4V14A

Structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
124
Chain Sequence
KRIHIVAGIIFNSDQSEIFITKRPDHKGGFWEFPGGKVEAGESREQAMVRELEEEIGITVTEQQAFQHFDFDSLSFDFMLVTAFDGQPHGREGQQGGWVKIADLANYRFPEANDPVVKQVIAQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTATOR MUTT PROTEIN
publication title Mutt from the Fish Pathogen Aliivibrio Salmonicida is a Cold-Active Nucleotide-Pool Sanitization Enzyme with Unexpectedly High Thermostability.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 29
structure length 124
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4v14A00
2A8TA 3SHDA 5FSNA 3GWYA 2JVBA 3FJYA 1RYAA 4JZTA 4NFWA 2A8QA 5IW4A 1NFSA 3FSPA 3Q1PA 2ICJA 5ANSA 5C7QA 2DHOA 5BONA 1NFZA 3COUA 1PPVA 1MQWA 3X0KA 3EXQA 1VHZA 1X51A 3P5TA 4KYXA 3FCMA 4N1TA 3HYQA 3ACAA 2QJTA 3GZ5A 3F6AA 4N1UA 3N77A 2DSCA 3A6TA 3X0PA 4KG3A 1F3YA 5ANTA 1SOIA 1VHGA 3Q91A 1VCDA 2O5WA 1VK6A 1SU2A 5C7TA 3X0QA 4S2XA 3FK9A 5HZXA 1U20A 1MR2A 1JKNA 3MGMA 3BHOA 5ANWA 4K6EA 1MQEA 2DSBA 3X0LA 3O52A 3DKUA 5IW5A 1OW2A 4KTBA 2FVVA 1VIUA 2GB5A 2O1CA 2YVPA 3FFUA 5DEQA 1V8WA 2A8RA 1TUMA 1V8UA 2ICKA 3GRNA 4NFXA 2FMLA 4KG4A 3I9XA 2O5FA 3L85A 2G73A 1SJYA 3X0SA 1Q33A 2FKBA 3A6VA 3O69A 4HVYA 2PNYA 2AZWA 2KDVA 3GG6A 1XSBA 5GHIA 3RH7A 1PUQA 2W4EA 1X84A 3GZ6A 4S2WA 2DSDA 5GHPA 1VC8A 2G74A 2XSQA 3O6ZA 3I7VA 2VNQA 4C9XA 3P6YA 1VIQA 5FSOA 1G9QA 2Q9PA 3GZ8A 2R5WA 1V8IA 1MUTA 3Q4IA 3SONA 1XSAA 1V8RA 4YPHA 2B06A 1MK1A 2GT2A 2CL3A 3ID9A 4JZUA 2KDWA 3DUPA 2I8TA 2YVNA 1PVFA 3BM4A 3Q93A 5GHNA 5C8LA 5BS6A 5FSMA 5DPKA 5GHJA 1PUSA 1R67A 3EF5A 3O8SA 5GHMA 1KTGA 1KT9A 2QKMB 5DD4A 4ZG0A 3ZR0A 3ZR1A 4YPRA 1JRKA 1X83A 2GT4A 4HFQA 3F13A 3MDIA 3MDGA 1V8VA 1XSCA 3H95A 2DUKA 3X0NA 5FSLA 1V8MA 5CFJA 2PQVA 5ISYA 4IJXA 4MPOA 3OGAA 3KVHA 2YYHA 1G0SA 3EEUA 5FSKA 3MCFA 2YVMA 3X0JA 1GA7A 1Q27A 2YVOA 1RRQA 1PPWA 3AC9A 4ICKA 3WHWA 1KHZA 1SZ3A 2A6TA 2A8SA 4V14A 3U53A 5LPGA 5GHOA 4YOQA 3G0QA 3I7UA 3X0MA 1VRLA 4JZVA 1PUNA 5ANUA 4DYWA 3Q2TA 5ANVA 4ILQA 