4V03A

Mind cell division protein, aquifex aeolicus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
236
Chain Sequence
b'AEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDADRNLDMILGLENRIVYDILDVLEGRVPYEKALVKDKRGLSLWLLPVIDIEKWNKTVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLESMDKRNYKVIVNRIKWEMVKRGAMLSVEDIVDILKAEIIGIIPEEPKLVDFTNRGEPIVLDEKFPASQAIIDTARRLMGESIPLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 82
structure length 236
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v03A00
4A2QA 2BMEA 2RGGA 2F1IA 4ZDWA 3A1WA 4Y0VA 1FW6A 1NSTA 2QRZA 1QHSA 5CLQA 3RRMA 1RPZA 3VR2A 3KXIA 1P75A 4HAUA 3RNLA 3IUYA 1E9BA 4LV8B 4MRRA 4ZDJA 1NKSA 1ZAKA 5CIWA 1YRBA 1Z06A 4A6PA 2WAXA 1KO8A 2H7VA 1CS4C 1E32A 1N5IA 3NEYA 1YZKA 4ASUA 2CE2X 2AK3A 2EFGA 3PXGA 2IYZA 2F43A 4LOAA 4NYIQ 1GFIA 3LBNA 3QOFA 1GNRA 1W5SA 1ZNXA 2FE4A 5ELXA 1J7KA 4M1YA 3WMFA 5LDDC 1N5JA 5A4JA 1KK0A 1ZM7A 2ATXA 3LVQE 1AZTA 4PZLA 2QAGB 1Z2CA 3GLFA 2W0MA 3KQHA 3EG5A 1OIVA 2WBLC 1EWRA 2IBMA 4C7OA 3R8CA 3TNFA 2OHFA 1KI6A 3AF2A 3RWMB 5KO2A 3QF4A 3VX4A 2GDJA 4TTRA 3ADDA 4M9ZA 2YHSA 3O47A 1G21E 1G8FA 2CJWB 2XTZA 4LV6A 4AG5A 2H57A 4G5QA 2VSOA 4P33A 5BYJA 3M1IA 2J1LA 2ZROA 4ACBA 1SKYB 4FCWA 2EYQA 1OE0A 1AA9A 2GWHA 5IT5A 2A2ZA 2DWOA 5KOYA 2IYLD 3PCRB 1OXXK 5AJYA 3LLUA 1R8SA 3WP1B 3SJCA 1Z0IA 4MYHA 3SOPA 2ZANA 2QMHA 1G20E 2ZVPX 3WYGA 4AKEA 2HV8A 4BZXA 5L3VA 4PQRA 5FBLB 1XCPA 2YJTD 2Z6VA 2O8CA 4IDPA 3MLEA 3DHWC 1VG1A 3GLIB 4TT3D 1M74A 1WF3A 2WWFA 3RS5A 3TRFA 1M1YE 5DE3A 1GRNA 4TN1A 4A8JB 1SULA 2OESA 4GMXA 4LHYA 1II0A 1D6JA 1KI4A 3CPHA 1KY3A 1Y3AA 2ZYTX 221PA 3RS0A 1Z0DA 3SHWA 3U3RA 3CWZA 1PV4A 3DM9B 1A4RA 2HT6A 2W2XA 1QVAA 4L16A 2ZE8A 3PR1A 4A0HA 5JI2E 2NO9A 5AUPB 4CEHB 4PHFA 3FWYA 1G5RA 1M34E 1OF1A 1OYYA 3C41J 4MKGA 1AS2A 1KDTA 1KJZA 4OQFA 1E0SA 2VEDA 2BBWA 5KHOC 4ZV4A 2P0EA 4Q66C 1MABB 2YINC 3DKPA 2QGZA 3SFZA 3CR8A 1CR4A 2PZEA 3A37A 2XZPA 3T1VA 3VR4A 3G82C 3L0SA 3AF1A 3LXXA 1IJFA 5HE8A 2V6IA 2F55A 4YDHB 4D0LB 1KY2A 1W44A 1E4VA 1DS6A 4AKHA 4Q9LA 3U5ZB 4GNKA 2XNDA 4IXNA 4XTRA 1ZM2A 4XVUA 2O8DA 1VKJA 4QRHA 4U00A 5G53C 4QKQA 4B76A 1ELOA 5FOXA 2EVWX 4AKGA 3R7WA 3H84A 4TZ6A 1SVKA 1XTQA 1PVOA 3VKGA 1P2UA 4BPBA 1O87A 2C98A 4JJKA 4F93B 1Z0AA 4V0ME 1NJFA 1G3MA 2BJVA 4LBVA 3MG9A 5EE0A 2WHXA 2OUKA 4DT1B 4KFSA 2D2EA 2QP4A 3AUYA 4JBXA 3RS2A 3GD7A 5E95A 2NZ8A 1VHLA 1IOZA 1A7JA 1UPTA 1T0JB 3QVUA 4ZO4A 2ORIA 4HAXA 1EK0A 4BWYA 4RJLA 2B6HA 4Q7KA 4HB2A 1JXOA 4M21A 1S3SA 3O8DA 2ZR9A 1X8LA 2DCUA 1G5TA 4JLJA 1R5NA 2D06A 2QN6A 2GVDC 5EUMA 1GTVA 1XJ0A 2PL3A 1H65A 2W6ID 4AYXA 3IEVA 4DZZA 1T3SA 1Z47A 1ANKA 2C5LA 1BKDR 1MV5A 4IOJA 4BLTA 5JSZA 1WRBA 1OB5A 3VNUA 2VSXA 5IHPA 5G3ZA 1VCOA 2ZXUA 2XOKA 2ZIAA 2REXB 2IUTA 3W9YA 4Q4JA 1NKTA 2BDTA 2X2FA 5TB5A 1X1RA 1ZYUA 3ZYCA 4Q01A 2JATA 1OFHA 2XB4A 1N2CE 2ZTSA 4RCZA 3TIFA 1W36B 1T8UA 4Z1MD 1G7RA 2G6BA 3I1FA 2MSCB 4ABYA 5CB8A 3CRMA 4BLRA 4TLEA 2FPMA 3THWB 4WZBE 4UNRA 3ASYA 1OKKA 1RVDA 2C8VA 2JJ2D 1ZM9A 4OHYA 1EFTA 2DFNA 4JSYA 2HDNB 3VTKA 3P27A 4E07A 2WMOB 2ECKA 3HPQA 2OFXA 2Z4SA 2B8TA 5FPSA 2XGJA 2ZETA 2ONJA 2ZR7A 1QF9A 4Q4AA 1LB1B 1KSFX 1XFAA 3ASZA 2BMDA 1XXHE 1DG3A 3ZIAA 4FMCB 2IF0A 4XD7A 3NG1A 1R6BX 1FTNA 2V54A 1G4AE 2KI5A 5AJVB 4B44A 1LS6A 2HJVA 3THYA 4IOMA 1N6NA 1KAOA 2NO6A 2FZLA 4OI2A 2QY9A 3Q5EA 4DC9A 3B1ZA 4URUR 3T12A 4M1KA 4HAYA 3AM1A 4IOLA 2BV3A 4I99A 1BMFD 3WNDA 4DDVA 2G77B 2KBFA 5L3SA 1P61B 4CVNA 4ZIRA 2WWGA 3BFKA 3O8RA 4JLPA 3NIBA 3BH6A 4Q4LA 1E2HA 5GJVC 5E7JA 1KSGA 4KO8A 4I1UA 5J47A 4LHVA 5J4YA 1C1YA 2G0NA 1KI9A 1G1MA 4OQLA 3K0AB 1G4UR 4OHXA 4LSGA 4NTZA 5IK2A 1E2MA 2GXAA 2HCJB 5JHHB 4E03A 3F0TA 1FQJA 3W3AA 2ZU0C 2FSHA 3P20A 4P31A 1VG9B 3Q3JB 1KOFA 3L82B 3K9LA 2C03A 4LJ5A 1OFIA 1Z6GA 1U99A 3UG7A 3W5JA 3A1VA 1IM2A 3W6OA 4EPXA 1BH2A 4OQMA 4TZ0A 4V0MA 2ZUBA 3TMKA 1DG1G 1N0VC 3LLMA 3IKJA 1AN0A 2ZJBA 1EXMA 2NTYC 4JT4A 4NPHA 4Q9HA 2R9VA 2ORWA 2PMDA 2RGXA 4DLRA 1SVSA 2DFKB 2QTFA 1S96A 2RB4A 3CNNA 3U7GA 2O8FA 4D4MA 4WW0A 4DCVA 2C96A 2BKEA 3EARA 1H8ED 5M04A 1D9ZA 1E9EA 5BWMA 1II8B 3L43A 3CW2A 4GRAA 2ZSFA 3TSOA 5KTYA 1MO3A 3KQKA 2QMUA 4IRUB 1J99A 2Q3FA 4W5JA 2DPXA 2FPLA 8OHMA 2GZAA 3BORA 2QPAA 3HWSA 4QJ4A 2HEIA 1U0LA 2HCBA 4HZUA 1XPOA 1CU1A 2RCNA 5EZ6B 3GLGB 3PG5A 3BOSA 1UEIA 1E9SA 5EE1A 2KSQA 3A4MA 3AGPA 3PENA 1QRAA 4FN5A 2GA8A 2CEAA 4JBWA 4OJQA 4Q1AA 4R7ZA 3T5DA 4X8MA 3B6EA 1GILA 1PUJA 4LGMA 2DWQA 1E9DA 3TUZC 4JL5A 4PHGA 1U8AA 2JLXA 2YWGA 1E1RA 4KV9A 2V7QD 5DN6A 2XXAB 1KMHB 3NC0C 4PANA 1F2UA 4QHTA 2AXPA 2J7PD 4E5UA 1UKZA 3A58B 2QTVB 4RFSB 4US1R 1IXZA 2ZYWX 3PFIA 4PXAA 4ARZA 3WYFA 1L4UA 1JAIA 1Q57A 3K70B 4RD0A 2OG2A 1W48A 2Q0HA 3EX7C 3KTAB 3RANA 1OJLA 1GSIA 4N3NA 4UXIA 1N0WA 2ZJ8A 3X1WA 1AQYA 4IEEA 4K8OA 3BFVA 1RZ3A 2NOAA 4I1SA 3QPWA 4RVCA 5JEDA 2X1VA 4BE7B 3UMRA 1N6KA 1ONBA 5CK4A 3KB2A 1SVLA 2NO1A 1GAJA 3W5IA 5CDFA 3T34A 4PR0A 4RKEA 1XXHA 1A2KC 3VR3A 1UBCA 4MKFA 1R0YA 1S9DA 2QAJA 3HJNA 1CRPA 2YC4C 3I8XA 2WJHA 1MO4A 3B78A 4ZCLA 1M6NA 2MMGA 4LPSA 2WJIA 2JLZA 3NTUA 3QG5A 1S1MA 4UNNA 2RGNC 4KITB 4KAXA 1E2KA 1XD2B 5LD2C 3T5GA 2ORVA 3EXAA 1B0UA 