4V19K

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
b'SGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
K PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4v19K02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 4v19K01
1VQPI 3I55I 3CCJI 2H8WA 1YIJI 3CC2I 1VQMI 5GAGJ 1VQ5I 2ZJQF 5DM7F 2JQ7A 1VQOI 3CMEI 3PIOF 3G4SI 3DLLF 1S72I 1VQ7I 3CCQI 2E34A 1QA6A 1FOYA 3CF5F 1Y39A 1YHQI 2ZJRF 3J7ZI 3CJRB 3CMAI 3EGVB 1YJWI 2QA4I 1ACIA 1FOXA 3CJQB 2OTJI 1WIBA 3G71I 2K3FA 2ZJPF 1FOWA 3CCLI 2OTLI 2E36A 3CCVI 2NXNB 5DM6F 3CCRI 1VQ4I 5GAHJ 5GADJ 3I56I 2FOWA 3J7YJ 1VQ9I 1HC8A 3CJTB 1YI2I 3CCEI 4IOCF 1YJNI 1VQ6I 1VQNI 3CC7I 4IOAF 3G6EI 3CD6I 2E35A 3CCSI 3CC4I 1VQ8I 4IO9F 4V19K 5JVGF 3CJSB 1VQLI 1VQKI 3CCMI 2QEXI 4UY8I 1MMSA 3CCUI 3PIPF 5GAEJ 1YJ9I 1YITI
chains in the Genus database with same CATH superfamily
2MYSA 3TOBA 2HDDA 1SAXA 3G1LA 1MW7A 4BUPA 1WH7A 1J75A 3BTCA 1X3UA 3GFIA 2PMHA 5HDKA 4CDGA 2D2WA 3RKWA 2ACJA 5F04A 3RSNA 4NQWA 3R61A 3HG9A 2H8RA 2UZKA 3QPLA 2V6CA 2HGCA 2JSPA 1VQ5I 3BR2A 2DPDA 3F0CA 2M8EA 1AKHA 2YU9J 3OL4A 3S32A 2NRAC 5J40A 4BQAA 4YIFA 5HVQC 3JREA 3HOYJ 4G7OF 1YTYA 1XMXA 1APLC 3CDIA 1V5FA 3B73A 4OMZA 2XPVA 1ZG3A 4UNOA 3OYBA 4E4HA 3SZTA 1I27A 4E7JA 1BR1A 3PNTA 3ZN1A 1ZN2A 3WE3A 4XLPF 2K9LA 3J81K 2Y0SN 2OU2A 2Y48A 4IQ4A 4Z6YA 4LMYA 3R4KA 1X1DA 1LFBA 1JE8A 1S29A 3CUQA 3HHHA 2OTJI 2JA2A 3H9JA 2HDWA 4HZFA 1YFHA 2O7OA 5HLTA 2QSFX 1I50J 1WSUA 4GFBA 2QSGX 1V5EA 1HDDC 4F52A 2K9MA 4HNUA 1G3WA 2KQRA 4ZTJA 1SFXA 1NK2P 5FGMA 1DPRA 5FD6A 3GFMA 1DGRM 5CVRA 5HODA 3FBNB 2DW4A 2VC1A 3CTAA 1O7LA 3DCFA 2E60A 1YW8A 2PJRB 2QQ9A 2BZTA 3B6AA 1TQIA 2QF7A 4XOPA 4OIRF 5FRNA 1R4NB 4RGRA 4C2UA 