4V0XA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-684)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
293
Chain Sequence
MLNIDSIIQRLLEVRGSGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
molecule keywords PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT
total genus 100
structure length 293
sequence length 295
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0xA00
1HO5A 1UTEA 4KBPA 2WDEA 4H1YP 1S8EA 3QFMA 4H1SA 4O5GA 3E7BA 1S3MA 4H2FA 5GTUA 3IB8A 2BQ8X 2IAEC 4UWQA 2P6BA 4F0ZA 1AUIA 4LACC 2ZBMA 3H67A 1Z2XA 2O8AA 4O43A 5INBA 4I5NC 4DHLA 3PSOA 2IE3C 3RL3A 2R17A 1M63A 4V0XA 3ICFA 1UF3A 4J6OA 1FJMA 3K7VC 2WDCA 2XMOA 4MOYA 1G5BA 2WDFA 4I5LC 3QFNA 4FBQA 1OI8A 4H2GA 1JK7A 2NYLC 1XZWA 3E7AA 4ZVZA 4V0WA 4LU9A 4XPNA 4LTYA 1S3LA 3GVEA 3DW8C 2Z06A 1V73A 4ORBA 3HVQA 2YVTA 3QG5C 5C1VA 2QFPA 3H66A 4FCXA 3THOB 1HP1A 1USHA 5F3WA 2USHA 1S70A 4O4KA 3RQZA 3IVDA 4UT3A 4KKZA 1T71A 3EGHA 4FBKA 1OIEA 3H63A 2A22A 1U32A 2QJCA 3CK2A 5JPFA 1WARA 3TGHA 4MP0A 4WWLA 2Z1AA 4UT3B 3FGAC 1QHWA 1WAO1 4ORAA 2HYOA 3C5WC 4JA7A 2KKNA 5EQVA 1II7A 4IYPC 1QFCA 3QFKA 2Q8UA 2Z72A 4H2BA 3RL4A 3AV0A 4IL1A 4M0VA 4TUGA 4B2OA 1T70A 2HY1A 3ZU0A 3C9FA 3AUZA 3H69A 4H2IA 3IB7A 3V4YA 4ORCA 4V0VA 3H60A 4TUIA 1SU1A 3EGGA 4JA9A 3K7WC 2AHDA 2BDXA 2GJUA 1XM7A 3H64A 2WDDA 1W24A 1OIDA 2IE4C 3ZTVA 1KBPA 2NPPC 4FBWA 1TCOA 4O24A 1IT6A 3DSCA 4MOVA 3RL5A 1S95A 1HPUA 4DSYA 3T1IA 3LL8A 3H62B 4G9JA 2NXFA 4ZX2A 3H61A 5JJTA 3P71C 2O8GA 3THNA 5IOHA 5J28A 3DSDA 3N5UA 2JOGA 3KBPA 4YKEA 2QFRA 3JYFA 2CV9A 4HD0A 1S3NA 1Z2WA 5HPEA 5JPEA 5B8IA 1MF8A 4DT2A 3H68A 2HYPA 3IVEA 3PSNA 3QFOA 2BCDA 4OR9A 4Q7FA 2DFJA 5DNYA 1NNWA 4UT2A 2NYMC 4NZVA
chains in the Genus database with same CATH superfamily
1HO5A 1UTEA 4KBPA 2WDEA 4H1YP 1S8EA 3QFMA 4H1SA 4O5GA 3E7BA 1S3MA 4H2FA 5GTUA 3IB8A 2BQ8X 2IAEC 4UWQA 2P6BA 4F0ZA 1AUIA 4LACC 2ZBMA 3H67A 1Z2XA 2O8AA 4O43A 5INBA 4I5NC 4DHLA 3PSOA 2IE3C 3RL3A 2R17A 1M63A 3D03A 4V0XA 3ICFA 1UF3A 4J6OA 1FJMA 3K7VC 2WDCA 2DXLA 2XMOA 4MOYA 1G5BA 2WDFA 4I5LC 3QFNA 2ZOAA 4FBQA 1OI8A 4H2GA 1JK7A 2NYLC 1XZWA 3E7AA 4ZVZA 