA 1HYQA 3ZS8A 2P3SA 3BIFA 3F0TA 4PQRA 4EDHA 4CGZA 3SNHA 4I1OA 3C41J 1U2RA 4NKRA 1E2QA 4QHTA 3FFAA 2ZI4A 1OHHD 2OV2A 4M9ZA 4LJ5A 4GOXA 1CRQA 2G88A 4IVRA 1TL7C 1TQDA 2MSDB 1Z0IA 2IYYA 3B9QA 5AK0A 4TLDA 1MO3A 4C0LA 2AWOA 4V0LA 1NG1A 2HDNB 3FMIA 1E32A 5K8IA 5J4YA 3O8DA 3QKRB 1N0WA 2PT7A 4C30A 4N0DA 3GD7A 1VHTA 3K0FB 1Q0UA 1XMIA 5DIFA 2QENA 1ZM2A 2OHFA 2QAGA 3TKLA 1EFRD 1ZM3A 1AQYA 1KI6A 2QAJA 3MJHA 2C77A 4M21A 4TT3D 3Q7QA 4EAQA 1IJFA 1VCMA 2ZE6A 4M1TA 3SU8A 1ZCBA 2CHQA 1J8YF 4AD8A 4N0EA 2IUUA 2WTUA 2ODBA 2IXGA 2R6AA 4CW7A 2QTFA 2JLVA 2VYFA 2GETA 2PZFA 4RFVA 3P4XA 3R9WA 1MV5A 2BCGY 1XTQA 2N1BA 1HY3A 2DFLA 5EUQB 1V43A 3THOA 3O8RA 1Q12A 4RJLA 4X8MA 3TRFA 3VX4A 3VNVA 3EWSA 1JR3E 4K46A 3K0SA 5IK2D 4UNNA 3ADKA 4Q9LA 4YMWA 3NEJA 1M34E 3V4RA 2HCJB 3RHFA 1KI9A 2NTYC 2WJJA 2ZI5A 3AP3A 1TF2A 2OCAA 3GJ3A 4Q00A 2HJGA 1LV7A 4KVGA 5H68A 3AP1A 5J4HA 2QZ4A 2O8CA 1K6MA 1GIAA 2ASEA 1T3SA 4NCIA 4M2LA 1GNRA 4TWZA 5C1BA 5AUPB 2JIZD 1BS1A 1JEDA 1U0LA 2C2HA 3QVUA 4B73A 4ARZB 3TAUA 2ZU0C 3UIEA 1YR7A 3EPHA 4L15A 2ODWA 3EARA 4FWIB 2J5XA 4DBLC 4Z51A 4KFTA 2RGCA 4BFVA 4OKSA 3RAPR 2ZI7A 2ZR7A 3FFBA 5D3MA 3DM5A 1E2GA 1YZNA 2NO7A 3EW9A 2OCPA 4V0ME 2R65A 1J99A 3C8UA 3GEEA 2OCYC 3GLIE 4E22A 2YHSA 5CK4A 2CK3A 1YZUA 1XPRA 2WAYA 1ZJ6A 3K0CA 2HF8A 4PQFA 1P9RA 2A5DA 4DZZA 1JJVA 4PPFA 4V0OA 4D0NA 1IAQA 3P20A 4TYPA 2IYQA 1SVMA 2VSOA 4O25A 3D7MA 3EZ9A 5JLJA 3K70B 2CLDX 3Q85A 5FI0B 1N6NA 3ZZUA 4KVAA 1GG2A 4ESHA 5FBLB 4AKGA 2PZEA 2XEXA 2FGJA 3I92A 3A6PC 4C9BA 2J3EA 2ZSEA 1IONA 2JJ2D 1D9ZA 4Q9IA 1RYHA 1KDOA 5AR1A 2XTMA 3EZ6A 4JKIA 3FHOA 3IDQA 2JLUA 4Q9JA 2D7DA 2BJWA 4QOSA 5G41A 4DXAA 5IRCD 1QHHA 4LYJA 3VR1A 4LCBA 2CLSA 4IXMA 3TH5A 4BRWA 4OYHA 3FDIA 3GFPA 3NHBA 1ZUHA 5FPYA 4O2RA 3GJ4A 4Q9KA 5FTNA 1IXSB 1SXJC 3U7HB 3CPEA 2H92A 4RFSA 4WW0A 4LBYA 1E2EA 3GPLA 4CDGA 4FMDF 1GSIA 2EYUA 4TSFA 1DVRA 1ZU4A 1KDTA 1YZGA 4F7WA 1V5WA 4I1VA 4OHVA 3T06B 1GKUB 4RY2A 2RGDA 4Q4AB 3KXIA 3GJ5A 5TB5A 1E2KA 3A1UA 1CJMA 4ZDIA 4Q03A 2C96A 3P27A 4Z8XA 1W2GA 3MSXA 4OK6A 1Z6YA 2H57A 4US1R 3TAHA 4HB0A 4DDUA 2L0XA 3THXA 1E2PA 4B3BA 2ZRIA 1R10A 4PAOA 2GJAA 2O8EA 4B74A 3GLGA 2WAXA 3QEOA 2NQ2C 2IA5A 2X77A 1CP2A 1N2CE 3EXAA 2JEOA 3BH7A 3IBYA 4PANA 4AYWA 1NSTA 3R9IA 1M6NA 5CB8A 2BWJA 3BB4A 4XD7D 1ELOA 4F38A 1HE1C 2PT5A 3KUCA 4Q5IA 3OHMA 1KDRA 1YZKA 1XD2B 2QQEA 2X2FA 2ZRAA 1W36B 4AY2A 1OV4A 3OEHD 4Q9HA 2Q21A 5KPDA 1QDEA 2EYQA 2IT1A 1ZYUA 1Z0FA 4RZ3A 3AVXA 4D26A 5AWFC 3WNBA 5JFGA 4LV5B 4D81A 2WJGA 5KSPA 2WJVA 1GNQA 4RD2A 3QSYA 5FL7A 4TLAA 1VG0B 3GLFB 5IDVA 4KITB 4BFTA 2MMGA 1II8B 4LC1A 4K81B 3EZ7A 5GJCA 3SZRA 5KHOC 3A1SA 4CEJB 3DMNA 3CNLA 3C7KA 4PHTA 4UNQA 4QM7A 1CJTC 3C14C 3TIFA 3T34A 1ZAKA 3DL0A 1RW4A 1HQCA 3DVLA 3QG5A 1E9DA 4BUJA 1T9HA 1FTSA 4AWXA 3H2YA 2JASA 4JLBA 3VR2A 3BFXA 2F3TA 5F9HA 4GSYA 4C0JA 2VHCA 2R6FA 3HPQA 2QMOA 3O8BA 4PHGA 5A5GA 1XXHA 5G53C 3W5IA 4B35A 1AK2A 4EFMA 2DFTA 1QVAA 1BKDR 2WWHA 4FI3C 2ZRDA 3EIEA 5G3YA 2HT6A 1I4LD 3K0EA 3K9GA 4IDNA 4DSOA 3L43A 1DAKA 2J0UB 4KLNA 4PO9A 4EPTA 4B48A 4DVGA 1NMXA 1G17A 1UKEA 2C99A 2CE2X 3AKYA 2YWGA 4G01B 2FMXA 5FBWB 2DPXA 4HLDA 4OJQA 3TLXA 3E70C 3JVUA 3F8TA 3M1IA 1K5GA 5TXGA 1W44A 3HDTA 3ZVLA 3RWMB 2QG6A 1WP9A 2LWIA 2XXAB 1UPTA 2R8RA 3AF0A 3BH6A 3CB4A 1JPJA 2IYUA 1XF9A 2REBA 1GL6A 4TMZA 3H4MA 1G8PA 1G3IA 3EC2A 3VR3A 2YOGA 3W6PA 1N0UA 3NHAA 2YJTD 4WZ6A 3SYNA 3IIJA 3F3YA 2FG5A 1PJRA 4OHWA 4TMTA 1N6IA 5KTYA 2QP4A 1U0HC 3LLMA 4QL3A 3RRMA 1KJYA 1E99A 2WWXA 3QPVA 5L3RA 4WVFA 3GJ8A 3WNDA 1CIPA 4KSCA 8OHMA 1Z6TA 4WBSA 2XNDD 1KMHA 4NH0A 4TMVA 1DOAA 3VU9A 4BFYA 1NVUQ 2A30A 2DFKB 3L8ZA 4JZKA 4CRWB 1AGRA 3CW2A 1YR8A 3B1VA 3FMPB 4MYUA 1C4OA 1U98A 2EVWX 3EZFA 3L82B 1UAAA 4DLYA 2BC9A 3B5JA 2VO1A 5DN6A 1G6HA 1BYIA 4FCVA 5DYIA 5LBIA 5JS8A 1OKKD 1A82A 4PZLA 2GILA 2B7CA 3WP0A 4UXHA 3NG1A 4B43A 4A8JC 3THWA 4KAXA 1YZLA 2GCNA 2FPLA 2QMEA 3HU2A 1DG3A 1XMVA 4Y0VA 5FOTA 1NLFA 1XP8A 2OLKA 2YOFA 1DAIA 1U8YA 2Q9CA 2ZUCA 2R9VA 4G5OA 4IOMA 1A7JA 