1NQZA 1PPXA 1V8TA 2I6KA 2VNPA 1V8YA 5DDGA 3QSJA 1K26A 2B0VA 1V8LA 1Q54A 5FSIA 4S2YA 3EESA 4JZSA 3A6UA 3X0RA 3X0IA 4C9WA 1I9AA 3CNGA 2B2KA 3X0OA 3E57A 3Q2SA 1MP2A 3N9UA 5CFIA 2RRKA 1QVJA 1IRYA 2J8QA 3R03A 1NQYA 1RRSA 3SMDA 2QJOA 3BAPA 1HZTA 5GHQA 5I8UA 3O61A 2A8PA 3HHJA 1K2EA 2I8UA 1HX3A 1V8SA 1V8NA 3J7Ye 3A6SA 4S2VA 1VC9A
chains in the Genus database with same CATH superfamily
2A8TA 3SHDA 5FSNA 3GWYA 2JVBA 3FJYA 1RYAA 4JZTA 4NFWA 2A8QA 5IW4A 1NFSA 3FSPA 3Q1PA 2ICJA 5ANSA 5C7QA 2DHOA 5BONA 1NFZA 3COUA 1PPVA 1MQWA 3X0KA 3EXQA 1VHZA 1X51A 3P5TA 4KYXA 3FCMA 4N1TA 3HYQA 3ACAA 2QJTA 3GZ5A 3F6AA 4N1UA 3N77A 2DSCA 3A6TA 3X0PA 4KG3A 1F3YA 5ANTA 1SOIA 1VHGA 3Q91A 1VCDA 2O5WA 1VK6A 1SU2A 5C7TA 3X0QA 4S2XA 3FK9A 5HZXA 1U20A 1MR2A 1JKNA 3MGMA 3BHOA 5ANWA 4K6EA 1MQEA 2DSBA 3X0LA 3O52A 3DKUA 5IW5A 1OW2A 4KTBA 2FVVA 1VIUA 2GB5A 2O1CA 2YVPA 3FFUA 5DEQA 1V8WA 2A8RA 1TUMA 1V8UA 2ICKA 3GRNA 4NFXA 2FMLA 4KG4A 3I9XA 2O5FA 3L85A 2G73A 1SJYA 3X0SA 1Q33A 2FKBA 3A6VA 3O69A 4HVYA 2PNYA 2AZWA 2KDVA 3GG6A 1XSBA 5GHIA 3RH7A 1PUQA 2W4EA 1X84A 3GZ6A 4S2WA 2DSDA 5GHPA 1VC8A 2G74A 2XSQA 2CZRA 3I7VA 2VNQA 3O6ZA 4J7GA 4C9XA 3P6YA 1VIQA 5FSOA 1G9QA 2Q9PA 3GZ8A 2R5WA 1V8IA 1MUTA 3Q4IA 3SONA 1XSAA 1V8RA 4YPHA 2B06A 1MK1A 2GT2A 2CL3A 3ID9A 4JZUA 2KDWA 3DUPA 2I8TA 2YVNA 1PVFA 3BM4A 3Q93A 5GHNA 5C8LA 5BS6A 5FSMA 5DPKA 5GHJA 1PUSA 1R67A 3EF5A 3O8SA 5GHMA 1KTGA 1KT9A 2QKMB 5DD4A 4ZG0A 3ZR0A 3ZR1A 4YPRA 1JRKA 1X83A 2GT4A 4HFQA 3F13A 3MDIA 3MDGA 1V8VA 1XSCA 3H95A 2DUKA 3X0NA 5FSLA 1V8MA 5CFJA 2PQVA 5ISYA 4IJXA 4MPOA 3OGAA 3KVHA 2YYHA 1G0SA 3EEUA 5FSKA 3MCFA 2YVMA 3X0JA 1GA7A 1Q27A 2YVOA 1RRQA 1PPWA 3AC9A 4ICKA 3WHWA 1KHZA 1SZ3A 2A6TA 2A8SA 4V14A 3U53A 4J7HA 5LPGA 5GHOA 4YOQA 3G0QA 3I7UA 3X0MA 1VRLA 4JZVA 1PUNA 5ANUA 4DYWA 3Q2TA 5ANVA 4ILQA 1NQZA 1PPXA 1V8TA 2I6KA 2VNPA 1V8YA 5DDGA 3QSJA 1K26A 2B0VA 1V8LA 1Q54A 5FSIA 4S2YA 3EESA 4JZSA 3A6UA 3X0RA 3X0IA 4C9WA 1I9AA 3CNGA 2B2KA 3X0OA 3E57A 3Q2SA 1MP2A 3N9UA 5CFIA 2RRKA 1QVJA 1IRYA 2J8QA 3R03A 1NQYA 1RRSA 3SMDA 2QJOA 3BAPA 1HZTA 5GHQA 5I8UA 3O61A 2A8PA 3HHJA 1K2EA 2I8UA 1HX3A 1V8SA 1V8NA 3J7Ye 3A6SA 4S2VA 1VC9A
