4V0WA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-669)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 111
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0wA00
5JPEA 1OI8A 2YVTA 4UT3B 1XM7A 1S3LA 1G5BA 3KBPA 4J6OA 5HPEA 3H69A 1USHA 2CV9A 3QFKA 4H1YP 4JA7A 3ZTVA 4HD0A 4ORBA 3H64A 1SU1A 3RL3A 3E7BA 2NPPC 3K7WC 3C5WC 2BQ8X 2GJUA 3N5UA 4Q7FA 1T70A 3IB7A 3T1IA 4MOVA 4V0XA 5C1VA 3DSCA 1JK7A 4H2BA 5J28A 4F0ZA 3IB8A 4B2OA 3K7VC 5JJTA 4O5GA 3P71C 1S70A 4TUGA 1XZWA 4FBQA 4M0VA 2IE4C 4H2FA 4NZVA 1KBPA 2NYLC 2R17A 4UT2A 3HVQA 2QJCA 2AHDA 1T71A 4MOYA 4WWLA 4KBPA 2JOGA 3QFOA 2QFPA 2USHA 4LACC 3RL4A 1II7A 3JYFA 4FBKA 4I5NC 2WDEA 2HYOA 4DHLA 4ZX2A 3ICFA 3THOB 1HP1A 2BCDA 5IOHA 4G9JA 4V0VA 3AV0A 4V0WA 1MF8A 4MP0A 3EGGA 4H2GA 1OIDA 2IE3C 2BDXA 2QFRA 4ZVZA 2Z1AA 1FJMA 2ZBMA 3IVDA 4FCXA 3C9FA 2KKNA 2O8AA 4YKEA 5DNYA 2WDFA 3TGHA 1HO5A 3IVEA 3QG5C 1WAO1 1S3NA 3H60A 3H68A 3LL8A 2WDDA 3DW8C 1NNWA 2XMOA 4UT3A 3H63A 5GTUA 2Z72A 3RL5A 4KKZA 2P6BA 4JA9A 4DSYA 5EQVA 3FGAC 2HYPA 3V4YA 1W24A 1M63A 1S8EA 4O4KA 4LTYA 3THNA 3AUZA 3ZU0A 1OIEA 1Z2XA 1S3MA 1TCOA 2Q8UA 3H62B 3EGHA 4UWQA 2O8GA 3CK2A 4O43A 4O24A 1Z2WA 3RQZA 3H67A 4FBWA 2A22A 4IL1A 3PSOA 4IYPC 2Z06A 4H2IA 1UF3A 4OR9A 4XPNA 3DSDA 3E7AA 2HY1A 2NYMC 3QFMA 3QFNA 1WARA 2DFJA 5B8IA 4H1SA 2WDCA 3GVEA 5INBA 4ORAA 1S95A 1V73A 1U32A 4I5LC 4LU9A 5F3WA 4ORCA 1QHWA 3H61A 1AUIA 5JPFA 4DT2A 1HPUA 1UTEA 1IT6A 2IAEC 4TUIA 3H66A 2NXFA 3PSNA 1QFCA
chains in the Genus database with same CATH superfamily
5JPEA 1OI8A 2YVTA 4UT3B 1XM7A 1S3LA 1G5BA 3KBPA 4J6OA 5HPEA 3H69A 1USHA 2CV9A 3QFKA 4H1YP 4JA7A 3ZTVA 4HD0A 4ORBA 3H64A 1SU1A 3RL3A 3E7BA 2NPPC 3K7WC 3C5WC 2BQ8X 2GJUA 3N5UA 3FLOA 4Q7FA 1T70A 2YEQA 3IB7A 3T1IA 4MOVA 3D03A 4V0XA 5C1VA 3DSCA 1JK7A 4H2BA 5J28A 4F0ZA 3IB8A 4B2OA 3K7VC 5JJTA 4O5GA 3P71C 1S70A 4TUGA 1XZWA 4FBQA 4M0VA 2IE4C 4H2FA 4NZVA 1KBPA 2NYLC 2R17A 4UT2A 3HVQA 2QJCA 2AHDA 2DXNA 1T71A 4MOYA 4WWLA 4KBPA 2JOGA 3QFOA 2QFPA 2USHA 4LACC 3RL4A 1II7A 3JYFA 4FBKA 4I5NC 2WDEA 2HYOA 4DHLA 4ZX2A 3ICFA 3THOB 1HP1A 