4RD3A 4ZI3A 2BOVA 5LB4A 5JZVA 2C9OA 3X1DA 1VCNA 3C16C 4ZCMA 1AKEA 1H8EA 2GZHA 2OILA 3C4JA 3RYTC 2OBNA 1JNYA 4HATA 2ZRNA 4A6XA 5C18A 1VG1A 1IN8A 2D7CA 2NG1A 1NVWQ 2CMKA 2WHXA 1SKQA 1D2EA 1CJUC 2WIAA 2ZRJA 3AP2A 4X8OA 1I4TD 1J8MF 2V54A 5DGXA 3QPUA 2N42A 3PG5A 2FX3A 1OXVA 2FV8A 1TPZA 3GEIA 2ZU6A 2HYDA 4ZO4A 5KDDA 2KJQA 1XU4A 3I5XA 4PHFA 1S96A 2YWEA 1G5PA 2BEKA 3TR0A 3IIMA 3A1WA 1OIXA 5L8VA 2QBYA 4Z1MD 2VF7A 3KB2A 1SZPA 4OHZA 3LA6A 1E1QA 1E0AA 1MABA 3RABA 2FEMA 3QE0A 1S0UA 1U9IA 5EXXA 4D82A 4V0NA 2OT3B 5JSZB 1GWNA 5JI3E 2QM8A 1E2MA 3BOSA 4ABYA 4LHYA 2P67A 4LV8B 2J46A 4DLTA 3K0AA 4YMVA 5GVSA 5FOUA 4M0LA 2LKCA 2WJYA 4D25A 4BLTA 3QXCA 4JBXA 4YXWD 1GRQA 1N5LA 3Q3JB 2G6BA 3HPRA 1KDPA 1BOFA 5JCZA 1N6LA 5A0FA 4DLXA 3PR1A 4W7SA 2NZJA 5C4GB 2VP0A 4GOJA 2LCFA 3KKNA 3VHXA 5GADl 2QE7D 2AX4A 1PZNA 2ZAMA 4LZZA 3AVTA 1ZCAA 2ZVQX 1IM2A 4XWAA 3OE7D 1XB2A 4FMDB 4PXAA 4LY6A 4BASA 2QTVB 2D74A 2BMFA 2ORWA 5FUYA 2GZAA 1G3MA 1CLUA 2C9YA 2ZE8A 5HZHA 4HDQB 4PZZA 1S3GA 4JKYA 2GWHA 1GRRA 3RS7A 1JALA 2JJ8A 1SXJB 4OQLA 3EA5A 4WXPA 1SQ5A 3FGNA 5HZKA 3K70C 3G0HA 5B57C 1KSHA 1OPXA 4NP6A 1YVDA 1NVVR 2GEUA 2CDNA 1S1MA 3AQ4A 4ASUD 3BORA 3K09C 2NZ8A 4XVUA 4B34A 4RSGA 1GTVA 2ZR0A 1AS3A 3CX8A 1E9RA 3LBHA 2HF9A 4C0QC 2Q6TA 1XMSA 1W47A 2C95A 3OEEA 4Q4HA 3V4FA 5FR2A 4LJ7A 2AKAB 3BWDD 3R20A 2DWPA 2GNOA 2FSGA 3B78A 2ZRBA 3B2EA 3NXSA 4UXJA 3B1WA 2FPMA 5B2ZA 3L0OA 4PPQA 1NVVQ 4M8NE 3I5YA 4C2UA 4HLUA 5KSYA 3FKSD 3ECCA 3RC8A 1DAEA 2W6IA 1AJEA 1U81A 5CJ2A 4AIIA 1NIPA 2VF8A 1H65A 1DADA 1VPLA 1NVXQ 1QHSA 3CWZA 3LD9A 2OSBA 4E07A 3LBNA 1UKYA 2VHUA 3ONWA 3F5FA 4KBGA 4DIDA 5JS7A 4TL6A 3DEFA 2XOKA 1N25A 3FKQA 3GJ7A 4P31A 4A4DA 1FP7A 1ZC3A 3UMSA 2W00A 1WF3A 4GMXA 4RZXA 1Z0KA 4DEXA 2W6JD 3QKTA 5K8LA 1L7VC 4XSGA 2FFHA 1OH6A 1US8A 4KJZA 4R2IA 5EXPA 5DSZA 1P72A 4QGHA 1CR4A 1DELA 2VLIA 4LYAA 1VYUA 3MJRA 1VECA 4UNSA 4A2PA 4IW3B 1FTNA 4FD2A 3AF4A 1TEXA 1YHNA 4M53A 2HXSA 1N6PA 2XJ4A 4JYCA 4QJ3A 5HKKA 4BZPA 2W2VA 2FEOA 3QPWA 4QGFA 3A4LA 4Q4JB 4WXRA 1OIVA 3NDPA 4UNPA 4TZ0A 3GLGE 1AGPA 5FBQB 1COWA 4KFRA 1W36C 1G3RA 3ZD6A 2W6ID 4DSTA 1E1RA 2BDTA 3U44A 3ZQ6A 2GF0A 5TY0A 2FH5B 2AFHE 4G1UC 4LHXA 2CBZA 2DBYA 2HUPA 1Z07A 4IDHA 3SEAA 4EPXA 3TMKA 5JMTA 4GP7A 3IEVA 1OFIA 1NI3A 1Y3AA 2OAQ1 3KKMA 5LPNA 2D62A 2WPDA 4LC0A 2IYSA 2P65A 4R71A 3WBJA 3EPJA 2ZPTX 1RIFA 3DDCA 5JWHA 4F91B 2JJ1D 3THYA 1D9XA 4MRSA 3VQTA 5J4KA 1H8HA 4AK9A 5JEDA 1QHIA 1ZIPA 2OEPA 2PCJA 2C03A 1P2VA 4TMWA 1E96A 4EJSA 1CBUA 3UXMA 5DLQC 3CUEF 2AD5A 3M4YA 1E69A 1Z2CA 1P2TA 3ADBA 1XCMA 1N5IA 1G7TA 2HCBA 1G6OA 3I73A 3MWYW 4HDOB 3ZQJA 1SVOA 3TNFA 4B32A 2REXB 1NN5A 4GI7A 1E94E 4ZDJA 1IBRA 1CTQA 1E2NA 3ZGXA 4TLEA 3GLHA 2A5JA 1SHKA 1O3YA 1UDWA 3K9NA 4B71A 1RPZA 1DG1G 4YDSA 3B8HA 3N5CA 1E9EA 4GDFA 2GXAA 3EX7C 1QBKC 3PJRA 5C2JB 4KLZA 3SDZA 1TX4B 4JL5A 1OHHA 1YJ5A 3DPUA 2LKDA 3CX6A 4BFZA 2VSFA 3HU3A 1TMKA 2IYZA 3NVAA 1F2TA 1XXHE 4Q4LA 4OK3A 2IW3A 1FX0A 1KY3A 1G3QA 1YZTA 2WOOA 1KNXA 3X1YA 5BW8A 5J47A 1X8LA 2QM7A 2ZJZA 4TLBA 5EXSA 2XSZD 4YDHB 1G18A 3TUIC 1KKMA 5LB2A 4NDZA 1EX6A 1R5NA 3U6BA 1EFRA 4JMPA 2ZRKA 5L3VA 4TT3A 4UNRA 1CULC 3A1TA 1U99A 4EPRA 1CR1A 3ZZTA 1II0A 4AURA 1OYWA 1UM8A 2ERYA 3KTAB 3BGWA 121PA 3WHKA 4EQ6B 4C7OB 2GBLA 5J4LA 2V1UA 4UXIA 1WMSA 4A8JB 3ADDA 4PHHA 1M7BA 4FCWA 1JBKA 3B1YA 4ILEA 4TYWA 1F6BA 3KXLA 3AH8A 3R9XA 2E1RA 2GF9A 4RKFA 4BFWA 5FUWA 1XEXA 5DNYB 2YC4C 3CNOA 4A2WA 1KI8A 3CF6R 5IK2A 2J7PD 1W7AA 5FR1A 2CEAA 3BH0A 1X8KA 1Z5ZA 2YV5A 5EZ6B 3K70D 3ICEA 3KKQA 2G9NA 2QPOA 1E2FA 2PH1A 2NO9A 2XAUA 2RHMA 4JSTA 3CZQA 3WRXC 3MUFA 4MITA 3CRRA 2W0SA 4URWR 4A15A 1NF3A 1OSNA 4KHZA 4DCSA 2QT0A 4JLNA 2O8FB 3A36A 1Q20A 4A36A 2EW1A 1SVIA 2JIZA 3Q5EA 4OJKA 2RCNA 4ZKEA 2A5GA 5DH9A 2G3YA 3GJXC 1F5NA 2X19A 1ZC4A 2I4IA 4LK2A 2QSYA 5JI2E 2F3RA 2X2EA 3C5CA 3HWSA 2ZSBA 3U3KA 4GL2A 2OFWA 1FMJA 2E9SA 2CL7X 3D3QA 4FMBB 5JJKA 3L0PA 2FZ4A 5JJIA 2ZRHA 1FL9A 1QHYA 1JI0A 1Z3IX 1E3MA 2KB0A 3IKJA 1Z6XA 1QHGA 1LF5A 2PZGA 2ZJ8A 