4V0WA 4LU9A 4XPNA 4LTYA 1S3LA 3GVEA 3DW8C 2Z06A 1V73A 4ORBA 3HVQA 2YVTA 3QG5C 5C1VA 2QFPA 3H66A 4FCXA 3THOB 1HP1A 1USHA 5F3WA 2USHA 1S70A 4O4KA 3RQZA 3IVDA 4UT3A 4KKZA 1T71A 3EGHA 4FBKA 1OIEA 3H63A 2A22A 1U32A 2QJCA 3CK2A 3FLOA 5JPFA 1WARA 3TGHA 4MP0A 4WWLA 2Z1AA 4UT3B 3FGAC 1QHWA 1WAO1 4ORAA 2HYOA 3C5WC 4JA7A 2YEQA 2KKNA 5EQVA 1II7A 4IYPC 1QFCA 3QFKA 2Q8UA 2Z72A 4H2BA 3RL4A 3AV0A 4IL1A 4M0VA 4TUGA 4B2OA 1T70A 2HY1A 3ZU0A 3C9FA 3AUZA 3H69A 4H2IA 3IB7A 3V4YA 4ORCA 4V0VA 3H60A 4TUIA 2ZO9B 3E0JA 1SU1A 3EGGA 4JA9A 3K7WC 2AHDA 2BDXA 2GJUA 1XM7A 3H64A 2WDDA 1W24A 1OIDA 2IE4C 3ZTVA 1KBPA 2NPPC 4FBWA 1TCOA 4O24A 1IT6A 3DSCA 4MOVA 3RL5A 1S95A 1HPUA 2DXNA 4DSYA 3T1IA 3LL8A 3H62B 4G9JA 2NXFA 4ZX2A 3H61A 5JJTA 3P71C 2O8GA 3THNA 5IOHA 5J28A 3DSDA 3N5UA 2JOGA 3KBPA 4YKEA 2QFRA 3JYFA 2CV9A 4HD0A 1S3NA 1Z2WA 5HPEA 5JPEA 5B8IA 1MF8A 4DT2A 3H68A 2HYPA 3IVEA 3PSNA 3QFOA 2BCDA 4OR9A 4Q7FA 2DFJA 5DNYA 1NNWA 4UT2A 2NYMC 4NZVA
chains in the Genus database with same CATH topology
1HO5A 1UTEA 4KBPA 2WDEA 4H1YP 1S8EA 3QFMA 4H1SA 4O5GA 3E7BA 1S3MA 4H2FA 5GTUA 3IB8A 2BQ8X 2IAEC 4UWQA 2P6BA 4F0ZA 1AUIA 4LACC 2ZBMA 3H67A 1Z2XA 2O8AA 4O43A 5INBA 4I5NC 4DHLA 3PSOA 2IE3C 3RL3A 2R17A 1M63A 3D03A 4V0XA 3ICFA 1UF3A 4J6OA 1FJMA 3K7VC 2WDCA 2DXLA 2XMOA 4MOYA 1G5BA 2WDFA 4I5LC 3QFNA 2ZOAA 4FBQA 1OI8A 4H2GA 1JK7A 2NYLC 1XZWA 3E7AA 4ZVZA 4V0WA 4LU9A 4XPNA 4LTYA 1S3LA 3GVEA 3DW8C 2Z06A 1V73A 4ORBA 3HVQA 2YVTA 3QG5C 5C1VA 2QFPA 3H66A 4FCXA 3THOB 1HP1A 1USHA 5F3WA 2USHA 1S70A 4O4KA 3RQZA 3IVDA 4UT3A 4KKZA 1T71A 3EGHA 4FBKA 1OIEA 3H63A 2A22A 1U32A 2QJCA 3CK2A 3FLOA 5JPFA 1WARA 3TGHA 4MP0A 4WWLA 2Z1AA 4UT3B 3FGAC 1QHWA 1WAO1 4ORAA 2HYOA 3C5WC 4JA7A 2YEQA 2KKNA 5EQVA 1II7A 4IYPC 1QFCA 3QFKA 2Q8UA 2Z72A 4H2BA 3RL4A 3AV0A 4IL1A 4M0VA 4TUGA 4B2OA 1T70A 2HY1A 3ZU0A 3C9FA 3AUZA 3H69A 4H2IA 3IB7A 3V4YA 4ORCA 4V0VA 3H60A 4TUIA 2ZO9B 3E0JA 1SU1A 3EGGA 4JA9A 3K7WC 2AHDA 2BDXA 2GJUA 1XM7A 3H64A 2WDDA 1W24A 1OIDA 2IE4C 3ZTVA 1KBPA 2NPPC 4FBWA 1TCOA 4O24A 1IT6A 3DSCA 4MOVA 3RL5A 1S95A 1HPUA 2DXNA 4DSYA 3T1IA 3LL8A 3H62B 4G9JA 2NXFA 4ZX2A 