chains in the Genus database with same CATH topology
2A8TA 3SHDA 5FSNA 3GWYA 2JVBA 3FJYA 1RYAA 4JZTA 4NFWA 2A8QA 5IW4A 1NFSA 3FSPA 3Q1PA 2ICJA 5ANSA 5C7QA 2DHOA 5BONA 1NFZA 3COUA 1PPVA 1MQWA 3X0KA 3EXQA 1VHZA 1X51A 3P5TA 4KYXA 3FCMA 4N1TA 3HYQA 3ACAA 2QJTA 3GZ5A 3F6AA 4N1UA 3N77A 2DSCA 3A6TA 3X0PA 4KG3A 1F3YA 5ANTA 1SOIA 1VHGA 3Q91A 1VCDA 2O5WA 1VK6A 1SU2A 5C7TA 3X0QA 4S2XA 3FK9A 5HZXA 1U20A 1MR2A 1JKNA 3MGMA 3BHOA 5ANWA 4K6EA 1MQEA 2DSBA 3X0LA 3O52A 3DKUA 5IW5A 1OW2A 4KTBA 2FVVA 1VIUA 2GB5A 2O1CA 2YVPA 3FFUA 5DEQA 1V8WA 2A8RA 1TUMA 1V8UA 2ICKA 3GRNA 4NFXA 2FMLA 4KG4A 3I9XA 2O5FA 3L85A 2G73A 1SJYA 3X0SA 1Q33A 2FKBA 3A6VA 3O69A 4HVYA 2PNYA 2AZWA 2KDVA 3GG6A 1XSBA 5GHIA 3RH7A 1PUQA 2W4EA 1X84A 3GZ6A 4S2WA 2DSDA 5GHPA 1VC8A 2G74A 2XSQA 2CZRA 3I7VA 2VNQA 3O6ZA 4J7GA 4C9XA 3P6YA 1VIQA 5FSOA 1G9QA 2Q9PA 3GZ8A 2R5WA 1V8IA 1MUTA 3Q4IA 3SONA 1XSAA 1V8RA 4YPHA 2B06A 1MK1A 2GT2A 2CL3A 3ID9A 4JZUA 2KDWA 3DUPA 2I8TA 2YVNA 1PVFA 3BM4A 3Q93A 5GHNA 5C8LA 5BS6A 5FSMA 5DPKA 5GHJA 1PUSA 1R67A 3EF5A 3O8SA 5GHMA 1KTGA 1KT9A 2QKMB 5DD4A 4ZG0A 3ZR0A 3ZR1A 4YPRA 1JRKA 1X83A 2GT4A 4HFQA 3F13A 3MDIA 3MDGA 1V8VA 1XSCA 3H95A 2DUKA 3X0NA 5FSLA 1V8MA 5CFJA 2PQVA 5ISYA 4IJXA 4MPOA 3OGAA 3KVHA 2YYHA 1G0SA 3EEUA 5FSKA 3MCFA 2YVMA 3X0JA 1GA7A 1Q27A 2YVOA 1RRQA 1PPWA 3AC9A 4ICKA 3WHWA 1KHZA 1SZ3A 2A6TA 2A8SA 4V14A 3U53A 4J7HA 5LPGA 5GHOA 4YOQA 3G0QA 3I7UA 3X0MA 1VRLA 4JZVA 1PUNA 5ANUA 4DYWA 3Q2TA 5ANVA 4ILQA 1NQZA 1PPXA 1V8TA 2I6KA 2VNPA 1V8YA 5DDGA 3QSJA 1K26A 2B0VA 1V8LA 1Q54A 5FSIA 4S2YA 3EESA 4JZSA 3A6UA 3X0RA 3X0IA 4C9WA 1I9AA 3CNGA 2B2KA 3X0OA 3E57A 3Q2SA 1MP2A 3N9UA 5CFIA 2RRKA 1QVJA 1IRYA 2J8QA 3R03A 1NQYA 1RRSA 3SMDA 2QJOA 3BAPA 1HZTA 5GHQA 5I8UA 3O61A 2A8PA 3HHJA 1K2EA 2I8UA 1HX3A 1V8SA 1V8NA 3J7Ye 3A6SA 4S2VA 1VC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8T