4V0XA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-684)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
293
Chain Sequence
MLNIDSIIQRLLEVRGSGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
total genus 100
structure length 293
sequence length 295
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0xA00
3H67A 4KBPA 5JPEA 3V4YA 4IYPC 5B8IA 3H63A 5EQVA 2QFPA 1HP1A 4ORCA 2NXFA 4V0WA 3GVEA 1WAO1 4V0VA 5JPFA 1AUIA 4H2FA 3IB8A 3H61A 3FGAC 1II7A 2O8GA 3AV0A 2HYPA 4TUGA 1G5BA 3PSNA 2DFJA 3RL5A 1SU1A 1V73A 1XM7A 2WDEA 1OI8A 3H62B 2WDCA 3DSCA 4TUIA 2KKNA 2Z72A 3RQZA 1USHA 1S95A 2R17A 3K7WC 1WARA 4JA7A 5IOHA 4XPNA 1HO5A 4H2IA 3THNA 3THOB 2Z1AA 2CV9A 3QFNA 1W24A 4UT2A 3IVDA 3JYFA 2O8AA 4IL1A 3QFOA 2IE3C 4Q7FA 2BQ8X 4M0VA 4H2BA 2JOGA 4LTYA 2NYLC 2Z06A 4O43A 4I5LC 4UT3A 1NNWA 2GJUA 2NPPC 4MOVA 1T70A 3H68A 1S3LA 1S8EA 2XMOA 3EGHA 3N5UA 4FCXA 3C9FA 3H60A 1Z2XA 4ORAA 1OIDA 4JA9A 4DT2A 4H1YP 2P6BA 3ZTVA 1OIEA 2BDXA 1TCOA 1UTEA 2A22A 1Z2WA 2Q8UA 4ZVZA 4FBWA 3TGHA 3RL3A 5DNYA 4DHLA 3H64A 4ORBA 4H2GA 3H69A 3QG5C 2WDDA 4J6OA 2YVTA 3KBPA 4LU9A 4V0XA 5C1VA 2QFRA 4O5GA 4LACC 3T1IA 3E7BA 3CK2A 1M63A 2HY1A 3ICFA 2WDFA 3K7VC 1U32A 5GTUA 3DSDA 1MF8A 1IT6A 4NZVA 3HVQA 2BCDA 4UT3B 4DSYA 3RL4A 5HPEA 5J28A 3QFMA 1JK7A 2NYMC 2IE4C 3IVEA 3ZU0A 3DW8C 3EGGA 4OR9A 1UF3A 3P71C 5JJTA 4ZX2A 4HD0A 4FBKA 1KBPA 4H1SA 4KKZA 4G9JA 3E7AA 2HYOA 4FBQA 4WWLA 3PSOA 1HPUA 4MOYA 1FJMA 4O24A 1S70A 3H66A 3IB7A 2QJCA 3C5WC 4F0ZA 4MP0A 5INBA 2AHDA 1T71A 1XZWA 1S3MA 4O4KA 4YKEA 2ZBMA 3LL8A 1QFCA 3QFKA 1QHWA 1S3NA 2USHA 3AUZA 4I5NC 4B2OA 5F3WA 2IAEC 4UWQA
chains in the Genus database with same CATH superfamily
3H67A 4KBPA 5JPEA 3V4YA 4IYPC 5B8IA 3H63A 5EQVA 2QFPA 1HP1A 2ZO9B 4ORCA 2NXFA 4V0WA 3GVEA 1WAO1 4V0VA 5JPFA 1AUIA 4H2FA 3IB8A 3H61A 3FGAC 1II7A 2O8GA 3AV0A 2HYPA 2DXLA 4TUGA 1G5BA 3PSNA 2DFJA 3RL5A 1SU1A 1V73A 1XM7A 2WDEA 1OI8A 3H62B 2WDCA 3DSCA 4TUIA 2KKNA 2Z72A 3RQZA 1USHA 1S95A 2R17A 3K7WC 1WARA 4JA7A 5IOHA 4XPNA 1HO5A 4H2IA 3THNA 3THOB 2Z1AA 2CV9A 3QFNA 1W24A 4UT2A 3IVDA 3JYFA 2O8AA 4IL1A 2DXNA 2IE3C 