3H61A 5JJTA 3P71C 2O8GA 3THNA 5IOHA 5J28A 3DSDA 3N5UA 2JOGA 3KBPA 4YKEA 2QFRA 3JYFA 2CV9A 4HD0A 1S3NA 1Z2WA 5HPEA 5JPEA 5B8IA 1MF8A 4DT2A 3H68A 2HYPA 3IVEA 3PSNA 3QFOA 2BCDA 4OR9A 4Q7FA 2DFJA 5DNYA 1NNWA 4UT2A 2NYMC 4NZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HO5 A;  1UTE A;  4KBP A;  2WDE A;  4H1Y P;  1S8E A;  3QFM A;  4H1S A;  4O5G A;  3E7B A;  1S3M A;  4H2F A;  5GTU A;  3IB8 A;  2BQ8 X;  2IAE C;  4UWQ A;  2P6B A;  4F0Z A;  1AUI A;  4LAC C;  2ZBM A;  3H67 A;  1Z2X A;  2O8A A;  4O43 A;  5INB A;  4I5N C;  4DHL A;  3PSO A;  2IE3 C;  3RL3 A;  2R17 A;  1M63 A;  4V0X A;  3ICF A;  1UF3 A;  4J6O A;  1FJM A;  3K7V C;  2WDC A;  2XMO A;  4MOY A;  1G5B A;  2WDF A;  4I5L C;  3QFN A;  4FBQ A;  1OI8 A;  4H2G A;  1JK7 A;  2NYL C;  1XZW A;  3E7A A;  4ZVZ A;  4V0W A;  4LU9 A;  4XPN A;  4LTY A;  1S3L A;  3GVE A;  3DW8 C;  2Z06 A;  1V73 A;  4ORB A;  3HVQ A;  2YVT A;  3QG5 C;  5C1V A;  2QFP A;  3H66 A;  4FCX A;  3THO B;  1HP1 A;  1USH A;  5F3W A;  2USH A;  1S70 A;  4O4K A;  3RQZ A;  3IVD A;  4UT3 A;  4KKZ A;  1T71 A;  3EGH A;  4FBK A;  1OIE A;  3H63 A;  2A22 A;  1U32 A;  2QJC A;  3CK2 A;  5JPF A;  1WAR A;  3TGH A;  4MP0 A;  4WWL A;  2Z1A A;  4UT3 B;  3FGA C;  1QHW A;  1WAO 1;  4ORA A;  2HYO A;  3C5W C;  4JA7 A;  2KKN A;  5EQV A;  1II7 A;  4IYP C;  1QFC A;  3QFK A;  2Q8U A;  2Z72 A;  4H2B A;  3RL4 A;  3AV0 A;  4IL1 A;  4M0V A;  4TUG A;  4B2O A;  1T70 A;  2HY1 A;  3ZU0 A;  3C9F A;  3AUZ A;  3H69 A;  4H2I A;  3IB7 A;  3V4Y A;  4ORC A;  4V0V A;  3H60 A;  4TUI A;  1SU1 A;  3EGG A;  4JA9 A;  3K7W C;  2AHD A;  2BDX A;  2GJU A;  1XM7 A;  3H64 A;  2WDD A;  1W24 A;  1OID A;  2IE4 C;  3ZTV A;  1KBP A;  2NPP C;  4FBW A;  1TCO A;  4O24 A;  1IT6 A;  3DSC A;  4MOV A;  3RL5 A;  1S95 A;  1HPU A;  4DSY A;  3T1I A;  3LL8 A;  3H62 B;  4G9J A;  2NXF A;  4ZX2 A;  3H61 A;  5JJT A;  3P71 C;  2O8G A;  3THN A;  5IOH A;  5J28 A;  3DSD A;  3N5U A;  2JOG A;  3KBP A;  4YKE A;  2QFR A;  3JYF A;  2CV9 A;  4HD0 A;  1S3N A;  1Z2W A;  5HPE A;  5JPE A;  5B8I A;  1MF8 A;  4DT2 A;  3H68 A;  2HYP A;  3IVE A;  3PSN A;  3QFO A;  2BCD A;  4OR9 A;  4Q7F A;  2DFJ A;  5DNY A;  1NNW A;  4UT2 A;  2NYM C;  4NZV A; 
