4V196

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
48
structure length
48
Chain Sequence
SKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 4
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4v19600
4UY81 3PIP1 4U671 5GAEc 5DM71 3J7Y1 5GAHc 5DM61 4V196 3J7Z1 5JVH1 5GADc 5H1Sc 5GAGc 5MLC3 5JVG1 4WFN1 3PIO1
chains in the Genus database with same CATH superfamily
4AI2A 1R0HA 5IYDL 4RXNA 3PWFA 3S15L 1WJVA 3RZOL 2JI1A 3S2HL 3A44A 5MFZA 3GTGL 4B8CD 4AR5A 2O5JD 1TWGL 2XJSA 5MF6A 3P2AA 3H0GL 2AYJA 3HAXC 1T9QA 1TWCL 8RXNA 2KKDA 3H9BA 1P7PA 3FKIL 2JI3A 2PVXA 4QIWP 1DVBA 3PO3L 4AR6A 4AR3A 1ODHA 3GTOL 2Z3QB 1FHMA 3KYUA 1VZIA 2JA5L 3PKIA 1OWCA 3LWPB 3J7Z1 4AI3A 1R0JA 1NXEA 5K2ME 1PZXA 4G6BA 3B0AB 3M3YL 2JI2A 4C3IL 2NVXL 2R92L 1SMWA 1R0GA 3H3VM 3RYGA 4Y52L 1FHHA 3I4NL 2J9UB 4UY81 2K2DA 2C6BA 5C4JL 3LWOB 4POGA 4AHZA 3LNLA 1PFVA 3PZAA 2XJPA 3H97A 3J7Y1 1TWAL 4A3KL 3HKZP 4C2M1 2XJVA 2CKCA 3HJWB 5RXNA 5M3ML 4A3JL 4ZN1B 4GS7D 5MGNA 4A93L 1IW7D 4AYBP 3KYWA 1YK4A 2V0FA 5GAHc 2HR5A 3LWVB 1WCML 4A3IL 4A3FL 4WFN1 2A6HD 2H12A 1S24A 3QVDA 2PPTA 2CKAA 1SMMA 4V196 3RZTA 1S30A 3CQZL 3B08B 2RFKB 1NXGA 1VZGA 2R93L 5GADc 2MS3A 4X6AL 3GTJL 3MPSA 1OWBA 2YU9L 5IP7L 2DSXA 3JR7A 2B63L 1ZRPA 3PIP1 5C3EL 4AR4A 3K7AL 1R0IA 3LWQB 3H9CA 3S1ML 4AHWA 1SFOL 3GTQL 2XJUA 2LCQA 1QQTA 1YUXA 3KYXA 5AI3A 4U671 1I3QL 2ERJA 4BBRL 1SMUA 1YUZA 4ZN3B 3S1QL 3P8BA 1LKMA 4JAEA 1R9TL 4K9FA 4AHXA 2CR8A 3HOVL 1RYTA 3H99A 1B71A 1F4LA 4XGHA 2A69D 4ME3A 3ZG6A 1RDVA 3NFPI 2GMGA 5FLML 2E2JL 4BY1L 2JA6L 1BFYA 2AQCA 1LKOA 2VL6A 3S16L 2ERSA 1IU5A 5IYCL 4BBSL 2VUML 5JVH1 4A3ML 2RDVA 5JVG1 4C3JL 5IY0A 4A3GL 3GTKL 1CAAA 4A3CL 2KN9A 3LWRB 1LKPA 3KYVA 3HOZL 3S1NL 3VPBE 2JA8L 2XJRA 2V0EA 2XJTA 3RZ6A 2Z3RB 3PO2L 3HJYB 1DX8A 2JA7L 2E2IL 7RXNA 5DM71 1JYBA 1YK5A 3PKJA 5MLC3 1R0FA 1TWHL 3WWLA 4Y7NL 5DM61 1YV1A 2NYDA 4XXBB 1RWDA 3PIO1 1RYQA 1Z92B 2M4VA 3K35A 3MQKB 3GTLL 2V3BB 2WB1P 4AI0A 4BY7L 1BQ8A 1RDGA 4BXXL 4TPUA 2A68D 3HOXL 4E6YA 3GTML 2APOB 1E8JA 6RXNA 