4V0ME

Crystal structure of bbs1n in complex with arl6dn
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDIPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
total genus 47
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0mE00
1G3IA 2OZEA 1OH5A 1EFRD 1AKYA 2ZRBA 3DEFA 1GFIA 3R20A 2HXYA 1OH7A 4TYPA 3I1FA 3QF4A 1R8QA 3E1SA 3AVTA 1OT3A 2VHQA 4JLMA 1R0ZA 4NBSA 1BH2A 2QNRA 2GCOA 1M7BA 3BFKA 4JT4A 2F9MA 5F9FA 3MUFA 4B71A 1W5TA 1RE0A 221PA 1RPZA 4HZUB 1IJEA 3MJRA 4YQFA 2OILA 2UKDA 3BERA 3FMOB 3LBNA 3C5HA 3GLHA 3M1IA 1E2FA 2G83A 1ZP6A 1F48A 3W3ZB 3C5CA 4RFSA 4TQ9A 5FTKA 1WBDA 3QSYA 1LS6A 4AURA 3PEYA 3BJIC 1S3SA 1UADA 5AJXA 4A8JB 3BH0A 1OH8A 2ORIA 2R6AA 2IEYA 5JEEA 1JEDA 3PFIA 1E98A 3CPHA 1QBKC 1IBRA 4DT1B 2VP4A 2QSZA 1EFCA 4KITB 3I3SR 3DMDA 3CONA 3TSOA 5GJBA 2BJWA 4LBZA 3MGCA 121PA 1M6NA 4V0ME 2ANBA 2WJJA 1AGPA 4URYR 3QIAA 5EXTA 1HURA 3TRFA 1IXZA 2F9LA 2VRWA 3EAQA 1W36B 4HYYA 4A36A 1CJVC 1CR0A 3N70A 3IIMA 2C03A 3DVLA 3WP0A 4KLZA 1A1VA 3I62A 2XSZD 3PUWA 4MGIR 5GVRA 3TUIC 3T1TA 3RLFA 3TR5A 2H16A 3OIWA 2KBFA 1OSNA 5CYPA 2J0UA 4M0LA 2YWFA 4R2IA 5EUMA 2BOVA 4JL5A 3T61A 2HT1A 4Q7MB 2HDNB 4PC3A 1HA3A 4TTPA 3U4QA 2DY1A 4QC2A 4BFZA 4GOKA 1XEWX 5L3VA 2AHOA 2ZUDA 2G88A 3EPLA 3IQWA 1GRRA 2ZYUX 3LA6A 3VTKA 1P62B 3D31A 1DBSA 5HR5A 1N3BA 4CRWB 4OJKA 3BAFA 4PPNA 5JHHB 2A5JA 3T35A 1HE8B 1R7RA 1E9FA 4C0QC 2A5DA 3EPHA 4TSFA 4BFWA 1IXRC 2AD1A 3AF3A 4MRVA 3GLHE 1M74A 1G8PA 2IYTA 4Q1BA 2X8AA 1E2LA 1X8KA 2B92A 2CL7X 4CW7A 5BN5A 5TXGA 2VH5R 5GVSA 2W2TA 2ZYVX 3CM0A 2XNSA 1E3MA 3OIVA 4Q5IA 4PC1A 1RVDA 3KUCA 3FTQA 5JCPA 1N6LA 3I72A 3ADDA 1ZCBA 3GJ5A 1JR3E 3MLEA 3CPEA 4B44A 5FFMA 1IHUA 2E9SA 1DARA 4M1SA 2ZS8A 2GVDC 3WRYC 1KTVA 1P2SA 3WRXC 2IYYA 1OHHA 2G1JA 4MKFA 2G1KA 2QTHA 4DDVA 1Z47A 2HLDA 3I32A 3S1AB 2EYUA 2J3EA 3I92A 2XZPA 4LGMA 1UDXA 3B1WA 1TU4A 5J4LA 1H8HA 3VR1A 2DPXA 3ZIAA 1Q0UA 4IEEA 3L0IB 2VHTA 2PMKA 1V5WA 3TIFA 4ABYA 2MMCA 3THOA 4DLYA 2KJQA 4MDEA 3CRW1 4DLRA 5E7JA 4IDHA 2PEZA 5ANRB 2ANCA 2ODNA 1ZNYA 1G8GA 4DCUA 2GXUA 2YWEA 1ZJ6A 2YOGA 2AK3A 2WMOB 4M1OA 1BIFA 3O8DA 1GKYA 4BLRA 1TEVA 1E32A 1GRNA 4FN5A 4IRUB 4J0QA 4DSOA 2JASA 3C41J 1P3JA 4TMTA 1T4GA 1V43A 1D8TA 2QM7A 4NTZA 5LB4A 1S96A 5A0FA 2O8EA 3UATA 3QXXA 2BBOA 3OIUA 2QN6A 3NBYC 1EG7A 2FH5B 4M9SA 2BKEA 3SEAA 1ZIOA 2ZE6A 3C16C 3SJZA 1TQDA 1U8YA 4IXMA 3SNHA 1CTQA 5CYOA 3P27A 1I2DA 4S2EA 3B7GA 3BBPA 3KJEA 4C4PA 4IDNA 4LK2A 1XCGB 2P6UA 1CRPA 3UPUA 1TL7C 4TTRA 4TZ0A 2IXFA 2XOKD 3EIHA 2GZAA 3AM1A 1KO1A 3GJ6A 1P9NA 4FMCB 4ZDKA 5CLQA 2PX3A 2O0KA 2GRJA 4A82A 3ZVRA 4G3XA 3GEHA 4DT1A 1RRFA 3U3KA 4B2PA 4Q00A 2QENA 1DG3A 4XVUA 2DFNA 3HPRA 1ZM9A 5KTYA 2WWYA 1JNYA 1WF3A 2ONJA 1KIMA 4BFYA 1E2GA 1AS0A 4DLSA 3EARA 1N2CE 1LW7A 1GKIA 3NWJA 4EPTA 2UZIR 3GLGA 4QM6A 1N6NA 1CP2A 1ZBDA 1Q21A 1KJWA 1UBCA 3N5CA 4IHQA 4YLGA 4CYMA 2CBZA 3R9WA 1NSFA 3IIJA 3VX4A 5C4MA 2XSZA 2D62A 5JJKA 3VHXA 4TZ6A 2NQ2C 3X1WA 4MRRA 4YC7A 4DDWA 4QHTA 4ZKEA 1XTQA 5FOTA 5BYKA 2YOFA 4N1AA 1NIPA 4KAXA 2WOJA 1XBTA 4D4LA 1O87A 3LQRA 4JVLA 4JIMA 4MKHA 3U3OA 1OF1A 4C7OB 2O5VA 3HR8A 1Z0DA 2OXCA 2ZS7A 5K8LA 5EP2A 4HAUA 1W44A 3UIEA 2IBMA 4R7ZA 4AG6A 3G5UA 2BM0A 3BH6A 2W83A 4L9SA 3W8RA 1RIFA 4C0LA 3LNCA 2OEPA 4Q4AB 2QI9C 5AJVB 4V0KA 5UKDA 1PJRA 5L8VA 4AD8A 1HTWA 1K8RA 2ZITA 4FI3C 4HATA 5G41A 1SKYE 1YZNA 2Q3HA 2RAPA 3BIFA 4JMPA 3T5GA 4OHVA 1M2OB 1K6MA 5JJLA 5EE0A 3PUVA 4BLSA 3KFVA 2ZUBA 4D2IA 1L2TA 3FMFA 1DAHA 2WMNB 4LJ9A 2NO0A 2VP9A 2D3WA 2ZJYA 2X19A 5C1BA 1DAMA 1SQ5A 1YZLA 3AVYA 1ZCAA 1ODFA 3EXAA 1X8LA 2BBTA 5CB8A 2GF0A 3MRSA 3LDAA 3EIQA 1S2MA 2RGGA 1WE2A 3QXHA 1D9XA 2AD5A 4HSEA 4ZCLA 1CBUA 2DB3A 1W4BA 2B7BA 2AXNA 3CX6A 1ZNXA 2RB4A 3SC3A 3B6EA 3KQNA 1XZQA 2QGNA 1HT1E 3UKDA 5EXPA 5KO2A 1Z8FA 1FP7A 1D6JA 2FNAA 3CH5A 5D3MB 4LYJA 4L15A 1MV5A 3NKVA 4DEYA 4Q4JB 5CIQA 3TQCA 4PO9A 4C0JA 1NI3A 1QVRA 1OKKD 1KI6A 3AUXA 3LX8A 3EPKA 1N6RA 2BKUA 2OSBA 4CT4B 1Q20A 1E9AA 3CNNA 2W2VA 1KKMA 3LVQE 2RGAA 3H4MA 2HEIA 4JLNA 1UEJA 1G291 4ZDJA 1R4AA 3BORA 1SXJA 3WNBA 3K1JA 4A15A 2JLVA 3KQUA 2FGKA 3R9XA 4NPHA 1OH6A 1GOTA 4ILEA 4DLVA 2GA8A 5FPKA 3BOSA 3REFA 1RC8A 1C4OA 4EPRA 3ZJYA 1QHIA 4Q9LA 4QG7A 3VKGA 3IPXA 3EASA 1NBMD 3K0CA 2QRZA 1KMQA 2ODBA 1XU4A 3K0CC 2C9CA 1CJKC 2GEDA 4Q4AA 3SYNA 1E6CA 1AJEA 2CHQA 2HV8A 3EZ7A 4DUGD 1VDZA 2Q3MA 2WJIA 4DCTA 3QOFA 3VR4A 4JLKA 3IILA 2GXQA 2RGBA 3SFVA 4HB2A 3AH8A 2C5LA 1VCIA 4JLAA 2ZYWX 4PAQA 1T8UA 3QI2A 4MQBA 2K5UA 2ZRLA 3QE0A 1FZQA 1XWIA 2V9PA 4B73A 5AUNB 5H8WA 4II7A 1IY2A 2Q3FA 2Y8EA 3U7GA 4RCYA 1Q1QA 3UWOA 2YC2C 3U6BA 3O8BA 3X1YA 3MMPA 2C98A 2G3YA 4MRSA 3K53A 1XP8A 4V0LA 4CEIB 2QMHA 5FOXA 2BEKA 2NO1A 3W5IA 4DSNA 2ORVA 3ZLJA 1G7SA 5A4JA 2ODWA 3IBGA 1CRQA 1GAJA 2AK2A 3QXSA 4WVFA 1JJVA 1QG2A 1II0A 3BK7A 3EZ2A 5KOYA 2FN4A 2ZI4A 3HPQA 1OPXA 1F60A 2ZJ5A 1NG9A 4AY2A 1HQCA 1R8SA 2EW1A 4WZ6A 3TVTA 4AC9A 3X2SA 4GI7A 4EJSB 5CK4A 2ATXA 1WA5A 4Q1EA 2ZU0C 3NEYA 1M7GA 4NDZA 5EE1A 3OHMA 1SXJE 5IDVA 2A30A 421PA 2A7QA 3I4LA 2ZM5A 2JDIA 2AXPA 1FP6A 4TLBA 1NJFA 3NXSA 1G5RA 4GSYA 2R65A 5EE9A 1QZXA 3BWDD 3SS8A 4DSTA 4M1WA 3Q9LA 