5DD8A 3E6BA 3ZOBA 2IGKA 3CC4I 4HDUA 3BPVA 3HJEA 4C9YA 4L0ZB 3S16J 1FZPB 3WE2A 3OIQA 5DEQA 1FX7A 3GUDA 3S8PA 4IHVA 3JAMK 1I5ZA 4GGGA 4E6KG 4WF2A 2XDVA 3QP5A 4F3QA 1TBXA 2P5LC 2Q2EA 3OYDA 1N77A 3K4MA 2DDBA 4A0ZA 5FLVA 1Z7UA 3ZR8X 4ZYEA 3IHUA 4OINF 4XKWA 2V1NA 1UG0A 2VL8A 1IRXA 3BWGA 2R7XA 3TP0A 3FXLA 3CCJI 4CGZA 2IS6A 3CUQC 2H8WA 1RIOH 2WY7Q 4N9HA 4EM0B 3M3YJ 4DNCA 3FK7A 1RETA 2R0QC 1PP8F 2HPIA 1XTAA 1W0UA 3VYUB 1U5TB 3BR3A 3VEPA 1BW6A 3H3VK 5L3FA 4ENKA 2ZMEA 2KZVA 1AHDP 1X4PA 3F21A 5HDGA 3PO2J 3JRHA 1RUNA 4IRIA 1HF0A 4MHGA 3BR6A 5FFZA 2J5OA 2ZO4A 2JQ7A 2DOEA 2XPUA 4BHCA 1I3AA 2BBYA 2EA4A 5D4RA 1ETYA 2HWVA 4ESBA 1T39A 2L4AA 2B7EA 2EILH 4KN7X 2E5NA 2XAGA 4ZC3A 2TRTA 2XGCA 1QRYA 3V8KA 2F4MB 3QPTA 1ZRFA 2HFHA 1YW7A 1HW5A 2ID6A 3HRSA 2CSOA 2VC0A 3QWLA 4KISA 2ZJRF 5F64A 2XGEA 4IRHA 5BQTA 3GW2A 3K2AA 1FIAA 5IP6A 2NS0A 3JRIA 2HVSA 4BXFA 1XGMA 2M45A 1Y6IA 4I99C 2IT0A 1S5LC 1ZRDA 3PQKA 2YU3A 4UV9A 1FYKA 1K83J 2H1LA 4ZZLA 2XIGA 3IUOA 4HX4A 2FSWA 2IBDA 3EUAA 3HRMA 4E7KA 2CV1A 4Q5SF 3H92A 4FCYA 1MBKA 3LSIA 5DM6F 2JT1A 3NARA 1SFUA 4DYQA 1ZG1A 1BOAA 2FOWA 1P2FA 2MABA 4UUVA 3ECOA 3HPGA 3EUKL 2E5ZA 4YIIA 2WB1N 2VN2A 4X1EA 1O3TA 1IXCA 4LIUA 3DBLB 1WI9A 1MDMB 2LNBA 2RV8A 1K7AA 4G9YA 1KYZA 2Z16A 4IO9F 1Z21A 2XV4S 4LJZF 2X4HA 2Y31A 4M3GA 1JTYA 1SANA 2CQXA 2GXAA 2NVQJ 1BR2A 2VASA 4DIQA 3RKQA 2V79A 3IP4B 5J3LA 3WTVC 1WCMJ 1HSJA 1FMWA 1B6AA 2DYRH 4LLGF 3RI4A 1QQIA 3NWSA 2MG4A 3BJ6A 4QPQA 4U0YA 3DFGA 1IN5A 5E1XA 3CZ6A 2IGNA 4UB6C 1ON1A 2L0KA 4C2TA 3TW6A 1GHCA 3GWZA 1CGPA 1SEUA 3E5XA 4ZDLA 2OA4A 3LL7A 4L5JA 1AWCA 1NH3A 2V1DA 1X1AA 1PDNC 2DQLA 5DYMA 5JI6A 4XMYA 2UXXA 3TDZC 5D5WB 4RAZA 5FROA 2W4SA 3LSMA 5EEHA 3OYLA 