4C3HL 1BE7A 2WAQP 1BQ9A 1T9OA 2Y0SP 1LTLA 5IYBL 2PVEA 3SS2A 3LPEB 1VZHA 2AUSB 4AHYA 5FJ8L 2NVQL 2E2HL 4JAFA 5M5YL 4A3BL 3S17L 4A3DL 3I4ML 3S1RL 2A6ED 1I6HL 3S2DL 3IU3I 4YWMA 5AN9H 2PSMC 3MSUA 1S2ZA 3S14L 1B2JA 5MFPA 1T9PA 1Y1WL 4A3LL 1TWFL 1PFYA 3HOUL 3GTPL 5H1Sc 2L0ZA 2M6PA 3FDJA 2XJQA 4LHLA 1IROA 2PYAA 3HOYL 1BRFA 1CADA 2BE5D 1C09A 2B5ID 1QCVA 1VCXA 1QYBA 1B2OA 5C4XL 3WWNB 2QL0A 5M3FL 2EY4E 1IU6A 5IP9L 2NVYL 2ZIXA 1Y1VL 2HVYC 1IRNA 2PMZP 5GAEc 5C44L 5EIOC 1NNQA 2C6AA 4JADA 3PL5A 3HOWL 4LHNA 2NVTL 4AI1A 3QQCE 1I50L 3RZDL 5M5XL 2R7ZL 4JAGA 3M4OL 5GAGc 4YWLA 4POFA 1PFWA 4TVMA 1K83L 5AI2A 4A3EL 5EINC 5M5WL 3KYYA 1RB9A 2M4YA 1PFUA 1B13A 2M6OA 1H7VA
chains in the Genus database with same CATH topology
1B71A 1LTLA 4XGHA 3PZAA 2A69D 2XJPA 4AI2A 2PVEA 4ME3A 3J7Y1 1R0HA 3SS2A 3LPEB 1VZHA 3ZG6A 1RDVA 4AHYA 3NFPI 2XJVA 2CKCA 2GMGA 4JAFA 4RXNA 3PWFA 5RXNA 1WJVA 2JI1A 3A44A 5MFZA 1BFYA 4B8CD 4ZN1B 4GS7D 4AR5A 5MGNA 2O5JD 1LKOA 1IW7D 2XJSA 3KYWA 5MF6A 3P2AA 2A6ED 3IU3I 1YK4A 2VL6A 4YWMA 2AYJA 5AN9H 2PSMC 2V0FA 2ERSA 5GAHc 1IU5A 2HR5A 3MSUA 1S2ZA 1B2JA 4WFN1 2A6HD 5MFPA 1T9PA 2H12A 1S24A 1T9QA 8RXNA 2KKDA 2PPTA 3QVDA 5JVH1 2CKAA 5H1Sc 2L0ZA 2RDVA 5JVG1 5IY0A 2JI3A 1SMMA 2M6PA 2PVXA 1CAAA 2KN9A 1DVBA 2XJQA 4V196 4LHLA 1IROA 2PYAA 4AR6A 4AR3A 3RZTA 1BRFA 1ODHA 1LKPA 1CADA 3KYVA 2BE5D 1C09A 2B5ID 1QCVA 1S30A 1VCXA 1QYBA 3VPBE 2XJRA 1B2OA 2V0EA 2XJTA 1FHMA 2Z3QB 3B08B 3RZ6A 3KYUA 2Z3RB 3WWNB 2QL0A 1VZIA 3PKIA 1DX8A 1IU6A 1OWCA 7RXNA 5DM71 1JYBA 1NXGA 1YK5A 3J7Z1 3PKJA 2ZIXA 4AI3A 1VZGA 5MLC3 1R0JA 1NXEA 1R0FA 1IRNA 5GAEc 5K2ME 3WWLA 5EIOC 4G6BA 5GADc 1NNQA 2MS3A 2C6AA 4JADA 3B0AB 3MPSA 1OWBA 2JI2A 2DSXA 5DM61 1YV1A 2NYDA 4LHNA 4XXBB 1RWDA 4AI1A 3PIO1 1RYQA 1Z92B 1ZRPA 3QQCE 1SMWA 3PIP1 1R0GA 3RYGA 1FHHA 4AR4A 2M4VA 3K35A 1R0IA 4AHXA 2V3BB 2J9UB 4AHWA 4AI0A 1BQ8A 1RDGA 2XJUA 2LCQA 4UY81 2K2DA 4JAGA 2C6BA 4TPUA 2A68D 4E6YA 1YUXA 3KYXA 5AI3A 4POGA 1E8JA 5GAGc 4AHZA 3LNLA 4U671 6RXNA 2ERJA 1SMUA 1YUZA 4YWLA 4POFA 