4V0WA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-669)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 111
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0wA00
3DSCA 3N5UA 3K7VC 3THNA 1OI8A 2QJCA 5JJTA 5C1VA 1WARA 4DT2A 3DSDA 4WWLA 3EGGA 1T70A 1G5BA 3RL5A 3AV0A 4V0WA 4LACC 3E7BA 3QG5C 4XPNA 1II7A 2WDDA 2WDFA 1V73A 1SU1A 4B2OA 4OR9A 4MOVA 4DSYA 3H61A 1HP1A 2AHDA 1HPUA 1UF3A 3THOB 4ZVZA 3IB7A 4UT3A 2BQ8X 2KKNA 4O43A 3ZU0A 3DW8C 3EGHA 4I5LC 1T71A 4LU9A 1HO5A 2XMOA 3QFMA 5JPFA 1USHA 2HY1A 3QFKA 2Z1AA 1S3LA 5EQVA 1OIDA 4MP0A 1OIEA 4F0ZA 1JK7A 2Z06A 2NXFA 4H1YP 3ZTVA 1S8EA 2IE4C 4FBWA 3HVQA 3T1IA 2ZBMA 2QFRA 4J6OA 4UT3B 5JPEA 2O8GA 2IAEC 4NZVA 5J28A 4FCXA 1S70A 2DFJA 4KKZA 5IOHA 2R17A 2GJUA 3C9FA 4FBQA 4Q7FA 5GTUA 3JYFA 5B8IA 4TUGA 3CK2A 4MOYA 4O24A 5INBA 2IE3C 4H2IA 2WDEA 2YVTA 2Z72A 3P71C 4I5NC 1QFCA 2O8AA 3QFNA 3GVEA 4M0VA 4V0XA 1AUIA 1Z2WA 1MF8A 3RQZA 1NNWA 2HYOA 3LL8A 1S95A 3KBPA 1S3NA 2CV9A 4JA9A 2HYPA 2BDXA 2WDCA 3PSOA 3QFOA 4G9JA 4HD0A 1UTEA 4H2GA 4IYPC 1U32A 3H60A 1FJMA 3H67A 4ORBA 3H69A 3RL4A 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 4FBKA 5HPEA 4ORAA 4V0VA 4ZX2A 2NPPC 2NYLC 4IL1A 3PSNA 3IVDA 4JA7A 4YKEA 3FGAC 2P6BA 3TGHA 2QFPA 1WAO1 3K7WC 3IVEA 4H1SA 1KBPA 5DNYA 4UWQA 4LTYA 3IB8A 3ICFA 4ORCA 1S3MA 1QHWA 1IT6A 2A22A 1W24A 3RL3A 2JOGA 1Z2XA 4H2FA 4O4KA 2BCDA 4O5GA 3E7AA 1M63A 4UT2A 1XZWA 5F3WA 4H2BA 3C5WC 4KBPA 4DHLA 1TCOA 2NYMC 3H63A 3H66A 2USHA 3H68A 3H62B 4TUIA
chains in the Genus database with same CATH superfamily
3DSCA 3N5UA 3K7VC 3THNA 1OI8A 2QJCA 5JJTA 5C1VA 1WARA 4DT2A 3DSDA 4WWLA 3EGGA 1T70A 1G5BA 3RL5A 3AV0A 4V0WA 4LACC 3E7BA 3QG5C 4XPNA 1II7A 2WDDA 2WDFA 1V73A 1SU1A 4B2OA 4OR9A 4MOVA 4DSYA 3H61A 1HP1A 2AHDA 1HPUA 1UF3A 3THOB 3FLOA 4ZVZA 3IB7A 4UT3A 2BQ8X 2KKNA 4O43A 3ZU0A 3DW8C 3EGHA 4I5LC 1T71A 4LU9A 1HO5A 2XMOA 3QFMA 5JPFA 1USHA 2HY1A 3QFKA 2Z1AA 1S3LA 5EQVA 1OIDA 4MP0A 1OIEA 4F0ZA 1JK7A 2YEQA 2Z06A 2NXFA 4H1YP 3ZTVA 1S8EA 2IE4C 4FBWA 3HVQA 3T1IA 2ZBMA 2QFRA 4J6OA 4UT3B 5JPEA 2O8GA 2IAEC 4NZVA 5J28A 4FCXA 1S70A 2DFJA 4KKZA 5IOHA 