A;  3SHD A;  5FSN A;  3GWY A;  2JVB A;  3FJY A;  1RYA A;  4JZT A;  4NFW A;  2A8Q A;  5IW4 A;  1NFS A;  3FSP A;  3Q1P A;  2ICJ A;  5ANS A;  5C7Q A;  2DHO A;  5BON A;  1NFZ A;  3COU A;  1PPV A;  1MQW A;  3X0K A;  3EXQ A;  1VHZ A;  1X51 A;  3P5T A;  4KYX A;  3FCM A;  4N1T A;  3HYQ A;  3ACA A;  2QJT A;  3GZ5 A;  3F6A A;  4N1U A;  3N77 A;  2DSC A;  3A6T A;  3X0P A;  4KG3 A;  1F3Y A;  5ANT A;  1SOI A;  1VHG A;  3Q91 A;  1VCD A;  2O5W A;  1VK6 A;  1SU2 A;  5C7T A;  3X0Q A;  4S2X A;  3FK9 A;  5HZX A;  1U20 A;  1MR2 A;  1JKN A;  3MGM A;  3BHO A;  5ANW A;  4K6E A;  1MQE A;  2DSB A;  3X0L A;  3O52 A;  3DKU A;  5IW5 A;  1OW2 A;  4KTB A;  2FVV A;  1VIU A;  2GB5 A;  2O1C A;  2YVP A;  3FFU A;  5DEQ A;  1V8W A;  2A8R A;  1TUM A;  1V8U A;  2ICK A;  3GRN A;  4NFX A;  2FML A;  4KG4 A;  3I9X A;  2O5F A;  3L85 A;  2G73 A;  1SJY A;  3X0S A;  1Q33 A;  2FKB A;  3A6V A;  3O69 A;  4HVY A;  2PNY A;  2AZW A;  2KDV A;  3GG6 A;  1XSB A;  5GHI A;  3RH7 A;  1PUQ A;  2W4E A;  1X84 A;  3GZ6 A;  4S2W A;  2DSD A;  5GHP A;  1VC8 A;  2G74 A;  2XSQ A;  3O6Z A;  3I7V A;  2VNQ A;  4C9X A;  3P6Y A;  1VIQ A;  5FSO A;  1G9Q A;  2Q9P A;  3GZ8 A;  2R5W A;  1V8I A;  1MUT A;  3Q4I A;  3SON A;  1XSA A;  1V8R A;  4YPH A;  2B06 A;  1MK1 A;  2GT2 A;  2CL3 A;  3ID9 A;  4JZU A;  2KDW A;  3DUP A;  2I8T A;  2YVN A;  1PVF A;  3BM4 A;  3Q93 A;  5GHN A;  5C8L A;  5BS6 A;  5FSM A;  5DPK A;  5GHJ A;  1PUS A;  1R67 A;  3EF5 A;  3O8S A;  5GHM A;  1KTG A;  1KT9 A;  2QKM B;  5DD4 A;  4ZG0 A;  3ZR0 A;  3ZR1 A;  4YPR A;  1JRK A;  1X83 A;  2GT4 A;  4HFQ A;  3F13 A;  3MDI A;  3MDG A;  1V8V A;  1XSC A;  3H95 A;  2DUK A;  3X0N A;  5FSL A;  1V8M A;  5CFJ A;  2PQV A;  5ISY A;  4IJX A;  4MPO A;  3OGA A;  3KVH A;  2YYH A;  1G0S A;  3EEU A;  5FSK A;  3MCF A;  2YVM A;  3X0J A;  1GA7 A;  1Q27 A;  2YVO A;  1RRQ A;  1PPW A;  3AC9 A;  4ICK A;  3WHW A;  1KHZ A;  1SZ3 A;  2A6T A;  2A8S A;  4V14 A;  3U53 A;  5LPG A;  5GHO A;  4YOQ A;  3G0Q A;  3I7U A;  3X0M