3EIHA 4Q7JB 3AF3A 1GNPA 1IXRC 2RGNA 3LRPA 4LJYA 1E9BA 1T6NA 1KI7A 2O0KA 1J2JA 4D6PA 2N46A 4DCUA 2CCGA 3FMFA 1EX7A 3QOFA 4XTCS 3B6EA 4IOKA 2A5YB 1TEVA 2ODEA 3LO5A 2BMJA 2REOA 2ZI9A 4PC3A 4F4JA 1NBMD 1HH4A 2JGNA 3FOZA 1Q3TA 1TADA 3E2IA 4IVQA 1RC8A 2B6HA 3NC0C 2GCOB 2W2TA 2V8OA 3BBPA 2GEDA 4AKHA 1U8AA 2DY1A 4A2QA 4F4CA 2JJ2A 4XWKA 4QXAA 3CR7A 1XX6A 1AQUA 2GCPA 1U94A 2PMDA 4GRAA 1GKYA 3KQUA 1OH7A 2XX3A 5TDHA 4DSUA 4JIMA 2CJWB 1YKSA 1N6OA 3M6AA 2Z6VA 2DYKA 3L8YA 4I1UA 2ODNA 2NGRA 2Z4SA 3NH9A 1WQ1R 2OFXA 5KSZA 3X2SA 1YRAA 4TL8A 2HYIC 4IEEA 5G3ZA 5AJZA 4Q47A 1TAGA 3QF4B 4S35A 1AKYA 3IEUA 4A1FA 2KBFA 3HP1A 2IS1A 3AVUA 1R8QA 2GTPA 2GJKA 3LY5A 4V03A 3W90A 2H8KA 2K5UA 3QI2A 4W9MC 2H16A 4X8LA 2HEIA 3MMPA 2IHYA 2QTHA 2WWYA 4D4JA 1T91A 5L3QB 2VHJA 4DLRA 5GJVC 3ND8A 1KJWA 4BFSA 4AYTA 1QG4A 2WBLC 4BFUA 5CITA 4JVLA 4BECA 1B0UA 1UEJA 5LD2B 1Q1ZA 1OLOA 4B2IA 2AKYA 3SI7A 4B75A 4NU0A 3SE0A 2PMKA 2V1XA 3TW4A 3GMTA 1E79D 4JT2A 2ZSDA 1TNDA 5IF9A 3FWYA 4DIEA 4LYFA 3MRSA 3SR0A 3QXXA 1YU9A 4GT1A 1DTSA 3W8NA 2RAPA 4M9QA 4XD7A 4TZ6A 1I2DA 3AF1A 4CEHB 1G7CA 4DCVA 1NNEA 5KPJA 3RC3A 1R0YA 3BE4A 3OFNA 5KDLA 3D31A 1HUQA 3OEHA 2OFOA 1ZUIA 2P5SA 2PX0A 4JBWA 3R8CA 4JVMA 2NO6A 1DAGA 3CH4B 3B1ZA 1P9WA 4P4SB 2I1QA 3T15A 4PC6A 4XH9B 3BK7A 1YRBA 1OIWA 1XTIA 2XNSA 5E95A 4EUNA 2FA9A 2ANBA 1WA5A 4XWOA 2J7KA 1FFHA 1J70A 2JLRA 5EE3A 1NG9A 5E3HA 2NO0A 2FFBA 5FOXA 3UWOA 3QXJA 4TQ9A 2O8BA 1IOZA 2ZIAA 1Z06A 1CJKC 3A58B 4Q1AA 3CRMA 3X1XA 1KK2A 4MUBA 4NCHA 2WWFA 4QHYA 1IY2A 1W0KD 3PCRB 2HJVA 3LDAA 1KK3A 4XVRA 2FN4A 4DEYA 5UKDA 2CL6X 1VIAA 4BLPA 4HUTA 2WJIA 4DUGD 3TW8B 4MGYR 3W3AA 2BIFA 1KYIA 1W48A 3LAWA 4NMMA 5EE0A 4AI6A 4Q7MB 3LXXA 4H9GA 1Z2AA 3WMEA 3X1ZA 2Q9AA 4NCNA 1KO8A 4OI1A 3R7WA 3OFND 4HZUA 1JQJC 3PENA 5D3QA 5P21A 5JWOA 4IFBA 2IXFA 4URZR 1QHXA 4GNKA 1HTWA 1NMZA 4OQMA 1IN6A 4D4KA 4KXFB 1ZM7A 2QAGB 1F60A 1NKTA 1ZW6A 2GESA 4C3ZA 3I3SR 4OK5A 1KI6B 5CIQA 5IT5A 4MUAA 4C4PA 4OQXA 3FYHA 5CM9C 1XTKA 4NYIR 5FPTA 4TQUS 2IC5A 3TQFA 5J4VA 2BBWA 4QNRA 3SJZA 5KNCA 6Q21A 4EFNA 1MOZA 4IVPA 4RCZA 1OT3A 1NJGA 2OUKA 1T0HB 2NPIA 3FVQA 4IOJA 5FOWA 4BZXA 4LPKA 3MLEA 2RHDA 1T3HA 1E9CA 2YC2C 1FMLA 3LH5A 2UKDA 1HEIA 4DWJA 3PEVA 2JAQA 2FU5C 2IWRA 4D0GA 3W9YA 2R6DA 4NYIQ 2WJHA 2IYLD 1KI2A 2ZYTX 3VKHA 4LV6A 1Z6GA 1S8FA 1DBSA 4MKIA 3T1VA 4P0TA 3BD9A 5CDFA 3KKOA 2O8DA 5TV2A 3X1WA 1P3JA 2XNDA 4JJZA 3QIAA 2O8CB 1TU3A 2F55A 3AV0B 1J7KA 2ZANA 3GJ0A 5L3SA 4BLOA 4L8GA 4O0MA 4AC9A 1W4BA 2IXEA 1D6JA 2WM9B 3PIRA 4IXNA 4B3XA 1YQTA 5KNDA 1D2MA 2IYRA 1G19A 3GJ6A 1P9NA 1ZP6A 3CRVA 5SZJA 1CJVC 3SBDA 5B64A 1E0KA 3U4QA 3TJZA 1OKKA 1RJ9A 1WRBA 5HTKA 3LNCA 3IPYA 4QFMA 221PA 1ZVQA 5D3MB 3TBKA 3RS0A 4ZPXA 3M0EA 2VH5R 2QSZA 5KSOA 4BWYA 4CZ2A 4MQBA 5EE1A 4O3MA 3SFZA 1WB9A 4RCYA 1TQ4A 2VRWA 1ZM9A 4OQNA 4PFSA 2C5LA 2CHVA 3OZXA 2QPAA 4QM6A 3VX3A 4KCGA 5BN3A 3TVDA 3FTQA 1UADA 3QUSA 1S2MA 2ZRCA 3KQLA 5HPYB 2P6UA 4Q1EA 2Q3FA 3GLHE 5F3WB 1JPNA 1AIPA 3I1FA 3WY9A 2VP9A 1UF9A 2CLCX 2ZXUA 1TF5A 4TL9A 1GL9B 3KUDA 2JLWA 4P32A 4B3FX 4B76A 4CYMA 3HR8A 3CNNA 4DSNA 1PLLA 1IN4A 2DR3A 3QXHA 3KQKA 1CR0A 1DAFA 2VA8A 2QRZA 2VTKA 2NO1A 2SHKA 1XNJA 4B3DA 2P6NA 2J9RA 2QL6A 1VMAA 1QHHB 3KJGA 2ZRPA 4KYUA 3RS3A 1KOFA 5AUOB 4QC2A 2XZOA 4PC7A 1E6CA 1AN0A 2HLDA 3TK1A 1E98A 2J0VA 1WE2A 4TYQA 3BFKA 4RFSB 5BYKA 4I81A 2PJZA 4Z1MA 2EFEB 2FOLA 3LW7A 4ON9A 5GVRA 1D5CA 5B30A 2A78A 3AKEA 3LW8A 4LSGA 1SXJD 3MD0A 3CF2A 4D0LB 4KI0A 2BBSA 2GK6A 2W2XA 1RRGA 4TMKA 5AJVB 3ZDQA 3DZ8A 3THXB 2XZPA 5GJWC 1Y63A 2WSSD 2J0QA 1NIJA 1XEFA 2BCJQ 2MMCA 2BBTA 2WOJA 4KODA 3LFUA 4IHQA 3EG5A 4DB2A 4YXWA 3GLGB 5AJYA 4HLUC 4JLDA 1E0JA 1LTQA 3T5DA 4QJ5A 4EFLA 2VHQA 1CS4C 4I1SA 2OXCA 3T1OA 1ANKA 3NEYA 1LNZA 2QE7A 2W83A 3EASA 3OIVA 5C46F 4TTPA 4HUQA 2DCUA 1CEEA 1ESNA 3ZD7A 4A0FA 2HLDD 2WVJA 2ZJAA 4GOKA 5CIWA 1I2MA 2H5EA 4DC9A 2V55B 1Q3HA 5HE8A 2FE4A 3OE7A 1GZSA 3PXGA 3SQXA 3FPAA 4P3YA 2VP2A 2V9PA 3W6NA 1G4AE 4PX9A 1EWQA 5KO2A 1XFAA 5KUTA 2R6CA 