2R17A 2GJUA 3C9FA 4FBQA 4Q7FA 3E0JA 5GTUA 3JYFA 5B8IA 4TUGA 3CK2A 4MOYA 4O24A 5INBA 2IE3C 4H2IA 2WDEA 2YVTA 2Z72A 3P71C 4I5NC 1QFCA 2O8AA 3QFNA 3GVEA 4M0VA 4V0XA 1AUIA 1Z2WA 1MF8A 3RQZA 1NNWA 2HYOA 3LL8A 1S95A 3KBPA 1S3NA 2CV9A 4JA9A 2HYPA 2BDXA 2WDCA 3PSOA 3QFOA 4G9JA 4HD0A 1UTEA 4H2GA 4IYPC 1U32A 3H60A 1FJMA 3H67A 4ORBA 3H69A 3RL4A 2ZO9B 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 4FBKA 5HPEA 4ORAA 4V0VA 4ZX2A 2NPPC 2NYLC 2ZOAA 4IL1A 3PSNA 3IVDA 4JA7A 4YKEA 3FGAC 2P6BA 3TGHA 2QFPA 1WAO1 3D03A 3K7WC 3IVEA 4H1SA 1KBPA 5DNYA 4UWQA 4LTYA 3IB8A 3ICFA 4ORCA 1S3MA 1QHWA 2DXNA 1IT6A 2A22A 1W24A 2DXLA 3RL3A 2JOGA 1Z2XA 4H2FA 4O4KA 2BCDA 4O5GA 3E7AA 1M63A 4UT2A 1XZWA 5F3WA 4H2BA 3C5WC 4KBPA 4DHLA 1TCOA 2NYMC 3H63A 3H66A 2USHA 3H68A 3H62B 4TUIA
chains in the Genus database with same CATH topology
3DSCA 3N5UA 3K7VC 3THNA 1OI8A 2QJCA 5JJTA 5C1VA 1WARA 4DT2A 3DSDA 4WWLA 3EGGA 1T70A 1G5BA 3RL5A 3AV0A 4V0WA 4LACC 3E7BA 3QG5C 4XPNA 1II7A 2WDDA 2WDFA 1V73A 1SU1A 4B2OA 4OR9A 4MOVA 4DSYA 3H61A 1HP1A 2AHDA 1HPUA 1UF3A 3THOB 3FLOA 4ZVZA 3IB7A 4UT3A 2BQ8X 2KKNA 4O43A 3ZU0A 3DW8C 3EGHA 4I5LC 1T71A 4LU9A 1HO5A 2XMOA 3QFMA 5JPFA 1USHA 2HY1A 3QFKA 2Z1AA 1S3LA 5EQVA 1OIDA 4MP0A 1OIEA 4F0ZA 1JK7A 2YEQA 2Z06A 2NXFA 4H1YP 3ZTVA 1S8EA 2IE4C 4FBWA 3HVQA 3T1IA 2ZBMA 2QFRA 4J6OA 4UT3B 5JPEA 2O8GA 2IAEC 4NZVA 5J28A 4FCXA 1S70A 2DFJA 4KKZA 5IOHA 2R17A 2GJUA 3C9FA 4FBQA 4Q7FA 3E0JA 5GTUA 3JYFA 5B8IA 4TUGA 3CK2A 4MOYA 4O24A 5INBA 2IE3C 4H2IA 2WDEA 2YVTA 2Z72A 3P71C 4I5NC 1QFCA 2O8AA 3QFNA 3GVEA 4M0VA 4V0XA 1AUIA 1Z2WA 1MF8A 3RQZA 1NNWA 2HYOA 3LL8A 1S95A 3KBPA 1S3NA 2CV9A 4JA9A 2HYPA 2BDXA 2WDCA 3PSOA 3QFOA 4G9JA 4HD0A 1UTEA 4H2GA 4IYPC 1U32A 3H60A 1FJMA 3H67A 4ORBA 3H69A 3RL4A 2ZO9B 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 4FBKA 5HPEA 4ORAA 4V0VA 4ZX2A 2NPPC 2NYLC 2ZOAA 4IL1A 3PSNA 3IVDA 4JA7A 4YKEA 3FGAC 2P6BA 3TGHA 2QFPA 1WAO1 3D03A 3K7WC 3IVEA 4H1SA 1KBPA 5DNYA 4UWQA 4LTYA 3IB8A 3ICFA 4ORCA 1S3MA 1QHWA 2DXNA 1IT6A 2A22A 1W24A 2DXLA 3RL3A 2JOGA 1Z2XA 4H2FA 4O4KA 2BCDA 4O5GA 3E7AA 1M63A 4UT2A 