3W3CA 1VNDA 2M87A 4BEHB 3WTUC 2WY8Q 1MNEA 2JMWA 1FNNA 1FBUA 4UHTA 1TWCJ 3OSFA 2QKMB 2L9NA 4AUXA 2PFBA 1WPKA 1TW3A 1ITYA 4DQ2A 3K1PA 3IRQA 4UVCA 1QZEA 4D7MA 3ABLH 1OISA 1RRJA 2MLGA 1IRZA 5EJCA 3MCZA 4HQMA 2L01A 2LF7A 2PI0A 3SQNA 1LNWA 5EG0A 3DTIA 4RDUA 3FWEA 2R7QA 3EGVB 2FU4A 2FA5A 2LKXA 3HB9A 3F6VA 4HV5A 1XGNA 1QPIA 3ABTA 3RPUD 3MZ8A 3M7GA 4FHTA 1RKTA 2VBXA 3ZQQA 1Y0NA 2CQ7A 2V9KA 3S93A 4CCJA 4JX4A 1G3SA 5E1WA 1WHUA 1B72A 3TMOA 4LIVA 3CCVI 2EFOA 3H5RA 3EYIA 3W2VA 1YG2A 1FIPA 2G0EA 2K7LA 2OQRA 4CSWA 1HXDA 4UUTA 4JP0A 1X1BA 3HIFA 1IDZA 1P7IA 3RQ4A 2L7MP 1KU3A 4EVIA 4WXHA 1ZR4A 4XQFA 5M5WJ 2JJ7A 3OWTA 4JYKA 2MSYA 5H6RA 2LSOA 1FTZA 2QQAA 1W36D 3CJTB 3ZN0A 1KA8A 1VQ6I 3F8BA 2ZSIB 4YFNF 2WAFA 3L2WA 3E6MA 4UB8C 3V8JA 5EF6A 3P9KA 2WAQN 3NQOA 2Y30A 3ZQLA 2B63J 5C3EJ 3QOPA 4IHTA 2X0LA 5ICFA 1TZLA 2CRGA 4EM1A 2EIMH 4O3MA 1RKWA 4NB5A 3GTGJ 5K5RA 4UY8I 3KLNA 4BXUA 5FFXA 1LDKB 3L00A 1A5JA 2WAEA 2DA1A 1QPMA 5DCFA 5HDNA 4NUBA 1YQAA 3FZVA 5J4VA 2IAIA 2VJ5A 2VPLA 1RPWA 5E8IA 1LE8A 1PUFB 4HDVA 4XR6A 3V42A 4ESJA 4QSHA 3ONQA 2EPFA 1N75A 2DMNA 1ZLKA 2E2JJ 2VQGA 3A0HC 1Y1WJ 1XMKA 2PN6A 1SD7A 3OOPA 1SD4A 1R6RA 5GAGJ 3FMRA 4RGXA 3IRRA 4PFPA 3S2DJ 3R0AA 2CFXA 2IA0A 1MMGA 1ZHFA 5EZHA 1V5GA 3F72A 4M3FA 4ZYHA 2OC6A 1LDDA 2X6WA 1S3JA 1FMVA 1UG2A 3N05A 4AWXB 3ZMSA 5FRMA 2R92J 1FP2A 2AO9A 2DTRA 3S17J 3JRAA 1N78A 4HX7A 4H4KC 1VQ7I 4UUSB 2HQAA 2ZXWH 3AAFA 3NRVA 2WWYA 3LSPA 1R36A 1D0ZA 3J7ZI 2VJ4A 2HKXA 1BI3A 3JRDA 1RESA 2BY2A 4AVZA 3K10A 4HQEA 1OJLA 1FLIA 1MDMA 5ILSA 2NVTJ 5FB2A 1M1EB 1PVEA 2R7DA 5EEGA 3RKXA 3TBIA 3H0GJ 1QHGA 2KP6A 4A3KJ 1UHWA 2KRCA 2EFPA 2D45A 1K61A 2L2OA 1HW1A 4IJAA 3WU2C 2IA2A 2XRLA 4BU2A 2DFEA 4YFXF 