3PEYA 3LBIA 4DT1A 1PLKA 1G5TA 2F7SA 3B85A 2IX3A 4IOLA 1OB2A 4PPNA 2B8TA 3D6TB 2QORA 4V02A 4CEIA 4LHVA 3K9LA 4WOPA 4ASUA 4L9WA 2QEQA 3OAAD 2QMUA 5JRZA 4HAZA 4V0MA 4W5WA 1KGDA 1NL3A 4D80A 4HLCA 1NY6A 1ZBDA 1Z0JA 2CXXA 4XJXA 3GLIA 4JT4A 1HT2E 1VDZA 2KWIA 4II7A 5KOYA 1JR3D 5AUQA 4ZIRA 2QNRA 3UANA 2GDJA 3RS2A 1WXQA 1VG8A 3ZH9B 1OH8A 4Q1BA 2BMEA 1XTSA 1N5JA 1VG9B 1KNQA 1E2HA 2ZTSA 2ZS9A 4TTRA 2DFNA 4E5UA 3FHCB 1XXHB 4MGZR 1TQ6A 1G5RA 5EE5B 5CYPA 5DI3A 2BVNA 4HI0E 3K9HA 3GEHA 1XPUA 4DLUA 3FKSA 3R8FA 2GJ8A 3S1AA 3UK6A 3PUWA 2A9KA 3IQXA 1W0JD 1E9FA 2G0NA 3AVYA 3Q5DA 4RD4A 4LDJA 1IXZA 3QBTA 1F2UA 1NRJB 2R6GA 2NMVA 4YMTA 2J41A 4JVSB 4EJSC 1G1MA 2P0EA 4ZDWA 4MYHA 5TARA 2JATA 2F9LA 2RGEA 3IUYA 2CNWA 4DDTA 1Q21A 3QKSA 4HYYA 3ZJYA 1XMJA 4I4LA 1DEKA 2W6JA 2CL0X 3JZAA 4TMXA 2Z43A 1UBGA 3U3RA 3AEZA 2PEZA 5F2EA 1M1YE 4BLSA 5JWRA 5DHAA 1OFTA 4LYHA 5LD2C 4OBEA 2C78A 3NDBB 4G5QA 3V9PA 1A5TA 3G82C 1LY1A 1LFDB 4GZMA 5KDOA 2WZQA 4MYCA 4PO8A 2ORIA 2R2AA 3IQWA 2CVFA 5CYOA 3I8SA 3RANA 3U3OA 4W5JA 2IS4A 3RS4A 1G3UA 4G5RA 1UBCA 1Z47A 4FMCB 5HE9A 4MKFA 1DE0A 1TTTA 3LX5A 3MG9A 2AFIE 2RGAA 2WMOB 2H17A 1MO6A 1KMHB 1S1CA 1S9HA 3AVVA 5FTKA 3T12A 3LWNA 1XEWY 2IYVA 2TMKA 3VU9B 4DLSA 3CWQA 1W2HA 4AKEA 4A0GA 4URVR 2ZITA 1XTJA 3NBXX 2BBOA 4BE7B 3FHTA 5CLLA 3P1JA 2CNWD 4LWZA 4NL4H 4U5XA 1XJQA 2ZI3A 3DHWC 4HB4A 3QKRA 4M1SA 1GM5A 5DE3A 4U7DA 5BQ5A 2JJ1A 4NHOA 1Z83A 1NKSA 2ZJYA 3K0FA 3PEWA 2ZRGA 4DDVA 1J90A 2DB3A 1CKEA 1VYVA 2PLFA 2RGBA 3CF0A 3PUZA 4ITRC 1T0JB 5EXTA 1X3SA 1P75A 3THWB 2ATXA 1M2OB 5G40A 1E2DA 3I8XA 3KX2A 2MSCB 5DYGA 4FINA 3REGA 2ZROA 5SZIA 4CIDA 5KU1A 1R0WA 4C0SA 3GQBA 4TQAA 3ICQB 1M8PA 1G9XA 3Q72A 421PA 1KJZA 1P61B 3N2IA 2OLJA 3CO5A 2KSQA 5E7MA 1G41A 1EFCA 2IYWA 2J0SA 4FWTA 4JL6A 1KTVA 2D2EA 5C4MA 5JECA 2IHBA 4JS0A 4NYJR 1UKVY 3T61A 2EFHB 3EA0A 3BERA 1JQLB 1ETUA 2QAGC 4L4UA 4HLQB 3B1XA 3AM1A 3I62A 4QBHA 2GCOA 3ZS9A 1T4GA 4IDOA 2CE7A 1LW7A 2V6IA 3I32A 3QQ5A 2V6JA 1HV8A
chains in the Genus database with same CATH superfamily
2Z95A 4L0CA 4M87A 1JQEA 3OOEA 1U2TA 3R74A 4R41A 1CY2A 3K0HA 1GNLA 4E31A 1DP4A 1SCBA 4ZXFA 5HF8A 3UCFA 1AA9A 1FOEB 3ETLA 4F85A 1CUWA 5EJ9A 1M6VB 3DDZX 4OL0A 4AMVA 3RRYA 2D4HA 3HRHA 4BGDA 1KZHA 2FPWA 3Q8MA 1N3BA 2D1QA 2DHCA 1B26A 1WB6A 4Z8YA 2I8AA 1MABB 2VAWA 5KJCA 4YUVA 4YMUA 2QLMA 4B85A 2QS9A 3PC6A 1ZH4A 4OI4A 5A5EA 2NZXA 2F1IA 3F3MA 1WV1A 3Q3CA 2QPLA 2ZJ1A 2AZDA 3A1FA 4PGAA 3RVPA 3CKYA 1JXMA 4CKZA 3OF2A 2QRVA 1FMFA 3OZEA 2A35A 2FQWA 2QGZA 5E3IA 4L5JA 4M22A 2R1ZA 4ZGWA 2GBCA 3OD1A 4ZODA 4KDEA 2XTJA 4RX1A 5HQJA 2H1RA 3NANA 4N0PA 4YDQA 3KWFA 3GIDA 3BS4A 3DOUA 4BX0A 4CKEA 2J7PA 1Z45A 4CG3A 2XECA 3ZIAD 4F72A 4Z5XA 1YS6A 3F4KA 4JXJA 4PQYA 3LQ2A 3GFSA 3PUVA 5CURA 1PW7A 5JSFA 1CY1A 1YR6A 3EPLA 1RXEA 3IGFA 1WL8A 1UXIA 3VHXB 2JDID 2ZBUA 3U7FB 2XBUA 3MCAA 4Q9NA 4EYOA 5IC6A 2Q5CA 2XF8A 2IS2A 2X8AA 3KQHA 1EWVA 1QF9A 1ZHHA 5I9IA 1LTKA 3ZZ0A 2FSFA 1E64A 3OSZA 2BCEA 2MIIA 4KXLA 5HR5A 1LKZA 2B99A 5CBKA 1MAHA 3RBXA 4MZDA 4L02A 5B2EA 2D5IA 1WEKA 3W05A 2QD4A 1E3TA 2YOHA 1KAQA 3D3WA 4JSYA 4RKEA 1HA3A 3FVVA 2FSIA 3HJNA 1XF1A 2BKEA 4OHOA 5AM5A 2QROA 1EVIA 1MO4A 1T1GA 3ELDA 4TKZA 1I3KA 3AVOA 4K26A 3JRWA 5KTTA 3K0CC 2Q0SA 3OM9A 4P0QB 1KEZA 2AEJA 3C15C 4D9HA 3ZYCA 3MMSA 3AL0C 2R8BA 3LM8A 1N92A 4IMIB 3DFMA 3MTGA 3UICA 5CEFA 5IM4A 3NT5A 1FSSA 1THZA 1UDXA 3QWFA 3M34A 4L5BA 4D3DA 4H4DA 5JIBA 2O50A 3VGPA 1S2GA 2C5EA 4CF5A 7ABPA 4GKKB 2QTTA 4EPYA 3HWX1 3KIPA 4DV5B 4WRRA 4EGQA 5DMXA 3WYDA 1N5KA 1UC8A 3T7TA 4KAJA 3EFOA 4BQOA 3D54D 4UTNA 1TOAA 2FI1A 3NBZC 2YCBA 4WADA 4BP3A 1NBMA 2YJNA 1DKLA 4LF9B 4HNVA 4LJ6A 3VMFA 4CL8A 2EERA 4R54A 4EPVA 5IKPA 4ZYXA 2NIPA 1QVRA 3ABZA 3ED1A 3DFIA 4A0RA 4ROTA 4F71A 1RE0A 4U6QA 3G59A 3ZHVA 1QIEA 2R96A 4IDPA 2PXHA 5E3JA 4IJMA 4MS4A 3Q7RA 4EG6A 1Z2EA 5AW1A 2PQ2A 3EUEA 4RSHA 2C04A 2CNOA 1QG6A 1MJ5A 4PYNA 5ESDA 5C32A 3ENVA 4I50B 1F0NA 5DI9A 3ZTTA 2V7QD 1P44A 4G07A 1KHTA 3TUJC 4BX3A 2I54A 4C4RA 1X7DA 1RRPA 