2JJ1D 2GEVA 2G0NA 5CDFE 1Q12A 1PLJA 2QUZA 2R44A 5AJYA 2B6HA 2R2AA 1DPFA 1C1YA 3CZPA 1AK2A 1MR3F 3KQLA 5H70A 1UKVY 2J0VA 1TQ4A 2EFDB 2W2XA 2ZJ8A 3P26A 4MRNA 4P4UA 2FFQA 2OCAA 4JBXA 4RJLA 3R9IA 3THXA 1XB2A 3CZQA 5FPTA 2VQSA 1U2RA 4EAQA 3RS0A 1N5KA 4QGFA 2HCJB 2O8BB 1SVLA 1G7RA 1X1SA 2GAOA 3TW8B 1R10A 1DAFA 1W7AA 2LKCA 2YOHA 4YONB 3SI7A 1E2KA 1CJUC 2ZIAA 4GZMA 4I1OA 5TV2A 3O8RA 2REOA 1GNQA 1AKEA 3AGQA 5BN3A 1UFQA 2ZR9A 3LO5A 5IF9A 4LY6A 2WWIA 5H1YA 1GL6A 4PZZA 4DCVA 1U8AA 4AI6A 3BGWA 3IHWA 4V03A 1JXOA 2G9NA 1N6HA 4XVQA 4JL6A 5KHOC 2FFAA 2A3RA 5DLQC 1KJZA 2RGNA 3B9PA 5FUWA 5L3SA 4E03A 1J99A 1II9A 5JEDA 1OIXA 4JJZA 1XNJA 3DMNA 2OV2A 1KDTA 2R62A 5JRJA 3QKUA 1I2MA 4A0GA 4C9BA 3SJCA 1CKEA 1Q1ZA 4Z1MD 3PG5A 1FX0A 3FB4A 2XTNA 3LLUA 1NN1A 4TQAA 4TYQA 2IA5A 2GCOB 2JEOA 2YV5A 1S9DA 3RRZA 4WBSA 5JSZB 3W6PA 5J47A 4CEHA 4LHVA 4JVMA 3BB4A 1HY3A 3OE7D 1UDWA 3V9PA 8OHMA 2QMOA 4KHZA 5J40A 2J0SA 1KNXA 1US8A 3CWQA 4LC0A 5H68A 5DSZA 3PUYA 4RFSB 4RVCA 1O3YA 2OLJA 2ZSDA 1IN4A 3T34A 2ZREA 1N6IA 4A8JA 2Q21A 1NKTA 4JL8A 2ZRMA 4TMVA 4V0OA 4Q4LA 1EWQA 1COWD 4ZIRA 1LB1B 4WA7A 3NDBB 3H2YA 2QBYB 2Z4RA 1TX4B 3NHAA 4Y0VA 4UQOA 3LW7A 5J4YA 2KSQA 1NSTA 5K8IA 1E96A 2ZROA 2CXXA 2HF8A 4PAMA 4XTCS 2JJ2D 1VIAA 2VA8A 2EQBA 2KI5A 3K0AB 3GJXC 4BZXA 4N3NA 1E1RD 1Z29A 4D4JA 1BMFA 2ZJ2A 1NKSA 4KVGA 4ESVA 3WYAA 2XJ9A 2QTFA 1TF7A 3TUZC 3Q5EA 3P32A 1E2DA 2IWHA 3U44B 3G82C 2TMKA 2BIFA 2CVFA 2ZI3A 3GCGA 2JATA 1U81A 1TUIA 4NP6A 1OIWA 1ZUIA 2IX3A 4C0SA 1NG1A 1W46A 4JJKA 4BFXA 2ZI9A 3W9YA 2WICA 4BLQA 3AP1A 4E07A 3ZVNA 1GM5A 2C78A 5FBQB 1OFUX 4BWYA 3MSXA 4AYXA 1DS6A 3IO3A 2BV3A 2ORWA 3FKSA 1KI8A 2UZ3A 3ZIAD 721PA 1JI0A 3CRMA 3OZXA 5SZIA 4PTLA 4HDCA 5E3HA 1IY1A 1KI6B 1VIYA 4FXPA 4LBVA 4RD3A 2GVZC 1XJCA 4POAA 2VF8A 4JYBA 2D2EA 3W90A 1IN5A 4B33A 3HYRA 2CMKA 2O0JA 1XZPA 3U7HB 4EPWA 2V55B 3K0FB 1B0UA 5KSYA 3OEHA 3PITA 4OL0A 1XF9A 1FMLA 3K9NA 2IYSA 1GIAA 4XVRA 5JRZA 3DKPA 1JR3D 5CDFA 4B43A 4D26A 2YJTD 3ICQB 2P5SA 4DVGA 1FPMA 2ZVPX 4F92B 3LLMA 1EX6A 1NLYA 3SHFA 3UMSA 5FTJA 4K8OA 1F2TA 3TH5A 2QPOA 2QP3A 1R5BA 3AP3A 4ZV4A 2GWHA 4KFTA 1G17A 2N42A 4A0HA 3VMFA 4JSTA 4KBGA 5JWOA 2IXEA 5DI3B 3T15A 4TLCA 4GNKA 5DYGA 3PUXA 3R8CA 5JSZA 5LD2B 4LJ7A 3GLFA 3GLIA 2HXSA 3WY9A 2WWXA 2VTKA 3SU8A 3A58B 3DM5A 3IUYA 4Q66C 3WMEA 4L9WA 2XX3A 4I1SA 1JPJA 3VR3A 4JLBA 1QG4A 3TNFA 3VKHA 4DBLC 1YR8A 3ASYA 1LF0A 3IEVA 1AS2A 2IC5A 2OBMA 3UMFA 3PEWA 1AZSC 4EJSC 5FOUA 2J1LA 2RH5A 4AG5A 3QKSB 4PHGA 2F7SA 3QEOA 3QUSA 3MCAA 4G5SA 1W48A 1KSHA 2GESA 2W6JD 3NDPA 3SQWA 3NBXX 4ZO4A 3FWYA 1MH1A 4UKDA 2NG1A 3LXXA 1ZUNB 3VU9A 3WMFA 1SVWA 2EVWX 4XWAA 3QPWA 1OYWA 3B8HA 2ZXUA 1IONA 1H8HD 3IDQA 2ZRNA 1NVWQ 2EFHB 1Z0JA 3RAPR 4Z51A 1ELOA 2A9KA 1ONBA 4CVNA 1FTNA 4L16A 1IJFA 2VSXA 4A2PA 4DCNA 1G20E 4NONA 4LV5B 4AKEA 5KPJA 4FMBB 4AIIA 2WKPA 1NVVR 1JAIA 4TQUS 3F5FA 4D4KA 3ONWA 2FV8A 4OHXA 2CLCX 1U94A 2FJUA 2XNDD 4MYUA 2XXAA 4JBWA 1Z06A 1N0VC 3KFXA 3AVQA 4PSAA 4YMVA 3THWB 2IYLD 2JLWA 4H1UA 5L3QB 2FSGA 3U7FB 1G6HA 4BFUA 2IUSA 1VG0B 1XXHA 2DWOA 2PCJA 3MJHA 4B3FX 1M7HA 4HUQB 4HZIA 4P0TA 1VPLA 2PJRA 1UKEA 2MMGA 1ZNWA 1T0JB 2RHDA 4S35A 1DAEA 5CJ2A 5FUYA 3LX5A 2BBWA 1EGAA 2V3CC 5AUOB 4M53A 4Q7LA 4NMMA 2NPIA 1ZNZA 2GNOA 2YVUA 4O0MA 3REGA 4HAWA 1PZNA 2N1BA 4BFSA 1T0HB 4BEJA 1CULC 1R0XA 4MKIA 3MD0A 1G7TA 4F4IA 1VHLA 1OIVA 3BD9A 4ZCIA 4AYWA 5LD2C 4GL2A 4HUQA 3J81k 4LZZA 3RRNA 3DM9B 2O8CA 1DTSA 1NY5A 2WIAA 1UBFA 1OB5A 1SVIA 2GETA 4UJ5A 4DDUA 4W9MC 2NO7A 2RGEA 4Z54A 5K8TA 2VBCA 1QVAA 4AWXA 1P75A 1X6VA 2IW3A 3B60A 1XD2A 5JI3E 2D4HA 4YDHB 4OI4A 2BDTA 5B30A 3QXCA 2YWGA 1SKQA 3OEED 4AKHA 3K0FA 4XSGA 4TYWA 1Q22A 3GMTA 3K0SA 3VU9B 4FCTA 4CGZA 5JS7A 1D5CA 1DADA 3H86A 4LJAA 1KI4A 4A6PA 4C3ZA 2ZE8A 2GJAA 1IY0A 2A2ZA 5AWFC 1X3SA 4P32A 1KNQA 3DOFA 4BGDA 2GZDA 3A1VA 4M4SA 4W5WA 1YZKA 3HU2A 2R6FA 1BO6A 4NCKA 3EX7C 4G5OA 4DRZA 3HDTA 1UPTA 4NZYA 3U61B 2XXAB 3NEJA 1VG9B 4P4SA 2QZ4A 5EZ5A 3THWA 4HDOB 4DLTA 4KVAA 3GJ7A 4HAXA 4JT2A 2WWGA 2ZE7A 3OE7A 4YMSA 4YXWA 4BLTA 4UNNA 1W36C 2V1UA 4PHTA 5DN6D 2H17A 3QKSA 4TL9A 2H18A 4EFLA 3HP1A 1NIJA 3EZ9A 1ZIPA 3QKTA 2WBLC 3P4YA 5E7IA 1M1YE 3SBDA 1SHKA 3QG5A 1LS1A 1J8MF 5EP4A 5GADl 4P3YA 2AR7A 3HU3A 2HJGA 4F38A 1PUIA 3RSOA 3AUYA 4PAOA 3TK1A 3V4FA 4C0KA 2RGXA 4A0RA 1ZINA 1W47A 4RZ2A 3FVQA 3H0KA 1NLFA 4CEJA 5IT5A 3Q5DA 5SZJA 3W5JA 1DE0A 2X2EA 1S4QA 2V4ZA 1BYIA 4ITRC 1U9IC 4RFVA 2O8EB 4DCSA 1XEXA 2QGZA 1QHXA 1W0KD 2WOOA 5J5CA 1MABB 3D3QA 4Q4HA 1D9ZA 4CEJB 2OCYC 2IUUA 2O8DB 3V4RA 4PFSA 5EZ6B 5AUPB 5HKKA 1T5IA 2V6IA 2PH1A 4EQ6A 1CU1A 2DHRA 5EXXA 4XOIA 2REBA 1TUEA 3O47A 1VKJA 1WRBA 1AGRA 2JGNA 5JZVA 1G16A 5EP3A 2EWWA 4A1FA 5F98A 3GJ8A 4PPGA 1NP6A 4JVNA 2GAAA 2VSFA 3AF1A 3RDPA 2ECKA 3CX8A 5J4VA 1LVGA 2OG2A 5FTMA 3C4JA 3OFND 2IF0A 1HQYE 1KI1A 3DL0A 1OXVA 2AKYA 2YWHA 4IOLA 4JVSB 2XZLA 4U02A 4HDQB 1NY6A 3EW9A 1XPUA 3VNVA 3DKVA 2AFHE 2PL3A 4NL4H 2OFXA 3SN6A 2ERYA 4BE7B 3Q7QA 1TQ2A 3KJGA 2XGJA 1Z2CA 4TLDA 2ONKA 1KSGA 3C7KA 1DO0A 4Z1MA 4PR0A 2QG6A 5DH9A 1W36D 3NVAA 1OFTA 2QROA 5TARA 4B35A 2WM9B 2ZI5A 2FFHA 2GK7A 