2GZWA 1HW2A 4QIWN 4A5MA 1YX3A 2IPQX 1B1BA 4F7ZA 2XHKA 1R1TA 5L3CA 2JZYA 1YIOA 2QKLB 4YRVA 3TO9A 2W85A 2KDZA 3ZQIA 1VQ9I 3BTLA 1X2MA 1FY7A 1O57A 4W1UA 3K1NA 2FRHA 4O5VA 1YJNI 2F4IA 2A69F 1K79A 1EA3A 4RMNA 1GLNA 1OR7A 2KT0A 2LY1A 2O61A 4IRGA 3TKYA 2CV0A 2DT6A 3AG4H 2OBPA 2FQ3A 4UV8A 1LFPA 3CDHA 4K2EA 2OZ6A 1UZCA 1UCRA 4BHPA 2F6CA 1UHMA 4OOIA 3GTPJ 1DDNA 2W57A 3PFYA 3F8CA 4XNFA 1BA5A 2JPCA 3PFIA 2F48A 1NK3P 1V54H 1I3QJ 1U6GA 5IT9K 2PX9A 1MMSA 1SD5A 1C0WA 1LJ9A 2LOOA 2YS9A 2VODA 4JOMA 4B1RA 3WTXC 1FYLA 2IW5A 4AIHA 2AQEA 1YIJI 4LB6B 1MJ9A 1Q1VA 1HA8A 1ZH5A 3I0TA 3AL0B 2ZFWA 2DOAA 4C3JJ 3FM3A 3HSFA 2A61A 2ZJQF 2ZCWA 3JCUC 5BS6A 1I6HJ 1CF7A 4G12A 5M3FJ 1NHAA 3QRFF 1SFOJ 4WCGA 3EPZA 2PMZN 2DK5A 4PK4A 3JTGA 1GVJA 1SVOA 2KIMA 2R4GA 2XPWA 3QYBA 1W0TA 2K4JA 1JJ8C 2RNJA 3TDUC 2Z3YA 4DBRA 3C7JA 3C2GA 1OR7C 2L7KA 1SMYF 1UFMA 1QA6A 1KU2A 3CLQA 5ILVA 1WH5A 2IGMA 3CF5F 1JUMA 2EWNA 1LEBA 3S15J 5ED4A 4I98B 3ULQB 5CQGA 5F6FA 2KISA 4CZCA 1DPUA 1WIBA 3BR1A 3GEZA 4XN3A 5DV5A 5DDGA 5LGUA 2XVCA 1MD0A 4A2UA 2VXDA 4HX8A 4YG2F 3M9AA 3VPRA 3P5JA 3WTYC 3OS1A 2XGDA 5EGOB 2YSRA 2OJED 4PCQA 3RCOA 2JVHA 1GT0C 1B8IB 3BZCA 1A31A 4J19A 5DTDA 1Z77A 2VT3A 5J1YA 2VKVA 3CDLA 3CF2A 5FKOA 5J47A 3H5AA 2AHQA 3MAJA 2EFWA 1OYIA 1YOVB 3I59A 2A68F 2IGOA 4MIMA 2V1XA 1EH7A 3V7CA 1WJCA 2DMQA 2P0WA 1MH3A 4E70A 3L1PA 4I09A 5FLMJ 1BW5A 1YO5C 2EQRA 2MW8A 3MN2A 4M6XA 4RAGA 2O8XA 2FX0A 4OIOF 4J00A 1XB4A 4M3EA 3K0LA 4OWRB 2COMA 2EZHA 1MSEC 4BBRJ 5CJ9A 1FWZA 2ELJA 3TOAA 4IX7A 3V8LA 3DEWA 3Q5FA 2R7WA 1X4OA 2OCEA 3HEFA 3QU3A 5LHGA 5HOOA 2CU7A 1YJ9I 2YPRA 3GTQJ 2OV7A 2R7SA 4D7NA 5B3SH 1E3HA 1OCPA 1MMAA 1V55H 3TO6A 3KP5A 1HDPA 2NVUB 5HS8A 4UUSA 1MGTA 