8AT1A 3RWBA 5GV7A 1NV8A 2P9BA 2FJPA 3KU4A 4ZI7F 3VOSA 1FP6A 3C74A 1K68A 3G0CA 3OBBA 3R3VA 3TZHA 3FCUB 3L8FA 3T3GA 3RKRA 5ALLA 3L8GA 3PQ8A 2ORYA 2SKCA 1SZCA 5BN4A 1ZPDA 1XTPA 4AUEA 3G9TA 2R4TA 3FM9A 5CW2A 4ZT5A 3D8SA 3RROA 4LZAA 5HFNA 3JSAA 3ZXXA 1XJWA 2E82A 1EESA 2GVNA 5ARCA 2PT6A 4J94A 4D74A 4QGAA 4LISA 2IK8A 5ANRB 5E8RA 3SS7X 1KR5A 1SD5A 1L8OA 3EVAA 4G1FA 3EXIB 2DWQA 4N7RA 3CNBA 1KYZA 4KR0A 3OP1A 4BO6A 4TUYB 2VTDA 4FFNA 2H4ZA 1A1VA 2UDPA 4OGKA 2PL3A 1J1ZA 4CETA 4MV4A 1AGXA 2P3LA 3RFFA 3SYLA 3ZBPA 3RT7A 4D4LA 4Q21A 4ZN6A 4MCJA 4JB0A 1HDGO 1VYTA 1SO8A 1B73A 1QIFA 1TUEA 2BISA 1ILWA 2EEZA 2VFAA 3GMIA 3KB6A 1DEHA 4IF6A 4JLKA 4LJKA 2XB2A 1R4AA 1C30A 2A84A 3U44B 1NXTA 1XO1A 2W2NA 1KAHA 3LVBA 1SVKA 3F7TA 4R1NA 3MWJA 4RZ2A 3RV4A 5DFAA 4C22A 3BZWA 1GQSA 3RH0A 1PJBA 2NWQA 1KU0A 1U3VA 3JD2A 3N70A 4JELA 4MHTA 1TM5E 1W94A 1XKTA 2QP3A 3C7AA 1CNFA 4M36A 4X92A 4W7IA 4P0PB 1Z5VA 3K1YA 4YJHA 3OZRA 1I3LA 4A9AA 1AUVA 4LGMA 5TF0A 5ES3A 1IBMB 2GBFA 2AZMA 5TVKA 2VJMA 3BAFA 3ZHQA 4EW2A 3NCTA 4NBRA 3A6DA 4I8IA 3RODA 5JEEA 4KX5A 1VTKA 1KY2A 2QP9X 4TV8B 2C7BA 4RIEA 2ZSUA 4LCEA 3CONA 1M0WA 4LZPA 5DHFA 3SLKA 3DD1A 4LRSB 4D0SA 5LOVB 4LXTA 3SN6A 4HNGA 3L79A 1KI1A 5K4HA 5KJEA 4NG5A 1U5CA 1C9EA 4NI5A 4X20B 2R84A 2BD0A 5CIYA 3HYSA 3H99A 3FSGD 3LP6A 4JI3B 4L95C 2Z8XA 3LP8A 1ORDA 3P0IA 3TBFA 5KQLA 2AZXA 1M9NA 5FTLA 5LP6B 1VXOA 2GA9A 2PJUA 3PUYA 4BPBA 3G9UA 2H3HA 2JC3A 3DA8A 3HB0A 1OFUA 4N12A 4RL6A 1RFGE 2AOXA 2YMMA 4LY3A 4ZQIA 1TKAA 4DUGA 4HDKB 1KQNA 2KBEA 4L50A 4DCGA 4YT5A 2ZOSA 2YIVX 4N48A 4UKDA 3MERA 1HNNA 1KMQA 4PSAA 3PVZA 3ITKA 1TI7A 1QFYA 5A3RA 4FOOA 2CWDA 3C3WA 2VP6A 4KBFA 4NEQA 1FX0B 3KAQA 3UAOA 1KEEB 4RIGA 4FEGA 1IZ0A 2DR0A 2DPLA 3ASYA 3QEMB 4X3CA 3SYKA 4F8YA 4US0R 1TAHA 2C8LA 3FWZA 3ABIA 2VIIA 1RRFA 4FE7A 1L7PA 4ZHQF 1H2WA 1LDNA 4MVJE 3UKDA 5LZ8A 1CERA 4E0BA 4YJ3B 1QZTA 1ZN7A 4XB2A 4UHBA 2QLJA 2AF4C 3L0IB 1NMYA 2YS7A 2R60A 4JUBA 1NE2A 2NU8A 3LF1A 3R0QA 3G68A 1NE7A 1Z2OX 4I55B 4S0XA 2OA0A 1Q7EA 5HIJA 2XGJA 5C9ZA 3RNOA 1JR2A 2OBMA 3AJ8A 4GZLA 1FDUA 4EY8A 3QEJA 3DAHA 1IY0A 4PGFA 3LKDA 2VHYA 3IKMB 5D00A 4UFOA 1IQ0A 4GPIB 4MA4A 5IPFA 2ZR8A 2VHTA 2UVQA 4MRNA 3GRRA 4F4UA 3B2NA 2J09A 5ITSA 4R8VA 2IIBA 1VLVA 3TSYA 1GGKA 4PONA 5L4NA 4ETWA 5LQDA 4JITA 4AG3A 5J1TB 2V45A 1GU0A 1P5ZB 1TZBA 1U3UA 2V3CC 3DHYA 3ESRA 3Q8XB 2JCSA 3ZXUB 5A9TA 4PAMA 4QGGA 3FFXA 1U0NA 3P52A 3FE2A 4C6SA 3P9QA 2GK3A 4LHWA 1N0VC 4XX0A 1GILA 2PGDA 4ER6A 1O2DA 4YLYA 2X8JB 3RVDA 1GL7A 1E6UA 3TM5A 2QQ0A 2ZETA 5IDYA 2XUQA 3RIGA 4DUYB 3PE6A 2R11A 3OUUA 4NRDA 4UMVA 5TPZA 2I55A 2D2FA 1WXFA 4IV8A 2A0YA 3ZZ1A 3UWKA 1KO4A 3LUGA 3SPXA 2W6PA 1R6XA 4YTEA 4CTJA 5J2UF 3EGXB 4OV6B 5JQGF 2AFHA 1W46A 1NNLA 2RFLA 1K9SA 1UH5A 3ADCA 1CXZA 4JP2A 1EI9A 3HU1A 3Q7PA 4LXQA 5CM8B 1P2UA 4RTOA 2AI3A 5JHGB 4TTSA 2VP4A 3ZV4A 2EWWA 5KX5F 3NMUF 4Z7NB 5TMBA 3B38A 2FSVA 4LVUA 3LPDA 4XTRA 5DYTA 4ILKA 2NSHA 2X7XA 3ROEA 1JLLA 4E2FA 1F0PA 2QJFA 2DPGA 2O2IA 4HB3A 3WXMA 2B94A 1UWLA 3WADA 1I7LA 3WWEA 2BM8A 3G88A 2YZNA 3MZ0A 2AA3A 1IWBB 2BTOA 2ZRFA 4TMYA 4J76A 9GPBA 1VL5A 5CJPA 5FFFA 2BUCA 4ZK6A 5FB3A 1WEHA 4Q01A 4KPGA 4KV9A 4DWOA 2PUEA 5JZBA 1DRUA 2PRSA 1J0BA 2IXBA 4J3JA 3HSSA 2BI8A 1D8TA 4ND5A 4LHZA 5J1SB 1CRWG 2FY8A 2W4IA 3KJIA 2CFIA 4GPEA 2CBXA 1EFTA 3V7FA 1CWUA 4F4IA 2ZR9A 4NCAA 3ICPA 1IHOA 1NBEA 1ZGZA 3HL0A 2DXIA 3BD8A 1QANA 3V7WA 1RHMA 2ZRLA 3KT3A 5SZKB 1M1NA 2Q07A 3ICVA 1HSOA 1XHLA 4BLWA 4BZQA 5BUCA 1PWYE 3TNYA 3LWDA 2QRGA 1GN8A 1DIAA 2YZ2A 3DKPA 4XB1A 1QWOA 4RH1A 1YA6A 3E58A 2XB4A 4PLTA 3MUNA 2R7AA 1G55A 1AQ6A 2A3NA 1KS9A 1P0MA 4TWJA 4KXXA 1DIGA 5AJWA 2I1VB 1LPAB 3D2LA 3ZU5A 1Z4QA 2OZKA 1KI4A 1U5BB 2ZYIA 3D02A 1EM8B 3GVIA 5E7JA 2D5BA 3CRW1 3DKIA 3ILHA 4Q6WA 1I6KA 2OCGA 3B9PA 2ZSAA 3G9XA 4DMGA 1RFLA 1DDIA 4O4IA 2ZQ5A 5AXCA 3DBHB 2XMDA 3DMFA 4CF7A 1C0KA 4ZA2A 1UMBB 4R01A 4YONB 2QTVA 3A0UA 1G20B 1SKYE 1MX9A 2PL9A 3AHGA 3B36A 4R9NA 4FU0A 1QRAA 4NMHA 3S5JA 3KOXA 4GOND 2EFDB 4H7IA 1NWCA 