2FFHA 4WIAA 3ONWA 2DBYA 2QORA 1UBFA 3SS8A 2FOLA 4IDHA 5UKDA 3GJ0A 2QP9X 4Q9IA 1U9IC 1YZQA 2DYKA 4JJZA 2Y8EA 4CW7A 1HURA 2ZE7A 5AWFC 2XAUA 4RZXA 1RC8A 3DM5A 4F92B 4JKIA 2BWJA 2KE5A 1TADA 3BB1A 1SXJD 1RFLA 4HEJA 2IUSA 3KUCA 2CDNA 1E2QA 1VG0B 3C4JA 3K9GA 3NH6A 3EAQA 4JLNA 1VIAA 1X8KA 2YOFA 4YMWA 4AY2A 4F4JA 3IHWA 2FNAA 1G17A 2HYIC 1HY3A 1NVVQ 4F91B 5KPDA 1OIWA 2AR7A 1EWQA 2PBRA 1SGWA 1VCIA 3U3OA 4FWTA 4M1WA 4TYPA 1LY1A 2HLDD 3K09C 5E4FA 3BE4A 5DI9A 3UMFA 2R6GA 1G8GA 2OBNA 3C5CA 4ITRC 4BECA 3U44A 1OV4A 3EZ2A 5JBQA 3EA0A 5GJCA 2ZRNA 4MA4A 4NL4H 4FXPA 1AGRA 1TTTA 2GCOB 1NVWQ 4WXRA 1W4AA 3MFYA 1KTVA 2J0QA 2FG5A 2CCGA 4IDOA 3NH9A 3AVUA 4MRSA 3TJZA 3PV0A 3IBYA 4PZZA 3TW8B 1XEFA 2P5SA 2G1KA 2OBMA 1U0JA 2IWRA 2BMFA 2IYWA 1RW4A 1JJVA 3LDAA 2AL7A 2GCPA 5K8LA 1VDZA 1HQYE 2JLSA 4IEIA 1ZIOA 2QT1A 5K8UA 4TYNA 2VRWA 3AKCA 4ON9A 2ASEA 4GOXA 3OEEA 4P32A 3JZMA 4Q9JA 5D3MB 3EPJA 3AUXA 4GP7A 2XX3A 2PZGA 2ZJYA 3WHKA 3DPUA 3LQQA 3SE0A 5FUXA 2IC5A 2WWIA 2CHVA 2F43B 4LJ9A 1JEEA 2CLSA 3QPVA 1EFRA 4NYMR 1P2TA 4O25A 1Q0UA 4ESHA 1E6CA 2BBTA 5K8TA 2D74A 2KJQA 4WBSA 3RAPR 1BYUA 2ZRCA 2GBLA 3TUIC 4DVGA 1FPMA 4FMBB 4URVR 2Z4RA 3GLFB 2OM2A 3LD9A 4O2RA 3NC1C 4Q21A 1BYIA 1HV8A 1W2HA 2IYXA 1UAAA 3AVTA 4C7OB 4AYTA 1G8HA 1E1QD 1KI6B 2H17A 3QF4B 1IY0A 2YKGA 4XTCS 4HYYA 4BLQA 2R44A 4Z51A 3DDCA 4NYJQ 2X2EA 2IS1A 2GAAA 4ZDIA 2BEJA 2GEDA 5JJLA 5CJPA 4JYBA 1K8RA 5FUWA 1YZUA 4A8JC 4GP6A 1Z22A 3Q5DA 4B47A 4FW9A 2IEYA 3AP1A 2UVQA 1YVDA 5IF9A 2FSIA 4OQNA 2WWHA 2C9YA 4RZ2A 1G7TA 2ODWA 1G6OA 2HF8A 1AIPA 1JNYA 5DNYB 2O8CB 3TQFA 2EQBA 2CHGA 2QM8A 4UQOA 3VU9A 1OHHD 4EIWA 5B64A 4HZIA 1KSHA 3I72A 4KLZA 2B92A 1DOAA 2CHQA 4KLNA 4LJ6A 4LJAA 4PO9A 1OXTA 2WPDD 1JALA 2QE7D 3OE7A 3SYKA 1COWD 5FOSA 4C9BA 1X1SA 2IL1A 4PQFA 1A82A 3GLHE 4RD2A 2QGNA 4BUJA 1WB9A 4F4IA 3BC1A 4RZUA 2JA1A 2AXNA 4A15A 1GNQA 3B13B 3W34A 3HPRA 2OLKA 2QENA 4B48A 3U61B 2JASA 3T35A 5LB4A 1P72A 4KHZA 2GEUA 3I3SR 4OK6A 4BGDA 2GTPA 3QUSA 4MGZR 1BOFA 2R6FA 5FTMA 5FPTA 2C77A 4DB2A 3CNOA 1IBRA 4M22A 4OKSA 5AUQA 2N42A 3REFA 3AF4A 3DKVA 4Q03A 4BFUA 1MOZA 3ZD6A 3OIYA 2F1RA 3EZ9A 4IFEA 1VG8A 3ADCA 5FPKA 4EUNA 3A1TA 4FINA 4A2WA 2W58A 4PAMA 2WIBA 1SZPA 1HYQA 1XEXB 1IXSB 2XSZD 1NN5A 3FHOA 2O8DB 3WNCA 1JR6A 2ZSDA 2IF2A 3D6TB 4OL0A 6Q21A 3KQLA 5H70A 1II9A 2ATVA 3R7WB 2IXFA 1XF9A 1IN7A 2CCKA 2JJ1D 2ONKA 2OLJA 1SVWA 4A9AA 4PC2A 5CK5A 5HR5A 1OXUA 1IY2A 3NBYC 3NWJA 2QSZA 2J87A 4B2PA 2FFAA 1D2MA 5HCIA 2SHKA 4IDQA 4GZLA 2ZRDA 4II7A 5KDLA 3LAWA 1Z0FA 4XVQA 2ZRMA 1RKBA 3TQCA 4AIIA 2VL7A 4LJYA 4G3XA 3PUWA 2CMKA 1O3YA 1SVOA 4P4UA 1J90A 2P6NA 2W2VA 3T06B 4LUCA 4AD8A 2WKPA 5EXTA 1IONA 3I62A 3QKSA 1NJGA 3DOFA 1HT1E 3GJ3A 3T1QA 2AD5A 5EUQB 1OXVA 4AG6A 3EA5A 5AR1A 2B7BA 2CXXA 1CJUC 1PZNA 4EPRA 2VHJA 4TMKA 5JSZB 4TMZA 4GI7A 4BLPA 2BM0A 2MSDB 2UZIR 3NVAA 2O8EA 3R9WA 3CH5A 4NHOA 4Q4JB 3IIKA 2BEKA 2UZ3A 1WE2A 1TF7A 5FPYA 2C2HA 3QNUA 4BEJA 1VHTA 3EZ7A 3IPXA 1DO0A 4M9SA 3FMOB 1NG1A 1F3OA 1ZM3A 2WWWA 4DXAA 1OFUX 3NDPA 4YMVA 4JVNA 5JWOA 1NMXA 1E9RA 1R4AA 2HJGA 4XWKA 2NG1A 2ERXA 1JR3D 3Q7QA 3F3YA 3E70C 2VF7A 3RABA 4JLKA 2ANBA 1MO5A 2ZPTX 1ZVQA 5C1BA 3MWLA 4QGGA 5EXPA 1W4BA 3IEUA 4OHWA 2VHCA 3OIWA 2C9CA 4M9QA 4PPQA 4OBEA 4JYCA 4LJ7A 4Q7LA 2P2LA 4LC1A 3WY9A 1T91A 1M2OB 4HAZA 1AQUA 2W6IA 4EKDA 2JLVA 5FL7D 4POAA 3HR7A 4I1OA 4JBYA 2H18A 4UKDA 2LWIA 4V0LA 4B3BA 3QVVA 4JT2A 2IHYA 4C0SA 2VHQA 4LHZA 5KNCA 4Q4AB 4MYCA 1ZCAA 2EWVA 1NF3A 4DIDA 4E22A 4OHZA 2CK3D 4I81A 2IEZA 3CIOA 3I61A 4TLAA 1S8FA 2WJVA 2AFIE 3UIEA 2QG6A 1TNDA 3D8BA 4DEYA 4Z1MA 1QVRA 1NIPA 3GLHA 3PJRA 2QPOA 3THYB 1KZGB 2IYQA 1GKYA 4FCTA 4IW3B 3A6PC 3MWJA 1YHNA 4NBSA 5JS7A 1MR3F 4D4JA 1XD9A 1P62B 4O2LA 3OAAD 1G18A 5JWRA 2JJ2A 1PLJA 3D7MA 1T3LA 4DCTA 4EQ6A 4ZIRB 3K70D 3K1JA 2AWNA 1KI1A 1YQTA 5GVSA 5EP1A 1JXMA 1ESNA 5KU1A 5FOVA 4X8LA 1HA3A 2QQ0A 1KAGA 2EW1A 1G16A 1VCNA 1XB2A 2A5JA 4L9WA 3SDZA 2NO0A 3BWDD 1YR8A 4Z8YA 3IBGA 2DFLA 2YV5A 1NIJA 5SZKB 1KO5A 5DI3A 5EP4A 4C2UA 1RRPA 1GL9B 2FF7A 2WJYA 2I4IA 3QENA 4HDQB 4HSEA 4RKFA 2ZRBA 3ZZUA 3KQUA 3PQCA 4GMDA 3RWOA 3SU8A 2ZRPA 2FPKA 1XZPA 1OYWA 2C95A 2GF9A 4M53A 1BMFA 2FEOA 5DGXA 2Z83A 3WHLA 4L5BA 4B6FA 3H86A 5JECA 1Z6XA 3K0SA 1AZSC 3ZVRA 3MWKA 2BCGY 2O0KA 2F1JA 1CJMA 3TSZA 3QSYA 2JLRA 1UBEA 5EP2A 3SHFA 1W0JD 3TVTA 1OW3B 2CL7X 5DIFA 1Q3TA 1SXJE 2O0JA 4X8OA 1KYIA 2IA5A 3KZ1E 3NBXX 1Q20A 3KL4A 2YWHA 4C0LA 1RRCA 1R0WA 2FZ4A 1MT0A 3A4LA 2IHBA 4TLDA 2D7DA 4HZUB 3AVWA 3SQXA 3K70C 2NZJA 4LC0A 3LBIA 3LX8A 3MCAA 2J0UA 4LK2A 4X8HA 4ZCIA 4Q7JB 5TDHA 3ZVMA 1UEJA 4Q1DA 3ICQB 3L8YA 2O52A 1S9HA 4IFBA 1GITA 4LWZA 4OQXA 3JVVA 3NDBB 3X1ZA 1DAGA 2EFEB 2WZQA 3HYRA 4ACAA 2ODBA 1FX0A 1F2UB 4NCHA 4G5OA 1ESMA 4CEJA 3Q8XB 4XIGS 2O5VA 4EAQA 4ARZB 5GJWC 4DCUA 3B9QA 3UANA 1H8EA 3ETLA 2PJZA 4IVQA 1T4GA 1K5GA 4JLOA 4EJSA 3SYNA 1D2NA 2WKRA 2GHIA 2W6JD 1DELA 3UATA 1CLUA 5JZVA 1GNPA 4NCKA 1E94E 4HLCA 4JLBA 2AWOA 4DSOA 3T1TA 1GWNA 3VAAA 2ZSAA 3FFAA 3QXCA 1DAIA 1E2GA 3B8HA 4DWJA 3UK6A 4QJ5A 2FX3A 5L3QA 3V00A 3CKLA 1XXHB 2XEXA 2HT1A 2PT7A 1E2IA 1KHTA 2GJSA 1Z6AA 4XH9B 3C14C 1YR7A 2DY1A 2V7QA 1CR1A 1XMJA 