#chains in the Genus database with same CATH topology
 1HO5 A;  1UTE A;  4KBP A;  2WDE A;  4H1Y P;  1S8E A;  3QFM A;  4H1S A;  4O5G A;  3E7B A;  1S3M A;  4H2F A;  5GTU A;  3IB8 A;  2BQ8 X;  2IAE C;  4UWQ A;  2P6B A;  4F0Z A;  1AUI A;  4LAC C;  2ZBM A;  3H67 A;  1Z2X A;  2O8A A;  4O43 A;  5INB A;  4I5N C;  4DHL A;  3PSO A;  2IE3 C;  3RL3 A;  2R17 A;  1M63 A;  3D03 A;  4V0X A;  3ICF A;  1UF3 A;  4J6O A;  1FJM A;  3K7V C;  2WDC A;  2DXL A;  2XMO A;  4MOY A;  1G5B A;  2WDF A;  4I5L C;  3QFN A;  2ZOA A;  4FBQ A;  1OI8 A;  4H2G A;  1JK7 A;  2NYL C;  1XZW A;  3E7A A;  4ZVZ A;  4V0W A;  4LU9 A;  4XPN A;  4LTY A;  1S3L A;  3GVE A;  3DW8 C;  2Z06 A;  1V73 A;  4ORB A;  3HVQ A;  2YVT A;  3QG5 C;  5C1V A;  2QFP A;  3H66 A;  4FCX A;  3THO B;  1HP1 A;  1USH A;  5F3W A;  2USH A;  1S70 A;  4O4K A;  3RQZ A;  3IVD A;  4UT3 A;  4KKZ A;  1T71 A;  3EGH A;  4FBK A;  1OIE A;  3H63 A;  2A22 A;  1U32 A;  2QJC A;  3CK2 A;  3FLO A;  5JPF A;  1WAR A;  3TGH A;  4MP0 A;  4WWL A;  2Z1A A;  4UT3 B;  3FGA C;  1QHW A;  1WAO 1;  4ORA A;  2HYO A;  3C5W C;  4JA7 A;  2YEQ A;  2KKN A;  5EQV A;  1II7 A;  4IYP C;  1QFC A;  3QFK A;  2Q8U A;  2Z72 A;  4H2B A;  3RL4 A;  3AV0 A;  4IL1 A;  4M0V A;  4TUG A;  4B2O A;  1T70 A;  2HY1 A;  3ZU0 A;  3C9F A;  3AUZ A;  3H69 A;  4H2I A;  3IB7 A;  3V4Y A;  4ORC A;  4V0V A;  3H60 A;  4TUI A;  2ZO9 B;  3E0J A;  1SU1 A;  3EGG A;  4JA9 A;  3K7W C;  2AHD A;  2BDX A;  2GJU A;  1XM7 A;  3H64 A;  2WDD A;  1W24 A;  1OID A;  2IE4 C;  3ZTV A;  1KBP A;  2NPP C;  4FBW A;  1TCO A;  4O24 A;  1IT6 A;  3DSC A;  4MOV A;  3RL5 A;  1S95 A;  1HPU A;  2DXN A;  4DSY A;  3T1I A;  3LL8 A;  3H62 B;  4G9J A;  2NXF A;  4ZX2 A;  3H61 A;  5JJT A;  3P71 C;  2O8G A;  3THN A;  5IOH A;  5J28 A;  3DSD A;  3N5U A;  2JOG A;  3KBP A;  4YKE A;  2QFR A;  3JYF A;  2CV9 A;  4HD0 A;  1S3N A;  1Z2W A;  5HPE A;  5JPE A;  5B8I A;  1MF8 A;  4DT2 A;  3H68 A;  2HYP A;  3IVE A;  3PSN A;  3QFO A;  2BCD A;  4OR9 A;  4Q7F A;  2DFJ A;  5DNY A;  1NNW A;  4UT2 A;  2NYM C;  4NZV A; 