1XAHA 4M0CA 4NK5A 3VDNB 1TA0A 1GZ5A 1Z6PA 2XTAA 4BCBA 1IMJA 4FW8A 3T3IA 2X3FA 2G63A 4ZAFA 3OC6A 3FHLA 2IWHA 1BS9A 2OHXA 3RLFA 3V8MA 2O20A 1VLQA 1CUAA 4S2EA 1NLYA 3TZ6A 3UMRA 1J2TA 5KYUB 1LZKA 2WIBA 1DL5A 2A5FA 2VATA 1ZNYA 2YHAA 4S0ZA 3ORHA 4LHSA 3RRNA 4D9FA 2BFBB 1G21B 3ZLJA 5BO5A 1RXCA 3ZNQA 4MGIR 1X1AA 2O2JA 1BHJA 4MULA 2AN9A 2NTJA 1W5SA 3LYAA 4TN5A 3FPLA 3QEKA 2WKPA 4GM1A 5EL0A 3F47A 2O06A 3OC0A 4RZUA 5ERXA 2EP8A 3JRNA 4MICA 2MYPA 3HCAA 3RUIA 3BL6A 2HNKA 3A25A 1U0JA 1FU4A 2WZDA 3N0VA 4MWOA 4F5ZA 5H4GA 1DOHA 2OZPA 1O97C 2QJWA 3LVQE 1WD5A 3R24A 4RD1A 4OQFA 5G0SA 2PNJA 3K6SA 3RVBA 4N18A 3JQEA 3RUCA 3P32A 5E7QA 3FKJA 4A92A 4ABTA 1R2QA 4FYXA 5BP7A 3OZVA 4BWFB 1DZ3A 5AVVA 5AW6A 4J0QA 1LBEA 2PPVA 1SKBA 4JNKA 4DAEA 2DR2A 4OOEA 4YWJA 2ILVA 2X9QA 5FYDA 3AG5A 3K9CA 2B25A 4U0KA 4Q3AA 2JZNA 4H7HA 1W1WA 5AKIA 2CD7A 2H1LA 1VCOA 3QK7A 2JFFA 5FLKA 4E5PA 1B8PA 3P9ZA 4Y3UA 3OQOA 3VPHA 1NX9A 3KSMA 1FUIA 1XDGA 1RDFA 3K6KA 1NP6A 4OFZA 2DTXA 1NUSA 2FPOA 1FFGA 2H7VA 4L1KA 5BN5A 1NM5A 2FKAA 5KKCA 1BS2A 4HNHA 1JHOA 1I7PA 2O3RA 1YJXA 2HWKA 4LTDA 3AUYA 1J5PA 2BJVA 1U7OA 3DLPX 2H48A 3FUCA 3N8DA 1MR3F 4QVGA 4Q48A 3EHEA 3OJEA 5KYWB 1BX1A 2JFXA 4IKEA 1XZQA 1YUNA 4UUNA 4DJFC 2JLZA 4JJEA 2OQ2A 2Q5QA 4PN3A 1IPFA 1KO7A 2P9FA 1VSUA 3V4SA 1EXMA 1FXUA 3VR5A 1U3WA 2QI9C 4WUVA 2G1KA 1TU4A 3JY6A 4X0EA 2OV6A 4ZOQI 4BQSA 3HUEA 5JHHB 2R85A 3GI1A 2RI6A 4M1WA 2P0YA 1BROA 1CC1S 2R47A 3M5CA 3V8BA 4EYKA 3SQLA 2XUAA 2AUNA 4W8GA 1TMYA 1EDBA 1JE1A 4FJ1A 2IUTA 4MQEA 1MW8X 2CNDA 1EXDA 3D2AA 1TC2A 2HBYA 1U7ZA 2GM9A 3R0VA 4I50F 2HF2A 3L0YA 4L5YA 4HL6A 2OMKA 2XB6A 2W6QA 3VJRA 4HLNA 5FWDA 5CLJA 1FTQA 3UBTA 5K2MA 1KORA 3C6BA 1XMOB 1JR6A 1P1BA 3BRWD 3CHYA 3OT1B 4KWTA 4UU1A 4Z0TA 1SM4A 5BVGB 3ZHUA 3PFIA 4G0PA 2FPIA 1YIOA 1O7JA 3D8BA 4CNQA 5K3SA 1MAWA 2YRXA 4KN8A 4L6AA 5EZ5A 4L0QA 3F49S 4QNMA 3GX1A 4WGFA 3RDPA 4EB6B 5ES4B 5KYYB 1Y4AE 3KJNA 3MCVA 4WZBB 4OJNA 5KNLA 2IBTA 1H6DA 2H00A 4QHSA 3UJHA 4HGQA 1D7AA 4KNYA 3ZHZA 3UO8B 1SUDA 3SJUA 4BO0A 5IUKC 5BRAA 4PNEA 2TMYA 4UPVA 3HXTA 4PQGA 3IELA 4OMUA 1M7HA 5E9QA 3USCS 3A4MA 4A91A 4L3VA 2IUFA 4PGHA 4Z4FA 4C0KA 1QVVA 4DARA 4E7PA 2ZVJA 4OHXA 2GAOA 4G81A 1LB1B 3PI7A 1I13A 5DYNA 4ADSG 1TO2E 3A0RB 4FE4A 4MGEA 2CLKB 2VL7A 3H0CA 1JHXA 4V3BA 3L0BA 2QYSA 4Q19A 1DX6A 1VMIA 4P38A 4TUYF 3W5UA 3ZYZA 5C8YB 4YFVA 4B6EA 1XZBA 2FWBA 3OFKA 3U0BA 2X0JA 4H1UA 4KU4A 3A1EA 4NYMQ 3AKCA 2JKVA 4BO9A 4HVTA 4DEVA 3FJYA 2NV0A 1RHJA 4GICA 4FZVA 3QIVA 2LNDA 3AIOA 2PFSA 1C4WA 1RPTA 1WCXA 4G26A 1E3WB 3H05A 4JN6B 3Q98A 4P3NA 4WN3A 2IYXA 1N6KA 3FUUA 3TQRA 1OGJA 3RC9A 3WYFA 2BYTA 1Z8HA 2DWOA 4CFYA 3WIVA 3F6CA 1HZJA 4DANA 3USZA 5EUBA 5DM2A 4NZOA 1ENPA 5FTMA 3V4LA 5L3SB 2GCEA 3T7JA 1M73E 1K8RA 1TKCA 3F5SA 3VKWA 2FN3A 3SEFA 2HO4A 2ZT8A 4MPPA 1R27A 5IBRA 2HNAA 1BG6A 3SZUA 1EZ1A 2O6HA 1PT7A 2Z9DA 4WERA 2IP2A 3G2QA 3SQNA 1ORWA 1UXOA 1ONBA 4BFXA 1TCBA 2J33A 3VGJA 1ZOIA 2D1YA 3U4QB 10MHA 3AKDA 2AW5A 3ZH2A 1DS6A 2X4IA 4DY4A 1U2ZA 2WWIA 3QP9A 4HMPA 3QX3A 3LVRE 4U1RA 4BO7A 3ZK7A 4TV8F 5FNVF 4Q37A 2PXXA 3D7LA 2JEZA 4ZVKA 4P5PA 1XTVA 3GZJA 3LBFA 3V2HA 4B4WA 5DWDA 1FFDA 4O8ZA 1EK0A 2C20A 2ES4A 4WZAB 2V4ZA 2XCOA 2Y3IA 4PYRA 4F3NA 4N6OA 3KDSE 4J0IA 3QW4B 4C7OA 1IN7A 1FRFS 5BN3B 4TPKA 4EZEA 3GLVA 1XWIA 1E8DA 1SB9A 2MSEB 2OO5C 1Z26A 4R0VA 1HQYE 3PD7A 1L8AA 2R7MA 4CKWB 2EF0A 4GE0A 4OG2A 4JC8A 2CXTA 4CLXA 4RHEA 1N2JA 4YJGB 2A0WA 2DLNA 1TK9A 1BMFA 1K6EA 4LOJA 5LXTA 1VJ1A 2RBKA 4R6WA 2W2KA 5FHRA 2HMTA 4OP1A 4KTVE 3CNEA 3EG9B 3DE1X 3ESXA 5KYGA 2Z04A 3TB6A 4YRCA 2Y67A 4XWYA 1JJAA 3CKMA 4P3PA 3WQHA 3AU8A 3ZZMA 1L9XA 3AVQA 4URYR 1IDN1 2YJ3A 5ALGA 1JDPA 2O8FA 3QMMA 1DAMA 2W2MA 1N2EA 2BRUC 2VPPA 3N2ZB 4PVCA 2ECQA 4QU9A 5DBOA 4AKIA 3CEHA 4AULA 1EWKA 4G24A 3RFUA 1W9MA 2F1JA 1GQ2A 4QKQA 2I9KA 1FFYA 1BW9A 1TEHA 2PA0A 2Z9CA 3CLRD 1EBBA 3SQDA 3O82A 2ZUFA 3ZDDA 2PUAA 2J31A 2WSMA 2ID7A 4FLEA 4QG7A 3EXG2 3IVMA 1H9BA 1KRWA 3EGCA 1BJKA 4HGRA 4OXRA 3EQ7A 4X1IA 4EA9A 3UJNA 4BEBA 