3QFOA 4Q7FA 2BQ8X 4M0VA 4H2BA 2JOGA 4LTYA 2NYLC 2Z06A 4O43A 4I5LC 4UT3A 1NNWA 3E0JA 2GJUA 2NPPC 4MOVA 1T70A 3H68A 1S3LA 1S8EA 2XMOA 3EGHA 3N5UA 4FCXA 3C9FA 3H60A 1Z2XA 4ORAA 1OIDA 4JA9A 4DT2A 4H1YP 2P6BA 3ZTVA 1OIEA 2BDXA 1TCOA 1UTEA 2A22A 1Z2WA 2Q8UA 2ZOAA 4ZVZA 4FBWA 3TGHA 3RL3A 5DNYA 4DHLA 3H64A 4ORBA 4H2GA 3H69A 3QG5C 2WDDA 2YEQA 4J6OA 2YVTA 3KBPA 4LU9A 4V0XA 5C1VA 2QFRA 4O5GA 4LACC 3T1IA 3E7BA 3CK2A 1M63A 2HY1A 3ICFA 2WDFA 3K7VC 1U32A 5GTUA 3DSDA 1MF8A 1IT6A 4NZVA 3HVQA 2BCDA 4UT3B 4DSYA 3RL4A 5HPEA 5J28A 3FLOA 3QFMA 1JK7A 2NYMC 2IE4C 3IVEA 3ZU0A 3DW8C 3EGGA 4OR9A 1UF3A 3P71C 5JJTA 4ZX2A 4HD0A 4FBKA 1KBPA 4H1SA 4KKZA 4G9JA 3E7AA 2HYOA 4FBQA 4WWLA 3PSOA 1HPUA 4MOYA 1FJMA 4O24A 1S70A 3H66A 3IB7A 2QJCA 3C5WC 4F0ZA 4MP0A 5INBA 2AHDA 1T71A 1XZWA 1S3MA 4O4KA 4YKEA 2ZBMA 3LL8A 1QFCA 3QFKA 1QHWA 1S3NA 2USHA 3AUZA 4I5NC 4B2OA 5F3WA 2IAEC 3D03A 4UWQA
chains in the Genus database with same CATH topology
3H67A 4KBPA 5JPEA 3V4YA 4IYPC 5B8IA 3H63A 5EQVA 2QFPA 1HP1A 2ZO9B 4ORCA 2NXFA 4V0WA 3GVEA 1WAO1 4V0VA 5JPFA 1AUIA 4H2FA 3IB8A 3H61A 3FGAC 1II7A 2O8GA 3AV0A 2HYPA 2DXLA 4TUGA 1G5BA 3PSNA 2DFJA 3RL5A 1SU1A 1V73A 1XM7A 2WDEA 1OI8A 3H62B 2WDCA 3DSCA 4TUIA 2KKNA 2Z72A 3RQZA 1USHA 1S95A 2R17A 3K7WC 1WARA 4JA7A 5IOHA 4XPNA 1HO5A 4H2IA 3THNA 3THOB 2Z1AA 2CV9A 3QFNA 1W24A 4UT2A 3IVDA 3JYFA 2O8AA 4IL1A 2DXNA 2IE3C 3QFOA 4Q7FA 2BQ8X 4M0VA 4H2BA 2JOGA 4LTYA 2NYLC 2Z06A 4O43A 4I5LC 4UT3A 1NNWA 3E0JA 2GJUA 2NPPC 4MOVA 1T70A 3H68A 1S3LA 1S8EA 2XMOA 3EGHA 3N5UA 4FCXA 3C9FA 3H60A 1Z2XA 4ORAA 1OIDA 4JA9A 4DT2A 4H1YP 2P6BA 3ZTVA 1OIEA 2BDXA 1TCOA 1UTEA 2A22A 1Z2WA 2Q8UA 2ZOAA 4ZVZA 4FBWA 3TGHA 3RL3A 5DNYA 4DHLA 3H64A 4ORBA 4H2GA 3H69A 3QG5C 2WDDA 2YEQA 4J6OA 2YVTA 3KBPA 4LU9A 4V0XA 5C1VA 2QFRA 4O5GA 4LACC 3T1IA 3E7BA 3CK2A 1M63A 2HY1A 3ICFA 2WDFA 3K7VC 1U32A 5GTUA 3DSDA 1MF8A 1IT6A 4NZVA 3HVQA 2BCDA 4UT3B 4DSYA 3RL4A 5HPEA 5J28A 3FLOA 3QFMA 1JK7A 2NYMC 2IE4C 3IVEA 3ZU0A 3DW8C 3EGGA 4OR9A 1UF3A 3P71C 5JJTA 4ZX2A 4HD0A 4FBKA 1KBPA 4H1SA 4KKZA 4G9JA 3E7AA 2HYOA 4FBQA 4WWLA 3PSOA 1HPUA 4MOYA 1FJMA 