3CPEA 3LW7A 3WMEA 1TX4B 1WBBA 2ZVQX 3WRXC 2WJJA 1QZXA 2J7PA 5P21A 2V6JA 1U94A 4Q5IA 1TQDA 2VBCA 5BQ5A 3BGWA 3VR5A 4B35A 4YQFA 5FI1B 3K0FB 4LX0A 1EFHA 4ZKEA 4HB3A 3U4QA 3L0IB 4Q1CA 2OCAA 2WOJA 5J4LA 2ZAMA 4S2EA 4WZ6A 3UWOA 4NE2A 2AX4A 3MD0A 1RYFA 4AYWA 1JBKA 4ZDKA 3EWAA 1HE8B 3U7FB 4WZAE 4B3DA 1FUUA 4QBFA 2VP5A 2XTNA 5DYIA 2BM1A 1JECA 4RD4A 1KDRA 1VYVA 5CITA 3BIFA 5F3WB 4Q48A 4BFSA 3J81k 3C8UA 1F2TA 4F4CA 1YKSA 4QBGB 3C16C 1I2DA 2AHOA 4FMDF 4HLUA 2J45A 3RVBA 5FUYA 5JCZA 1TF5A 2NIPA 1G5PA 1W0KD 1QDEA 4FI3C 2IT1A 4R71A 1KSJA 1N6HA 1W7AA 2J5XA 4LDJA 3REGA 4GOKA 1GRRA 3TR0A 4GSYA 3B1WA 4QXAA 2VQSA 3GJ6A 2F9LA 2PMKA 1N6RA 4HAVA 4H9GA 1KO7A 2YOGA 1W46A 3U6BA 2D7CA 2F3RA 1E96A 3WYAA 3U2QA 5BYKA 1XEWY 2ZRLA 1B23P 4M8NE 1QHGA 1RRFA 3U6KA 3CH4B 2IYRA 4D25A 4AK9A 4V03A 1UKYA 1CF4A 2CJWA 4FCVA 2CL6X 3WBJA 1D8TA 4WAUA 2XB2A 2JLQA 4QBIA 5TXGA 4C0BA 3QIAA 2IS4A 1IAQA 1T5IA 4Q4HA 4TYWA 2ZEJA 4D4KA 2PCLA 3CONA 3V4RA 1SXJA 3O8BA 3EW9A 4BFTA 5L8VA 1ODFA 2R2AA 3B2EA 3CRQA 3EC1A 1US8A 4IXMA 4TTQA 4OK5A 2ZYUX 3GFPA 1W4RA 1ZNWA 4LZZA 3CB4A 4Q19A 2QI9C 3AVPA 1X6VA 3KFXA 2HLDA 3GFTA 1NY5A 3CZPA 3I32A 1D9XA 4Z54A 5JWHA 4GPTA 4QG7A 1XTRA 4NMMA 5TVKA 4XSGA 3LO5A 2FGJA 2EFCB 4EPVA 4MDEA 3B60A 1LFDB 5JI3E 4LRWA 4KJZA 1P2SA 4URXR 3K0CA 2G0TA 2Q21A 4M1OA 3KX2A 5ANRB 2UKDA 1E2NA 1VYTA 3PVSA 4EPWA 3QXSA 4ZI3A 1GDDA 3TAUA 3RS4A 1N6IA 4H1VA 4LYAA 4A0GA 3SQWA 3VNVA 1GKIA 2FU5C 4CT4B 3FYHA 4YMUA 3TVDA 3U60B 5B30A 4O3MA 3BXZA 1I2MA 2OFOA 4UNPA 3AVVA 4PSKA 3K8YA 4KODA 5C18A 3KUDA 4PPGA 3C7KA 1NVXQ 3X1XA 2EFDB 1E79D 2ZJZA 4DLYA 2FH5B 5J4VA 2GXQA 3CF6R 1ZUIA 3WRYC 4A2PA 4MUBA 4BFVA 1QHXA 2R8RA 3B1YA 4G01B 4J0QA 4HAWA 1HEIA 4O0MA 4DDUA 4MITA 2V1UA 3VU9B 3W3ZB 4DUGD 4WA7A 1E9CA 4D80A 3KJGA 2ZE5A 3IGFA 3FPAA 1MH1A 3M6AA 2AFHE 4W7SA 1E1QA 2WSSD 4PAQA 5JCPA 1XBTA 4GL2A 2O0HA 3BB3A 5JHGB 4BRWA 3I5XA 4ZCMA 5KDDA 1LW7A 2PT5A 3R8FA 3HYTA 3KKMA 2Q6TA 1JR3E 2FA9A 5AJXA 1GM5A 1ZU4A 3RLFA 1U98A 4UXJA 1DAKA 2NMVA 121PA 4JLDA 3OESA 3TW4A 1ZW6A 1EFCA 3B9PA 4Q02A 1ZD1A 2J59A 4CEIA 4BZQA 1Q1QA 2CLDX 3C15C 2ZJAA 2JGNA 3BRWD 1N6LA 2OO7A 2WKQA 3IHLA 3AF0A 3S1AA 1TPZA 4Y0AA 1XMSA 1XTJA 4LY6A 3T1OA 4US0R 4CF7A 4HUTA 1A5TA 1N6OA 2W2TA 4PQYA 2WTUA 1P3JA 4JKYA 1NLYA 4V0OA 2JCSA 521PA 1OHHA 1NMZA 3A8TA 5KNDA 1XD8A 2X77A 2VHUA 2WPDA 1U8ZA 1PLKA 2E9SA 1X3SA 5G3YA 3FOZA 2VPPA 4EFLA 1COWA 4PC7A 5EZ5A 3K9HA 2WVJA 4JL6A 5HKKD 2V1XA 3EASA 3CRW1 3NEJA 3EZFA 3PUZA 3LNCA 3HU3A 2R6AA 3OZXA 2BIFA 4R2HA 4KVGA 3WMGA 4DCNA 2LKCA 2C78A 4A0FA 3LA6A 1FTSA 1NN0A 1P6XA 2R62A 1YZNA 1AS0A 5HTKA 2JEOA 1G6HA 1KMQA 2ZRJA 2OBLA 1F48A 4WXPA 5C4GB 4DRZA 4CDGA 4N0EA 4R9UC 4DSTA 2ODNA 1DTSA 4KFTA 1VMAA 1H8HD 3FHTA 4EPYA 3PITA 2BVNA 2PH1A 1P73A 4MDFA 3BAFA 3X1YA 2J0SA 1KDOA 2B7CA 2GRJA 4QNRA 3QE0A 2J46A 3OIVA 4V0NA 2ODEA 3QKSB 4GBMA 2QRNA 1OIXA 2XJ9A 2XSZA 1KK2A 2QL6A 1LTQA 3SBEA 2F9MA 4DIEA 1NVUQ 1JB1A 3OEHA 4B75A 2O8EB 2H16A 1OH6A 4EFNA 1P2VA 5CLLA 2JJ1A 2ZYVX 3LV8A 2J9RA 3KJIA 4OI1A 3RDPA 1S4QA 4Q7MB 1MRNA 5FR2A 5F9HA 3KXKA 3NHBA 1Z2AA 4JIMA 2ZJOA 2QAGC 4KCGA 4LV5B 4LYFA 4MRVA 5H1YA 1N25A 3RRNA 1XCGB 1RJ9A 3RRYA 2GXSA 4P4TA 2RGAA 1XTKA 3AEZA 2CVHA 4TMTA 4HUQA 4U02A 5A0FA 1CULC 5JRJA 4ZPXA 5JLJA 4MRPA 4CT5A 1J8YF 4IOKA 2XTMA 2G1JA 1U2RA 4RD3A 2GNOA 2YZ2A 3QXXA 2QPTA 2QSYA 3AF3A 3B1XA 2WV9A 4TMVA 5BW8A 1M8PA 2NO7A 2A30A 4MUAA 3E5HA 3CF0A 3QPUA 4ILEA 5H68A 3WBKA 2F7SA 4C4PA 1QHYA 1VIYA 2WM9B 1IXRC 5FBVB 4TYYA 1JJ7A 1GIAA 2WMNB 2E1RA 3E1SA 1Z0JA 1EX6A 1DEKA 2F6RA 5B57C 5FTLA 1OFTA 1CKEA 4N1AA 5EQTA 2QM7A 1ZINA 1HE1C 2GJAA 3DO6A 3GLHB 1E1RD 1SVMA 1MKYA 2OILA 3WXMA 5DN6D 1JR3A 1WCV1 1PUIA 1UBGA 2FFQA 2AN9A 5CJ2A 2EWWA 5TMPA 2HXSA 4L9SA 3VR1A 2AKAB 1Z8FA 2X19A 3DL0A 2H1LA 4PPFA 1JPJA 4EQ6B 1OLOA 2VP6A 3SYLA 1JPNA 4RD1A 3TK1A 3PEUA 2OCPA 4PZYA 4NCJA 4AWXA 4DLVA 1P9WA 4PC1A 5FBWB 1DPFA 1E3MA 3QQ5A 4DSUA 1YR6A 1V43A 2CLCX 4MGIR 3X1DA 821PA 1X8JA 3GEHA 3RC8A 1GOTA 4HLQB 2G3YA 2O8BA 5KUTA 2CBZA 1JQJC 1DAHA 2CK3A 3AP3A 3CF2A 4LJ4A 2KB0A 4NONA 5FUVA 3TE6A 3SJAA 4NYIR 5DI3B 5LPNA 3AVYA 4G5SA 3QKRA 4DJTA 1W36D 4L15A 1KDPA 5FTJA 1NLFA 4BFYA 4QGAA 3AQ4A 1XCMA 3IO5A 3RS3A 4JLAA 5EXSA 3IQWA 1JQLB 1UKEA 1DAFA 2W0SA 2KBEA 1Q44A 3GMTA 4KSBA 4ZKDA 1KKMA 2L0XA 1FP7A 3OAAA 4LHWA 1FFHA 4P4SA 1GKUB 1DARA 2VHTA 5F2EA 4TTPA 3AVOA 4NCNA 3HU1A 1ZUHA 5JS8A 1M7GA 3I5YA 2F3TA 4KSCA 3IO3A 3LRPA 4U7DA 3W8NA 3ZDQA 3CX6A 4A92A 4TT3A 4BFXA 1NMYA 2ZE6A 3UG6A 1KI2A 3IQXA 3RS7A 2OXRA 1E2EA 2PJRA 4F7WA 3OF5A 1Z08A 3BERA 3AH8A 4LYHA 4R2IA 2I1VB 3EIEA 1CJKC 1G7SA 1ZJ6A 3BB4A 3HP1A 2GJKA 3KFVA 1AKEA 1E2FA 1KI7A 3NBFA 5BN4A 3GFOA 4IHQA 4HI0E 2J0UB 4W5WA 1F60A 3GJ7A 5JRZA 2NPFA 1EESA 2ZRIA 1CTQA 2ERYA 3MWYW 4DLWA 4PX9A 4JVLA 1G3QA 4TL9A 1FOEB 3CZQA 2GESA 2GJ9A 4FMCF 2IS6A 1KIMA 1FX0B 2WICA 1CR0A 4QOSA 2ZI7A 2Q3MA 4CEJB 3TGPA 5FBQB 1XZQA 3WP0A 5BN5A 2OCYC 2ZI5A 4MQBA 1W36C 2CNWD 2B21A 1Z5ZA 1OH8A 1W49A 1TEXA 2N1BA 5CIQA 1NBMD 2JDID 4EJSB 1XX6A 3QXJA 4NYMQ 4Q1BA 1JI0A 4WOPA 3EZ6A 3N5CA 1FZQA 4JSTA 2OEPA 2BMJA 2NQ2C 3CLVA 1Z6YA 1VYUA 1R0ZA 2ZR0A 4L4UA 3E2IA 5LD2B 1G41A 