A;  1VRL A;  4JZV A;  1PUN A;  5ANU A;  4DYW A;  3Q2T A;  5ANV A;  4ILQ A;  1NQZ A;  1PPX A;  1V8T A;  2I6K A;  2VNP A;  1V8Y A;  5DDG A;  3QSJ A;  1K26 A;  2B0V A;  1V8L A;  1Q54 A;  5FSI A;  4S2Y A;  3EES A;  4JZS A;  3A6U A;  3X0R A;  3X0I A;  4C9W A;  1I9A A;  3CNG A;  2B2K A;  3X0O A;  3E57 A;  3Q2S A;  1MP2 A;  3N9U A;  5CFI A;  2RRK A;  1QVJ A;  1IRY A;  2J8Q A;  3R03 A;  1NQY A;  1RRS A;  3SMD A;  2QJO A;  3BAP A;  1HZT A;  5GHQ A;  5I8U A;  3O61 A;  2A8P A;  3HHJ A;  1K2E A;  2I8U A;  1HX3 A;  1V8S A;  1V8N A;  3J7Y e;  3A6S A;  4S2V A;  1VC9 A; 
#chains in the Genus database with same CATH topology
 2A8T A;  3SHD A;  5FSN A;  3GWY A;  2JVB A;  3FJY A;  1RYA A;  4JZT A;  4NFW A;  2A8Q A;  5IW4 A;  1NFS A;  3FSP A;  3Q1P A;  2ICJ A;  5ANS A;  5C7Q A;  2DHO A;  5BON A;  1NFZ A;  3COU A;  1PPV A;  1MQW A;  3X0K A;  3EXQ A;  1VHZ A;  1X51 A;  3P5T A;  4KYX A;  3FCM A;  4N1T A;  3HYQ A;  3ACA A;  2QJT A;  3GZ5 A;  3F6A A;  4N1U A;  3N77 A;  2DSC A;  3A6T A;  3X0P A;  4KG3 A;  1F3Y A;  5ANT A;  1SOI A;  1VHG A;  3Q91 A;  1VCD A;  2O5W A;  1VK6 A;  1SU2 A;  5C7T A;  3X0Q A;  4S2X A;  3FK9 A;  5HZX A;  1U20 A;  1MR2 A;  1JKN A;  3MGM A;  3BHO A;  5ANW A;  4K6E A;  1MQE A;  2DSB A;  3X0L A;  3O52 A;  3DKU A;  5IW5 A;  1OW2 A;  4KTB A;  2FVV A;  1VIU A;  2GB5 A;  2O1C A;  2YVP A;  3FFU A;  5DEQ A;  1V8W A;  2A8R A;  1TUM A;  1V8U A;  2ICK A;  3GRN A;  4NFX A;  2FML A;  4KG4 A;  3I9X A;  2O5F A;  3L85 A;  2G73 A;  1SJY A;  3X0S A;  1Q33 A;  2FKB A;  3A6V A;  3O69 A;  4HVY A;  2PNY A;  2AZW A;  2KDV A;  3GG6 A;  1XSB A;  5GHI A;  3RH7 A;  1PUQ A;  2W4E A;  1X84 A;  3GZ6 A;  4S2W A;  2DSD A;  5GHP A;  1VC8 A;  2G74 A;  2XSQ A;  2CZR A;  3I7V A;  2VNQ A;  3O6Z A;  4J7G A;  4C9X A;  3P6Y A;  1VIQ A;  5FSO A;  1G9Q A;  2Q9P A;  3GZ8 A;  2R5W A;  1V8I A;  1MUT A;  3Q4I A;  3SON A;  1XSA A;  1V8R A;  4YPH A;  2B06 A;  1MK1 A;  2GT2 A;  2CL3 A;  3ID9 A;  4JZU A;  2KDW A;  3DUP A;  2I8T