1XZWA 5F3WA 4H2BA 3C5WC 4KBPA 4DHLA 1TCOA 2NYMC 3H63A 3H66A 2USHA 3H68A 3H62B 4TUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSC A;  3N5U A;  3K7V C;  3THN A;  1OI8 A;  2QJC A;  5JJT A;  5C1V A;  1WAR A;  4DT2 A;  3DSD A;  4WWL A;  3EGG A;  1T70 A;  1G5B A;  3RL5 A;  3AV0 A;  4V0W A;  4LAC C;  3E7B A;  3QG5 C;  4XPN A;  1II7 A;  2WDD A;  2WDF A;  1V73 A;  1SU1 A;  4B2O A;  4OR9 A;  4MOV A;  4DSY A;  3H61 A;  1HP1 A;  2AHD A;  1HPU A;  1UF3 A;  3THO B;  4ZVZ A;  3IB7 A;  4UT3 A;  2BQ8 X;  2KKN A;  4O43 A;  3ZU0 A;  3DW8 C;  3EGH A;  4I5L C;  1T71 A;  4LU9 A;  1HO5 A;  2XMO A;  3QFM A;  5JPF A;  1USH A;  2HY1 A;  3QFK A;  2Z1A A;  1S3L A;  5EQV A;  1OID A;  4MP0 A;  1OIE A;  4F0Z A;  1JK7 A;  2Z06 A;  2NXF A;  4H1Y P;  3ZTV A;  1S8E A;  2IE4 C;  4FBW A;  3HVQ A;  3T1I A;  2ZBM A;  2QFR A;  4J6O A;  4UT3 B;  5JPE A;  2O8G A;  2IAE C;  4NZV A;  5J28 A;  4FCX A;  1S70 A;  2DFJ A;  4KKZ A;  5IOH A;  2R17 A;  2GJU A;  3C9F A;  4FBQ A;  4Q7F A;  5GTU A;  3JYF A;  5B8I A;  4TUG A;  3CK2 A;  4MOY A;  4O24 A;  5INB A;  2IE3 C;  4H2I A;  2WDE A;  2YVT A;  2Z72 A;  3P71 C;  4I5N C;  1QFC A;  2O8A A;  3QFN A;  3GVE A;  4M0V A;  4V0X A;  1AUI A;  1Z2W A;  1MF8 A;  3RQZ A;  1NNW A;  2HYO A;  3LL8 A;  1S95 A;  3KBP A;  1S3N A;  2CV9 A;  4JA9 A;  2HYP A;  2BDX A;  2WDC A;  3PSO A;  3QFO A;  4G9J A;  4HD0 A;  1UTE A;  4H2G A;  4IYP C;  1U32 A;  3H60 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  3RL4 A;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  4FBK A;  5HPE A;  4ORA A;  4V0V A;  4ZX2 A;  2NPP C;  2NYL C;  4IL1 A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  3FGA C;  2P6B A;  3TGH A;  2QFP A;  1WAO 1;  3K7W C;  3IVE A;  4H1S A;  1KBP A;  5DNY A;  4UWQ A;  4LTY A;  3IB8 A;  3ICF A;  4ORC A;  1S3M A;  1QHW A;  1IT6 A;  2A22 A;  1W24 A;  3RL3 A;  2JOG A;  1Z2X A;  4H2F A;  4O4K A;  2BCD A;  4O5G A;  3E7A A;  1M63 A;  4UT2 A;  1XZW A;  5F3W A;  4H2B A;  3C5W C;  4KBP A;  4DHL A;  1TCO A;  2NYM C;  3H63 A;  3H66 A;  2USH A;  3H68 A;  3H62 B;  4TUI A; 