2BJWA 4OK3A 3G0HA 3SNHA 2QNRA 4YONB 2QROA 1WA5A 3ZQ6A 2FDCA 5L3QB 3O8CA 4HDOB 1L4YA 4KBFA 1Z3IX 5DH9A 3SFVA 5JEEA 2VLIA 3BH0A 1QG2A 3LX5A 3FKSD 1Q3HA 1OPXA 1GL7A 2Q3HA 4NU0A 3ZS8A 5H8WA 2JIZD 4YXWD 1F6BA 4TQUS 1U0HC 2OZEA 1QHHA 2HUPA 4TSFD 5E7IA 3RRZA 4QGFA 3U3MA 1XU4A 2WSMA 4LYJA 3CBQA 1A2BA 4LBYA 2OCBA 3DVLA 4JS0A 1YR9A 3U4QB 3ND8A 1D5CA 3AV0B 2ZI4A 1IN4A 4B73A 3OFND 4DLZA 1TL7C 1OB2A 3DMDA 2QMEA 3FGNA 3I92A 1P60A 2W6JA 621PA 5KSZA 3KJEA 1GRQA 1YE8A 2PZFA 4OYHA 1E2LA 3GQBA 4A4DA 4DB4A 1UF9A 3IIJA 3G5UA 2G88A 3KXLA 3TUJC 3N70A 4GT1A 5FBRB 2J7KA 4AC9A 5D3MA 2VTKA 2Z43A 1F2TB 2WIAA 3IIMA 4FD2A 3VMFA 2GAOA 2IYUA 2ZUCA 5SZHB 2ZRGA 3CR7A 1G19A 5TV2A 1IY1A 5JJKA 5FL3A 4LBWA 4PHHA 1GUAA 4B74A 1QBKC 2EFHB 3B82A 4M1SA 4MKHA 1XPUA 1I4LD 1Z29A 4URZR 3VKWA 4KU4A 1LV7A 5AUOB 3KJHA 1BIFA 4XVRA 1NN1A 2CVFA 3GJ5A 5SZJA 5L3SB 4D81A 3VHLB 1P9RA 1A1VA 1ZD9A 1GVNB 1GZSA 5GADl 3OE7D 4URYR 721PA 1W5TA 3M4YA 5FFMA 3UMSA 1UADA 4QL3A 4CYMA 3ND9A 2D3WA 4Q4HB 3X2SA 3PEWA 1S1CA 4YC7A 5LB2A 1CRQA 1ZD8A 1ZNYA 3ZVLA 1YU9A 2HXYA 3QXHA 2JAQA 1SXJB 2GBLC 4CRWB 4D0GA 1WMSA 3L8ZA 4RSGA 3W8RA 3ZH9B 2TMKA 3MGCA 1W4CA 4HATA 1US8B 3A4NA 4Q9KA 5BXQC 1TUEA 1FP6A 1Z83A 2FFBA 3CRVA 2V55B 2VH5R 3ECCA 2DR3A 1E0KA 3THOA 1W47A 2ZJ2A 1EGAA 3FFBA 421PA 4DLTA 1W0KA 2A9KA 3CM0A 4NKRA 4B2LA 2NGRA 4MRNA 3Q85A 4HB0A 3A36A 1FUKA 4A82A 2QBYA 4L8GA 4Q1EA 3ADBA 1AGPA 3JZAA 3GP8A 4Q18A 3RHFA 1PJRA 2P3SA 1L2TA 2GF0A 4S35A 2IWHA 4C3ZA 2Q9AA 5HE9A 5FH9A 2O8FB 2FN4A 4XJXA 2CCJA 2WOOA 3UPUA 3PIRA 1FMJA 3AGQA 3QEOA 2RHMA 1XMVA 4G5RA 3THXA 1SKYE 1TAGA 1F5NA 4K81B 3L0OA 1LVGA 2PEZA 1XNJA 1E99A 4LPKA 1LS1A 4KVAA 1EX7A 1SQ5A 2RAPA 2ZU6A 3U7EB 3NKVA 5EE3A 1UKVY 1NY6A 4KFUA 4LJ8A 4QM6A 1KI3A 3IILA 3UWKA 1NNEA 4QHYA 4PHTA 1J8MF 3BBPA 2RKOA 1HQCA 3GLIE 1ZIPA 1TMKA 2Z5FA 3FE2A 3TLXA 3PEYA 1ZNZA 3ZS9A 2WAYA 1UDWA 1P4SA 4DBLC 2OV2A 3CX8A 1K5DA 1XEXA 1WDTA 2GJ8A 4MYTA 4OI0A 4B43A 4IDNA 2PX3A 4KYIB 1N0UA 5TY0A 3PUYA 5GJBA 1IJEA 2RH5A 2VP0A 3BS4A 3GJ4A 4F38A 1S3GA 3GEIA 3I73A 4NDZA 2J3EA 1KK3A 1NI3A 2RGBA 1YZLA 4IVPA 4C0QC 3EWSA 2BHRA 1IN8A 4FIDA 3H1TA 3LVRE 2RGNA 1GP2A 2ZRAA 4LBZA 1E0JA 3L0PA 3P1JA 5DHAA 3RSOA 1CR2A 3QF7A 1RYHA 4C0JA 4D4LA 3PUXA 4NH0A 3SJBA 4M4SA 4ASUD 2FJUA 4I4LA 2ZRFA 5DLQC 5FOTA 4GZMA 1U9IA 2J41A 4CEIB 2GVZC 5AK0A 2REBA 3M0EA 1E79A 1TF2A 1YZGA 4AI6A 1Q1EA 2FSFA 3H2YA 3T61A 3LWNA 1XTIA 2ZI9A 5E7MA 1G7CA 3A1UA 3BJIC 3SC3A 3TKLA 3S1AB 2PEYA 2XZLA 5CM9C 2FEMA 4TL6A 2YOHA 4B3FX 3U7HB 4PTLA 1YRAA 4YLGA 1OH7A 4B2IA 1AJEA 2IW3A 4MGKR 4DUGA 3CNLA 4P0TA 2H8KA 4A36A 4GDFA 1T3HA 2WSSA 4G1UC 4MH0R 4D2IA 1QHNA 1T0HB 2ZI6A 2YWFA 5CM8B 3K09A 3AKDA 3D31A 3I4LA 5AJWA 3QJYA 3AVXA 3GJXC 4QGHA 4B32A 5AJZA 3GEEA 3D3QA 1CJTC 2ZI3A 4B3CA 1S2MA 1E0AA 2DWPA 3KKNA 2GILA 4RZ3A 4YMSA 1G8YA 4TL8A 4JMPA 1TUIA 4RD6A 4PSVA 1RRGA 2FMXA 3F8TA 3V9PA 2IYTA 2XZOA 3Q72A 1KNXA 1V5WA 2ZS8A 4TQAA 2FV8A 3KKQA 2YC2C 1IN5A 1J70A 5A5GA 3KDSE 1T9HA 4PFSA 3U44B 2QAGA 4LHXA 4B33A 3ZGXA 2P6UA 2YWEA 2GK6A 3ADKA 1CIPA 4BZPA 3R9XA 2BBOA 1N6PA 2QMOA 1TQ6A 4MYUA 5AUNB 2FWRA 5CDFE 1Z07A 3EIHA 4MKIA 3OHMA 1PLLA 4ESVA 1IHUA 1G9XA 2VF8A 3R9IA 3CRRA 2VIIA 1FMLA 1Z28A 1KO4A 1NRJB 2ZS9A 3NHAA 5HKKA 4TQ9A 3DMNA 5CB6A 1ZCBA 3VR6A 1CJVC 1JAHA 2VYFA 4OJKA 5DYGA 5F9FA 4BRUA 1DADA 3K0EA 5B2ZA 3SEAA 1D2EA 1RJ9B 2JJ8A 4PC3A 1EG7A 4OHVA 4XWAA 1R5BA 3TAHA 3ZQJA 4HUQB 1H8HA 4TWZA 2HYDA 2ZREA 2RGDA 2P67A 3VFDA 1C9KA 3LXRA 2IYYA 2ZUDA 1CP2A 1T5LA 5JMTA 3GLIA 1E4YA 1U81A 4D82A 1ZC3A 2MSEB 1L8QA 5FPHA 5DISB 5HZKA 1AK2A 1KGDA 2XNDD 4HLDA 2D4HA 2QZ4A 4PPNA 3LH5A 2VP9A 4A8JA 4DKXA 4ZI2A 4KBGA 3A1SA 1NVVR 3H4MA 5KSOA 5KPJA 1DO2A 2IYSA 2Z0MA 2DB3A 4I1VA 4NZYA 5E3HA 2QU8A 2ZSBA 3N2IA 5FI0B 5EXXA 5HPYB 3MSXA 3ZZTA 4GFDA 4UJ5A 4EFMA 1XMIA 2ZITA 4D6PA 2BKUA 2H92A 3ZLJA 3NBZC 1NSFA 4CEHA 2OSBA 2WWXA 3QKTA 1QHIA 1U90A 4HB4A 3MJHA 3HU2A 4E09A 1SKQA 1ZC4A 5FR1A 3EPKA 1MABA 1SHKA 5J40A 2YYZA 5DSZA 2IYVA 4Z8XA 1NBME 4TMXA 4PO8A 2XJ4A 5FTKA 2VO1A 3PUVA 2BCJQ 3HR8A 1U8YA 1E9AA 4M1MA 1VPLA 2BC9A 4H1UA 4KXFB 2DHRA 3SZRA 3Q7PA 3FMFA 4QHSA 1T6NA 1FQKA 2REOA 4KFRA 1J2JA 1TQ2A 2ZQ5A 2O8BB 2XOKD 4RFVA 1Q12A 2NPIA 2Q9CA 2OXCA 3AKYA 2C9OA 1KI8A 2P6RA 3H0KA 4DEXA 4JL8A 5SZIA 4AURA 3QKRB 5DHFA 4KYUA 1GG2A 2MMCA 4DT1A 5C2JB 1G291 1UFQA 4IJMA 4N0DA 2PX0A 4B71A 3LQRA 1KJWA 3SBDA 3CX7A 1XJCA 2HF9A 2VA8A 1MRSA 2GZHA 1Z6TA 1ZU5A 4P4SB 1E98A 1OKKD 4CZ2A 1N5LA 4PO1A 1ZUNB 1ZMXA 5LBIA 1FNNA 2R6DA 1VECA 3BFXA 4G0NA 5EP3A 2RGCA 3QI2A 1XWIA 2ZSEA 3TBKA 3HDTA 4NP6A 2JLWA 4Q00A 2FSGA 3V4FA 5C46F 2RHDA 1ZRHA 1BS1A 4NYJR 4QBHA 2D2FA 3GLGE 3MAAC 2P65A 3AB3A 4FWIB 2LKDA 2QP3A 4Q47A 5G41A 1E9FA 2QE7A 2ZJ5A 3K9NA 3ZIAD 1OSNA 4WVFA 4A0RA 4XD7D 4XWOA 4LI0A 2JLYA 5IDVA 2DFTA 1G3UA 1NLZA 1G8PA 1CEEA 1Q1ZA 1XEWX 4EJSC 1YZTA 4TLBA 3FTQA 5KSPA 3FB4A 4B34A 3BK7A 3CWQA 3W6PA 4M2LA 2R6CA 3LFUA 2A3RA 4C2TA 1K6MA 3WNBA 3QKUA 3BH7A 3THWA 2IK8A 2C04A 4DDTA 1GL6A 3FMPB 1XJQA 1Q1BA 1XRJA 2WJGA 4DLSA 2IXGA 3K0FA 4DDWA 2G83A 3QY0A 3VKHA 2IX3A 1P5ZB 4TL7A 1DAMA 5KSYA 1E2DA 3FVQA 2A78A 1WBDA 1KJYA 2CE7A 3LW8A 2XITA 4TMWA 1XP8A 