4KODA 3VHLB 2C9YA 4C0HA 3X1DA 2EFGA 1E2JA 4Z8YA 1A2BA 2CNWD 4US0R 2WSSA 1CJTC 4BASA 4HLQB 4CIDA 1D2EA 5EJEA 1G3UA 4ACBA 1E0JA 2WWHA 3SQXA 1XRJA 5DHAA 1GVNB 1H8EA 1ZD1A 2A5YB 3PXGA 5IK2D 4KSCA 2A78A 2O0HA 4C2UA 5FI0B 3RRYA 4AKIA 3BC1A 3RNLA 3CUEF 1ZVQA 3AVPA 4QBHA 3WNCA 3ZDQA 3GLFE 1L8QA 3GLIE 2VEDA 1GRQA 1LFDB 1U0LA 3L2OB 4Q02A 3SZRA 3WYGA 4B75A 4URXR 4KYUA 2J7PD 2H1LA 3CX7A 4NCJA 1TQ6A 3HR7A 3W8NA 4URUR 3K70B 2F1JA 4GPTA 4PQFA 2WJHA 3TR0A 1IM2A 1NN5A 5BWMA 1SGWA 2OAQ1 4M1MA 1KKLA 3IIKA 5DN6A 1XTKA 3U2QA 3OESA 3PEUA 2PX0A 2ATVA 3FDIA 1IAQA 3T1QA 3PVSA 2VP5A 3L82B 2ZE5A 5HE9A 2XJ4A 4O25A 3QBVA 4ARZB 2JLXA 4OHZA 5GJWC 5FL7A 4JSYA 3MAAC 3CBQA 1GP2A 3E5HA 3B1XA 1XMIA 4LYAA 5FTLA 4LUCA 1UJ2A 2QTVB 4Q21A 3H1TA 1Y63A 3RS3A 3WXMA 2GJ9A 1KY3A 5JFGA 1VYUA 1YQTA 4IOKA 5FI1B 5BQ5A 1ZC3A 4LC1A 1RRCA 2PT7A 2QRNA 3OIYA 3I5YA 1E1QA 5BXQC 1ZM7A 3RABA 3A8TA 1KOFA 2FGJA 2X2FA 1JQJC 1XTJA 3N2IA 1OW3B 1T3LA 3B1VA 4GZLA 1QF9A 3CW2A 5KDDA 3AKEA 1RYHA 3JVUA 4UNPA 2IK8A 1I4TD 2WZQA 3A1UA 5CIWA 3MG9A 5AUQA 1KJYA 2IEZA 1NMZA 1AQUA 3B1ZA 2Z83A 2CK3D 4OQMA 4XH9B 1CF4A 3VAAA 3G0HA 1AIPA 3U4QB 1WP9A 4MITA 1AQYA 5FL3A 4D6PA 3GPLA 5IHPA 4NCIA 2QAGC 2ZEJA 2DR3A 4QXAA 3RANA 1D2MA 3KKQA 1SKYB 4LV6A 4PZYA 4BZQA 3ND9A 1E2IA 4TTQA 1UAAA 3IPYA 2R6GA 4O2LA 4ZI3A 1DAGA 4M21A 1E0SA 2IYUA 4KV9A 2CL0X 2FA9A 1CJMA 4V0MA 4QBIA 4ZCMA 1T6NA 3NH9A 3IBYA 4Z8XA 1Z6AA 1TPZA 1LV7A 3CRVA 2AFIE 1F5NA 2AWNA 1YR6A 4MH0R 4BLOA 1X1RA 2QP4A 1SXJC 5J4KA 4PANA 4YMUA 3AVWA 2C04A 3ZS8A 5CM8B 2AL7A 2JIZD 4BRWA 4B76A 2YC4C 1RRGA 1G19A 2QY9A 3CNLA 1Q57A 3QPUA 1Z3IX 2C77A 3LV8A 4DZZA 4O3MA 4IVPA 5KYKA 4OQNA 1ZU5A 2OBLA 1VG8A 3VFDA 4M9QA 1SULA 1EFTA 1II8B 2ZTSA 4A2QA 1JBKA 4A6XA 1DELA 2HF9A 1NLZA 4IW3B 3RVBA 3EZ6A 4G01B 4QBFA 2ZUCA 3SE0A 3ZQJA 1E79D 5FPYA 3K9LA 3VNUA 1TEXA 1Z22A 1IOZA 2GILA 1J2JA 4B6FA 4ON9A 2PJZA 2XNDA 1N0WA 3ICEA 3L8YA 1W0KA 1CR4A 3EWAA 2DBYA 1R5OA 2V8OA 2FMXA 1Q3TA 2R8RA 3B82A 2ZSFA 1P2TA 1CS4C 3EA5A 2JDID 3U7EB 2FX3A 1IQPA 2OLKA 2ZR0A 2ZYTX 1KK1A 1LF5A 2IS4A 2VO1A 1KY2A 1MT0A 3A4NA 1PLKA 3K9GA 4JLDA 3SFZA 5ELXA 1JECA 4Q1DA 2HLDD 1S1MA 4PC2A 4B47A 4DKXA 4LHWA 2FWRA 1YU9A 2GJ8A 3JZAA 2IHYA 4BZPA 621PA 1TAGA 4WW0A 5LPNA 4A92A 4Q4JA 5IRCD 3D6TB 3TQFA 5IK2A 4NYIQ 3KL4A 4BRUA 4BFTA 2HT6A 1PV4A 2W58A 2BMDA 1WMSA 1KYIA 4Q7KA 1W2HA 4FD2A 4B3DA 1E9RA 1KI7A 3K0EA 2PZGA 3QKRA 2CCGA 1ANKA 3LAWA 4HB3A 4BFVA 1Z0AA 3A1TA 4WZBE 2C8VA 3RHFA 1KO4A 5FOWA 2F1HA 1BOFA 1HT2E 1E9EA 2EWVA 2GCPA 1FNNA 2OFWA 3EC2A 3ZS9A 1W49A 4D25A 4NCNA 4GOJA 4MUAA 5FTNA 2C95A 5G40A 2BC9A 4LCBA 1G8HA 4JLPA 5GJCA 2R6DA 3WHLA 4B2IA 4E5UA 2CJWA 3Q72A 3ZVMA 2CLDX 2XEXA 2HJVA 3VR2A 1TADA 2QE7D 4US2R 5C18A 2JJ1A 1E4YA 3FMIA 2P6NA 4P33A 4IKEA 3ZQ6A 3UWKA 1IN8A 3EIEA 3KKNA 4O2RA 4PX9A 3ASZA 3NG1A 1E1RA 2OBNA 3CWZA 5D3QA 1DOAA 4DJTA 1OXTA 5JS8A 3KTAA 1E1QD 4JLVA 2JJ2A 2J0QA 2ZSAA 4OI0A 2AKAB 4Q9IA 1XCMA 4WZAE 1G3QA 3W34A 5KSZA 1U8ZA 2ERXA 1J8YF 2ZRKA 4F4JA 4DSUA 2EU8A 1ZW6A 4MKGA 2PCLA 3DPUA 5D3MA 4D0GA 3A37A 5TVKA 3S1AA 1WCV1 2PT5A 2BMFA 1Z6GA 3QY0A 2W6ID 2F43A 4TMXA 1ETUA 2IWRA 4G5RA 2OXRA 3UG6A 1KSJA 2VSOA 4HAZA 3VR5A 3LW8A 4CEIA 2B8WA 1UKZA 5B64A 4EPXA 2CLSA 4CT5A 4Q9KA 3T06B 2DYKA 3T1VA 4MGYR 4N0DA 1YR7A 2XOKA 5FOSA 1W4CA 3R7WB 1QHGA 5EUQB 4PPQA 1TF5A 2J7PA 4Q9HA 2ZANA 2N46A 4XJXA 3FPAA 1RJ9A 1HE1C 3MWKA 3QF7A 4JKYA 4HLUA 1KZ7B 1GUAA 4HLUC 4EJSA 3CR7A 3F3YA 3QEJA 2ZRHA 4C0BA 2JCSA 2EFCB 2WAYA 3BFXA 1HYQA 1KAGA 1QRAA 1F2TB 2FEMA 4KSBA 5C4GB 1P60A 4R71A 4XWOA 2GXAA 1Z0FA 2EFEB 3H84A 1YRAA 1YZQA 4HB4A 4LHYA 5M04A 4NHOA 1F2UB 1KSFX 4URZR 2ZSBA 4DDTA 5JHGB 5JLJA 2YNMA 3BXZA 2QQ0A 4V0NA 5G3YA 5CITA 1L4UA 3Q7PA 1KMHB 3AVVA 4W5HA 2RGDA 4KCGA 4P31A 1K5DA 4PSVA 5E4FA 2V7QA 5G3ZA 3LXRA 2XTMA 2Z43A 1A7JA 3W3AA 1E69A 2ZRAA 1J90A 1DO2A 2IYXA 2WJVA 3IQXA 3QG1A 3SOPA 4ASUD 4UXJA 2CEAA 2I3BA 4TL7A 3ADCA 3EWSA 3F8TA 4NE2A 1KK0A 2Q9AA 5FL7D 5KDLA 4DUGA 4XD7D 1UM8A 4A4DA 5F3WB 1QHHB 1YE8A 2GTPA 5KSPA 2REXB 2VYFA 3EZFA 1ESMA 1N6KA 1W1WA 4PHFA 1BMFD 1Z28A 2W0MA 3M0EA 5FR1A 5DI3A 1FOEB 2BM1A 2X77A 4K81B 1MO6A 1DG1G 3U3RA 4KI0A 4LX0A 4OQFA 3K70D 2FOLA 4HB0A 2ZRPA 3KQHA 1A2KC 1XJ0A 4QHSA 2QP9X 4EKDA 4QRHA 2RKOA 3M6AA 5JWHA 2L0XA 3CRQA 3PENA 1F3OA 2DFKB 5L3RA 4UXIA 2WPDA 2BMEA 2PLFA 1ZD8A 1NN0A 4W7SA 2CDNA 4L5BA 4Q47A 4X8HA 3I8SA 5GJVC 1E9BA 4JBYA 3RS5A 2ZR7A 1A4RA 2VL7A 3QENA 1TU3A 1WXQA 4D0LB 2HUPA 1CXZA 1Z08A 1G8FA 4JLOA 4GOXA 4EIWA 1GL7A 1UEIA 3CRRA 1S8FA 4IVQA 5AJWA 4DB2A 2RGNC 2FPLA 5HCNA 3GP8A 3LFUA 4C0AC 3AF4A 3AEZA 2VIIA 5DHFA 5DISB 3RC8A 1GNRA 2KBEA 4LJ8A 1RFLA 1OV4A 1VECA 3ADKA 1G21E 4KO8A 4RD0A 3KUDA 2OHFA 1FNMA 2R9VA 3SYKA 2NPFA 5EE5B 2XAUA 5SZKB 2BHRA 4UNRA 2WWWA 3GLGB 2QL6A 3GJ3A 3U5ZB 3UK6A 1OFIA 1JEEA 2OM2A 3I73A 2LWIA 3KB1A 4D81A 1VCOA 4Y0AA 1W5SA 1LNZA 3WYFA 2CNWA 1XEFA 2C9OA 2G77B 4GDFA 2GDJA 2F6RA 2H92A 3L0SA 4PO8A 2H8KA 1E9CA 2QAGB 1P72A 4NH0A 3U6KA 3GEIA 1FFHA 5DIFA 2ZJOA 2VHUA 2AWOA 2O8FA 2O52A 2WPDD 4ASUA 1G4AE 3P4XA 1KDRA 5HKKD 2ZPTX 3PCRB 3T1OA 3CF0A 1E2MA 1XMJA 4B74A 4OJQA 5JMTA 1R5NA 4HAYA 