1H0RA 3MOIA 4HFMA 4MIKA 5DM70 2G76A 2F6RA 3AR9A 2OO7A 4KUEA 1D2NA 3ZV3A 1EBUA 1CZKA 2ZRQA 3AUXA 4QRDA 5A5DA 2WFLA 5EP1A 2GN4A 5HM6A 1R5JA 4CIAA 2PO5A 3BCHA 4TTVA 1C4KA 1F48A 1DAOA 1GZ4A 2VDVE 4JR2A 4Q12A 2Q45A 1EZZA 1YCHA 2V5UA 2R44A 4MGKR 1FBNA 1Z63A 2GJ9A 3A4NA 2ANCA 3LDHA 1ETHA 1JJ7A 1M34B 2WM2A 1TW2A 2HXGA 2ZVPX 3A28A 3IULA 4LBWA 2D6FA 2RH5A 1NT4A 1UBKS 2PU7A 3HYCA 4HUQB 1UODA 3PTZA 3PLNA 4F7DA 4J75A 1SA0B 3R3WA 1WUIS 2QZPA 4UHEA 2ALJA 4MIOA 3BXZA 3L9WA 1ST2A 4URXR 3QVVA 3VR6D 2PGIA 1UEIA 2IU3A 3EVTA 3BMNB 1ISSA 1P0FA 4URFA 1VLZA 1I1NA 4E4RA 1U7TA 1ADGA 3EQ6A 4FZ5A 3E1SA 3MN1A 3KPUA 4NBSA 2ZRMA 2FNAA 1VSTA 1PRYA 1K88A 1J0DA 3R3ZA 3RKUA 1DSSG 1LLFA 2DUWA 1IOWA 2CCJA 2HSDA 2JIBA 2GEFA 2XIJA 3K1JA 4PC2A 3VUEA 3UMYA 3KT0A 4Z0HO 1XJ5A 1YDWA 4WJKB 2OXRA 1DB3A 2BFNA 2W98A 5IXYA 3FSEA 1WDTA 3VA7A 1FRNA 1O95D 1IJEA 1Q1QA 2PZ8A 3SQOA 4C0HA 2IYNA 1T1JA 5EPEA 2GM3A 2V6GA 2B7LA 4TS4A 3LGSA 4M4SA 1GLNA 4GGPA 4Y67A 5E2IA 4GNRA 2Q6LA 1O9GA 1Q1AA 5NULA 1OBOA 4ZCLA 1XDBA 5T8KC 4BO8A 4G6ZA 1MIOB 2I87A 2FPSA 2K7FA 3L2OB 4AS2A 2HAEA 3B1JA 3GOQA 4JLWA 1M1XB 3L8EA 1S8NA 1I6MA 4GUDA 4J0FA 2PG3A 4E51A 1Z0DA 1YL6A 3U26A 1ZD5A 2W0MA 3AEKA 4E70A 1CYDA 2GZ1A 5FBKA 2D54A 4L4XA 5DI3B 3H1TA 4IXTA 1P1CA 5DYYA 4HBZA 2C4WA 2QRLA 4R2JA 4TTQA 1REQB 3JYOA 3WQRA 4X65B 1S4QA 3PVSA 1YACA 1YQQA 4EHKA 4CXMA 4EIWA 1E2LA 3TRJA 521PA 4POOA 5EQTA 4PO1A 4E2XA 5DASA 1BWRA 1F2UB 5IZCC 4I9HA 1Q19A 4IUYA 2GBPA 1ZRSA 1FA9A 3AQIA 1M0EA 1OWPA 1UBEA 3WMXA 3B2QA 2I2BA 3VTZA 3W1WA 4WWHA 2LW7A 5AKXA 1RRCA 1RZRD 1QHNA 2I80A 1QDLB 3RVJA 4OLBA 1FBTA 2NYUA 3CRQA 3KXPA 3DAYA 3N6RA 3L02A 3LPLA 2ZEJA 3DPSA 3DXXA 1OYYA 3QVGB 3UV7A 1NNSA 3O3OB 1NHWA 2HADA 2NZUG 1EX1A 3BWVA 3F78A 4P4SA 2FMIA 4B7UA 5FUVA 1G63A 3OZUA 2HRQA 5F98A 4F92B 2F43A 3HK2A 1N32B 2FEKA 1J2UA 1MRSA 1VP9A 2EG9A 4FPXA 1QZUA 4NEHB 2Q2NA 1SXJE 2Q99A 3TSOA 1OXTA 3HGMA 3H3FA 3HBFA 3H0EA 2Y6VA 16PKA 2P75A 4I4TB 4RLSA 4OP3A 2G77B 3IHLA 1A2BA 4TSRA 3BMCA 3PNKA 1MUUA 3F46A 4M83A 4L9SA 1EDEA 1X42A 3F7OA 3LK7A 4PM4A 5FOVA 3EEIA 3F0TA 2PGOA 3KS9A 4EDHA 5JAOA 4CGZA 1AQIA 5IYZA 3L6DA 1WUJS 3O4HA 4UCXA 3NTVA 1BVRA 2IZ5A 3CLHA 1KBOA 2FWPA 1DNPA 3DR5A 2DKFA 1WUHS 1Q74A 1P0QA 1PK9A 2CXHA 3GZ4A 1QRTA 1E4EA 1NSYA 2ON6A 2WQ6A 1F8UA 3PKZA 4D9BA 3OU2A 1MO3A 1RWXA 2CNKA 5FD8A 4C7XA 4IHJA 4H1TA 4QQKA 4D97A 1HMPA 3U4IA 4RCVA 1E32A 3PC2A 5AI0A 3C7CB 2OLEA 4FMPA 3ZD9A 1N0WA 4N0DA 1VHTA 2VPZA 2JAUA 3K0FB 1Q0UA 1T2UA 1XMIA 5DIFA 3SIRA 5HTOA 1ZM2A 3LC1O 3WGTA 1NI4B 3BGOS 5DHRA 1ZM3A 1PEKE 1KI6A 1K7SN 2QAJA 5CH3A 4M21A 1XZFA 3MJVA 2EKQA 3KALA 5LWQA 1VCMA 3AEQB 2AG6A 1VL2A 3SU8A 5KTKA 4N0EA 2P1ZA 5KU7A 2QW1A 4N7BA 4PG5A 5FV7A 3VYVA 2AJTA 2QKYA 3E48A 2JFGA 3FCCA 4CW7A 3GQBB 3TEJA 2Y4NA 1GPNA 3I37X 1BFDA 2H63A 1P5JA 2RC6A 4WT7A 4YMGA 4QDZA 2NM0A 1AQLA 1HY3A 1M2VA 2DFLA 2QVLA 2X13A 2Z3WA 1RACA 5JMOA 5JJKA 4LN1A 2V98A 3BJEA 4LXUA 3VNVA 3UVEA 5JPCA 1JR3E 2GUWA 1IG3A 2HSWA 2RBEA 2VRNA 3Q8WA 4HEA1 4UNNA 4UHFA 3NVKI 4WV3A 3NEJA 3TINA 2F64A 2HCJB 3EIOA 5E1DA 1KI9A 3RQIA 3V33A 3C6MA 4RELA 2WJJA 3AP3A 4MJ7A 1F14A 1SUWA 4JFRA 2A1TR 2G5TA 3SBOA 2LZ0A 1LV7A 2PUCA 2DSNA 2ZTUA 2HA4A 2QZ4A 3PIIA 3W5HA 1E1KA 1GIAA 3FYTA 5HKAA 4M2LA 1GNRA 6AT1A 5M29A 3NP7A 1G98A 2JIZD 3KLNA 1JEDA 1Z0SA 2C2HA 1FSPA 5LVAA 4ARZB 2WYHA 3M5DA 3U4AA 3UIEA 4F1JA 1X7ZB 3EOZA 9MHTA 4FWIB 2ZT7A 1QYCA 5JATA 1GPUA 3VVBA 3CLTD 3W8DA 5FWNA 3BGVA 1Q6ZA 2PFGA 3I76A 3PICA 1O6ZA 4MTCA 3O0DA 3RTDA 1MX1A 3ZWNA 5BUSA 1DFGA 1THTA 2H3EA 3ZE6A 2IW1A 3R41A 2ZI7A 1O6FA 2ZR7A 5H02A 5ELMA 4EGJA 4OMCA 3W04A 4CU2A 1RI2A 1YZNA 2NO7A 3GK3A 3WJAA 2BF4A 1AKMA 3WOHA 4HXGA 4DCCA 2OCPA 4V0ME 2C2XA 4PFJA 3C8UA 1NUTA 4OKNA 4S1TA 3FVTA 1HTBA 4O5AA 4WK6A 1IATA 5DIZA 5CK4A 3GPIA 2VSNA 5JS6A 4CMIA 2HF8A 2C54A 2QZ9A 3G0DA 4PQFA 1KH2A 2VCYA 5C8YF 1JKIA 3MJDA 4XA8A 4I5FA 3VU1A 4D0NA 2CXQA 3P20A 1ZK0A 5TQ2B 2IYQA 5A2QA 5LCXA 3ESQA 2DHEA 4MI3A 1OFGA 1SVMA 4QUKA 3QV1A 2WUVA 5KJ1A 1URPA 1RWPA 