3U3JA 4CGZA 2QTHA 5CYOA 1WP9A 3TR5A 2ZM5A 1IQPA 1I4TD 3F5FA 1Z0KA 5IK2D 1DBSA 3IPYA 2C99A 1FNMA 3EPHA 2GKSA 2QEQA 4M0LA 2OT3B 3W6NA 2ZRHA 5KYKA 1M7BA 5C4MA 1VCMA 5FOUA 2OE2A 3IDQA 3OIUA 1NP6A 4Q1FA 2W83A 1HUQA 4B3GA 1NG9A 3LY5A 1C4OA 3FKQA 3KB1A 4NCIA 4UNSA 1IN6A 3GPLA 2AD1A 2WWYA 1E69A 2AKYA 1Q22A 2D62A 3VQTA 1DAEA 3MMPA 4URWR 1QHHB 2GK7A 5EE9A 1CXZA 2VP4A 4BEBA 1P9NA 2QT0A 2IUUA 5HCNA 4B3XA 1LF0A 4JLVA 1L7VC 3GJ8A 3LBHA 3EPLA 3DEFA 2CNWA 4HLUC 2PLFA 1OT3A 2LCFA 4LCBA 1NBMA 2JDIA 1X86B 1WXQA 2QQEA 3PEVA 3K0AA 5G40A 4MGYR 2N46A 5J5CA 2V9PA 1UJ2A 3ZJYA 1AKYA 3MJRA 1TQ4A 3SJZA 3K53A 5TARA 3VX3A 4JVMA 2GETA 4PSAA 3SN6A 2AK2A 3JVUA 4RY2A 1R7RA 3RC3A 4BLSA 4EDHA 3FHCB 2A5GA 3ZD7A 4CIDA 4DLUA 4G5GA 4JZKA 4JLMA 1SVIA 4M1TA 1HT2E 2V8OA 4B6EA 5KNBA 3FKSA 3UXMA 1EFUA 4W5HA 2JLUA 1TU4A 4C0KA 3CUEF 4YMTA 2JIZA 3CPJB 4YXWA 4BLOA 1SXJC 4D0NA 3ZZ0A 3FDIA 4TSFA 4US2R 4TLCA 2XNSA 4BFWA 1G3RA 1G64A 2ZRKA 3CO5A 3EC2A 4C0HA 1II8A 3OFNA 4FMDB 2R65A 2B8WA 4C0AC 1R2QA 3ICEA 5FL7A 3RSLA 2EYUA 4W9MC 3AVQA 3R20A 1MO6A 3QEJA 1BO6A 3GLGA 5CYPA 3KQNA 2P5TB 4KI0A 1KKLA 5J4HA 2IS2A 1N3BA 3K0CC 3TSWA 2X8AA 3QBTA 3EIQA 1DVRA 1E2PA 1QG4A 1UDXA 3P26A 3Q9LA 3B7GA 1RIFA 4K46A 5EE5B 2EU8A 2YVUA 4ERNA 1DE0A 2OAQ1 3GLFE 2BOVA 2XXAA 1KMHA 1XPRA 1UM8A 4HDCA 1OXSC 4QJ3A 2A5DA 2QBYB 4RFSA 5FTNA 3DZDA 3MRSA 5EJEA 1W1WA 5F98A 2K5UA 2ZAOA 2A7QA 3C5HA 4XOIA 3T15A 3P32A 1WQ1R 2OFWA 1NN3A 2I1QA 1XTSA 3KTAA 3I8SA 1VTKA 5L3RA 2A5FA 1M7HA 1AM4D 4QNMA 3U3KA 3THXB 1NL3A 2CL0X 2PCJA 3RYTC 5FOWA 5B58C 1ZM4A 3B5JA 1KK1A 4A6XA 4BQSA 2A5YB 2VSFA 4UJ3A 5DO9A 1KZ7B 1SHZA 2V4ZA 4UNQA 2GZDA 4AKIA 2OAP1 1R10A 4GOJA 3N2EA 4EPTA 2Q9BA 2BBSA 4U5XA 2GEVA 4V02A 1ZBDA 2VP2A 4IKEA 3B1VA 4XSHA 1N5KA 1Y63A 2QUZA 1XD2A 1ZP6A 2W00A 2G9NA 3L2OB 3AKEA 4V0KA 5HZHA 2E87A 3SI7A 3KKPA 2GXUA 1TU3A 2ANCA 2RMKA 4DCSA 4DLXA 3QBVA 4OI4A 5J4KA 3OEHD 3P4XA 4PC6A 2ZS7A 5JFGA 1I4DD 1S0UA 5BN3A 3SR0A 1ETUA 1W0JA 4UXHA 1LF5A 3B85A 3QG1A 3NXSA 1R5OA 1JEDA 2F1HA 4QC2A 4QM7A 2PLRA 1HH4A 1G3IA 3AP2A 1KO1A 2IXEA 3DOEA 5IRCD 4DSNA 2QA5A 1W2GA 3FMIA 4RCYA 3TH5A 4IVRA 1R8QA 3OEED 3GCGA 4QFMA 4BASA 4A1FA 2I3BA 1YJ5A 5KDOA 1Z63A 4BFZA 4YDSA 3W90A 1TEVA 1Q21A 2GCNA 4M9XA 3VHXA 2J0VA 1XDBA 3DZ8A 1HTWA 1P7CA 5JJIA 1EFRD 4D26A 2RGEA 1KNQA 4TYQA 1OH5A 2GCOA 1FL9A 2H5EA 3KKOA 2KWIA 3BD9A 1E2JA 3UKDA 4JVSB 1AS3A 4PAOA 5K8IA 4P3YA 3P4YA 5D3QA 2V3CC 1RE0A 2YNMA 5GVRA 4C30A 3MUFA 2FGKA 1CBUA 4R98A 3ZVNA 1LNZA 1R0XA 1T8TA 4DHEA
chains in the Genus database with same CATH superfamily
3H5RA 3MILA 5T3YA 4BXOA 1PAUA 3DE0X 4Y0VA 1NUQA 2ODAA 1EB9A 1FU4A 2HRQA 2H4FA 4W5QA 1RPZA 4E7PA 2WHPB 3RC9A 4HAUA 4OBBA 4UDYX 1ST3A 4LV8B 4MRRA 2BGGA 2FZKA 3FCYA 1YRBA 1OY1A 1XVVA 2H7VA 4XCQA 4O8ZA 2H4HA 4GLLA 4N47A 5BNTA 1H4VB 4CQLB 4ASUA 4KDFA 1J00A 3Q3EA 3TSAA 4P7KA 5CFQA 4TMYA 3V1UA 4J03A 2EFGA 1UOEA 3PXGA 4A3SA 4EGJA 2UU9B 4OREX 2XMCA 2F43A 1R6DA 1SCDA 2GZRA 2I62A 5DXAA 4PQGA 5GZ3A 5ELXA 4RCVA 1UPCA 3MT0A 3CU5A 2P7IA 1RJEA 5LDDC 4ND2A 4Y2TA 1Z7GA 2ZIXA 3OCZA 2D1YA 1KK0A 2QVGA 3M82A 2ATXA 3CUKA 4U9UA 4U7WA 1RCFA 4B6SA 5CXUA 5D6OA 1AZTA 3DBVO 2QAGB 5CG1A 1Z2CA 1KHHA 3GLFA 2W0MA 4ZEOA 5JSHA 2RH8A 3QXGA 1TIBA 2WBLC 1EWRA 2YQZA 2OHFA 3AF2A 2FR8C 4RACA 2GN9A 2XB6A 4KUGA 4RPCA 2IP2A 3O47A 3I42A 3WGZA 1QANA 1TM7E 1D6SA 3HI6A 4LV6A 2NVUA 2A1UB 1X77A 1WZEA 2OOSA 1Z5PA 3C1AA 4WEOA 1S7GA 3T3IA 5ILOA 4QULA 4ACBA 3A1NA 4ITVA 2EYQA 1POXA 1CY6A 2P9CA 4KMOA 2VR1A 4U1RA 2X23A 5BR8B 4OMCA 1O97C 1DLJA 4B87A 2FCAA 1A5BB 3W1VA 3ISJA 4BO5A 1SN7A 3G0BA 5FBZA 5TNXA 5CDHA 1HT0A 2VDUE 1HOTA 2ZANA 3FUCA 3A6EA 3O4GA 1QNFA 4P7FA 3WYGA 4AKEA 4M6WB 5AHKA 1ENPA 2CNNA 2TS1A 1VHQA 3H1EA 1YE3A 2HNAA 2YJTD 2Z6VA 3H3FA 3ND6A 4Q3AA 1HMPA 1QB8A 3IAFA 5D1HA 3DHWC 2VF5X 3DBRA 2HLHA 3I76A 4FZ3A 1C8KA 1H1LA 4FOPA 1LJUA 4HDKB 2VZ0A 1EEXB 1UWLA 3RT1A 3MTIA 2DCMA 5THXA 1EBUA 1ECCA 5H4HA 2DJIA 1W52X 3W5VA 3D2LA 2OESA 1DEOA 5IARA 2P40A 4LHYA 2L18A 1KI4A 3CPHA 3O4HA 5ECGC 3TFWA 2BTEA 1DX9A 4J0IA 2XQFA 3MTGA 1A98A 5AQ1A 3U3RA 2RJNA 4U5QA 2ILVA 2H48A 5C35A 3CWZA 1PV4A 1ZGHA 3CS3A 2WDPA 3R3SA 2HT6A 3HMQA 3E7XA 4UZFA 1QGUA 2JZCA 4YCBA 1EUQA 3MPOA 4UMFA 4A0HA 1LDNA 4QTZA 5IT0A 1SBYA 3FTFA 4LA4A 1RSZA 4DLBA 3D6MA 5JVDB 3QWBA 4FSXA 3GVXA 5A04A 1EMDA 1JFRA 4UM9B 1WZNA 2G25A 4WA8A 1KDTA 4J7XA 3HNPA 2XDQA 2WI8A 3CJTA 2BMWA 4X3CA 5JPIA 3S8MA 4D57A 5KHOC 3V7UA 5AVOA 2P0EA 1G38A 1CR4A 2PZEA 3T1VA 2HSZA 2VCHA 1OLXB 1KYZA 3AF1A 3I2JA 3JATB 5EZYB 5L3ZA 1IJFA 3A70A 3HB1A 4M9CA 5EIOA 1JR2A 3HJHA 1YZHA 3Q9NA 1K3UB 2ZP1A 4D0LB 1WM1A 1MC8A 1L0BA 2BDEA 5B1HA 1NJ1A 4Q9LA 1E3DA 3DCYA 5C1DA 3VOBA 1EXNA 2XVZA 4J9VA 4F04A 2VDPB 4WADA 4XTRA 4XVUA 2O8DA 1VKJA 1XQVA 4QRHA 1H6BA 4RZQA 4U00A 5AXDA 2ATCA 1A4XA 3KZKA 4ZYYA 2BTOA 2W5UA 5FOXA 3G9QA 1O0CA 3U19A 4AN4A 2VDQB 2H65A 1ADFA 4GLOA 4CDRA 3VKGA 4P58A 3RO7A 4ZYZA 5KI6A 4JXXA 2PQMA 4WUTA 2CLHB 10MHA 1XZJA 4DAEA 3LYLA 4KWTA 3WLQA 2OUKA 1Z5NA 3FG9A 4DDUA 4JBXA 4BQQA 4FQ8A 2MU1A 4M8IA 4EHIA 2NZ8A 1VHLA 4YCNA 2XZTA 5K4HA 2IYAA 1CT9A 5FX2A 1A76A 3G9UA 1G2OA 5C8YF 4KREA 4Q7KA 4M21A 3NHZA 