1YZUA 3FHCB 5BN4A 2ZU6A 4E09A 3NBZC 1OHHD 5EE3A 1J7KA 4MGKR 4DWJA 2NTYC 2D7DA 2CCKA 2ZRFA 4QGGA 2IYZA 2VLIA 4UJ3A 1U98A 3CF2A 2QE7A 2IL1A 1PLLA 5A5GA 1NBMA 1KI3A 2BCJQ 3PR1A 1W4AA 3EPJA 2ZI7A 5BYJA 3BH7A 5DE3A 1YR9A 1P73A 4LRWA 1VYVA 1E2EA 1SVKA 3C14C 5CJPA 1AZTA 3HJNA 2FPKA 4OQLA 2H5EA 2JAQA 4U7DA 2MSCB 1A5TA 1FUKA 2GK6A 4WXPA 1NL3A 3EC1A 3LY5A 2P3SA 3WNDA 4BPBA 2RMKA 2I4IA 4QHYA 1NJGA 1VTKA 4P4TA 2QBYA 1E94E 2ASEA 4ZI2A 1Z0KA 3Q8XB 3VKWA 1OJLA 2D7CA 2XITA 3PEVA 2IS6A 4W5JA 1JR3A 3U3MA 4GRAA 4YXWD 3B13B 4ZDIA 3TAHA 3A36A 3KKOA 1JPNA 1DAIA 3DZDA 1VMAA 3B85A 4LWZA 1Z0IA 4RY2A 3W6OA 4LJYA 1HH4A 1MRNA 1TNDA 4NYMQ 4QNRA 2JLQA 2J46A 1XX6A 3AVXA 2QEQA 5JECA 2GJSA 2AX4A 3GLGE 4WOPA 1DEKA 3BE4A 2Q9CA 1P5ZB 2VP6A 4PPFA 3QJYA 1KI2A 4B2LA 4Q1AA 1XEXB 3THYB 5J4HA 1UBGA 1OFHA 4LI0A 5DGXA 3ZYCA 1XDBA 3GJ4A 1Q1EA 1ZM2A 1KK2A 1DAKA 4B32A 1MOZA 5KSOA 5DYIA 2AN9A 3L8ZA 5JJIA 4FMDB 1OXUA 4NU0A 2QM8A 3KXKA 3KB2A 4PC7A 4IDPA 3NTUA 1NVUQ 3M4YA 2J59A 1ESNA 2PZEA 4RSGA 2OCBA 5FUVA 4D0NA 3PIRA 1JB1A 3C15C 3X1XA 1HEIA 2FU5C 3WP1B 4LBYA 1XJQA 2P2LA 3I5XA 1RJ9B 5HZKA 4DLWA 2QPAA 2QQEA 1Z5ZA 5HE8A 2A5FA 3ZVLA 3P20A 4F7WA 2NO6A 3N2EA 3PQCA 1NVVQ 1SXJD 4L4UA 4RZXA 5TY0A 2C2HA 5JBQA 2QPTA 3RYTC 4Q4HB 2GCNA 2V54A 1R2QA 4JS0A 4F4CA 3QXJA 4IDOA 4XD7A 4IFEA 4OI1A 3D8BA 3QPVA 5FPSA 4D80A 3F0TA 4GP7A 3TAUA 3RS2A 5KNBA 2VPPA 4RD4A 1OKKA 1Z63A 5KDOA 4CDGA 5LBIA 3V00A 3D7MA 1RZ3A 1G9XA 1Z6XA 2IYRA 2OCPA 2X1VA 2GXSA 1KK3A 1XTRA 1T3HA 3BFVA 3OAAD 2P67A 1J70A 1U0HC 1SHZA 3ZZ0A 4TT3D 3UXMA 4M1YA 2J45A 4PQYA 2IYWA 2VP0A 2WAXA 2JLYA 3IO5A 1G4UR 4XTRA 5FBRB 3ZZTA 3R8FA 2ZI6A 3DDCA 1GZSA 2I1VB 2ODEA 4IJMA 4YMWA 4M22A 1QHHA 1AM4D 4BLPA 3LH5A 4I81A 2FSIA 1N5IA 2PZFA 4M8NE 1PVOA 2NOAA 1N0UA 1FMJA 2ZRJA 4TYYA 2WJGA 1W0JD 3LD9A 3SBEA 1KO5A 3K09C 3EG5A 1IXSB 3AGPA 3IEUA 1E79A 1Z6YA 6Q21A 3GFPA 3KDSE 4QOSA 3NC0C 4BEBA 2LKDA 4GP6A 4FIDA 2BMJA 1YZGA 4NYJR 3TJZA 1N5JA 4QJ3A 3O8CA 2LCFA 2XTZA 2FEOA 1OE0A 1Z07A 4RKEA 2WTUA 1FL9A 2W00A 2C96A 3GD7A 2GZHA 4ZIRB 4LYFA 4QNMA 2RCNA 1VYTA 1GSIA 3TKLA 4JZKA 1XXHE 4OI2A 2CHVA 1CEEA 1P7CA 1YHNA 2DCUA 4Q9JA 1TF2A 4A0FA 2OO7A 1B23P 3K0AA 1YJ5A 2FDCA 1L4YA 2BVNA 1AN0A 1KO8A 1KDOA 4ACAA 2RHMA 2XB4A 4Q18A 3IHLA 3SHWA 2F3TA 2ZSEA 5FBWB 4HAVA 1KMHA 2PEYA 5K8UA 4DHEA 1JR6A 3FHOA 4RD2A 2WKRA 1EFUA 2ZRIA 4OHWA 3T5DA 4D4MA 4R2HA 4TMKA 4RD1A 4B3XA 1Q44A 4QM7A 1NN3A 1ZU4A 3VR6A 4K46A 3ZZUA 5L3QA 4OK3A 1GG2A 5FUXA 3UANA 4BQSA 2JIZA 4FCWA 1M34E 2KB0A 1LTQA 2OAP1 4C30A 1NBME 2PMDA 5AK0A 2ZS9A 4QGAA 2QAJA 4WXRA 2WVJA 5KNCA 4B48A 1E0AA 4R98A 1EFHA 2WWFA 2ZAMA 2OFOA 3B1YA 4FMDF 3FOZA 2ZRGA 4LPKA 2ZRDA 3KKPA 1NMXA 1FUUA 1HUQA 4V02A 2R6CA 3GJ0A 3GLFB 4LJ4A 3GLIB 1XD8A 2SHKA 5JCZA 5DI9A 4RKFA 4G0NA 4LPSA 4NYIR 4MRPA 4IDQA 4CEHB 3QF4B 4MGZR 2IF2A 4JLJA 4OBEA 1RRPA 2BJVA 2EYQA 2OESA 4QKQA 4HUTA 1QHNA 2J7KA 2Q0HA 2QSYA 3W6NA 4M9ZA 3FE2A 2JLZA 2J41A 5EXSA 4DB4A 4HI0E 4LV8B 2CK3A 3RSLA 1KDPA 1MO3A 2OE2A 3WBKA 1Z6TA 2F3RA 1ZD9A 1X86B 2FSFA 2FZ4A 1MO4A 2FPMA 3B78A 1T3SA 1FQKA 4G5QA 3OFNA 4LJ6A 2Z4SA 4QGHA 3K9HA 4AKGA 2DWQA 1E9DA 3TMKA 3MWYW 4NYJQ 3DZ8A 2BBSA 3PUZA 1N6OA 1X8JA 4PQRA 3SYLA 3PJRA 2VHCA 1VCMA 2QT0A 2UVQA 2ZETA 2ZJAA 4Q7JB 5FR2A 1ZM3A 3SR0A 1XPRA 2Z5FA 3IKJA 4M2LA 4Q01A 3ZGXA 1VG1A 4AK9A 2GKSA 5KPDA 3TGPA 1YZTA 2NMVA 1CR1A 4IEIA 1H65A 4LHXA 4OHYA 1P9WA 3B2EA 1G5TA 1GILA 4Q19A 1Q3HA 1E0KA 4PO1A 3SDZA 4B6EA 3QBTA 4B3BA 3FFBA 3LWNA 3SJAA 3Q3JB 4LSGA 3NIBA 5G53C 1I4DD 3PV0A 1IN6A 2VP2A 4EUNA 1W0JA 2DFTA 3A1SA 3RRMA 1UBEA 2IXGA 1KZGB 2E1RA 4ERNA 4GBMA 3NBFA 4PC6A 1E2QA 4IVRA 1VCNA 4URVR 3MWLA 4M9XA 1QHYA 4WIAA 3NC1C 2IS1A 5LB2A 3RS7A 2B8TA 1YVDA 3KZ1E 1UKYA 3JVVA 3OF5A 2O8FB 3BS4A 1K5GA 2MSEB 4HEJA 3THXB 2F1RA 3ND8A 2QORA 4IOMA 1S9HA 4XIGS 5KNDA 1EESA 1SXJB 2C99A 5P21A 1D2NA 1PUJA 3LBHA 821PA 1M8PA 1WDTA 2VHJA 4B3GA 3A4MA 5KUTA 4CF7A 4H1VA 2V6JA 2OUKA 1TTTA 2ZVQX 4XWKA 3DHWC 1LY1A 1MRSA 2F43B 2XB2A 1GWNA 2KWIA 5FPHA 2FF7A 1W2GA 3K09A 2F1IA 5HCIA 3VQTA 1P4SA 3CO5A 2CHGA 2QA5A 4A8JC 2D2FA 1XD2B 1S0UA 4G5GA 3RS4A 3CNOA 1S3GA 3CLVA 3GQBA 2CVHA 4I1UA 4IXNA 1E9SA 3FMPB 1U99A 2E87A 3KXLA 2QU8A 1QHSA 3RWMB 2FFBA 4TT3A 5B57C 1NF3A 2I1QA 1ZMXA 4BUJA 1N25A 2GBLA 1G8YA 3FKSD 4U5XA 1XPOA 3MWJA 1JAHA 2WSMA 1FQJA 3QNUA 1G6OA 4RZUA 4EPYA 4F93B 1WB9A 2J5XA 4KLNA 5CB6A 5TMPA 5EP1A 1GL9B 3SJBA 1YRBA 3ECCA 4FCVA 3KX2A 4DC9A 2NGRA 1US8B 1UF9A 4UNSA 4FMCF 2MSDB 3TSZA 3WBJA 1ZAKA 1KI9A 3U3JA 5TDHA 2F55A 3FKQA 5CK5A 1C9KA 3K8YA 3MFYA 3AV0B 3TLXA 3K70C 4TN1A 5F2EA 3E2IA 3TW4A 4EDHA 2ZJZA 1A82A 2P6RA 4MUBA 4TYNA 1P2VA 1KAOA 2BEJA 1G1MA 4LHZA 1XD9A 3L0PA 1E4VA 1FTSA 1Q1BA 2ZJBA 3KKMA 4KU4A 2P0EA 4LJ5A 4OK6A 4UXHA 3UG7A 4FINA 5AR1A 3EA0A 2Q6TA 5FBVB 5HZHA 4DXAA 5JI2E 4JYCA 2W0SA 4EFMA 1CLUA 4TWZA 5C2JB 3FHTA 4QL3A 4U00A 1R0WA 2WHXA 1XXHB 2GF9A 2QMEA 5TB5A 4FWIB 1W4RA 2V1XA 4GT1A 4GFDA 3CB4A 5KU1A 3A6PC 5E7MA 4TL6A 4X8OA 3CIOA 3GEEA 1HV8A 4GMXA 4MYHA 2FSHA 5B58C 3AF0A 2NO9A 2W6IA 3A1WA 4OQXA 3HU1A 4UNQA 3L0OA 1E99A 1IN7A 5E95A 4B34A 4DIDA 1ZUHA 2ZRCA 1EFRA 5C46F 3AVUA 