4ZN3B 4TVMA 3P8BA 1LKMA 1BE7A 4JAEA 5AI2A 1BQ9A 1T9OA 5EINC 4K9FA 3KYYA 1RB9A 2M4YA 1B13A 2M6OA 1H7VA 2CR8A 1RYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 1;  3PIP 1;  4U67 1;  5GAE c;  5DM7 1;  3J7Y 1;  5GAH c;  5DM6 1;  4V19 6;  3J7Z 1;  5JVH 1;  5GAD c;  5H1S c;  5GAG c;  5MLC 3;  5JVG 1;  4WFN 1;  3PIO 1; 
#chains in the Genus database with same CATH topology
 4AI2 A;  1R0H A;  5IYD L;  4RXN A;  3PWF A;  3S15 L;  1WJV A;  3RZO L;  2JI1 A;  3S2H L;  3A44 A;  5MFZ A;  3GTG L;  4B8C D;  4AR5 A;  2O5J D;  1TWG L;  2XJS A;  5MF6 A;  3P2A A;  3H0G L;  2AYJ A;  3HAX C;  1T9Q A;  1TWC L;  8RXN A;  2KKD A;  3H9B A;  1P7P A;  3FKI L;  2JI3 A;  2PVX A;  4QIW P;  1DVB A;  3PO3 L;  4AR6 A;  4AR3 A;  1ODH A;  3GTO L;  2Z3Q B;  1FHM A;  3KYU A;  1VZI A;  2JA5 L;  3PKI A;  1OWC A;  3LWP B;  3J7Z 1;  4AI3 A;  1R0J A;  1NXE A;  5K2M E;  1PZX A;  4G6B A;  3B0A B;  3M3Y L;  2JI2 A;  4C3I L;  2NVX L;  2R92 L;  1SMW A;  1R0G A;  3H3V M;  3RYG A;  4Y52 L;  1FHH A;  3I4N L;  2J9U B;  4UY8 1;  2K2D A;  2C6B A;  5C4J L;  3LWO B;  4POG A;  4AHZ A;  3LNL A;  1PFV A;  3PZA A;  2XJP A;  3H97 A;  3J7Y 1;  1TWA L;  4A3K L;  3HKZ P;  4C2M 1;  2XJV A;  2CKC A;  3HJW B;  5RXN A;  5M3M L;  4A3J L;  4ZN1 B;  4GS7 D;  5MGN A;  4A93 L;  1IW7 D;  4AYB P;  3KYW A;  1YK4 A;  2V0F A;  5GAH c;  2HR5 A;  3LWV B;  1WCM L;  4A3I L;  4A3F L;  4WFN 1;  2A6H D;  2H12 A;  1S24 A;  3QVD A;  2PPT A;  2CKA A;  1SMM A;  4V19 6;  3RZT A;  1S30 A;  3CQZ L;  3B08 B;  2RFK B;  1NXG A;  1VZG A;  2R93 L;  5GAD c;  2MS3 A;  4X6A L;  3GTJ L;  3MPS A;  1OWB A;  2YU9 L;  5IP7 L;  2DSX A;  3JR7 A;  2B63 L;  1ZRP A;  3PIP 1;  5C3E L;  4AR4 A;  3K7A L;  1R0I A;  3LWQ B;  3H9C A;  3S1M L;  4AHW A;  1SFO L;  3GTQ L;  2XJU A;  2LCQ A;  1QQT A;  1YUX A;  3KYX A;  5AI3 A;  4U67 1;  1I3Q L;  2ERJ A;  4BBR L;  1SMU A;  1YUZ A;  4ZN3 B;  3S1Q L;  3P8B A;  1LKM A;  4JAE A;  1R9T L;  4K9F A;  4AHX A;  2CR8 A;  3HOV L;  1RYT A;  3H99 A;  1B71 A;  1F4L A;  4XGH