2BCDA 5IOHA 4G9JA 4V0VA 3AV0A 3E0JA 4V0WA 1MF8A 4MP0A 3EGGA 4H2GA 1OIDA 2IE3C 2BDXA 2QFRA 4ZVZA 2Z1AA 1FJMA 2ZBMA 3IVDA 4FCXA 3C9FA 2KKNA 2O8AA 4YKEA 5DNYA 2WDFA 2ZOAA 3TGHA 1HO5A 3IVEA 3QG5C 1WAO1 1S3NA 3H60A 3H68A 3LL8A 2WDDA 3DW8C 1NNWA 2XMOA 4UT3A 3H63A 5GTUA 2Z72A 3RL5A 4KKZA 2P6BA 4JA9A 4DSYA 5EQVA 3FGAC 2HYPA 3V4YA 1W24A 1M63A 1S8EA 2DXLA 4O4KA 4LTYA 3THNA 3AUZA 3ZU0A 1OIEA 1Z2XA 1S3MA 1TCOA 2Q8UA 3H62B 3EGHA 4UWQA 2O8GA 3CK2A 4O43A 4O24A 1Z2WA 3RQZA 3H67A 4FBWA 2A22A 4IL1A 3PSOA 4IYPC 2Z06A 4H2IA 1UF3A 4OR9A 4XPNA 3DSDA 3E7AA 2HY1A 2NYMC 3QFMA 3QFNA 1WARA 2DFJA 5B8IA 4H1SA 2WDCA 3GVEA 5INBA 4ORAA 1S95A 1V73A 1U32A 4I5LC 4LU9A 5F3WA 4ORCA 2ZO9B 1QHWA 3H61A 1AUIA 5JPFA 4DT2A 1HPUA 1UTEA 1IT6A 2IAEC 4TUIA 3H66A 2NXFA 3PSNA 1QFCA
chains in the Genus database with same CATH topology
5JPEA 1OI8A 2YVTA 4UT3B 1XM7A 1S3LA 1G5BA 3KBPA 4J6OA 5HPEA 3H69A 1USHA 2CV9A 3QFKA 4H1YP 4JA7A 3ZTVA 4HD0A 4ORBA 3H64A 1SU1A 3RL3A 3E7BA 2NPPC 3K7WC 3C5WC 2BQ8X 2GJUA 3N5UA 3FLOA 4Q7FA 1T70A 2YEQA 3IB7A 3T1IA 4MOVA 3D03A 4V0XA 5C1VA 3DSCA 1JK7A 4H2BA 5J28A 4F0ZA 3IB8A 4B2OA 3K7VC 5JJTA 4O5GA 3P71C 1S70A 4TUGA 1XZWA 4FBQA 4M0VA 2IE4C 4H2FA 4NZVA 1KBPA 2NYLC 2R17A 4UT2A 3HVQA 2QJCA 2AHDA 2DXNA 1T71A 4MOYA 4WWLA 4KBPA 2JOGA 3QFOA 2QFPA 2USHA 4LACC 3RL4A 1II7A 3JYFA 4FBKA 4I5NC 2WDEA 2HYOA 4DHLA 4ZX2A 3ICFA 3THOB 1HP1A 2BCDA 5IOHA 4G9JA 4V0VA 3AV0A 3E0JA 4V0WA 1MF8A 4MP0A 3EGGA 4H2GA 1OIDA 2IE3C 2BDXA 2QFRA 4ZVZA 2Z1AA 1FJMA 2ZBMA 3IVDA 4FCXA 3C9FA 2KKNA 2O8AA 4YKEA 5DNYA 2WDFA 2ZOAA 3TGHA 1HO5A 3IVEA 3QG5C 1WAO1 1S3NA 3H60A 3H68A 3LL8A 2WDDA 3DW8C 1NNWA 2XMOA 4UT3A 3H63A 5GTUA 2Z72A 3RL5A 4KKZA 2P6BA 4JA9A 4DSYA 5EQVA 3FGAC 2HYPA 3V4YA 1W24A 1M63A 1S8EA 2DXLA 4O4KA 4LTYA 3THNA 3AUZA 3ZU0A 1OIEA 1Z2XA 1S3MA 1TCOA 2Q8UA 3H62B 3EGHA 4UWQA 2O8GA 3CK2A 4O43A 4O24A 1Z2WA 3RQZA 3H67A 4FBWA 2A22A 4IL1A 3PSOA 4IYPC 2Z06A 4H2IA 1UF3A 4OR9A 4XPNA 3DSDA 3E7AA 2HY1A 2NYMC 3QFMA 3QFNA 1WARA 2DFJA 5B8IA 4H1SA 2WDCA 3GVEA 5INBA 4ORAA 1S95A 1V73A 1U32A 4I5LC 4LU9A 5F3WA 4ORCA 