3ZD6A 5JWRA 4OKSA 4TMZA 3RWOA 1XTIA 3B9QA 3KXIA 4F91B 2Q9BA 4DEXA 2HYIC 4MDFA 1Z83A 1OYYA 3RC3A 2XZOA 1RKBA 3TUJC 4MA4A 4MYCA 3LBIA 1G3RA 1XMSA 3I8XA 1S1CA 4PXAA 2QAGA 3VX3A 3CH4B 4TL8A 1FW6A 4FW9A 4LBWA 4DLXA 1N5LA 1H8ED 4RZ3A 5F9HA 5AJZA 4D82A 1U9IA 4NKRA 4QBGB 1P61B 1VHTA 1WBBA 3C8UA 1G41A 1U0JA 1F2UA 4TLAA 2JA1A 1GNPA 2YKGA 3NH6A 4TMWA 4C2TA 1G5PA 2J9RA 4GMDA 1MO5A 3OEEA 4Q03A 3R7WA 2ZQ5A 3BRWD 3TVDA 1OLOA 3AKCA 3Q85A 1E2PA 4C7OA 2JLSA 1EX7A 3P1JA 4ESHA 4DLUA 2IYVA 2QMUA 4EFNA 2PBRA 2V7QD 5L3SB 2OT3B 3WHKA 4OK5A 1GITA 2IS2A 2CL6X 4ARZA 3BB1A 1T91A 3AB3A 4KFUA 2RGCA 2IHBA 5SZHB 1YKSA 4KFSA 2ZAOA 4PSKA 3CR8A 2W6JA 2O8CB 1BKDR 1BS1A 2FG5A 2GBLC 4IOJA 3LRPA 3FYHA 5EQTA 3CKLA 1JQLB 3AKYA 3TSWA 1EXMA 1E2NA 1KHTA 4RD6A 2YYZA 1R0YA 3BB3A 3CF6R 4AYTA 4EQ6B 4RCZA 2IUTA 3A4LA 3OEHD 1TMKA 1P6XA 2NZ8A 1XCPA 1MKYA 4DIEA 1SVOA 5DNYB 4CZ2A 2YHSA 4P4SB 4ZKDA 4YDSA 2B7CA 2DFLA 3QKRB 4R9UC 5FBLB 3AF2A 3U60B 1P2UA 1RW4A 2JJ8A 3OAAA 3WMGA 4BECA 2NIPA 3KJHA 4HLCA 2KE5A 2JLUA 2HYDA 4M1KA 1EWRA 3DOEA 2YZ2A 1FX0B 3TE6A 1KGDA 4KXFB 3E70C 4I1VA 3UMRA 3X1ZA 4ZPXA 4MYTA 2WV9A 4WAUA 5FH9A 1KO7A 4I99A 3QVVA 4QJ4A 4YMTA 2CJWB 1T8TA 2BCGY 1I4LD 1Y3AA 4N0EA 1SVMA 4PZLA 4G1UC 4KFRA 2DWPA 3U44A 1XMVA 1L7VC 3FFAA 4IFBA 3LQQA 4PHHA 1ZRHA 2G6BA 4JKIA 4Q48A 2D06A 1G18A 2NZJA 3GFTA 1SVSA 3GFOA 3TBKA 3AQ4A 1G3MA 4KYIB 4HZUA 1Z2AA 3QVUA 4LYHA 5CM9C 3T12A 4EPVA 1AA9A 3FGNA 2B21A 3CPJB 2J0UB 3ADBA 3AVOA 1MABA 3GLHB 4OYHA 1XEWY 5HPYB 1COWA 2O8BA 4Q1CA 1ZC4A 2YINC 4ZDWA 4M1TA 4NYMR 2O8DA 1NMYA 4LOAA 1CR2A 2GJKA 3HWSA 1ZYUA 4FWTA 1GDDA 1II8A 1DVRA 4KJZA 4X8LA 1U90A 2WIBA 2PLRA 4X8MA 1N6PA 2IYQA 3NHBA 4URWR 4H9GA 5LDDC 4QFMA 3QQ5A 1P9RA 4XSHA 2FZLA 4E22A 1R6BX 5HTKA 1CIPA 4Q1FA 2D74A 1E2HA 2H7VA 4QJ5A 2P5TB 2CE2X 3THYA 3AKDA 3DO6A 3ETLA 1NVXQ 1XFAA 2WKQA 1G7CA 3KQKA 2P65A 2HCBA 1RYFA 2VF7A 4L8GA 1T9HA 5B2ZA 3L43A 3I61A 1EK0A 4B3CA 1G64A 2CE7A 1JXMA 1ZM4A 1QDEA 1WQ1R 2Z6VA 2A5GA 4I4LA 5FOVA 1OB2A 1T5LA 2G0TA 3B5JA 2JLRA 1OXXK 4HLDA 4DLZA 5BW8A 1F6BA 2H57A 4US1R 2BWJA 3HYTA 2CCJA 2WSSD 3IGFA 1NNEA 2J87A 4A9AA 2QT1A 1GTVA 1OXSC 3LVRE 1JALA 3AP2A 1XTSA 1BYUA 4A2WA 4KBFA 2GEUA 5CLLA 2Z0MA 3JZMA 4LDJA 4TLEA 3ZD7A 3ZH9B 1GKUB 521PA 5DO9A 2IT1A 3KJIA 1JJ7A 1NRJB 4NCHA 1SZPA 2WJYA 3KTAB 2GHIA 2FE4A 1AS3A 4TSFD
chains in the Genus database with same CATH superfamily
1G3IA 1RPNA 2OZEA 4II3A 3TTUA 3AFGA 2QM3A 4FHCA 1JLHA 2W43A 5ALKA 3IV7A 3K6KA 4LXQA 2F3UA 4LRTB 1NGSA 1AKTA 4XWWA 1L3BA 2RJ3A 2WYWA 4JLMA 2DSTA 5TPWB 3O4IA 1O8BA 1RU3A 4G0OA 1NUQA 3TZHA 1J2EA 4IX1A 1M7BA 3K1ZA 4JT4A 2XVMA 4JOSA 4GC9A 3N2KB 2D2VA 4HVCA 1QK4A 3PKJA 1LDYA 1PTJA 4XQ9A 2C7OA 1EDZA 2J3LA 3MT0A 2H2DA 2HSJA 2QD1A 4F8YA 3KJXA 3M1IA 3CVJA 2ZFUA 3L0DA 1BA2A 1ZP6A 5LZ7A 3ZY4A 1JEYB 3C5CA 3DQQA 4RFSA 4XB6B 3BHIA 4FC6A 4R8LA 5HS6A 1LS6A 4YQEA 4AURA 3EVCA 3JYQA 3N7AA 3L1UA 1PNRA 1UADA 4A8JB 1MAAA 1E1KA 2GPTA 1ZO8A 2N1MA 1UBMS 3OJXA 4BJHB 4UMDA 1JEDA 1E98A 3FSJX 3PVZA 4FX2A 4MDYA 2HPZA 3FNHA 1BFKA 1DQRA 2B37A 1EFCA 4KITB 4X3OA 5A7HA 1SOWA 1TM3E 3TRKA 4ZQHA 3DMDA 4PVDA 5E6UB 2VJNA 1Z74A 1PL6A 1HG1A 5EEHA 4BO1A 4EL0A 1H0SA 2UUBB 1MW9X 1NBIA 2ANBA 2WJJA 1HNWB 5DTEA 3KO8A 1OA1A 1HURA 1AMOA 1VGVA 2F9LA 4Q34A 4INOA 4G0WA 4A36A 3QFRA 3ZW7A 3DVLA 3JWHA 3R40A 4K40A 2XSZD 2EKPA 3PUWA 4L4YA 4H6WA 5GVRA 7ADHA 3DFIA 3T1TA 4L57A 5LOVA 4EFDA 3E03A 4PW0A 1B93A 2J0UA 4OKIA 2YWFA 3EVDA 3T61A 1WCIB 1S89A 1QLJA 2AQ8A 2QRQA 2HDNB 4CKEB 3CUSA 2HT1A 1PGOA 4ZQEA 8ADHA 2XTJA 4R31A 2Y1DA 2I22A 4QC2A 4S3MA 4TTPA 3GBVA 3VDRA 4NBTA 5HA5A 2FZEA 3GH3A 2ZUDA 1GRVA 1VM6A 1ENOA 2BD0A 3RADC 1BE0A 3IQWA 2W2KA 4C43A 2AE2A 2H63A 4J0FA 4LGCA 5EAIA 1V39A 1DBSA 3BAFA 5JHHB 2RKWA 4Q4DA 1R7RA 4WLFA 1XLTC 3UT5B 4A0SA 3ZWBA 1E9FA 2IOFA 4IUCS 3TO5A 1XELA 1RPAA 2VBIA 5GONA 1Q7CA 1ZISA 1GZ5A 4FKZA 3CTMA 1IXRC 2HSWA 3AF3A 4MRVA 4KP7A 4ZCPA 1G8PA 5AXAA 1YU6A 5CVCA 3IL2A 1X8KA 2B92A 3P0HA 5KBYA 3KALA 4D56A 3KSZO 3KHUA 4IHJF 2W2TA 2ZYVX 3CM0A 2XNSA 2PX5A 3OIVA 1E3MA 3N8DA 3N3AC 1L7MA 1RVDA 2ZB4A 4QXPA 5TIIA 4V0QA 3GGPA 4Y9UA 1ZL0A 3WLMA 1PKEA 1Y81A 2XT0A 4C21A 3GJ5A 3O91A 1JR3E 4ABTA 2R68A 2P4EA 4P92A 1V7PC 4JNCA 2GOYA 5JNTA 2WJPA 2ZYGA 4B44A 4AJ9A 1DARA 2FEWB 2ZS8A 1WHSB 1XROA 1KMCA 3Q9UA 2WU1A 4XIFA 3WRXC 5BYBA 4CN9A 3IVCA 1KH1A 1JH9A 3EH2A 1QH8B 2QTHA 1GLVA 2VJQA 4YP7A 5G0VA 1YF3A 3V1KA 3JAKB 2HLDA 2EYUA 2X8WA 2EJVA 3I92A 2E1PA 2XZPA 4LGMA 4MWOA 3PK0A 3B1WA 1TU4A 1J0XO 3KTDA 3ZCVA 1V9LA 3ZIAA 4WZBA 4RV9A 2EGGA 1XAGA 1M6WA 1XZFA 2Q2NA 2VHTA 4AN1A 5LLSA 3SR3A 2MMCA 5C0OE 2CNKA 4CQMB 4DLYA 4JXXA 4BCCA 5BP7A 4IGKA 4DLRA 5E7JA 4HEQA 4MYRA 5KINB 4V38A 3B3AA 4C08A 3QEMB 1RP7A 4N7MA 2ODNA 3DZIA 1UFKA 1UMKA 5A62A 2YWEA 3BRSA 5INTA 1HDEA 1T3ZA 2WMOB 3O8DA 3WSVA 4BLRA 1B4DA 2OD2A 4WJZA 4DSOA 2JASA 2IY7A 1T4GA 1V43A 3QJGA 2QM7A 4K5QA 5LB4A 3TTSA 4L5JA 5K0GA 3DF9A 1S96A 3RI3A 4BNHA 1VSQA 5A0FA 3RVPA 3UATA 1PT6A 3QXXA 2QN6A 4IXWA 4MR8A 3SZGA 4D3YA 2BKEA 1P1KA 1ZIOA 2ZE6A 3C16C 3G89A 4CLOB 4Y9DA 1A7UA 2J4FA 4IXMA 2ZCVA 2H48A 4LKRA 1CB7A 1KL7A 5A4AA 