A;  2A69 D;  4ME3 A;  3ZG6 A;  1RDV A;  3NFP I;  2GMG A;  5FLM L;  2E2J L;  4BY1 L;  2JA6 L;  1BFY A;  2AQC A;  1LKO A;  2VL6 A;  3S16 L;  2ERS A;  1IU5 A;  5IYC L;  4BBS L;  2VUM L;  5JVH 1;  4A3M L;  2RDV A;  5JVG 1;  4C3J L;  5IY0 A;  4A3G L;  3GTK L;  1CAA A;  4A3C L;  2KN9 A;  3LWR B;  1LKP A;  3KYV A;  3HOZ L;  3S1N L;  3VPB E;  2JA8 L;  2XJR A;  2V0E A;  2XJT A;  3RZ6 A;  2Z3R B;  3PO2 L;  3HJY B;  1DX8 A;  2JA7 L;  2E2I L;  7RXN A;  5DM7 1;  1JYB A;  1YK5 A;  3PKJ A;  5MLC 3;  1R0F A;  1TWH L;  3WWL A;  4Y7N L;  5DM6 1;  1YV1 A;  2NYD A;  4XXB B;  1RWD A;  3PIO 1;  1RYQ A;  1Z92 B;  2M4V A;  3K35 A;  3MQK B;  3GTL L;  2V3B B;  2WB1 P;  4AI0 A;  4BY7 L;  1BQ8 A;  1RDG A;  4BXX L;  4TPU A;  2A68 D;  3HOX L;  4E6Y A;  3GTM L;  2APO B;  1E8J A;  6RXN A;  4C3H L;  1BE7 A;  2WAQ P;  1BQ9 A;  1T9O A;  2Y0S P;  1LTL A;  5IYB L;  2PVE A;  3SS2 A;  3LPE B;  1VZH A;  2AUS B;  4AHY A;  5FJ8 L;  2NVQ L;  2E2H L;  4JAF A;  5M5Y L;  4A3B L;  3S17 L;  4A3D L;  3I4M L;  3S1R L;  2A6E D;  1I6H L;  3S2D L;  3IU3 I;  4YWM A;  5AN9 H;  2PSM C;  3MSU A;  1S2Z A;  3S14 L;  1B2J A;  5MFP A;  1T9P A;  1Y1W L;  4A3L L;  1TWF L;  1PFY A;  3HOU L;  3GTP L;  5H1S c;  2L0Z A;  2M6P A;  3FDJ A;  2XJQ A;  4LHL A;  1IRO A;  2PYA A;  3HOY L;  1BRF A;  1CAD A;  2BE5 D;  1C09 A;  2B5I D;  1QCV A;  1VCX A;  1QYB A;  1B2O A;  5C4X L;  3WWN B;  2QL0 A;  5M3F L;  2EY4 E;  1IU6 A;  5IP9 L;  2NVY L;  2ZIX A;  1Y1V L;  2HVY C;  1IRN A;  2PMZ P;  5GAE c;  5C44 L;  5EIO C;  1NNQ A;  2C6A A;  4JAD A;  3PL5 A;  3HOW L;  4LHN A;  2NVT L;  4AI1 A;  3QQC E;  1I50 L;  3RZD L;  5M5X L;  2R7Z L;  4JAG A;  3M4O L;  5GAG c;  4YWL A;  4POF A;  1PFW A;  4TVM A;  1K83 L;  5AI2 A;  4A3E L;  5EIN C;  5M5W L;  3KYY A;  1RB9 A;  2M4Y A;  1PFU A;  1B13 A;  2M6O A;  1H7V A; 
#chains in the Genus database with same CATH homology