2ZO9B 1QHWA 3H61A 1AUIA 5JPFA 4DT2A 1HPUA 1UTEA 1IT6A 2IAEC 4TUIA 3H66A 2NXFA 3PSNA 1QFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPE A;  1OI8 A;  2YVT A;  4UT3 B;  1XM7 A;  1S3L A;  1G5B A;  3KBP A;  4J6O A;  5HPE A;  3H69 A;  1USH A;  2CV9 A;  3QFK A;  4H1Y P;  4JA7 A;  3ZTV A;  4HD0 A;  4ORB A;  3H64 A;  1SU1 A;  3RL3 A;  3E7B A;  2NPP C;  3K7W C;  3C5W C;  2BQ8 X;  2GJU A;  3N5U A;  4Q7F A;  1T70 A;  3IB7 A;  3T1I A;  4MOV A;  4V0X A;  5C1V A;  3DSC A;  1JK7 A;  4H2B A;  5J28 A;  4F0Z A;  3IB8 A;  4B2O A;  3K7V C;  5JJT A;  4O5G A;  3P71 C;  1S70 A;  4TUG A;  1XZW A;  4FBQ A;  4M0V A;  2IE4 C;  4H2F A;  4NZV A;  1KBP A;  2NYL C;  2R17 A;  4UT2 A;  3HVQ A;  2QJC A;  2AHD A;  1T71 A;  4MOY A;  4WWL A;  4KBP A;  2JOG A;  3QFO A;  2QFP A;  2USH A;  4LAC C;  3RL4 A;  1II7 A;  3JYF A;  4FBK A;  4I5N C;  2WDE A;  2HYO A;  4DHL A;  4ZX2 A;  3ICF A;  3THO B;  1HP1 A;  2BCD A;  5IOH A;  4G9J A;  4V0V A;  3AV0 A;  4V0W A;  1MF8 A;  4MP0 A;  3EGG A;  4H2G A;  1OID A;  2IE3 C;  2BDX A;  2QFR A;  4ZVZ A;  2Z1A A;  1FJM A;  2ZBM A;  3IVD A;  4FCX A;  3C9F A;  2KKN A;  2O8A A;  4YKE A;  5DNY A;  2WDF A;  3TGH A;  1HO5 A;  3IVE A;  3QG5 C;  1WAO 1;  1S3N A;  3H60 A;  3H68 A;  3LL8 A;  2WDD A;  3DW8 C;  1NNW A;  2XMO A;  4UT3 A;  3H63 A;  5GTU A;  2Z72 A;  3RL5 A;  4KKZ A;  2P6B A;  4JA9 A;  4DSY A;  5EQV A;  3FGA C;  2HYP A;  3V4Y A;  1W24 A;  1M63 A;  1S8E A;  4O4K A;  4LTY A;  3THN A;  3AUZ A;  3ZU0 A;  1OIE A;  1Z2X A;  1S3M A;  1TCO A;  2Q8U A;  3H62 B;  3EGH A;  4UWQ A;  2O8G A;  3CK2 A;  4O43 A;  4O24 A;  1Z2W A;  3RQZ A;  3H67 A;  4FBW A;  2A22 A;  4IL1 A;  3PSO A;  4IYP C;  2Z06 A;  4H2I A;  1UF3 A;  4OR9 A;  4XPN A;  3DSD A;  3E7A A;  2HY1 A;  2NYM C;  3QFM A;  3QFN A;  1WAR A;  2DFJ A;  5B8I A;  4H1S A;  2WDC A;  3GVE A;  5INB A;  4ORA A;  1S95 A;  1V73 A;  1U32 A;  4I5L C;  4LU9 A;  5F3W A;  4ORC A;  1QHW A;  3H61 A;  1AUI A;  5JPF A;  4DT2 A;  1HPU A;  1UTE A;  1IT6 A;  2IAE C;  4TUI A;  3H66 A;  2NXF A;  3PSN A;  1QFC A; 