1YRNB 1ENHA 5L3DA 5TJJA 4ZH4F 3MKZA 2STWA 4I2OA 1I39A 3GTOJ 3DU5A 1WWXA 3EDPA 5JHFA 1QVTA 5JVTA 4HF0A 4AU7A 5CVIA 3A02A 3Q9VA 1TTYA 3A0BC 3E6DA 1W7PD 4IHWA 4ENMA 3GLXA 1YW9A 2BY1A 4KFCA 4FE4A 4HNVA 3M4OJ 3L2VA 3S3OA 1VQOI 3ZXSA 3HUGA 1P9QC 2ELHA 3PUFA 3U9GA 3MWMA 5KAFC 3HGGA 3WTTC 5CPRB 1RNLA 2X1CA 4KIFA 4Y3OA 3SHFA 2DFHA 5C4JJ 1B9MA 2P5VA 4XKCA 3PSIA 3TEDA 2E2HJ 2BXYA 2KIQA 2F5CA 1XCVA 4P9FA 3K1MA 2W7NA 3D5SC 3HOWJ 4ENJA 3FXOA 3LOCA 4LG0A 3ASNH 3GZ5A 2F5FA 5FJ8J 4M73A 1BC8C 2W84A 2QWWA 1Y8QB 2LY2A 4KIGA 3S1RJ 3S2HJ 3FXQA 1AOYA 3W2AA 1PYVA 4HLYA 3VWBA 4XBFA 1KYWA 2HQ5A 1MJAA 4JX6A 1FBSA 5GTIC 4EGZA 4HF2A 4JX5A 1J09A 2DA4A 4A0XA 1MBHA 3DF8A 1W4MA 3H9QA 3ZMZA 2XB5A 3GX4X 5EZGA 4NDLA 2BEOA 1E0EA 5EEAA 4FASD 3I56I 2L7ZA 5K5OA 2EFQA 5FLXZ 4XKBA 1W1WE 2KL4A 2X6YA 3SFZA 1ZAOA 5IYDJ 1A6QA 1S7EA 2M9HA 2W25A 3FMQA 1OYWA 1YI2I 1XGSA 3DWLE 3FKJA 3LSKA 3CCEI 3CC7I 1STZA 1HCRA 2RNGA 5LEKA 3HOTA 2CS3A 4IF4A 4A3DJ 3RPQA 5ICGA 3GFLA 1UJ8A 4BQNA 2JRMA 1REPC 1KZHA 1Z91A 3HOZJ 3IH2A 3M07A 2KFDA 4MFEA 1VQKI 2YR2A 3SDGA 1V3FA 3CO6C 4HBLA 3WHBA 3BTJA 3IWZA 3GLLA 4RAFA 2V6EA 1OCTC 3WTSC 2KPMA 3FDYA 4HSTA 2NS8A 4JQFA 2LMDA 4I6ZA 1B9NA 2DOFA 5GPAA 1KGSA 1XC5A 2Y9ZA 3LMMA 1JT6A 4MQ9F 4EJVA 1TWAJ 1QBJA 1K4TA 5JFRA 4X0GA 3O2PE 3LSTA 2FBKA 2YX7A 1JJ6C 2FD5A 3CO7C 1T08B 1XD7A 3E97A 4UXNA 1BJAA 2X6OA 4L5EA 5D5XB 3DKYA 1Z05A 4M9SA 3JW4A 2R7UA 4XLCA 4DYCA 3CC2I 2ECBA 5FKKA 2P7CB 1VQMI 3VYTB 4NC6A 1R5ID 2JUCA 1U8RA 1X1CA 1P6RA 1USTA 2GA1A 1MBFA 1W7PB 2ZXJA 4IXAA 4EEFG 4X6AJ 2X6XA 3KE2A 4A6EA 4M9XA 4XLAA 2VB6A 4RBOA 1MSFC 1BJZA 1Y0UA 2FMYA 2E1OA 2L5QA 4N4NB 3FMSA 2QUFA 2R5YB 5LGTA 4WX9A 1D1AA 2VIXA 2ZXHA 4NNJA 5IPAA 5FD5A 