4JU9A 4LOHA 2AFVA 2QX6A 3R3UA 2Q2VA 4LK2A 2EHDA 3UPUA 4TTRA 1C4KA 2BZ0A 2I6UA 4ISCA 3D1VA 1KO1A 3DC7A 3GJ6A 4J90A 1P9NA 1ZIXA 1N2CA 2ADOA 3KPYA 3OCZA 2EZ4A 4FMCB 4XWTA 3E9DA 4AO8A 4BCDA 3A6HA 2O2YA 4ZXPA 2GI4A 3KYJB 4Y8VA 4B2PA 4I8IA 4DBLE 3EMVA 3N8GA 3DOIA 4Q00A 4AP6A 2Z4TA 3HPRA 2C2XA 1ZM9A 4U3JA 2BR5A 5DTJA 2IYNA 4U63A 1TM1E 2DLDA 2HF2A 1QQAA 3G7NA 2LTAA 4R1TA 2G1PA 2IV2X 1MO2A 1LW7A 1DP4A 5EJ4A 4EPTA 3HL4A 4RV5A 1JG4A 1N6NA 3WV4A 5CFRA 2I1WA 3N5CA 4IHQA 1RRVA 1Q92A 2WZDA 2CBZA 3IE2A 3FVTA 1E3LA 1NSFA 3EGVA 2XSZA 1R5JA 4XX1A 5JJKA 1GUDA 2G04A 1CZUA 1WIWA 4TXMA 4DDWA 2PJDA 1GDTA 1XTQA 5IFKA 4K1LA 4K05A 4KAXA 3VISA 3TEJA 1RQXA 3K94A 4L72A 2FZWA 1OF1A 3KSDO 2H7YA 4P5EA 1Y1TA 3GQBB 1WHSA 1AQ6A 2ZS7A 4UREA 3PQ6A 5EKDA 5K8LA 1ST3A 4OBWA 4ENWA 4WEOA 2BEWB 2IBMA 4N40A 1BDJA 1P2DA 4HRAA 3BH6A 1QHFA 4L9SA 5F9MA 3GT7A 1JKJB 3LNCA 3NBUA 5CTAA 2QI9C 5AJVB 5SYAA 5UKDA 3I42A 2JGKA 4EABA 4AD8A 2H31A 2HN9A 4BWFB 2ZITA 4I8XA 4PG7A 4L8VA 2OXTA 4OX9B 2FPGA 3LUFA 3BIFA 4JMPA 3OLCX 5K45A 4OHVA 2C8LA 5G4KA 2HCTA 2O59A 2VAXA 3KPJA 3JZDA 3PUVA 3R3VA 1MJHA 1L2TA 1OBVA 1S7GA 3C1OA 2Q62A 3PDCA 3QOXA 2D3WA 2ZJYA 4CFSA 1NF9A 5EWMA 1TEZA 2Q3BA 4M0CA 5AW3A 1SQ5A 2BGRA 3UK7A 3NUZA 4HX5A 4Y6LA 2WV7A 3JWPA 2LE0A 3S6JA 3DMGA 2Z2XA 4F46A 1YS4A 3LDAA 1QGZA 5LQRA 1IK4A 1WCWA 1ETHA 3K73O 4IIEA 3B9BA 1YXMA 1CBUA 1A5AB 4MHOA 1E1CA 2EZTA 3HXLA 3PL1A 5HEKA 3KE8A 2AXNA 3ZU2A 2Y93A 3VVBA 1I2ZA 1XZQA 4P86A 3QVTA 1H2RS 5EXPA 3UKDA 2X5NA 2DJ5A 1D6JA 4EHAA 5KO2A 1C80A 2RC5A 3C6BA 1SEPA 4JT9A 5CXUA 1NXXA 2B2NA 3T95A 3NKVA 3KV1A 3A3NA 1E58A 2V5AA 1Z18A 5TX7A 4I3HA 3DAOA 3TQCA 4C0JA 3E9QA 5K3EA 1QVRA 2E48A 2EWMA 4MRAA 1KI6A 3DWIA 4O2BB 2W6ZA 5EIXA 3QEBZ 5K2OA 5C5EA 2EOAA 5E8JA 1DEAA 4HEHA 4CQMD 3WDMA 2DC1A 1QK5A 1WMEA 2W2VA 5DW0A 1UMDB 5ESWA 4P0QB 4WKBA 1Y1SA 4L2IA 4A26A 4RA9A 1YIDA 4Y6PA 4MGHA 1MMFB 1T2DA 3I12A 4MIYA 4OG2A 3ABOB 2GRAA 3GT4A 1QRSA 1L4GA 1B8NA 5GIPE 4B3RB 2QKYA 2ZBGA 3M3PA 1LBTA 1JHMA 3OOYA 3LYAA 3BK2A 1GR1A 2H9IA 1GOTA 2XUDA 3GFBA 4WCFA 2PUDA 3M4ZA 4NV3A 4MS4A 3RKSA 4G0PA 3BDVA 3CO0S 3HRIA 3PT5A 1A69A 4AZ0B 5HFAA 1BQ4A 1C4OA 1F14A 2DHCA 2A9RA 4XEHA 3CRNA 1RC8A 1M10A 3RSZA 1MN6A 1Y42X 1YB2A 3DLPX 5KNCH 4B40A 2VAVA 5BWOA 4QG7A 3UJCA 3IPXA 4Z1OA 5BORA 2XUFA 1NBMD 3K0CA 4YP5A 4N8EA 2ODBA 2X1MA 1CJKC 3AHHA 3QU7A 4V2UA 3AUAA 4W8HA 4EHNA 3HSKA 3SYNA 1K68A 1YZYA 1L5RA 1TQHA 1J23A 3C8MA 3CEMA 4XARA 2A0FA 1Z73A 1AJEA 2YZ7A 2CHQA 1LKZA 1K0FA 3ADOA 1XN4A 1UP7A 2GN1A 2PQMA 3VR4A 2C7BA 3EEYA 3HCNA 4UDYX 1EPUA 4KZPA 3WJAA 3GT0A 2R79A 3K2QA 5D86A 3R3SA 3SFVA 5KYYA 3CLRD 2R5NA 4D9MA 3K8OE 2C5LA 4G4JA 2K7ZA 2C7GA 2Z2YA 3DE7X 2QTLA 3OQ1A 2ZYWX 5FWYB 4MQBA 4F3NA 6YASA 4PZ9A 2ZRLA 3KZCA 3RRBA 1X92A 3W5HA 4M7OA 2YBDA 1ORRA 2HY7A 2Y8EA 3U7GA 4RCYA 4AJNA 1JHAA 4UAJA 3U6BA 5I48A 3O8BA 4U2BA 3X1YA 4UBIA 1BCRA 3AFIA 4KQFA 1A4XA 4J4TA 2B25A 5KJEA 3NIFB 4EHJA 3OQJA 2BEKA 4DSNA 2UUOA 3Q8WA 2B9VA 4G4IA 2R8ZA 1ODCA 3F47A 3UXYA 1QFSA 3G6KA 3UMMA 3C2QA 3WADA 1QG2A 3DD5A 3EZ2A 4ZVKA 1OPXA 1JLKA 1SG6A 2XVAA 2EW1A 3TVTA 3FLMA 5EMKA 4KWHA 2VATA 4CU2A 3PKZA 3FY4A 3NHSA 5HYVA 1WA5A 4L3OA 3RC1A 3TFWA 1WHTA 1XZ8A 2FN3A 1YBAA 2R6JA 5EHQA 1IWBB 4PCAA 4RSMA 5EE1A 2I87A 5IDVA 3MHPA 3UA4A 1Q50A 1NOKA 1ZCFA 3ZY6A 1CUVA 1UPXA 3LLCA 5BV0A 1CDZA 2PMWB 4LTMA 5THKA 2YASA 3NR2A 4F3RA 4BNUA 5A5EA 1SWVA 1G5RA 4GSYA 1P17A 2ZWOA 3BWDD 4MWCA 4PONA 3P7MA 2VAPA 4O3FA 1NDHA 3O73A 1N9GB 1Q12A 2GBFA 3P4UA 1PLJA 1E3WA 1OT5A 2B6HA 1C30B 5B53A 3CZPA 3JQ7B 4CTOA 3CNHA 3PGA1 5H70A 4L50A 4EBFA 2NZWA 4FYKA 5AW8A 1LRLA 2EFDB 2W2XA 3P26A 4MRNA 4MXDA 4UEJA 5FO1A 1QG0A 3ZXYA 4JBXA 4Y6RA 5FPTA 2QV7A 3D9QX 1V3UA 1SFRA 2VQSA 4UM9D 2ARKA 3RS0A 4L3WA 3U39A 2BTOA 4ZOQI 2O05A 4E5DA 4QGFA 4JFAA 2HCJB 4HNSA 1VL0A 3HXTA 1G7RA 4ME6A 3TW8B 1RLTA 1R10A 3ZK9A 3CZMA 2HCRA 3NASA 5BN5B 2J3JA 3GZ4A 2AEFA 4C05A 3HBLA 1E2KA 3K0BA 1KETA 3OPYB 4RACA 4I1OA 4BX9A 5FO0A 1JBQA 3S8EA 5DX0A 1GNQA 4DQ0A 5FX2A 3HY3A 1AKEA 4AZSA 3LO5A 1AK9A 1YQQA 2RAUA 2VPWA 1G6Q1 2WWIA 4G0YA 1B6RA 3DAYA 1HDGO 1T4BA 3IHWA 4CMIA 1MOQA 3A11A 5A3QA 2JCBA 2YV2A 5JY6A 4MW7A 2PZLA 2QD2A 5EWLB 4Z3DA 1H66A 4EYKA 3AUKA 3OQ6A 3B9PA 4GOLD 3RSHA 1J99A 3ESRA 2XMZA 1II9A 5F5LA 4DC1A 5JEDA 1OIXA 1R0LA 1XNJA 4NZ9A 3KTAB 3PE3A 1SUFA 3EVFA 2YIJA 4ITVA 2C4VA 5JRJA 5BN4B 4E21A 4C9BA 5FYDA 1EVYA 1NAIA 2BLNA 3FX2A 3JSAA 3TLAA 1QG6A 2XMRA 5ALYA 2CL5A 4ZANA 1NN1A 4TYQA 2R5FA 3VKFA 4LFCB 3A0UA 5EMHA 3RRZA 4B4DA 5JSZB 5J47A 3D4OA 3FUXA 1YR2A 3IPAA 3M6UA 5ARCA 4JVMA 3SVLA 2XRMA 2MOKA 4DRXA 1MJGA 1XQWA 2QMOA 1V6SA 1JAYA 4YJGB 2FPPB 3CWQA 3UAYA 1JMYA 4MZDA 2AFIA 3EFHA 2Q4OA 4EG6A 2V5VA 3RSCA 3UJPA 4RVCA 2WT9A 3IHTA 3WGGA 3C74A 2W8BB 2ZSDA 2LDXA 2PV7A 3BMCB 1GCAA 3PQEA 4N7JA 3TQQA 4A10A 4DL9A 1U7XA 4PCLA 1NKTA 2G76A 4ZAVA 3NRCA 4YCBA 1EWQA 3D1JA 3EQ8A 3D02A 3V7WA 4H7IA 3ACCA 3ODPA 4JFRA 4R8RA 5LUBA 4LZAA 2ABWA 3H2YA 3C70A 4BYMA 4YT8A 2QBYB 5K01A 1PI3A 5IKXA 3L8MA 2KSQA 3DVAA 5ERGB 2ZROA 1QE3A 3QUBA 2CXXA 2HF8A 3WI7A 6REQA 4XTCS 1NT4A 2JJ2D 2C4TA 2EP8A 4Z7JA 3K0AB 4XD2A 2D5BA 3Q2KA 