A;  2YVN A;  1PVF A;  3BM4 A;  3Q93 A;  5GHN A;  5C8L A;  5BS6 A;  5FSM A;  5DPK A;  5GHJ A;  1PUS A;  1R67 A;  3EF5 A;  3O8S A;  5GHM A;  1KTG A;  1KT9 A;  2QKM B;  5DD4 A;  4ZG0 A;  3ZR0 A;  3ZR1 A;  4YPR A;  1JRK A;  1X83 A;  2GT4 A;  4HFQ A;  3F13 A;  3MDI A;  3MDG A;  1V8V A;  1XSC A;  3H95 A;  2DUK A;  3X0N A;  5FSL A;  1V8M A;  5CFJ A;  2PQV A;  5ISY A;  4IJX A;  4MPO A;  3OGA A;  3KVH A;  2YYH A;  1G0S A;  3EEU A;  5FSK A;  3MCF A;  2YVM A;  3X0J A;  1GA7 A;  1Q27 A;  2YVO A;  1RRQ A;  1PPW A;  3AC9 A;  4ICK A;  3WHW A;  1KHZ A;  1SZ3 A;  2A6T A;  2A8S A;  4V14 A;  3U53 A;  4J7H A;  5LPG A;  5GHO A;  4YOQ A;  3G0Q A;  3I7U A;  3X0M A;  1VRL A;  4JZV A;  1PUN A;  5ANU A;  4DYW A;  3Q2T A;  5ANV A;  4ILQ A;  1NQZ A;  1PPX A;  1V8T A;  2I6K A;  2VNP A;  1V8Y A;  5DDG A;  3QSJ A;  1K26 A;  2B0V A;  1V8L A;  1Q54 A;  5FSI A;  4S2Y A;  3EES A;  4JZS A;  3A6U A;  3X0R A;  3X0I A;  4C9W A;  1I9A A;  3CNG A;  2B2K A;  3X0O A;  3E57 A;  3Q2S A;  1MP2 A;  3N9U A;  5CFI A;  2RRK A;  1QVJ A;  1IRY A;  2J8Q A;  3R03 A;  1NQY A;  1RRS A;  3SMD A;  2QJO A;  3BAP A;  1HZT A;  5GHQ A;  5I8U A;  3O61 A;  2A8P A;  3HHJ A;  1K2E A;  2I8U A;  1HX3 A;  1V8S A;  1V8N A;  3J7Y e;  3A6S A;  4S2V A;  1VC9 A; 
#chains in the Genus database with same CATH homology
 2A8T A;  3SHD A;  5FSN A;  3GWY A;  2JVB A;  3FJY A;  1RYA A;  4JZT A;  4NFW A;  2A8Q A;  5IW4 A;  1NFS A;  3FSP A;  3Q1P A;  2ICJ A;  5ANS A;  5C7Q A;  2DHO A;  5BON A;  1NFZ A;  3COU A;  1PPV A;  1MQW A;  3X0K A;  3EXQ A;  1VHZ A;  1X51 A;  3P5T A;  4KYX A;  3FCM A;  4N1T A;  3HYQ A;  3ACA A;  2QJT A;  3GZ5 A;  3F6A A;  4N1U A;  3N77 A;  2DSC A;  3A6T A;  3X0P A;  4KG3 A;  1F3Y A;  5ANT A;  1SOI A;  1VHG A;  3Q91 A;  1VCD A;  2O5W A;  1VK6 A;  1SU2 A;  5C7T A;  3X0Q A;  4S2X A;  3FK9 A;  5HZX A;  1U20 A;  1MR2 A;  1JKN A;  3MGM A;  3BHO A;  5ANW A;  4K6E A;  1MQE A;  2DSB A;  3X0L A;  3O52 A;  3DKU A;  5IW5 A;  1OW2 A;  4KTB A;  2FVV