4MWTA 1S3SA 1EUDB 1VRCA 3O8DA 3UY4A 4CUZA 4NFLA 1X8LA 3A3OA 1P1JA 3UQZA 4JLJA 1WWKA 1R5NA 2EHJA 2D06A 5KSWB 1GG5A 1NXPA 5M29A 3L46A 4BEVA 3IQIX 1GQFA 3IQEA 4TPKA 4OGKA 1L5LA 1HRKA 1E1KA 2PL3A 3ZW9A 4UQLA 3RG8A 1LSSA 2RHRA 4P53A 3R7BA 2J3DA 1DIOB 2J9XB 3IEVA 3I45A 3WFIA 1MEJA 4BLTA 1UPUA 4J2TA 4NK4A 2RGUA 2VYND 1VCOA 4IV5A 2ZIAA 4EK9A 3TG2A 2IUTA 4MMXB 4Q4JA 2Q1WA 1NKTA 3VPAA 2BDTA 1S2LA 4LF9B 3E23A 2FETA 5AQEA 2O7NA 3SQLA 1RADA 3IODA 3V3KA 4Q01A 2XB4A 4X1IB 1N2CE 2TMDA 2ZTSA 4YAEA 3TZEA 3HM2A 1ILWA 4MVCA 3V7FA 1T8UA 4RV5A 1NSYA 3VOAA 5KTNA 4ZVTA 3JWHA 4ZMSA 3PSAA 4DR1B 2MSCB 2VWPA 1E3SA 5TQVA 3H4VA 4BLRA 1V16B 5CB8A 3JWIA 1Q77A 4KQEA 3OKPA 2IV7A 4PLHA 4DG8A 4AY4A 2FZEA 3MTBA 2FPMA 4TLEA 3VH3A 1PGNA 3N3AC 3WIVA 1PI3A 1UBNA 4YTEA 5DOVA 1RVDA 2JJ2D 4FBLA 1BVHA 4TWBA 1ZM9A 3GGJA 2X0NA 5CFPA 4Y0NA 3R5SA 2JLBA 2DFNA 4MIKA 1K7EB 3UJPA 3EDOA 2HDNB 3WK6A 5LZ7A 3QWHA 2HADA 1E62A 1SXGA 5FPSA 3NCHA 3W4JA 3RVSA 3WL5A 4BNKA 4B3SB 2G1AA 1X7WA 4BV3A 1RXYA 3BIXA 1LB1B 2VJOA 1EP1B 1KSFX 3II6X 4XLTA 2EJWA 1M1YA 3ASZA 2BMDA 1JT2A 4ZTZB 2WSBA 2ZDQA 1JIVA 4DN6A 3RAJA 5AI9A 2YFYA 5FUMA 3HCCA 2CXSA 3NT2A 1FTNA 1I2BA 3Q98A 4H0FA 4DMKA 2V54A 2KI5A 4OOFA 3MRVA 1LS6A 8ABPA 4ZOEA 4IP0A 3QX8A 4Q9NA 3D0OA 3MGGA 1KAOA 4ED9A 3W8EA 1SIBE 2QY9A 3Q5EA 5AK4A 1ZGZA 2CKDA 1E6EA 3H5WA 3MOGA 1LLUA 1OASA 1GGJA 5MDHA 3LUGA 3Q87B 1EG2A 2ZWPA 1Y9DA 4IOLA 4I36A 2BELA 3QVJA 3GBSA 1PQYA 4ZYXA 3O8RA 2C5GA 3PF9A 1NJ8A 3GCDA 4Q3LA 3BH6A 4AMZA 4DWVA 5BRNA 4Q4LA 1E2HA 2ZUTA 1U8XX 3AHJA 4MUGA 4EB3A 1W35A 1U9JA 5EL0A 3T94A 1W30A 1HKUA 4EB6B 1C1YA 4ZHQF 1A4UA 2G0NA 2YWJA 1G1MA 4ZOCA 4BLWA 1P31A 2PPLA 4OQLA 3K0AB 3PR3A 2R6ZA 1G4UR 3JTEA 4OHXA 1KQNA 2HLNA 4EGFA 2GXAA 2G8NA 2I76A 5JHHB 1W0CA 3PHHA 5CDTA 3W3AA 2JH9A 3DBHB 1I6MA 3KVOA 3D2CA 3P20A 4I8IA 4P31A 2DQ4A 1DQZA 1H66A 3GNTA 3VO1A 2IPXA 4NBLA 1U8TA 1O94D 3K9LA 2C03A 5FWAA 2OB2A 4BNDA 1PFWA 3SC2B 5KTKA 1U99A 4EF5A 3UG7A 3RUFA 3N1UA 1IM2A 4CTMA 2HJWA 4HWSA 1NA5A 4V0MA 2O6LA 4HX5A 4NABA 3TMKA 4C0WA 1N0VC 3B2QA 1SC1A 1EXMA 3BXXA 2XR1A 5CR9A 3RASA 3DBLA 2Z1DA 3W4IA 2QTFA 1UFOA 1S96A 3L49A 1XG5A 3HADA 1N9ZA 3L7JA 2DPYA 3ZHVA 2D0OB 4I3FA 2BKEA 3TJMA 1AKQA 1D9ZA 2VWGA 3CW2A 2R00C 4GYKA 3T4PA 3R6TA 3AEYA 3N0TA 3S29A 2VAPA 3EXG1 2QYOA 1SBNE 1V8PA 4KQKA 3UOGA 4CLHA 4JYMA 4HNHA 3ERCA 3NCTA 4YNBA 4ZCRA 2GB4A 5KBYA 3C8MA 3CSDA 4KH1A 2I66A 4M76B 5E4YA 5JQGF 1AA6A 2EDAA 3RM3A 3NASA 1EUZA 4HZUA 2GARA 2XVAA 1S2GA 3T4UA 1UQUA 3BOSA 3CEAA 3PG5A 2JGAA 1RAFA 1C9EA 2KSQA 2LD4A 3AGPA 4JBWA 4MSUA 2CEAA 1M8KA 4QPJC 4BNVA 5JH7A 5KU7A 2LTAA 3R4CA 3NOXA 2DWQA 1E9DA 3HXQA 1L5WA 4ND6A 5DX0A 4QX6A 2JHGA 4YRGA 1SCQA 1XTVA 3ZWYA 3R3VA 1TJPB 2BCEA 2P11A 3DEJA 2V7QD 4FT4A 1R6AA 2P3LA 2ZT5A 4MPDA 3NC0C 2I7VA 5C5EA 2AXPA 3FLMA 3E1KA 3E9RA 2PUTA 4L4RA 2ZPAA 3UWSA 3ZTTA 4C2AA 4JA0A 3PFIA 3C1TA 4BVAA 4WZBA 4OJYA 2OQIA 1NBAA 1EVLA 1HOXA 1MU0A 1FNBA 1Y3FE 3M83A 3SVZA 1JTVA 4DNFA 1SOVA 2JD0A 1GV1A 2P4QA 2Q0HA 3NYIA 1OJLA 1U0RA 2VQDA 5ETJA 5F5XA 2Z1MA 1N0WA 3X1WA 4IEEA 1AF7A 3TFQA 1RZ3A 3U9SA 4ROSA 3SR4A 1C1XA 5JEDA 3R6LA 5ALOA 4B6PA 1HR0B 4C22A 2X0DA 1Y1RA 3KB2A 2GM9A 3ISVA 1PVVA 4YH1A 1GAJA 1TC2A 1BWPA 5CDFA 4PR0A 3D3WB 2Q2QA 4RKEA 1GARA 5B3JC 2D6FA 2GNAA 1R0YA 1VMDA 1CRPA 2YC4C 3H9UA 2WJHA 3L0ZA 4UUNA 5BN4B 4OVKA 4G0XA 3C3PA 3HO6A 4ZCLA 2HA3A 1ZY2A 4RXMA 1E20A 3DKIA 1H2HA 4W7IA 3K4HA 1NXXA 2BM8A 5H3HA 5EHQA 5TJ9A 3Q8MA 4KQCA 1B0UA 1PJZA 1YR2A 2FFHA 4OQZA 5I9BA 3ONWA 2DBYA 3R77A 2FB9A 5J63A 3ZCQA 1F8FA 5L51A 1KWKA 4ER0A 1L4MA 1DQNA 3KOUA 4L3OA 1YMQA 3SS8A 3TF5A 2GN0A 1F0NA 1YZQA 2E4UA 2OFFA 2DYKA 3GFRA 4JJZA 4UMVA 1OXMA 1SOAA 1ZJWA 3ZW8A 2PMCA 2WYVA 2ZE7A 1FXWF 1RHQA 2A33A 2OK8A 4RZXA 2CNDA 4UEQA 1RC8A 1Z75A 1YGPA 2B1IA 4JKIA 3DFIA 3P7MA 3TI9A 4EITA 2BWJA 1X7ZB 2WA2A 3BB1A 4WERA 3C87A 4KDEA 1Y7IA 5EESA 2IUSA 3MA0A 2CDNA 1E2QA 4GKAA 3RS2A 2QVYX 2XYVA 1MBZA 4INOA 4KNWA 4QUEA 4F4JA 3QEAZ 1L7BA 5TGDA 2QGFA 1H93A 1OIWA 3U3OA 2I22A 4QTYA 3C3KA 4M1WA 5IEJA 3IOEA 1FYVA 1R0LA 1WCYA 5AK3A 2AJLI 5KOJA 1B0AA 5EJGA 4NRDA 1HC7A 1G8GA 1SC6A 2OBNA 2IJGX 2R6GA 2QW8A 3ZHQA 1XZNA 2BHLA 3EZ2A 2W4QA 3Q9UA 4DLNA 3EA0A 5GJCA 3BIOA 3ZNOA 1TTTA 2GCOB 5B1YA 1NVWQ 4AN1A 2YFKA 4WESA 4I4TA 2CCGA 3BBLA 4EGCB 1X42A 5CT4A 4DG9A 2KM1A 2PWBA 2UXDB 1QC5A 4IGAA 3N58A 3IBYA 3VH2A 4ESOA 1LWOA 3TW8B 5A3RA 2JLAA 2AF4C 1XEFA 2VJDA 2P5SA 2REQB 4JMLA 1QZTA 2BGNA 4MRMA 3EGIA 3TECE 2AA3A 3CUTA 3GIWA 1WW2A 3L05A 4BXOB 4F9GA 3T7EA 2GCPA 3P8ZA 5K8LA 3SJUA 5KS2A 3FDJA 1JSRA 2YN4A 5TMDA 4PCUA 1KY4A 5K8UA 4L08A 1POWA 1DUVG 1ZPDA 3ANMA 1YL5A 2AH5A 4PS0A 3OEEA 3ZHSA 3HDQA 2QXTA 4HVAA 3EPJA 3AUXA 3W78A 3BYZA 3D6FA 4HYTA 2WJ6A 4JK3A 1R18A 2F43B 3GNSA 3ZDEA 2CLSA 2HF2A 2ODQA 1CX9B 5KKCA 1CZNA 2AZDA 3DCJA 5K7SA 5I9MA 1Z5UA 1J5EB 1P2TA 3CZMA 1DP4A 4G5FA 1ISJA 2ZIXB 1GVHA 2CXNA 3C3YA 3IKMB 3P0FA 4LZJA 4TN5A 4ESHA 5K8TA 2KJQA 3DMPA 1PD1A 2CLOB 3PT5A 4NATA 2VOJA 4KQ1A 3TUIC 1FPMA 4FMBB 3TNDA 3GLFB 4QEKA 5AW4A 3GOQA 1VKHA 2VH2A 5CM2Z 2XDAA 4Q21A 2CLEB 2IYXA 2PGLA 3AVTA 4K1XA 5EXEA 3KFLA 2H17A 2G70A 1CUJA 1E7YA 2OAEA 4XTCS 1PR9A 