#chains in the Genus database with same CATH topology
 3DSC A;  3N5U A;  3K7V C;  3THN A;  1OI8 A;  2QJC A;  5JJT A;  5C1V A;  1WAR A;  4DT2 A;  3DSD A;  4WWL A;  3EGG A;  1T70 A;  1G5B A;  3RL5 A;  3AV0 A;  4V0W A;  4LAC C;  3E7B A;  3QG5 C;  4XPN A;  1II7 A;  2WDD A;  2WDF A;  1V73 A;  1SU1 A;  4B2O A;  4OR9 A;  4MOV A;  4DSY A;  3H61 A;  1HP1 A;  2AHD A;  1HPU A;  1UF3 A;  3THO B;  3FLO A;  4ZVZ A;  3IB7 A;  4UT3 A;  2BQ8 X;  2KKN A;  4O43 A;  3ZU0 A;  3DW8 C;  3EGH A;  4I5L C;  1T71 A;  4LU9 A;  1HO5 A;  2XMO A;  3QFM A;  5JPF A;  1USH A;  2HY1 A;  3QFK A;  2Z1A A;  1S3L A;  5EQV A;  1OID A;  4MP0 A;  1OIE A;  4F0Z A;  1JK7 A;  2YEQ A;  2Z06 A;  2NXF A;  4H1Y P;  3ZTV A;  1S8E A;  2IE4 C;  4FBW A;  3HVQ A;  3T1I A;  2ZBM A;  2QFR A;  4J6O A;  4UT3 B;  5JPE A;  2O8G A;  2IAE C;  4NZV A;  5J28 A;  4FCX A;  1S70 A;  2DFJ A;  4KKZ A;  5IOH A;  2R17 A;  2GJU A;  3C9F A;  4FBQ A;  4Q7F A;  3E0J A;  5GTU A;  3JYF A;  5B8I A;  4TUG A;  3CK2 A;  4MOY A;  4O24 A;  5INB A;  2IE3 C;  4H2I A;  2WDE A;  2YVT A;  2Z72 A;  3P71 C;  4I5N C;  1QFC A;  2O8A A;  3QFN A;  3GVE A;  4M0V A;  4V0X A;  1AUI A;  1Z2W A;  1MF8 A;  3RQZ A;  1NNW A;  2HYO A;  3LL8 A;  1S95 A;  3KBP A;  1S3N A;  2CV9 A;  4JA9 A;  2HYP A;  2BDX A;  2WDC A;  3PSO A;  3QFO A;  4G9J A;  4HD0 A;  1UTE A;  4H2G A;  4IYP C;  1U32 A;  3H60 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  3RL4 A;  2ZO9 B;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  4FBK A;  5HPE A;  4ORA A;  4V0V A;  4ZX2 A;  2NPP C;  2NYL C;  2ZOA A;  4IL1 A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  3FGA C;  2P6B A;  3TGH A;  2QFP A;  1WAO 1;  3D03 A;  3K7W C;  3IVE A;  4H1S A;  1KBP A;  5DNY A;  4UWQ A;  4LTY A;  3IB8 A;  3ICF A;  4ORC A;  1S3M A;  1QHW A;  2DXN A;  1IT6 A;  2A22 A;  1W24 A;  2DXL A;  3RL3 A;  2JOG A;  1Z2X A;  4H2F A;  4O4K A;  2BCD A;  4O5G A;  3E7A A;  1M63 A;  4UT2 A;  1XZW A;  5F3W A;  4H2B A;  3C5W C;  4KBP A;  4DHL A;  1TCO A;  2NYM C;  3H63 A;  3H66 A;  2USH A;  3H68 A;  3H62 B;  4TUI A; 
#chains in the Genus database with same CATH homology