A;  1VIU A;  2GB5 A;  2O1C A;  2YVP A;  3FFU A;  5DEQ A;  1V8W A;  2A8R A;  1TUM A;  1V8U A;  2ICK A;  3GRN A;  4NFX A;  2FML A;  4KG4 A;  3I9X A;  2O5F A;  3L85 A;  2G73 A;  1SJY A;  3X0S A;  1Q33 A;  2FKB A;  3A6V A;  3O69 A;  4HVY A;  2PNY A;  2AZW A;  2KDV A;  3GG6 A;  1XSB A;  5GHI A;  3RH7 A;  1PUQ A;  2W4E A;  1X84 A;  3GZ6 A;  4S2W A;  2DSD A;  5GHP A;  1VC8 A;  2G74 A;  2XSQ A;  2CZR A;  3I7V A;  2VNQ A;  3O6Z A;  4J7G A;  4C9X A;  3P6Y A;  1VIQ A;  5FSO A;  1G9Q A;  2Q9P A;  3GZ8 A;  2R5W A;  1V8I A;  1MUT A;  3Q4I A;  3SON A;  1XSA A;  1V8R A;  4YPH A;  2B06 A;  1MK1 A;  2GT2 A;  2CL3 A;  3ID9 A;  4JZU A;  2KDW A;  3DUP A;  2I8T A;  2YVN A;  1PVF A;  3BM4 A;  3Q93 A;  5GHN A;  5C8L A;  5BS6 A;  5FSM A;  5DPK A;  5GHJ A;  1PUS A;  1R67 A;  3EF5 A;  3O8S A;  5GHM A;  1KTG A;  1KT9 A;  2QKM B;  5DD4 A;  4ZG0 A;  3ZR0 A;  3ZR1 A;  4YPR A;  1JRK A;  1X83 A;  2GT4 A;  4HFQ A;  3F13 A;  3MDI A;  3MDG A;  1V8V A;  1XSC A;  3H95 A;  2DUK A;  3X0N A;  5FSL A;  1V8M A;  5CFJ A;  2PQV A;  5ISY A;  4IJX A;  4MPO A;  3OGA A;  3KVH A;  2YYH A;  1G0S A;  3EEU A;  5FSK A;  3MCF A;  2YVM A;  3X0J A;  1GA7 A;  1Q27 A;  2YVO A;  1RRQ A;  1PPW A;  3AC9 A;  4ICK A;  3WHW A;  1KHZ A;  1SZ3 A;  2A6T A;  2A8S A;  4V14 A;  3U53 A;  4J7H A;  5LPG A;  5GHO A;  4YOQ A;  3G0Q A;  3I7U A;  3X0M A;  1VRL A;  4JZV A;  1PUN A;  5ANU A;  4DYW A;  3Q2T A;  5ANV A;  4ILQ A;  1NQZ A;  1PPX A;  1V8T A;  2I6K A;  2VNP A;  1V8Y A;  5DDG A;  3QSJ A;  1K26 A;  2B0V A;  1V8L A;  1Q54 A;  5FSI A;  4S2Y A;  3EES A;  4JZS A;  3A6U A;  3X0R A;  3X0I A;  4C9W A;  1I9A A;  3CNG A;  2B2K A;  3X0O A;  3E57 A;  3Q2S A;  1MP2 A;  3N9U A;  5CFI A;  2RRK A;  1QVJ A;  1IRY A;  2J8Q A;  3R03 A;  1NQY A;  1RRS A;  3SMD A;  2QJO A;  3BAP A;  1HZT A;  5GHQ A;  5I8U A;  3O61 A;  2A8P A;  3HHJ A;  1K2E A;  2I8U A;  1HX3 A;  1V8S A;  1V8N A;  3J7Y e;  3A6S A;  4S2V A;  1VC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...