4X9XA 2AH5A 1E1RD 1RYDA 1QVVA 1M1YA 2YMPA 1BMFA 4QJBA 4FFMA 3W9SA 4ENUA 1QQ6A 4ESVA 3GFRA 1EUDA 2DCMA 4CF3A 3Q5EA 1Q83A 1A5SB 1E2DA 2XDWA 3KSRA 2R8BA 4L7VA 2EP7A 2PUFA 2Z1NA 2CVFA 3E9CA 2GAFA 3GCGA 4ZEMA 3TAXA 2N3ZA 4EMUA 1RXEA 4HNHA 4NP6A 1ZUIA 5J1TB 3ND7A 2IX3A 1W46A 4JJKA 3U40A 3A10A 3NOXA 2ZI9A 5DLEA 1CEXA 4E07A 4D97A 4BWYA 4PG4A 3OJLA 3IO3A 5AW9A 1SOMA 3FKSA 721PA 2KLHA 1NWHA 3C3YA 4UD6A 3OC6A 5SZIA 4PTLA 5LA6B 4HDCA 2VT3A 4MKRA 2YDXA 4OXYA 1TECE 1VIMA 4RLSA 4KO2S 1XMXA 4HX2A 1ZHOA 1SU4A 2VF8A 1QP7A 1KKUA 4R7TA 4WINA 3HMKA 4DY4A 3ESQA 2CMKA 3WLEA 3MGAA 5GPBA 4RVDA 3UEOA 1P1JA 3VZDA 3ZHTA 4EPWA 3O1HB 3U7HB 3VPFA 3DTNA 3UV7A 1TYZA 2PT6A 3LGXA 4FWBA 3ROEA 4OL0A 4BGUA 3LCRA 1FMLA 3Q7EA 1ZEMA 3DKPA 5CDFA 4B43A 5AVRA 3VHRA 4ALKA 4PYQA 1FPMA 4PV7A 3UT6A 1FYVA 2X5XA 1QJ4A 4KAAA 5D1NA 3M4NA 4L85A 3PD7A 2JFVA 3T9DA 1RWNA 3DHYA 2N42A 1B2LA 4KBGA 3Q10A 3WLPA 4TM8A 1E3DA 1EQ2A 3T15A 3TMAA 4L73A 4BNXA 2NXJA 4GNKA 3EG9A 4E4YA 1IC6A 3D2AA 4X64B 4YRJA 4KQ9A 3TE7A 2VQDA 3GLIA 2HXSA 2X0KA 4G63A 3WY9A 2VTKA 1JSXA 3E84A 4EY7A 1FSPA 2QF7A 3A9UA 4L9WA 3VR3A 1JPJA 2W2PA 1QG4A 3FPFA 3TNFA 3U5TA 5PNTA 3OOHA 2OGTA 5KVVA 1NXVA 5HF8A 2AFIB 3WHPA 4AKIA 3F9IA 3ASYA 1H4TA 1LF0A 3IEVA 3P9ZA 3PEWA 3UT5A 4ZI7B 3PXAA 3JAMA 3AL2A 1ZVJA 4J07A 1Z8NA 2J1LA 3ZC3A 1E1CB 2XY4A 4LXIA 2REQB 3QEOA 4MLCA 1UPUA 3QUSA 1XLUA 2IX9A 3HSSA 3NDPA 1KSHA 5EUCA 5LXTF 2YZGA 3EF3A 3IMKA 3ILVA 3ZU3A 5JYEA 3WMFA 2WHPB 4YFVA 2EVWX 5EJAA 1P1RA 1OYWA 2WE8A 3GZNB 3O0TA 3QPWA 2R7AA 4CMCA 4K3VA 3HB7A 3RIEA 4BMXA 1JEQA 2FG7C 1Z0JA 5DM0A 3ZJUA 3G7UA 1ELOA 2A9KA 4CVNA 2VSXA 1H2WA 1JHQA 5CLIA 1CUDA 1QRRA 2B1QA 1CERA 2ZULA 4G26A 5IC4A 4LV5B 5CIYA 1U02A 1MEJA 1JJAA 3D0RA 3PFHA 5AJUA 1KMMA 1INLA 2BGNA 4P93A 5CA0A 4HWSA 2YXLA 1L8XA 1MFZA 3ZK8A 2B1GA 4ZOCA 2IHJA 2AQIA 5FCDA 5CA1F 1C4XA 1PRYA 1QAMA 4LSWA 4S1OA 3ZBQA 4DIMA 1EJBA 1JFFB 4JBWA 2XXAA 1Z16A 3FPEA 4FU0A 4L1KA 3AVQA 5ICFA 5A0VA 3NWPA 3THWB 1QH8A 2IYLD 3EGDA 2JLWA 1FTWA 3EZXA 2WJ4A 4L78A 3DDHA 3TZ6A 1V1MB 5BSFA 1VG0B 2WD7A 2DWOA 2HADA 2YY7A 4RC9A 2YL2A 4ZT6A 4B3FX 5I45A 2BSQA 1ISJA 2JAPA 2PTGA 4HUQB 4MIOA 4P0TA 1CHNA 3PE6A 3ZTYA 1QPBA 2GPWA 4R8KA 5AKJA 1UKEA 1C81A 1TVKA 1P5RA 1ZNWA 1T0JB 2RHDA 4S35A 3RF7A 1DAEA 1WS6A 3LX5A 3N58A 3KBOA 1Y6JA 3X2EA 3E61A 5KYUB 1U2SA 5AUOB 2VDNB 1YC5A 2WWTA 3FYUC 2XWSA 5BR1A 3P9IA 4QE3A 4QU5A 1U80A 5GZ1A 1MA0A 2FCAA 1J06A 3OF3A 4R8VA 2IGBA 3REGA 4KMMA 1HRDA 2H1IA 1XFDA 4CI0B 4BEJA 3COWA 4MKIA 3ER9A 1OVGA 3MD0A 1EFPA 2HO5A 2YYSA 3OZGA 3OQOA 4CLRA 3N8HA 3DCNA 3JYHA 3B3GA 3R3XA 4OGFA 3BGSA 3DOJA 3DB1A 5LQAA 1NY5A 2VZLA 4JQZA 2JD2A 3OT4A 2RJNA 1XNQB 4B83A 3L18A 4UJ5A 3DCIA 4YUVA 2IE0A 3AR4A 4DF3A 5K8TA 1QTRA 3ID6C 1QVAA 4AWXA 1WCIA 1XKQA 5WRFA 2D3TA 1FBTA 1GT6A 1YK0A 4K6GA 3L6CA 4OXXA 2IW3A 3TB6A 3O4FA 3IDZA 3W4KA 4RHFA 1OAKA 4YDHB 4N48A 1WPGA 3QHQA 4M0MA 2WP8J 5B30A 2X2PA 3GLSA 1JIJA 4KQGA 2JG3A 3QXCA 2OPBA 4XYGA 3GZTB 1UT5A 2YWGA 1MGPA 3ZVKA 2FK7A 1G5IA 2Y1LA 1YRWA 3JYNA 3K0FA 3PQ7A 5EMMA 4RPGA 1WSDA 4XSGA 2REQA 2G72A 4JSRA 4BNTA 4EO4A 3NQ41 3R23A 1L5QA 3ZE0B 1VPDA 5EI5A 3OJEA 3HVKA 2WVGA 3IAM1 4QGBA 4JC4A 4O4LA 2HA4A 1T0IA 3NUQA 4H35A 2CMGA 1X7GA 3MBKA 4A6PA 4C04A 2VYND 4AZTA 4C3ZA 1ZKMA 1WMFA 2GJAA 1F4PA 2JFPA 3LUJA 3NAMA 1TRHA 1VPTA 3FDXA 3OJWA 2JLAA 4OY3A 4P32A 1GSAA 1KNQA 3GNLA 3WNZA 1TO2E 2QI9F 4M4SA 4EGJA 2CDAA 3K15A 1GQ2A 1Q74A 3IPLA 1BO6A 3AJ8A 4A03A 3QV1A 4BYGA 3WIDA 4ARCA 3F4LA 1DDIA 3DEZA 4TV8B 2VAWA 1P8AA 4P1ZA 1O96B 2M6LA 2C1ZA 5E38A 1PWYE 4BXOB 4P4SA 2C83A 2QZ4A 5EZ5A 3AQIA 5C1PA 1QKIA 4HDOB 3E22A 1BSVA 4IIFA 3D2LA 3BGDA 3VTZA 1WLSA 3IR5A 3VPCA 4HDKB 4W63A 4JT2A 2WWGA 4YMSA 2FVXA 3DKIA 4PNZA 4BB5A 2FPIB 1SCUA 1TDJA 4EW3A 3UNXA 2AB0A 2H18A 2J31A 4QA9A 1NIJA 3EZ9A 2JBWA 2CLMB 3QKTA 5G4KB 3FRHA 3I9V6 2BMWA 1M1YE 1JBEA 5DGDA 1SHKA 4KXQA 3SBDA 1YDWA 3E3MA 3AFMA 3L7LA 4MVJI 5AMXA 5AK6A 3RKUA 3KZOA 1DC6A 3G2NA 4F38A 2R7MA 3I6IA 4P22A 1XNGA 1FBNA 1FFEA 1BD3A 1RWQA 2G1AA 3IUSA 4AULA 4ZYTA 4A0RA 1ZINA 1W47A 4ZZIA 4DIOA 3OSUA 1KMIY 3K5HA 3VV2A 3T5AA 3RV4A 4D9IA 4F3YA 1Y3FE 2ZRQA 3NYWA 5KYNA 3BDAA 4FC7A 4QEKA 3W5JA 2CW5A 3IMCA 5FLXA 3OLQA 4DCSA 4LJKA 5SYNA 3VDNB 2IPXA 3IDAA 4FGWA 5TSDA 1VPVA 5J5CA 3UMJA 1WXXA 3A6DA 1UR5A 4FFPA 1VQ1A 4M83A 4WE3A 3T7JA 1NX6A 3VXKA 2WAAA 1A1SA 2NSLA 1VGRA 4JJ8A 4IG9A 4LYYA 2CV0A 2IUUA 5LYJB 3ZV6A 2X6RA 3MW8A 3QH4A 4UEKA 5DEOA 3BTOA 1O94D 2Q1XA 2ZAIA 4EQ6A 3BT7A 2JF0A 4XOIA 3AIOA 2REBA 1OZHA 1VKJA 4CWAA 2GCGA 3P9RA 1GUZA 2J3IA 1U0SY 2OCGA 3HEAA 3LUHA 4M98A 1AD2A 5DT2A 5EP3A 3G1UA 1L4MA 3FNRA 3VH1A 5F98A 2PBZA 4PPGA 3S5UA 2WA2A 1NP6A 2AF3C 2UAGA 4OMUA 3ZY5A 4HJRA 4G36A 1KE2A 2X42A 3BD6A 3RDPA 2ECKA 1J2YA 2P11A 4CQLB 1LVGA 1TZBA 4K6FA 3DDOA 2J8ZA 2WYIA 1NPDA 1QE5A 2YVKA 4D5EA 2XCRB 2Q3CA 2V4MA 1UL1X 2HQOA 1VA4A 2VQ6A 1IN1A 4FP9A 4AJIA 2C61A 4HAOA 4QQNA 4IOLA 2EKLA 3TXAA 1U28A 3HJRA 4DCMA 3OCXA 4C4SA 4PWYA 2ZUWA 1NY6A 1MQSA 4KK4A 4LHEA 1DOHA 2NTEA 1XU9A 2KHZA 3Q7QA 3KJGA 1Z2CA 3VUFA 5HBRA 1AUOA 2H65A 3WLQA 4D9GA 4TROA 3QLUA 1SY7A 1HYGA 4N6OA 4Z1MA 2BGWA 