#chains in the Genus database with same CATH topology
 5JPE A;  1OI8 A;  2YVT A;  4UT3 B;  1XM7 A;  1S3L A;  1G5B A;  3KBP A;  4J6O A;  5HPE A;  3H69 A;  1USH A;  2CV9 A;  3QFK A;  4H1Y P;  4JA7 A;  3ZTV A;  4HD0 A;  4ORB A;  3H64 A;  1SU1 A;  3RL3 A;  3E7B A;  2NPP C;  3K7W C;  3C5W C;  2BQ8 X;  2GJU A;  3N5U A;  3FLO A;  4Q7F A;  1T70 A;  2YEQ A;  3IB7 A;  3T1I A;  4MOV A;  3D03 A;  4V0X A;  5C1V A;  3DSC A;  1JK7 A;  4H2B A;  5J28 A;  4F0Z A;  3IB8 A;  4B2O A;  3K7V C;  5JJT A;  4O5G A;  3P71 C;  1S70 A;  4TUG A;  1XZW A;  4FBQ A;  4M0V A;  2IE4 C;  4H2F A;  4NZV A;  1KBP A;  2NYL C;  2R17 A;  4UT2 A;  3HVQ A;  2QJC A;  2AHD A;  2DXN A;  1T71 A;  4MOY A;  4WWL A;  4KBP A;  2JOG A;  3QFO A;  2QFP A;  2USH A;  4LAC C;  3RL4 A;  1II7 A;  3JYF A;  4FBK A;  4I5N C;  2WDE A;  2HYO A;  4DHL A;  4ZX2 A;  3ICF A;  3THO B;  1HP1 A;  2BCD A;  5IOH A;  4G9J A;  4V0V A;  3AV0 A;  3E0J A;  4V0W A;  1MF8 A;  4MP0 A;  3EGG A;  4H2G A;  1OID A;  2IE3 C;  2BDX A;  2QFR A;  4ZVZ A;  2Z1A A;  1FJM A;  2ZBM A;  3IVD A;  4FCX A;  3C9F A;  2KKN A;  2O8A A;  4YKE A;  5DNY A;  2WDF A;  2ZOA A;  3TGH A;  1HO5 A;  3IVE A;  3QG5 C;  1WAO 1;  1S3N A;  3H60 A;  3H68 A;  3LL8 A;  2WDD A;  3DW8 C;  1NNW A;  2XMO A;  4UT3 A;  3H63 A;  5GTU A;  2Z72 A;  3RL5 A;  4KKZ A;  2P6B A;  4JA9 A;  4DSY A;  5EQV A;  3FGA C;  2HYP A;  3V4Y A;  1W24 A;  1M63 A;  1S8E A;  2DXL A;  4O4K A;  4LTY A;  3THN A;  3AUZ A;  3ZU0 A;  1OIE A;  1Z2X A;  1S3M A;  1TCO A;  2Q8U A;  3H62 B;  3EGH A;  4UWQ A;  2O8G A;  3CK2 A;  4O43 A;  4O24 A;  1Z2W A;  3RQZ A;  3H67 A;  4FBW A;  2A22 A;  4IL1 A;  3PSO A;  4IYP C;  2Z06 A;  4H2I A;  1UF3 A;  4OR9 A;  4XPN A;  3DSD A;  3E7A A;  2HY1 A;  2NYM C;  3QFM A;  3QFN A;  1WAR A;  2DFJ A;  5B8I A;  4H1S A;  2WDC A;  3GVE A;  5INB A;  4ORA A;  1S95 A;  1V73 A;  1U32 A;  4I5L C;  4LU9 A;  5F3W A;  4ORC A;  2ZO9 B;  1QHW A;  3H61 A;  1AUI A;  5JPF A;  4DT2 A;  1HPU A;  1UTE A;  1IT6 A;  2IAE C;  4TUI A;  3H66 A;  2NXF A;  3PSN A;  1QFC A; 
#chains in the Genus database with same CATH homology