 1B71 A;  1LTL A;  4XGH A;  3PZA A;  2A69 D;  2XJP A;  4AI2 A;  2PVE A;  4ME3 A;  3J7Y 1;  1R0H A;  3SS2 A;  3LPE B;  1VZH A;  3ZG6 A;  1RDV A;  4AHY A;  3NFP I;  2XJV A;  2CKC A;  2GMG A;  4JAF A;  4RXN A;  3PWF A;  5RXN A;  1WJV A;  2JI1 A;  3A44 A;  5MFZ A;  1BFY A;  4B8C D;  4ZN1 B;  4GS7 D;  4AR5 A;  5MGN A;  2O5J D;  1LKO A;  1IW7 D;  2XJS A;  3KYW A;  5MF6 A;  3P2A A;  2A6E D;  3IU3 I;  1YK4 A;  2VL6 A;  4YWM A;  2AYJ A;  5AN9 H;  2PSM C;  2V0F A;  2ERS A;  5GAH c;  1IU5 A;  2HR5 A;  3MSU A;  1S2Z A;  1B2J A;  4WFN 1;  2A6H D;  5MFP A;  1T9P A;  2H12 A;  1S24 A;  1T9Q A;  8RXN A;  2KKD A;  2PPT A;  3QVD A;  5JVH 1;  2CKA A;  5H1S c;  2L0Z A;  2RDV A;  5JVG 1;  5IY0 A;  2JI3 A;  1SMM A;  2M6P A;  2PVX A;  1CAA A;  2KN9 A;  1DVB A;  2XJQ A;  4V19 6;  4LHL A;  1IRO A;  2PYA A;  4AR6 A;  4AR3 A;  3RZT A;  1BRF A;  1ODH A;  1LKP A;  1CAD A;  3KYV A;  2BE5 D;  1C09 A;  2B5I D;  1QCV A;  1S30 A;  1VCX A;  1QYB A;  3VPB E;  2XJR A;  1B2O A;  2V0E A;  2XJT A;  1FHM A;  2Z3Q B;  3B08 B;  3RZ6 A;  3KYU A;  2Z3R B;  3WWN B;  2QL0 A;  1VZI A;  3PKI A;  1DX8 A;  1IU6 A;  1OWC A;  7RXN A;  5DM7 1;  1JYB A;  1NXG A;  1YK5 A;  3J7Z 1;  3PKJ A;  2ZIX A;  4AI3 A;  1VZG A;  5MLC 3;  1R0J A;  1NXE A;  1R0F A;  1IRN A;  5GAE c;  5K2M E;  3WWL A;  5EIO C;  4G6B A;  5GAD c;  1NNQ A;  2MS3 A;  2C6A A;  4JAD A;  3B0A B;  3MPS A;  1OWB A;  2JI2 A;  2DSX A;  5DM6 1;  1YV1 A;  2NYD A;  4LHN A;  4XXB B;  1RWD A;  4AI1 A;  3PIO 1;  1RYQ A;  1Z92 B;  1ZRP A;  3QQC E;  1SMW A;  3PIP 1;  1R0G A;  3RYG A;  1FHH A;  4AR4 A;  2M4V A;  3K35 A;  1R0I A;  4AHX A;  2V3B B;  2J9U B;  4AHW A;  4AI0 A;  1BQ8 A;  1RDG A;  2XJU A;  2LCQ A;  4UY8 1;  2K2D A;  4JAG A;  2C6B A;  4TPU A;  2A68 D;  4E6Y A;  1YUX A;  3KYX A;  5AI3 A;  4POG A;  1E8J A;  5GAG c;  4AHZ A;  3LNL A;  4U67 1;  6RXN A;  2ERJ A;  1SMU A;  1YUZ A;  4YWL A;  4POF A;  4ZN3 B;  4TVM A;  3P8B A;  1LKM A;  1BE7 A;  4JAE A;  5AI2 A;  1BQ9 A;  1T9O A;  5EIN C;  4K9F A;  3KYY A;  1RB9 A;  2M4Y A;  1B13 A;  2M6O A;  1H7V A;  2CR8 A;  1RYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...