 3DSC A;  3N5U A;  3K7V C;  3THN A;  1OI8 A;  2QJC A;  5JJT A;  5C1V A;  1WAR A;  4DT2 A;  3DSD A;  4WWL A;  3EGG A;  1T70 A;  1G5B A;  3RL5 A;  3AV0 A;  4V0W A;  4LAC C;  3E7B A;  3QG5 C;  4XPN A;  1II7 A;  2WDD A;  2WDF A;  1V73 A;  1SU1 A;  4B2O A;  4OR9 A;  4MOV A;  4DSY A;  3H61 A;  1HP1 A;  2AHD A;  1HPU A;  1UF3 A;  3THO B;  3FLO A;  4ZVZ A;  3IB7 A;  4UT3 A;  2BQ8 X;  2KKN A;  4O43 A;  3ZU0 A;  3DW8 C;  3EGH A;  4I5L C;  1T71 A;  4LU9 A;  1HO5 A;  2XMO A;  3QFM A;  5JPF A;  1USH A;  2HY1 A;  3QFK A;  2Z1A A;  1S3L A;  5EQV A;  1OID A;  4MP0 A;  1OIE A;  4F0Z A;  1JK7 A;  2YEQ A;  2Z06 A;  2NXF A;  4H1Y P;  3ZTV A;  1S8E A;  2IE4 C;  4FBW A;  3HVQ A;  3T1I A;  2ZBM A;  2QFR A;  4J6O A;  4UT3 B;  5JPE A;  2O8G A;  2IAE C;  4NZV A;  5J28 A;  4FCX A;  1S70 A;  2DFJ A;  4KKZ A;  5IOH A;  2R17 A;  2GJU A;  3C9F A;  4FBQ A;  4Q7F A;  3E0J A;  5GTU A;  3JYF A;  5B8I A;  4TUG A;  3CK2 A;  4MOY A;  4O24 A;  5INB A;  2IE3 C;  4H2I A;  2WDE A;  2YVT A;  2Z72 A;  3P71 C;  4I5N C;  1QFC A;  2O8A A;  3QFN A;  3GVE A;  4M0V A;  4V0X A;  1AUI A;  1Z2W A;  1MF8 A;  3RQZ A;  1NNW A;  2HYO A;  3LL8 A;  1S95 A;  3KBP A;  1S3N A;  2CV9 A;  4JA9 A;  2HYP A;  2BDX A;  2WDC A;  3PSO A;  3QFO A;  4G9J A;  4HD0 A;  1UTE A;  4H2G A;  4IYP C;  1U32 A;  3H60 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  3RL4 A;  2ZO9 B;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  4FBK A;  5HPE A;  4ORA A;  4V0V A;  4ZX2 A;  2NPP C;  2NYL C;  2ZOA A;  4IL1 A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  3FGA C;  2P6B A;  3TGH A;  2QFP A;  1WAO 1;  3D03 A;  3K7W C;  3IVE A;  4H1S A;  1KBP A;  5DNY A;  4UWQ A;  4LTY A;  3IB8 A;  3ICF A;  4ORC A;  1S3M A;  1QHW A;  2DXN A;  1IT6 A;  2A22 A;  1W24 A;  2DXL A;  3RL3 A;  2JOG A;  1Z2X A;  4H2F A;  4O4K A;  2BCD A;  4O5G A;  3E7A A;  1M63 A;  4UT2 A;  1XZW A;  5F3W A;  4H2B A;  3C5W C;  4KBP A;  4DHL A;  1TCO A;  2NYM C;  3H63 A;  3H66 A;  2USH A;  3H68 A;  3H62 B;  4TUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...