 5JPE A;  1OI8 A;  2YVT A;  4UT3 B;  1XM7 A;  1S3L A;  1G5B A;  3KBP A;  4J6O A;  5HPE A;  3H69 A;  1USH A;  2CV9 A;  3QFK A;  4H1Y P;  4JA7 A;  3ZTV A;  4HD0 A;  4ORB A;  3H64 A;  1SU1 A;  3RL3 A;  3E7B A;  2NPP C;  3K7W C;  3C5W C;  2BQ8 X;  2GJU A;  3N5U A;  3FLO A;  4Q7F A;  1T70 A;  2YEQ A;  3IB7 A;  3T1I A;  4MOV A;  3D03 A;  4V0X A;  5C1V A;  3DSC A;  1JK7 A;  4H2B A;  5J28 A;  4F0Z A;  3IB8 A;  4B2O A;  3K7V C;  5JJT A;  4O5G A;  3P71 C;  1S70 A;  4TUG A;  1XZW A;  4FBQ A;  4M0V A;  2IE4 C;  4H2F A;  4NZV A;  1KBP A;  2NYL C;  2R17 A;  4UT2 A;  3HVQ A;  2QJC A;  2AHD A;  2DXN A;  1T71 A;  4MOY A;  4WWL A;  4KBP A;  2JOG A;  3QFO A;  2QFP A;  2USH A;  4LAC C;  3RL4 A;  1II7 A;  3JYF A;  4FBK A;  4I5N C;  2WDE A;  2HYO A;  4DHL A;  4ZX2 A;  3ICF A;  3THO B;  1HP1 A;  2BCD A;  5IOH A;  4G9J A;  4V0V A;  3AV0 A;  3E0J A;  4V0W A;  1MF8 A;  4MP0 A;  3EGG A;  4H2G A;  1OID A;  2IE3 C;  2BDX A;  2QFR A;  4ZVZ A;  2Z1A A;  1FJM A;  2ZBM A;  3IVD A;  4FCX A;  3C9F A;  2KKN A;  2O8A A;  4YKE A;  5DNY A;  2WDF A;  2ZOA A;  3TGH A;  1HO5 A;  3IVE A;  3QG5 C;  1WAO 1;  1S3N A;  3H60 A;  3H68 A;  3LL8 A;  2WDD A;  3DW8 C;  1NNW A;  2XMO A;  4UT3 A;  3H63 A;  5GTU A;  2Z72 A;  3RL5 A;  4KKZ A;  2P6B A;  4JA9 A;  4DSY A;  5EQV A;  3FGA C;  2HYP A;  3V4Y A;  1W24 A;  1M63 A;  1S8E A;  2DXL A;  4O4K A;  4LTY A;  3THN A;  3AUZ A;  3ZU0 A;  1OIE A;  1Z2X A;  1S3M A;  1TCO A;  2Q8U A;  3H62 B;  3EGH A;  4UWQ A;  2O8G A;  3CK2 A;  4O43 A;  4O24 A;  1Z2W A;  3RQZ A;  3H67 A;  4FBW A;  2A22 A;  4IL1 A;  3PSO A;  4IYP C;  2Z06 A;  4H2I A;  1UF3 A;  4OR9 A;  4XPN A;  3DSD A;  3E7A A;  2HY1 A;  2NYM C;  3QFM A;  3QFN A;  1WAR A;  2DFJ A;  5B8I A;  4H1S A;  2WDC A;  3GVE A;  5INB A;  4ORA A;  1S95 A;  1V73 A;  1U32 A;  4I5L C;  4LU9 A;  5F3W A;  4ORC A;  2ZO9 B;  1QHW A;  3H61 A;  1AUI A;  5JPF A;  4DT2 A;  1HPU A;  1UTE A;  1IT6 A;  2IAE C;  4TUI A;  3H66 A;  2NXF A;  3PSN A;  1QFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...