3Q85A 1N6NA 1EUDB 3INNA 4GXNA 2CKDA 4WL0A 3TMAA 4RV9A 4GZ3A 5FBLB 2LCIA 3ROKA 2FGJA 3I92A 3A6PC 4YVFA 4C9BA 3S8EA 4PG7A 4Q9IA 3T95A 2JKZA 3IT1A 3T3EA 1T5DX 1UPUA 1F17A 4P1ZA 5AR1A 3W7BA 3ZK9A 4JKIA 4FC7A 3IBTA 3QVLA 2BEUB 4GI3A 1TA9A 4UDOA 1N9KA 2PWAA 2JLUA 4LF5B 5G41A 3SXUB 5IRCD 1QHHA 3IOMA 4AECA 3GT0A 3VR1A 2CLSA 1B6SA 5IMSA 1ZRNA 3H1PA 1PR6A 4O2RA 4F6RA 3UNXA 4EHNA 1L7DA 1RABA 5FTNA 1BCRB 1UZNA 1SXJC 2ZULA 1BFUA 5KVCA 5ILQA 3T0FA 1JFFA 2SNIE 2JJMA 1FNBA 1A9QA 2FQYA 4CDGA 1F38A 5AKLA 4FMDF 1ECFA 3THRA 2EYUA 4AVYA 2CV0A 4IMPA 3R7SA 4QDKA 5K99A 1MJGA 2YIJA 1A71A 1CS0A 1YZGA 2JZOA 4WJLA 3CSSA 2JB9A 5F7OA 4RY2A 3NP9A 3VU0A 4DQ0A 2CHUA 3GFGA 1E2KA 3G0OA 4YCMA 5F76A 3ZGLA 1NFQA 2FHSA 4AP6A 3EEBA 1QC5A 1Z6YA 4DOMA 1F4LA 2BTEA 3NBMA 1A9OA 1BX3A 2Q4TA 3DE0X 4DDUA 3PZRA 4JYAB 1E2PA 1M2GA 1R10A 3SR4A 1C80A 3HRKA 3GNQA 3KV3O 3NUQA 4JFAA 4NDNE 4RA6A 1Y9JA 3URKA 3MYRA 2O8EA 4TTJA 4LGVA 4C21A 3GLGA 1BJRE 2WAXA 1YJAA 2NQ2C 3FNIA 4FBLA 3EMKA 3VPAA 2X77A 3SSOA 5HQ3B 4X94A 3E9NA 1N2CE 3GHYA 4HRVA 1UJNA 5AXDA 3P2IA 3U0VA 2W8BA 5DGDA 3E7DA 1OZGA 1V96A 3HFJA 4FGWA 1N7GA 2ST1A 1N0HA 3H4VA 1VP3A 4LOHA 4KZPA 1PYGA 3NBAA 1Q0SA 1P4RA 3NALA 1Q6YA 1P4JA 1JIUA 3PHGA 3AIIA 3UWPA 1W36B 4I9NA 1Q7GA 2ZUSA 5F3RA 4BV8A 3MJ4A 5IFKA 1HO3A 5KPDA 1DX9A 1QO7A 2XA2A 3IXQA 1ZYUA 2ACEA 1Z0FA 3LL7A 3IP6A 3PTLA 4BNKA 1NLUA 1SCUA 1YMUA 4XPIB 4HQOA 1LD3A 5AWFC 4Z9BA 4N3GA 4D81A 2GWRA 2WJGA 2BTQB 2PX6A 2O23A 1WJGA 1NVBA 2ZCUA 3OUZA 4JI6B 3GLFB 1PWHA 3PPWA 1R9GA 3MINA 4BFTA 3GEBA 2HTFA 3EBPA 5CB0A 5JH7A 2HR1A 4B6OA 4IV0A 2W37A 5BOVA 4K81B 1E63A 3B52X 3SZRA 5B1DA 1FTWA 3QBEA 3DMNA 1JQDA 3C7KA 4PHTA 4UNQA 4PF1A 4QM7A 1CVIA 3C14C 3KE9A 2Q9UA 4KP7A 4OQEA 1PJ2A 3DL0A 3T34A 4F0JA 3WTCA 3KSRA 1JFSA 1E1CA 2IYFA 4Q15A 1X9IA 3D8UA 1GPBA 1ZN9A 1FTSA 4FNMA 2YJ5A 3H2YA 1QJ4A 1HEUA 4J0GA 2HM7A 4P6VF 3VR2A 4GSYA 1PJLA 4MV1A 2XQJA 3ZCVA 2P2YA 2AOTA 2R6FA 2VHCA 2QMOA 4L5IA 5FA8A 2XE8A 4RVGA 3RFXA 3SIWA 4B35A 1ORVA 3GEDA 1QE5A 1ADFA 4YASA 2LVBA 4QPPA 2PSEA 3TLJA 4FI3C 3I9FA 1DUSA 5G3YA 1Z7EA 2PKWA 2PV7A 3K0EA 1B4DA 1LV8A 4IDNA 3L43A 3ZE8A 2HUNA 4RXUA 5KVQA 3WFZA 3LHIA 1TMOA 4PO9A 1OAOA 3K9FC 1NMXA 3KEOA 2CE2X 1W29A 4HLDA 3E5RA 4OJQA 2OR3A 3E70C 3ZKWB 3JVUA 3Q40A 4P9NA 4NY1A 1GPAA 3KD2A 3M1IA 1YE5A 1U8UA 5TXGA 4PS1A 1W44A 3HDTA 4O4LA 4FYPA 3H5VA 3ZVLA 2QG6A 2A5LA 2HW8A 3HC7A 1BAPA 5GAJA 3JX9A 2RH9B 2I66A 2DX7A 3BH6A 2A59A 1A77A 3D6JA 3EFEA 3P7MA 2IYUA 3IXMA 4G4IA 4OIMA 1JA9A 3GRYA 5EGNA 3ZCRA 3UEOA 4YV1A 2GQ0A 5BSMA 3CSDA 4HCJA 4MV9A 3FI0A 2B61A 3H5RA 1XCOA 3O3NB 3KPWA 1NUPA 2FMHA 3F6RA 2IZ0A 3EC2A 3SLRA 1THMA 2AYYA 1JKJA 1E89A 1RHRA 4PBTA 2R8ZA 4WZ6A 1OJ7A 1M0SA 3EH2A 3F3YA 3QOYA 2YCLA 3H8JA 4FZJA 4YCJA 1UM9B 5HF5A 5BR4A 1WMFA 2GPNA 3B9BA 1ZK2A 3KQMA 4X24A 5F77A 5ALPA 3N7UA 5KTYA 1RRMA 3LLMA 3IAM1 1YOVA 2YW9A 4HDMB 5BVHA 3OCUA 3GJ8A 1C3LA 2RHCA 1AXRA 8OHMA 1ZGGA 3WDKA 2CLIB 3IVXA 1XZCA 4LQLA 2A0FA 2AXQA 3QVKA 4WBSA 5D84A 3UY4A 1JDBC 1KOGA 1W5AA 2P9CA 4JWKA 5EJIA 4TMVA 1YB6A 1P19A 1M54A 5K0TA 5IW8A 1WBBA 3I53A 3MB5A 1CDDA 1NNI1 2R5WA 2UVPB 3QBDA 4CBVA 2AG1A 3CW2A 3O92A 4UBNA 1P45A 1YR8A 2JGKA 3B1VA 4HAIA 1AB6A 4I36A 2NZYA 1UAAA 2H5JA 3NNDA 3HI6A 3BIJA 1NYLA 4E3ZA 4NFSA 2WG1A 1KIAA 5DN6A 2X9VA 4JDUA 1G6HA 4FCVA 5DYIA 5BV8A 5HZGA 3MM4A 5DTQA 1A82A 3OHSX 2GILA 2B7CA 4UC0A 1U8TA 5F64A 3MGGA 3QKIA 4FS8A 4QPCA 5FI3A 2AIRA 5I8PA 3LKVA 1MTZA 2QQFA 3THWA 4YGXB 1NRIA 2D1TA 4KAXA 5EMKA 2PSFA 2GCNA 2QMEA 2B3TA 2XUOA 3HU2A 3NGLA 3QLTA 4L8YA 1XP8A 3ZCPA 4AY4A 4BLPA 1FLDA 1U8YA 3WFIA 2ZUCA 4D46A 3VPDA 1JEYA 2B1QA 1CX9B 4D3XA 3IBSA 4JGGA 4ZI3A 3J7AC 4TVKA 3DE2X 2P68A 3P4UA 3C16C 1FLAA 1P5HA 5CX1A 3X1DA 4F5DA 2AE2A 4AJHA 2CUZA 3BIWA 3PQ4A 2BGGA 2OBNA 5GY7A 3D43A 5C18A 1VG1A 3PFGA 3R5XA 5KQMA 2N9UA 4NEGA 3BVPA 4DGQA 2WP0A 1X8XA 2GS9A 1SKQA 1D2EA 4FEAA 4QATA 1LPMA 1R4NB 2WIAA 1PJAA 4WBXC 4X8OA 5T3YA 1J8MF 1E77A 2VDUE 2EZ9A 2N42A 2NN3C 3EY9A 3OUTA 3ZY6A 1Q92A 2FX3A 2VJKA