4O24A 1S70A 3H66A 3IB7A 2QJCA 3C5WC 4F0ZA 4MP0A 5INBA 2AHDA 1T71A 1XZWA 1S3MA 4O4KA 4YKEA 2ZBMA 3LL8A 1QFCA 3QFKA 1QHWA 1S3NA 2USHA 3AUZA 4I5NC 4B2OA 5F3WA 2IAEC 3D03A 4UWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H67 A;  4KBP A;  5JPE A;  3V4Y A;  4IYP C;  5B8I A;  3H63 A;  5EQV A;  2QFP A;  1HP1 A;  4ORC A;  2NXF A;  4V0W A;  3GVE A;  1WAO 1;  4V0V A;  5JPF A;  1AUI A;  4H2F A;  3IB8 A;  3H61 A;  3FGA C;  1II7 A;  2O8G A;  3AV0 A;  2HYP A;  4TUG A;  1G5B A;  3PSN A;  2DFJ A;  3RL5 A;  1SU1 A;  1V73 A;  1XM7 A;  2WDE A;  1OI8 A;  3H62 B;  2WDC A;  3DSC A;  4TUI A;  2KKN A;  2Z72 A;  3RQZ A;  1USH A;  1S95 A;  2R17 A;  3K7W C;  1WAR A;  4JA7 A;  5IOH A;  4XPN A;  1HO5 A;  4H2I A;  3THN A;  3THO B;  2Z1A A;  2CV9 A;  3QFN A;  1W24 A;  4UT2 A;  3IVD A;  3JYF A;  2O8A A;  4IL1 A;  3QFO A;  2IE3 C;  4Q7F A;  2BQ8 X;  4M0V A;  4H2B A;  2JOG A;  4LTY A;  2NYL C;  2Z06 A;  4O43 A;  4I5L C;  4UT3 A;  1NNW A;  2GJU A;  2NPP C;  4MOV A;  1T70 A;  3H68 A;  1S3L A;  1S8E A;  2XMO A;  3EGH A;  3N5U A;  4FCX A;  3C9F A;  3H60 A;  1Z2X A;  4ORA A;  1OID A;  4JA9 A;  4DT2 A;  4H1Y P;  2P6B A;  3ZTV A;  1OIE A;  2BDX A;  1TCO A;  1UTE A;  2A22 A;  1Z2W A;  2Q8U A;  4ZVZ A;  4FBW A;  3TGH A;  3RL3 A;  5DNY A;  4DHL A;  3H64 A;  4ORB A;  4H2G A;  3H69 A;  3QG5 C;  2WDD A;  4J6O A;  2YVT A;  3KBP A;  4LU9 A;  4V0X A;  5C1V A;  2QFR A;  4O5G A;  4LAC C;  3T1I A;  3E7B A;  3CK2 A;  1M63 A;  2HY1 A;  3ICF A;  2WDF A;  3K7V C;  1U32 A;  5GTU A;  3DSD A;  1MF8 A;  1IT6 A;  4NZV A;  3HVQ A;  2BCD A;  4UT3 B;  4DSY A;  3RL4 A;  5HPE A;  5J28 A;  3QFM A;  1JK7 A;  2NYM C;  2IE4 C;  3IVE A;  3ZU0 A;  3DW8 C;  3EGG A;  4OR9 A;  1UF3 A;  3P71 C;  5JJT A;  4ZX2 A;  4HD0 A;  4FBK A;  1KBP A;  4H1S A;  4KKZ A;  4G9J A;  3E7A A;  2HYO A;  4FBQ A;  4WWL A;  3PSO A;  1HPU A;  4MOY A;  1FJM A;  4O24 A;  1S70 A;  3H66 A;  3IB7 A;  2QJC A;  3C5W C;  4F0Z A;  4MP0 A;  5INB A;  2AHD A;  1T71 A;  1XZW A;  1S3M A;  4O4K A;  4YKE A;  2ZBM A;  3LL8 A;  1QFC A;  3QFK A;  1QHW A;  1S3N A;  2USH A;  3AUZ A;  4I5N C;  4B2O A;  5F3W A;  2IAE C;  4UWQ A; 