2GEJA 1P77A 2JI7A 4BLQA 2R7NA 1WW8A 2R44A 4KR9A 4F8JA 1T9ZA 2YJZA 2XAAA 2ZJ1A 3BL5A 4FNAA 4NYJQ 2NVUB 1C4KA 1JMVA 2BEJA 1O5IA 2GEDA 4H1WA 3PDWA 2QD1A 4H6XA 4P36A 4AJ2A 2C8LA 4TRRA 1SU4A 5CJPA 5LCXA 3K35A 3GGCA 4NFSA 3QM1A 4QOHA 3REQA 1TM1E 4HDSB 2XMGA 1YZUA 3Q5DA 3IEMA 2Y3IA 2P2ZA 3AP1A 3Q0TA 3H3JA 4KE9A 1U1IA 1MX3A 2JCGA 3PNQA 5IF9A 2PV0A 4UAVA 4RZ2A 3HA2A 1IB6A 2ODWA 4ZEWA 4JI4B 1ZVMA 1DC6A 1AIPA 1L1RA 2H06A 2HF8A 1VA4A 3DTVA 4U7FA 4V0SA 3CTMA 5A5EA 2OV3A 5KX5F 1ORTA 3W7VA 5H5JA 3DBRB 5KNDH 3TQFA 3X2EA 2C42A 1NZDA 3DD1A 2CHEA 3VU9A 1WF6A 1OHHD 1H1LB 5B64A 3BIJA 4FCCA 4WLVA 5KNDD 1KSHA 3UV6A 1DOAA 2IZ7A 3EW7A 4KLNA 4KZKA 2JGKA 4LE1A 4LJ6A 4RFLA 5AFSA 3DYIA 2IXTA 2Q3LA 2WEKA 3O92A 3LYAA 5CUQA 1WXGA 5EIFA 1P5FA 4IYJA 5FOSA 2QTCA 3PL1A 1X1SA 1U5BA 4PQFA 1GGMA 2WF8A 1DIBA 3GLHE 1WB9A 5KVAA 4RZUA 3Q7EA 4JWTA 4FHFA 2IDJA 4OB8A 1QGUB 3DLIA 1SUWA 1M0TA 1TKCA 1FMCA 3SR3A 2ERCA 5IWAB 3PKZA 1Q7TA 2DKFA 3PC8A 4GKVA 4J4BA 1L4NA 1TYAE 5E6SA 5MFZA 4WY5A 1P8AA 2LIPA 2OBBA 4KHZA 1RC1A 1XYVA 5CG2A 3NRBA 4BGDA 2XDQB 2GTPA 3JQGA 3ZBPA 2GM3A 2JGEA 3JYQA 4MGZR 1BOFA 4NV0A 4IGKA 3JRNA 3CNOA 1IBRA 4M22A 3H2SA 3MELA 1ZGGA 1RXEA 1WMBA 2YJNA 2N42A 2ZZKA 3H3XA 1AU9A 4XWTA 5AUQA 3IJPA 5CFOA 1JX6A 3A25A 3OOSA 1TYDE 4KQIA 2F1RA 3MC1A 5B12A 4EG3A 5JCXA 3A1TA 4CIBA 3F4KA 2WIBA 1RHMA 3RJTA 1XEXB 3OT4A 1NN5A 1GQYA 2FSVC 4YJDA 2O8DB 1H2FA 2XTJA 4HVTA 3PUJA 4E08A 1VSVA 3VO2A 2B82A 2JGFA 3A06A 3D4LA 5ALQA 4OL0A 4CL0A 4D8UA 4BVBA 1ZK0A 4XYGA 5H70A 4MPTA 5J2TB 5CFLA 2IXFA 4KWIA 2CCKA 3V4ZA 4HTAA 4UUMA 5C1IA 2EV9A 4QWWA 4YAGA 1Q19A 4PC2A 1B7GO 2ZOSA 5HR5A 1XE3A 2QSZA 2J87A 1LC0A 4B2PA 1P4GA 3HFRA 5B6JA 2SHKA 2ZJ3A 3B6ZA 3NBKA 4WRRA 4BWGA 4JBIA 4CT0A 2Z5VA 4YFYA 3VHQA 5KDLA 4TKVA 2NZVG 3A4IA 3A04A 2VPZA 1LRLA 1P18A 1FDRA 2VDNB 3LOQA 4QYSA 1V4VA 5ICCA 1SY7A 4N9WA 3H8WA 4LJYA 1Z16A 5T6MA 4RH1A 4YO7A 5FNZA 3JAMA 1CUVA 1SVOA 1JWAB 2P6NA 2W2VA 5DYTA 3S3TA 2WKPA 3K1ZA 1A4IA 5EXTA 1IONA 3DOHA 4QFCA 1JHXA 4YT8A 5JO0A 2XUFA 4J0HA 2WUFA 4QU8A 5DGIA 5EHGA 2F17A 2O3QA 4LTDA 1PSWA 4AG6A 3IB3A 2B7BA 2CXXA 1CJUC 3WWYA 3GK3A 4ZVUA 4D96A 4LF8B 2PQ0A 4GI7A 4F84A 3VC1A 2MSDB 2UZIR 3R9WA 1GD1O 2ZULA 4TSKA 4Q4JB 3K6JA 3KYJB 2FZCA 3MZ0A 5KNBH 4U2EA 3QNUA 1FLDA 3EZ7A 1U2SA 4AW9A 2JZOA 5KNBD 2HW8A 1NULA 1ZM3A 3R24A 3AV3A 1NUHA 1ZXXA 1ZZGA 4E5SA 4X90A 1H94A 1GU0A 3DBIA 3NDPA 1FFGA 3ON5A 3Q1KA 3AMVA 1NMXA 5DBEX 1EGQA 1R4AA 2HJGA 4FFLA 4FFWA 4DIMA 4IIEA 4ZQEA 3RUAA 3Q7QA 4IILA 1X74A 1A7UA 2PGXA 4S1TA 4XEUA 5C1BA 1DKMA 2ZPTX 1J8VA 5EXPA 3T54A 1RD4A 5I7FA 1W4BA 3IEUA 4MCJA 5GPBA 1JXAA 3OI7A 1NV9A 1NDQA 2GMWA 1ULAA 3EGXA 2OCIA 4LJ7A 1NGSA 2P2LA 3D0RA 4MULA 1UPXA 5T8KC 3WY9A 1T91A 1K3FA 3DXYA 4HAZA 2IXDA 4RLSA 3W5CA 1OI3A 4EKDA 5CA1F 1NQXA 5I9NA 1PT9A 1QX4A 1TW2A 3HR7A 4I1OA 4TV8A 4UKDA 5T41A 2LWIA 1FJGB 4G4SO 2PS1A 4E3WA 1SB9A 1X7WB 2AQ8A 2VHQA 2Z3WA 3MGBA 4HPXB 2W6CX 4DIDA 2EWVA 1NF3A 1L7OA 1M1YB 1ZK4A 5TT1A 4OHZA 2CK3D 4ZOLA 4E22A 3NB0A 1V9SA 4I81A 1ACMA 1CRZA 1N7JA 2IEZA 3CIOA 3V46A 1BE0A 1MEOA 2EL7A 2O07A 3LLCA 1JRLA 1S8FA 1DBVO 4TLAA 3KJQA 2J4CA 1A8QA 3UIEA 5KOHB 1Q0HA 5E9WA 3PJRA 4HFRA 2XUKA 1DFIA 1MHPA 2IYQA 1GKYA 2VNHA 3MUNA 3PDIA 4NF2A 4LDNA 3DJFA 1YHNA 5DBGA 1Q84A 3USZA 2Q7XA 4OFXA 1H4SA 1XD9A 5TF4A 4DV1B 1MH9A 2PRKA 4GX5A 4A1OA 1G18A 4KQFA 1YBMA 4ZHSA 2ACKA 2JJ2A 1PLJA 1R9JA 3JR7A 3ZV7A 3IP3A 4BFCA 2VHZA 3HTXA 5DK4A 1AKMA 1KI1A 3OC6A 2FN3A 2IYOA 1WXEA 4IMRA 4V3BA 1NP7A 5KU1A 2QPLA 1BJKA 4GGOA 4PYMA 1KU6A 1GLNA 2XUJA 3SVTA 1LPSA 1HA3A 2RJOA 3E05A 4Y6PA 2G1PA 4M0FA 2XQIA 1G16A 2YIVX 1VCNA 2HNBA 4L9WA 1MTZA 4R1TA 3PTAA 2DECA 3STUA 4QT0A 5DBIA 2GZ2A 3R76A 4DDKA 3O0DA 1Z4PX 4GGPA 1NIJA 4MKRA 3OCCA 3O8CA 4BV8A 1RRPA 3DLCA 4RLFA 1SBQA 2GPWA 1RRMA 3JAKB 4GUDA 4NCAA 1FX1A 5HQ3A 4QELA 3IQGX 2I4IA 2Q29A 4X1YA 3GW8A 1JU3A 4RKFA 5HBRA 4BAGA 4HT3B 3SQDA 1I3KA 1WLSA 1YE5A 2CMGA 4GMDA 4FZRA 1FP2A 5D1NA 4C88A 1H0KA 4FFRA 4B4WA 3HSYA 4HQ0A 4BNTA 4A91A 3C2QA 3I28A 3BJZA 3NHLA 4BQSA 3UBTA 1U28A 3QJ5A 3WHLA 2E7ZA 2Z83A 5JBIA 1RWOA 2R8YA 1J2RA 3DBLB 3DNPA 2WIKA 1BRMA 1IFXA 2B4RO 4C5BA 2RIPA 4X66B 3RREA 4HN4B 3H13A 3GLRA 4ME6A 2F1JA 3TSZA 3ZGVA 2R25B 4I5DA 2UAGA 1LI7A 3GWZA 5LUAA 1UBEA 1J25A 4WCFC 1XA0A 3X3HA 5K0CA 1OW3B 3H65A 3H6KA 1EP2B 5AVUA 2C7OA 5D3KA 3UAOA 1Q3TA 2O0JA 3B6KA 3FLAA 4G9BA 1KYIA 2IA5A 1OOEA 1RKUA 1Q20A 2H2FA 2RARA 4FHDA 4JLUA 1SA0A 4OQQA 5EOVA 5L95A 3WWDA 2CV1A 4DR4B 2KHZA 2FZ4A 3A4LA 2IHBA 2C9ZA 2G7ZA 4HZUB 4D45A 5BR7A 1WOYA 1EFVA 1NXSA 2M6RA 4XVCA 3K70C 2R7AA 1AO3A 1KZ6A 3Q6NA 3HKEA 4H77A 1QYXA 4YJHA 4LC0A 4ZXPA 5IAKA 5JH7B 1O94A 1W8IA 2R8XA 3HP4A 3JZIA 4FVTA 4FX5A 4X8HA 4Q7JB 5TDHA 4Y1RA 2RONA 2PPVA 3LCVB 1EJBA 3A3YA 4LISA 4AZSA 4B31A 4CV1A 2WILA 2AC2A 2HO4A 2Z8YA 3L8YA 5CIYA 4LN1A 4IFBA 1H3NA 3O94A 5BSHA 1FFDA 2B7LA 1XFDA 4OXIA 3NDBB 4NZ9A 2V7EA 2EFEB 2WZQA 2ZKIA 4RZIA 2FY8A 3ZDXB 1AH2A 3UJ6A 3WRWA 1JAZA 2CXHA 1ORWA 3BGIA 3L4BA 1AGXA 2O5VA 3PHJA 4XIGS 1GNVA 1CQPA 3AHEA 4WZBB 3SHOA 5D00A 2WFMA 1N4DA 3P9YA 4LJLA 4R8LA 3B9QA 3UANA 4B46A 5FKJA 4IVQA 1K5GA 3MEQA 4E33A 1IN1A 3O1JC 3SYNA 