4MV9A 5EIBD 1RZRA 2UUCB 1W36D 1OFTA 1PDWA 2AMLA 2E18A 1OYVA 1YB7A 3D2CA 5TARA 3X1JA 4B8ZA 4ER6A 2YFYA 4DQKA 2Y2VA 2AZTA 4KODA 3X1DA 2EFGA 3PNKA 3V33A 1O95D 5ICSA 4DMFA 1CJTC 4OLJA 1DL5A 3QEAZ 3UICA 2Y05A 1JLMA 1X7YB 4OREX 2WWHA 1LBSA 3GGOA 3NJRA 2WTMA 1DCTA 5A02A 1JQ3A 1PR6A 2QB5A 4MRMB 4TGLA 5F64A 3OWHA 4J0JA 4FEYA 2A78A 4UATA 1EGHA 1NVBA 2BFDB 2E4AA 4A91A 1Z26A 3RNLA 3ZDQA 1ZVQA 1IUKA 3GLIE 2C29D 1U0LA 1VCHA 5ALFA 2P91A 2YHAA 2H1LA 4N0QA 4Z2YA 4X3PA 2EKQA 2VWHA 2CWWA 5IVHA 2C8JA 3CLTC 4PXYA 5CAEB 3ML1A 3NXKA 3CIFA 4RELA 4CL8A 3TFOA 5IH7A 1FB5A 4PQFA 4Q15A 4X84A 4JI0B 3PNBA 2WJHA 3ROZA 1PD0A 2ZB2A 2IUYA 3NPAA 1IM2A 1YVPA 1QS0A 1O0CA 3NJ4A 3PRKE 4AQYB 2OAEA 4M1MA 2V3VA 1U9ZA 1JJBA 3U2QA 3GLKA 4DA7A 3D6VA 3OBIA 1J07A 4DILA 1TD9A 3MBIA 2WC1A 1PX2A 1KQGA 3T1QA 3MIIA 4FFNA 1ZOSA 2Y2UA 3F46A 5TMBA 1CUIA 2OHJA 4HDSA 4G89A 4ARZB 2JLXA 4OHZA 3G7SA 5ARDA 1M0SA 3GPIA 1WQ4A 2V7PA 2H7CA 3DE5X 1BHQ1 3JQQA 4D46A 4ID9A 3OLZA 4LYDA 3B1XA 5JQGF 3UOGA 2XE8A 2GPAA 2UYOA 3MUOA 3H1TA 3DC2A 3WXMA 2GD6A 3G2IA 4W8GA 1XSEA 1JS1X 5JFGA 4ARBA 1QQTA 4IOKA 4V1CI 1W85B 3R7DA 5L51A 1BCSB 1ZC3A 1BE1A 2C5SA 2BCEA 3LT4A 2AXQA 4NFHA 1RRCA 1UFRA 4YO7A 3BXOA 1E1QA 2HFKA 4BWGA 1P91A 2GFQA 1EIZA 2XH8A 1RQRA 4PG6A 4GU5A 1JQJC 1X7DA 4Z0HO 3W6ZA 1YOVA 4GZLA 3CW2A 4O4JF 2VYCA 4KRFA 1QIEA 3U1TA 1I51A 3AKEA 4TXJA 4F72A 3AR6A 4GX0A 3JVUA 4J6FA 1KFCB 1I4TD 2YJZA 1JYFA 1O4VA 1TUGA 2PT9A 3A1UA 2AW3A 4GF5A 4HNAA 5CIWA 1XCOA 5AUQA 1BGXT 1KPHA 2ZR8A 5IJ9A 2ORYA 1IQUA 3VAAA 1AIPA 3U4QB 4TKUA 1ZXLA 4F12A 2I2BA 3QMVA 3M6XA 5HK9A 2OK7A 4MITA 2Z57A 4D6PA 4WVLA 1FDOA 3NORA 1IEXA 5IHPA 4DR2B 1DLJA 4NENB 1T1RA 3W2EA 2PZAA 1MJFA 4BZQA 3GN2A 2YW9A 3ND9A 2NSJA 2ROQA 2CD7A 4JXJA 4O2LA 4BVJA 4Z3OA 1DZIA 1B8PA 1DAGA 3DVRX 3FR7A 4M21A 4KR9A 4F6RB 4M0EA 5A3SA 2A0UA 1V6CA 3PHJA 4MR9A 4V0MA 1KAMA 4QBIA 4ZCMA 3NH9A 1OBFO 1SKUA 3R9KA 1I5RA 3BSWA 3AM5A 5JS1A 3ESCA 3MD9A 1F5NA 2AWNA 5T67A 3TVYA 2XGOA 2QP4A 2JKVA 1SXJC 2VAMA 5J4KA 4M1QA 4CQNA 1G2IA 5K2MA 1HK7A 3L07A 3ES9A 4HWOA 4QVIA 5C32A 2G36A 3OPYI 5CM8B 4YBRA 2RAVA 1YBFA 3ABSB 4B76A 1RCUA 4DMLA 2EJUA 3FOAA 5P8WA 3ICWA 4OV6B 3TOCA 3DR3A 1IM5A 1T6XA 1PHRA 5IU6A 2W2OA 2OBLA 1SBNE 2GB4A 5HDBB 1VG8A 4GWKA 3SZLA 3VFDA 3WRVA 4CR8A 3DNMA 4IHKA 1FDIA 4JLSA 4RJ2A 3BWMA 5AW7A 1DELA 2HF9A 3UHPA 2HA3A 5JCOA 3PUIA 1XZBA 3WLAA 3SE0A 1OY1A 3RRXA 3T7EA 1M54A 1XMPA 1DI0A 1CY4A 5AHRA 3DDWA 3SHTA 1Z22A 3VSDA 2W4MA 2GILA 4RF3A 4GYJA 3PDIA 4H6PA 4Z0PA 4ON9A 5AKIA 2PJZA 2JBAB 4UBNA 4UM7A 3BKWA 3HCRA 2YIMA 4WFQA 1R5OA 3FMVA 3JQBA 3NC4A 1Q3TA 3S68A 2LD4A 3RYCB 4FK8A 2V65A 2I66A 4XDHA 1CS4C 1EJ0A 4FB5A 4EHHA 2FX3A 3BE5A 1IQPA 4F04A 1NNI1 1DSSG 3IESA 5AM4A 1GPLA 2WG1A 1LF5A 2C07A 4RGBA 5CMLA 4DUPA 3O8QA 4EHIA 3OT5A 3K9GA 3A4NA 3M7IA 4MW1A 1HLFA 2N0SA 2HLDD 1RQLA 1E6LA 1Z8DA 4LHWA 1FA9A 1YU9A 1ZQ9A 2GJ8A 3ENZA 3JZAA 2EFYA 2VUHB 4BZPA 1BC5A 3PDJA 3PSHA 4IJWA 4QEZA 4TWIA 3KC2A 2JEZA 2J9FA 3D6TB 5IK2A 4G4GA 3PFWO 1U5CA 1UXGA 3IUNA 5ESDA 4BFTA 3OIFA 3KT6A 1K7XB 4FYMA 3M8KA 1YK1A 3BD7A 1EXWA 2AYZA 3QOYA 5IAJA 1ZWLA 2Q8NA 4FD2A 4GO1A 2L2QA 3CG0A 4YJ3B 2Z9CA 5CDSA 1YR3A 1GGNA 5J2UF 2C4KA 4TV9A 3YASA 3VC1A 1E6MA 2A1TS 3VPSA 3O94A 4L0MA 2XYHA 3EGXA 5ALOA 1K92A 5AXDA 1FLVA 4CFYA 2OORC 2EWVA 3LTEA 2OFWA 3IXMA 1FNNA 5GV7A 3G2HA 5KB3A 1W49A 2I4RA 1UFVA 1L5YA 2D5IA 4GOJA 4NCNA 5CX1A 1GPYA 4EA6A 3CLSD 2AMVA 2Z5LA 4RVUA 5G40A 1IBSA 2V9CA 1ZRMA 3UVEA 3ZV7A 3ETNA 5D87A 1IDOA 4MKXA 1SOVA 1Q1AA 3PPXA 4J1NA 4D0SA 2VC2B 4WUVA 3U09A 4M8KA 4NICA 5IVPA 1FLDA 1T36B 4E5UA 3LKDA 2VYNA 4MAAA 5A1TA 3AJDA 1QV7A 1YQEA 4BLVA 2XEXA 3RASA 4C1BA 1BVRA 1Q6YA 2P0AA 3VR2A 4WV3A 4US2R 2QE7D 1B8UA 4XX0A 3UMVA 4DDHA 1AGNA 1S7CA 1X13A 3C3EA 3OD1A 3O8OB 4X91A 2JFYA 3EIEA 3KKNA 4PX9A 3F6PA 5BSRA 3ASZA 2ZVJA 2I65A 4EGQA 3JYLA 2QE6A 4XJSA 4LE1A 3UWPA 1F8XA 3TCKA 1DOAA 5JS8A 4WKPA 4EENA 4JLVA 3I6ZA 3UCFA 2GCIA 3URMA 4MR7B 4OPMA 2RB5A 1C9DB 3JRNA 3DLIA 2J0QA 4OI0A 1G8MA 2BFEA 4Q9IA 1JIUA 1XCMA 4YROA 5K4HA 2BSXA 4WZAE 5KSZA 3REQB 3AI2A 5IW8A 2A59A 2EU8A 2YHUA 4UZFA 3RIXA 1KS2A 1NFFA 5LJLA 1U7OA 2QK4A 3U19A 1MX1A 3EK2A 2J6BA 1W4ZA 4IAOA 3M5DA 4ZV7A 5TVKA 2GHQA 1WCV1 5C5CA 3G2JA 3UKJA 2GQ0A 2DULA 3AUTA 3F6YA 1W1UA 3DFFA 4WASA 3O7MA 2QYSA 1PVDA 2QQ5A 1KERA 4FR2A 4GOMD 4AMYA 1NKVA 3HXKA 5CB4A 5KYWB 3ANYB 3F71A 3S28A 3V8RA 1ETUA 1GHTA 3RUEA 4LTNA 1UFOA 3UG6A 3NVMB 1TKAA 3PFFA 3S2YA 4HAZA 4LSZA 4EI2A 2NTNA 2HDWA 3LW8A 4CEIA 4ENVA 1SUSA 5B64A 4EPXA 1K6IA 2CLSA 3MTEA 3AR7A 3TR5A 1BE8A 1WM1A 2I80A 3TF5A 2DYKA 3T1VA 4S05A 1WDWB 2Z3VA 1T1IA 3R7WB 3BMOA 4QYSA 4Q9HA 1NATA 3D3JA 1XI2A 4TX1A 5I9IA 5U1PA 3QF7A 3CE6A 1GFSA 1IOVA 2BDUA 4JKYA 5TQ2B 3V97A 1TTHA 1PTKA 3HGQA 4G1FA 3BAZA 3CR7A 3F3YA 3QEJA 4HLUC 1WXIA 4L27A 4MJ7A 3DO8A 2I2DA 1C3OA 4LKOA 3U7IA 4B2YA 2JCSA 5FT9A 4WK6A 5ADUS 3LQ2A 4ISBA 5C80A 1QH1A 1M8JA 3BFXA 2E49A 1HYQA 4AMUA 4RK6A 1QRAA 3PLAE 3AZOA 1ZGHA 3ASVA 4KSBA 1DGQA 1PGNA 2OCLA 2WHEA 3DHVA 4YCDA 1YRAA 2D5AA 3F2VA 5M04A 3ITNA 2QLLA 4TKVB 1SH7A 1QSGA 2QQ0A 3QGMA 4V0NA 2JI4A 1MXFA 4EF6A 1L4UA </