#chains in the Genus database with same CATH topology
 3H67 A;  4KBP A;  5JPE A;  3V4Y A;  4IYP C;  5B8I A;  3H63 A;  5EQV A;  2QFP A;  1HP1 A;  2ZO9 B;  4ORC A;  2NXF A;  4V0W A;  3GVE A;  1WAO 1;  4V0V A;  5JPF A;  1AUI A;  4H2F A;  3IB8 A;  3H61 A;  3FGA C;  1II7 A;  2O8G A;  3AV0 A;  2HYP A;  2DXL A;  4TUG A;  1G5B A;  3PSN A;  2DFJ A;  3RL5 A;  1SU1 A;  1V73 A;  1XM7 A;  2WDE A;  1OI8 A;  3H62 B;  2WDC A;  3DSC A;  4TUI A;  2KKN A;  2Z72 A;  3RQZ A;  1USH A;  1S95 A;  2R17 A;  3K7W C;  1WAR A;  4JA7 A;  5IOH A;  4XPN A;  1HO5 A;  4H2I A;  3THN A;  3THO B;  2Z1A A;  2CV9 A;  3QFN A;  1W24 A;  4UT2 A;  3IVD A;  3JYF A;  2O8A A;  4IL1 A;  2DXN A;  2IE3 C;  3QFO A;  4Q7F A;  2BQ8 X;  4M0V A;  4H2B A;  2JOG A;  4LTY A;  2NYL C;  2Z06 A;  4O43 A;  4I5L C;  4UT3 A;  1NNW A;  3E0J A;  2GJU A;  2NPP C;  4MOV A;  1T70 A;  3H68 A;  1S3L A;  1S8E A;  2XMO A;  3EGH A;  3N5U A;  4FCX A;  3C9F A;  3H60 A;  1Z2X A;  4ORA A;  1OID A;  4JA9 A;  4DT2 A;  4H1Y P;  2P6B A;  3ZTV A;  1OIE A;  2BDX A;  1TCO A;  1UTE A;  2A22 A;  1Z2W A;  2Q8U A;  2ZOA A;  4ZVZ A;  4FBW A;  3TGH A;  3RL3 A;  5DNY A;  4DHL A;  3H64 A;  4ORB A;  4H2G A;  3H69 A;  3QG5 C;  2WDD A;  2YEQ A;  4J6O A;  2YVT A;  3KBP A;  4LU9 A;  4V0X A;  5C1V A;  2QFR A;  4O5G A;  4LAC C;  3T1I A;  3E7B A;  3CK2 A;  1M63 A;  2HY1 A;  3ICF A;  2WDF A;  3K7V C;  1U32 A;  5GTU A;  3DSD A;  1MF8 A;  1IT6 A;  4NZV A;  3HVQ A;  2BCD A;  4UT3 B;  4DSY A;  3RL4 A;  5HPE A;  5J28 A;  3FLO A;  3QFM A;  1JK7 A;  2NYM C;  2IE4 C;  3IVE A;  3ZU0 A;  3DW8 C;  3EGG A;  4OR9 A;  1UF3 A;  3P71 C;  5JJT A;  4ZX2 A;  4HD0 A;  4FBK A;  1KBP A;  4H1S A;  4KKZ A;  4G9J A;  3E7A A;  2HYO A;  4FBQ A;  4WWL A;  3PSO A;  1HPU A;  4MOY A;  1FJM A;  4O24 A;  1S70 A;  3H66 A;  3IB7 A;  2QJC A;  3C5W C;  4F0Z A;  4MP0 A;  5INB A;  2AHD A;  1T71 A;  1XZW A;  1S3M A;  4O4K A;  4YKE A;  2ZBM A;  3LL8 A;  1QFC A;  3QFK A;  1QHW A;  1S3N A;  2USH A;  3AUZ A;  4I5N C;  4B2O A;  5F3W A;  2IAE C;  3D03 A;  4UWQ A; 