#chains in the Genus database with same CATH homology
 1HO5 A;  1UTE A;  4KBP A;  2WDE A;  4H1Y P;  1S8E A;  3QFM A;  4H1S A;  4O5G A;  3E7B A;  1S3M A;  4H2F A;  5GTU A;  3IB8 A;  2BQ8 X;  2IAE C;  4UWQ A;  2P6B A;  4F0Z A;  1AUI A;  4LAC C;  2ZBM A;  3H67 A;  1Z2X A;  2O8A A;  4O43 A;  5INB A;  4I5N C;  4DHL A;  3PSO A;  2IE3 C;  3RL3 A;  2R17 A;  1M63 A;  3D03 A;  4V0X A;  3ICF A;  1UF3 A;  4J6O A;  1FJM A;  3K7V C;  2WDC A;  2DXL A;  2XMO A;  4MOY A;  1G5B A;  2WDF A;  4I5L C;  3QFN A;  2ZOA A;  4FBQ A;  1OI8 A;  4H2G A;  1JK7 A;  2NYL C;  1XZW A;  3E7A A;  4ZVZ A;  4V0W A;  4LU9 A;  4XPN A;  4LTY A;  1S3L A;  3GVE A;  3DW8 C;  2Z06 A;  1V73 A;  4ORB A;  3HVQ A;  2YVT A;  3QG5 C;  5C1V A;  2QFP A;  3H66 A;  4FCX A;  3THO B;  1HP1 A;  1USH A;  5F3W A;  2USH A;  1S70 A;  4O4K A;  3RQZ A;  3IVD A;  4UT3 A;  4KKZ A;  1T71 A;  3EGH A;  4FBK A;  1OIE A;  3H63 A;  2A22 A;  1U32 A;  2QJC A;  3CK2 A;  3FLO A;  5JPF A;  1WAR A;  3TGH A;  4MP0 A;  4WWL A;  2Z1A A;  4UT3 B;  3FGA C;  1QHW A;  1WAO 1;  4ORA A;  2HYO A;  3C5W C;  4JA7 A;  2YEQ A;  2KKN A;  5EQV A;  1II7 A;  4IYP C;  1QFC A;  3QFK A;  2Q8U A;  2Z72 A;  4H2B A;  3RL4 A;  3AV0 A;  4IL1 A;  4M0V A;  4TUG A;  4B2O A;  1T70 A;  2HY1 A;  3ZU0 A;  3C9F A;  3AUZ A;  3H69 A;  4H2I A;  3IB7 A;  3V4Y A;  4ORC A;  4V0V A;  3H60 A;  4TUI A;  2ZO9 B;  3E0J A;  1SU1 A;  3EGG A;  4JA9 A;  3K7W C;  2AHD A;  2BDX A;  2GJU A;  1XM7 A;  3H64 A;  2WDD A;  1W24 A;  1OID A;  2IE4 C;  3ZTV A;  1KBP A;  2NPP C;  4FBW A;  1TCO A;  4O24 A;  1IT6 A;  3DSC A;  4MOV A;  3RL5 A;  1S95 A;  1HPU A;  2DXN A;  4DSY A;  3T1I A;  3LL8 A;  3H62 B;  4G9J A;  2NXF A;  4ZX2 A;  3H61 A;  5JJT A;  3P71 C;  2O8G A;  3THN A;  5IOH A;  5J28 A;  3DSD A;  3N5U A;  2JOG A;  3KBP A;  4YKE A;  2QFR A;  3JYF A;  2CV9 A;  4HD0 A;  1S3N A;  1Z2W A;  5HPE A;  5JPE A;  5B8I A;  1MF8 A;  4DT2 A;  3H68 A;  2HYP A;  3IVE A;  3PSN A;  3QFO A;  2BCD A;  4OR9 A;  4Q7F A;  2DFJ A;  5DNY A;  1NNW A;  4UT2 A;  2NYM C;  4NZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...