3LKVA 7REQA 5DU2A 4Y2JA 2ZXFA 4NJEA 1IM5A 2HQOA 2WD7A 3N75A 1WG8A 3EH1A 1DELA 3I4CA 1NI4A 3BXFA 3C3BA 1CLUA 3HN7A 2WFLA 1RAEA 1DT3A 1C1XB 4ITUA 2NYAA 2GN6A 1SIWA 4PO3X 4XOUA 4DSOA 2BYTA 2ZSAA 2Y1XA 4N6NA 1FJ2A 3B8HA 3M70A 1XVUA 4DWJA 2OV6A 4QJ5A 4QU9A 4NSNA 5JNTA 4B4OA 1RJGA 3T5PA 5L7WA 3KR1A 1TCUA 1Q7GA 4I4CA 2ZBUA 2O1EA 4TXHA 2I8CA 1A9TA 1KHTA 2CWDA 2AFIA 1Z6AA 2PT7A 3BMNA 4NWIA 1ZH0A 3C14C 1VZ3A 3I1YA 2BR5A 3JQFA 4XX1A 4YRPA 2WB4A 2E6KA 1DIHA 2V7QA 3OJ0A 1CR1A 1XMJA 4TOIA 4RTKA 3DAYA 3WRXC 2Q4TA 2QXUA 2WJJA 3PWZA 2V6JA 3S2EA 1U94A 3ELDA 1TQDA 2QZJA 1I2CA 4B35A 3K0FB 1W87A 3CR3C 3O93A 3PCTA 4HB3A 4KLAA 4ZO6A 3U26A 3UH0A 5K4GA 5IDWA 1I3OA 3JWEA 3L7YA 1GLGA 4QJBA 1XAGA 5ESXA 2C92A 3EEFA 5H7XA 1JVNA 4NE2A 1N33B 4ZDKA 5HZMA 3U7FB 3OZEA 3JY6A 4WZAE 1O96A 1PQWA 2VP5A 3ORQA 2Z6AA 3RVPA 1H3EA 3P5SA 3MLAA 1JECA 3G2JA 3T7TA 2WJZB 3BIFA 4BFSA 3PLNA 2PAAA 5HRUA 2HMUA 2CBXA 2F64A 2HBYA 1FSGA 4EG1A 1I2DA 4LMBA 2AHOA 3VPHA 4N5LA 1RP7A 2E5LB 1KVUA 5ICFA 2MHCA 5K0NA 2GASA 2NIPA 4B4KA 3OLZA 3B48A 1QDEA 4L07A 4Y2HA 3UK1A 4DA6A 1KSJA 4P93A 5KOJB 1XZFA 3REGA 1XTPA 4FU0A 4H7IA 1B00A 3EXHA 3UOAB 3GJ6A 4RMJA 3L77A 3CN9A 3WYNA 3BREA 1W46A 3FM9A 1I5OA 4QD3A 1SUIA 5HIMA 1NFQA 3GHHA 1K08A 3LHSA 4I4TB 4WESB 1RPAA 4EDFA 4K0KB 3UJDA 5D7BA 3I0NA 3GCWA 3KOWA 3TQRA 3U6KA 3H9QA 1M1NA 4D25A 4UBOA 5CXSA 5F3DA 1NMQA 4ND8A 1DCMA 1CLEA 1R88A 1UQRA 2CJWA 3D3EA 4FCVA 2VNAA 4IFTA 4I6JA 4MRMB 5CH3A 3STHA 2IS4A 1GEGA 1IAQA 1T5IA 2I03A 4FQ5A 4MJLA 4FDUA 3UC5A 5BWCA 3O8BA 3LF1A 4D8VA 1JEQA 1DB3A 2DTDA 5CD9A 3F98A 3NNNA 4FGSA 3R75A 3WHPA 1PK7A 1A9XA 4IXMA 2YYSA 4R1SA 3DFKA 3I01A 1W4RA 4WXEA 3UV7A 4C04A 2F4VB 1RI5A 3FA2A 3UFBA 2B1QA 3ABOB 4EI7A 1TZ2A 2QI9C 1X6VA 3AVPA 4UUAA 4YALA 3TOSA 4OHKA 4YRFA 5JOQA 5AOCA 3ENZA 2BHTA 2HK9A 1V1JA 1BC5A 1P7WA 1RT9A 2P2SA 4GPTA 4WEQA 4HHEA 3BMXA 3U7RA 3AFHA 2EIXA 3DPIA 3R5KA 4R9VA 2DXIA 1YAHA 2WQ7A 1U0FA 4Y2PA 3WWOA 4MDEA 4ZVQA 3TRHA 4LQLA 2FKAA 5A7FA 3TIXB 4WK0B 1U0EA 3EK2A 4G8DA 4REOA 3NO4A 1ZJZA 2V74B 1P2SA 2HPAA 2K7FA 2QX7A 2Q21A 5GQSA 2WU4A 4O4IA 4EG6A 4IZIA 4PZEA 2GCEA 2O7QA 2UKDA 4L0MA 3OFJA 4MUYA 4YBZA 4CM3A 3NOOA 5AHRA 3OFKA 4H31A 1K6XA 4ENUA 3G8DA 2PZBA 1EAYA 2HIMA 3AJEA 3OJXA 4H1VA 5F2KA 3WLSA 4A0GA 2XQJA 4HADA 3SQWA 3VNVA 3HS3A 1UMCA 4OLHA 1SUEA 4K6CA 4BB9A 1CB0A 1NW7A 3IE0A 3ZJTA 3H17A 3L1KA 3REQB 4ZT3A 4IQFA 3AVVA 2X42A 3X1KA 4CDNA 1O89A 4E2WA 1HX7A 2HU8A 3F1LA 5C18A 3TLAA 3C7KA 1NVXQ 3CBGA 4DLYA 4OH1A 4TXMA 5H0IA 3S2SA 2DF8A 3WB9A 3CF6R 4BFVA 2R8RA 3DTVB 4X85A 5JROA 3KEQA 3N05A 3QFHA 3SYTA 1KVSA 1U2DA 4O0MA 3O31A 4N7RA 4PZDA 3VU9B 3TL3A 3T1HB 4RU1A 4D80A 3GC6A 3KJGA 1WZ2A 1O77A 2A8YA 4ZT6A 4E4YA 3CTPA 4O4LA 4GOMD 3EFOA 3UMYA 2GBCA 2QK4A 3WO1A 4KOAA 1LX6A 3R2JA 2P9ZA 4IEFB 4EENA 5KDDA 2XNHA 1U5BB 3KSRA 1K27A 4GXQA 1LW7A 4LE2A 4U63A 4R54A 4OKNA 3R8FA 5FV7A 1I4EB 3W2GA 1A1SA 3QQPA 4V38A 1O08A 3ZY3A 1JR3E 2FA9A 3IH5A 3L8CA 4D8TA 4FHEA 3RLFA 4F3RA 3FOEC 1GM5A 3G9ZA 1TM2A 1RJWA 4UXJA 3P9XA 2J6CA 4YACA 2NMVA 121PA 5E6SB 1FS6A 4AKSA 3TW4A 1XKQA 1LK0A 3B9PA 3DUWA 4Z0PA 3U31A 3JQGB 1JHMA 2WNIA 2ZJAA 3ZGYA 3BRWD 1SQGA 3FVVA 1RAIA 1W5BA 1X7XA 4IUDS 5EJ9A 1NYQA 3OU7A 1RXSA 1DFGA 2VZLA 4RMNA 5FBHA 3QEMA 4Y0AA 4EVSA 2NYRA 4RV9A 3G2HA 3TOZA 3I37X 4G41A 1P3JA 4JKYA 3C3WA 1OGYA 3KK0A 5DTRA 521PA 5FLEX 1OHHA 2ZUUA 1NP3A 5KNDA 4ZC8A 2X77A 1VSTA 1VE7A 2SKCA 2WJWA 1XEAA 4G6ZA 5LA6B 4A27A 5CBKA 2E9SA 4WN3A 1V48A 5G3YA 2ACEA 1EXVA 3U81A 4EFLA 1U7HA 1D2CA 3R7LA 1P0IA 1P1HA 3CLUD 4R01A 5HKKD 2WINI 4CR8A 3LL4A 2PUBA 3M5PA 3CRW1 5GOTA 1V6AA 2I80A 3LNCA 5IM4F 2G4LA 3OZXA 3TKAA 1FC0A 3VNBA 3CSSA 3D3KA 3S99A 1LVUA 4G0OA 1W5AA 3RTEA 1VKOA 2JEOA 1MXFA 4GMHA 4DRZA 4ZEVA 1F48A 4GPAA 4J6EA 4WXPA 1F0KA 5BURA 4C7OA 4TKVB 1K68A 4I6EA 4DSTA 3HCRA 2ZWIA 5BSKA 3JPWA 4X9XA 1PJLA 4EPYA 2ETXA 1G2QA 2H2WA 1VI6A 3C5WP 3AI2A 1VQ1A 2PH1A 4TS9A 1TYBE 1T2CA 3BAFA 2J0SA 1CEQA 1N1GA 1QO9A 2BKLA 2OBXA 2A9RA 2PT9A 2YW2A 5HZGA 4BGVA 5C1PA 1L4FA 2J46A 5K8CA 1JWBB 2VXCA 4G0VA 1CQIA 2XJ9A 1D0VA 4LDQA 1UBJS 2ZSHA 3Q15C 2A92A 3SBEA 1IQUA 1UMKA 3UPDA 2F9MA 4S24A 4DIEA 2JFBA 3U0BA 1NVUQ 1S3IA 2C4HA 2GD0A 3ZHRA 3R6DA 1JB1A 2ZZNA 4QQNA 2H16A 5A4IS 1D1QA 4BMXA 1SUAA 1K9VF 3BFPA 4FKZA 5P8WA 1P2VA 3MF4A 1G2IA 1PGOA 2ZYVX 1KE2A 3KJIA 3RBXA 5JNUA 2J48A 3MBKA 3T8YA 1QWSA 4PVCA 3W8FA 5FR2A 4ARBA 4EMSA 2PO7A 1I9GA 4JIMA 2WD8A 1TZBA 2QAGC 2VZEA 2Y2UA 2ZJOA 4KCGA 4K87A 4YUYA 5LQSA 1VC2A 1P91A 2RGAA 1TECE 2CMDA 3V4OA 4EHDA 2V4MA 2B25A 4Q3EA 1Y4UA 3GLSA 3GVHA 2B4TO 4LFCB 4Y2SA 1ADCA 4IIXA 4BRSA 3FWNA 3K8QA 4NFHA 4ZPXA 3CX4A 1ZRSA 3M33A 2AZXA 4D97A 4DTCA 3O0TA 2X0RA 1A88A 2OCDA 3RWBA 4AY3A 1R6UA 4IOKA 3ENVA 4O2AF 1U2RA 4RD3A 4BE9A 1ISFA 2DPGA 2WDZA 2YWDA 3EGXB 3DE6X 3MWFA 4H59A 3DDZX 2WV9A 4BRZA 3GZJA 5BW8A 5JVDF 5ED4A 4KXMA 4WE3A 1ZVVA 3DZJA 3RGGA 1DAPA 3CX3A 1VL5A 5C1OA 5K0ZA 2V7PA 3QPUA 4ILEA 5DGHA 3UEOA 4C4PA 1M33A 1OWPA 1DUSA 4QXMA 5LUBA 3G89A 1PZXA 2EZUA 5FBVB 2W42A 2WMNB 3LUKA 1DDGA 1XVTA 2E1RA 1UK9A 3AG6A 4J49A 4B45A 3JALA 2PRJA 1EX6A 1IIBA 1UPAA 1Z4KA 2N75A 4P81A 5T4HA 4OM8A 3HUEA 1U8UA 3U40A