#chains in the Genus database with same CATH homology
 3H67 A;  4KBP A;  5JPE A;  3V4Y A;  4IYP C;  5B8I A;  3H63 A;  5EQV A;  2QFP A;  1HP1 A;  2ZO9 B;  4ORC A;  2NXF A;  4V0W A;  3GVE A;  1WAO 1;  4V0V A;  5JPF A;  1AUI A;  4H2F A;  3IB8 A;  3H61 A;  3FGA C;  1II7 A;  2O8G A;  3AV0 A;  2HYP A;  2DXL A;  4TUG A;  1G5B A;  3PSN A;  2DFJ A;  3RL5 A;  1SU1 A;  1V73 A;  1XM7 A;  2WDE A;  1OI8 A;  3H62 B;  2WDC A;  3DSC A;  4TUI A;  2KKN A;  2Z72 A;  3RQZ A;  1USH A;  1S95 A;  2R17 A;  3K7W C;  1WAR A;  4JA7 A;  5IOH A;  4XPN A;  1HO5 A;  4H2I A;  3THN A;  3THO B;  2Z1A A;  2CV9 A;  3QFN A;  1W24 A;  4UT2 A;  3IVD A;  3JYF A;  2O8A A;  4IL1 A;  2DXN A;  2IE3 C;  3QFO A;  4Q7F A;  2BQ8 X;  4M0V A;  4H2B A;  2JOG A;  4LTY A;  2NYL C;  2Z06 A;  4O43 A;  4I5L C;  4UT3 A;  1NNW A;  3E0J A;  2GJU A;  2NPP C;  4MOV A;  1T70 A;  3H68 A;  1S3L A;  1S8E A;  2XMO A;  3EGH A;  3N5U A;  4FCX A;  3C9F A;  3H60 A;  1Z2X A;  4ORA A;  1OID A;  4JA9 A;  4DT2 A;  4H1Y P;  2P6B A;  3ZTV A;  1OIE A;  2BDX A;  1TCO A;  1UTE A;  2A22 A;  1Z2W A;  2Q8U A;  2ZOA A;  4ZVZ A;  4FBW A;  3TGH A;  3RL3 A;  5DNY A;  4DHL A;  3H64 A;  4ORB A;  4H2G A;  3H69 A;  3QG5 C;  2WDD A;  2YEQ A;  4J6O A;  2YVT A;  3KBP A;  4LU9 A;  4V0X A;  5C1V A;  2QFR A;  4O5G A;  4LAC C;  3T1I A;  3E7B A;  3CK2 A;  1M63 A;  2HY1 A;  3ICF A;  2WDF A;  3K7V C;  1U32 A;  5GTU A;  3DSD A;  1MF8 A;  1IT6 A;  4NZV A;  3HVQ A;  2BCD A;  4UT3 B;  4DSY A;  3RL4 A;  5HPE A;  5J28 A;  3FLO A;  3QFM A;  1JK7 A;  2NYM C;  2IE4 C;  3IVE A;  3ZU0 A;  3DW8 C;  3EGG A;  4OR9 A;  1UF3 A;  3P71 C;  5JJT A;  4ZX2 A;  4HD0 A;  4FBK A;  1KBP A;  4H1S A;  4KKZ A;  4G9J A;  3E7A A;  2HYO A;  4FBQ A;  4WWL A;  3PSO A;  1HPU A;  4MOY A;  1FJM A;  4O24 A;  1S70 A;  3H66 A;  3IB7 A;  2QJC A;  3C5W C;  4F0Z A;  4MP0 A;  5INB A;  2AHD A;  1T71 A;  1XZW A;  1S3M A;  4O4K A;  4YKE A;  2ZBM A;  3LL8 A;  1QFC A;  3QFK A;  1QHW A;  1S3N A;  2USH A;  3AUZ A;  4I5N C;  4B2O A;  5F3W A;  2IAE C;  3D03 A;  4UWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...