3SEZA 3IAS2 3FHZA 3LNQA 3D0SA 1JKPC 4BS9A 3AL0C 1SD6A 4YEJA 4DYRA 1K78B 2K3FA 2M8GX 2VQLA 3BOQA 3K70D 3LWFA 2ZJPF 1ZQ3P 1MJBA 3U2RA 3ZQCA 1QVUA 2LD5A 3LQRA 2HTSA 2E1MB 3MKLA 4QPOA 1A04A 2D1HA 4G6DA 4KA4A 2XC7A 3Q3SA 2I8DA 3PNVA 2KIFA 1NG6A 1X19A 2YUSA 1LDJA 3F8MA 1RR7A 3IH4A 4G7HF 1TNSA 1ETOA 1X58A 2O0YA 2VQCA 5F0FA 2QBYB 3TW7A 4ZDPA 3J80Z 2J5PA 4XICA 3LA2A 2X48A 2ZBKA 4EMSA 5BPIA 2DYSH 4UVBA 4IOAF 1WZ2A 4XK4A 2CH0A 1QO0D 1NTCA 1SAUA 3S14J 3V4GA 2LG4A 1ETWA 2UWMA 3RZOJ 1J9IA 4LLLA 1ONVA 3PSFA 1JKOC 1JXSA 2EIJH 5DCMB 3LSJA 5HNHA 2HOTA 3L2CA 3PJRA 2K5CA 1MNDA 2JTVA 3W6JB 3BY6A 2RC4A 3GZNB 1MIJA 3CCMI 2MGQA 3HRUA 1Z6TA 3AKZA 2RKHA 3HYIA 4R1HA 5F27A 2ZC2A 3IKVA 3Q9SA 5K5QA 3ML6A 3C18A 3J7YJ 3ERMA 1R1UA 3LSHA 4GDFA 4L9JA 4S05A 1XPXA 3KLOA 2LFBA 5E8GA 2H6BA 3MMYB 1TLHB 1JT0A 2CJJA 4GRIA 2NS7A 1FP1D 1G8XA 1YYVA 4F91B 4BBSJ 2MBFA 1FBQA 3HKZA 5CVJA 4XLFA 4A6DA 4C2MJ 2K3PA 2VOOA 5E1ZB 2DFIA 3Q0VA 4XLNF 1ZLJA 1T56A 3DU6A 2BHYA 2AXLA 3VODA 4IHYA 5IYBJ 5B1BH 1TP4A 3K9TA 2ECCA 1H89C 2E7WA 2XGXA 4OIQF 1Z0XA 2F5EA 5B66C 2HI3A 4BKXA 3QPHA 3IAM2 2ZSHB 2HXIA 3LAPA 2O8KA 1KU9A 1OFCX 3I64A 2DCEA 4G8XA 4LOCA 3CMEI 4C30A 2M4GA 4IZZA 4A3FJ 1WJFA 5FO5A 3DLLF 1OPCA 4C3HJ 3CCQI 1R9TJ 2R93J 5E3NA 2W00A 2FBHA 1O3QA 3IKTA 1SFKA 3W2WA 4BL0B 4RB1A 2DI3A 4EATA 3BDDA 4PUSA 2HR3A 3GVAA 3G2BA 1YLFA 5B5EC 1ORKA 2CW7A 3T5XA 1P4AA 4Q48A 3JRFA 3OYAA 4LG3A 2LBFB 3ISPA 3NEUA 4U0WA 2DDAA 2OTLI 2ESHA 1ZKGA 4Y15A 3IL2A 4NHJA 3CP8A 5TRDA 4ZYGA 1LFUP 3QQAA 2OQGA 4HRIA 2PEXA 1U78A 1D8JA 4FETA 4G7ZF 4U0VA 5IT3A 4S04A 1D0XA 3H1CA 5GTHC 3I5UA 1G6NA 1R7JA 1XG1A 2PJRA 3F22A 4M9ZA 1ETQA 4XRMA 1N25A 3WU0A 1ZYRF 1VQNI 2L4MA 1FEXA 3KYDB 3MKWB 3FKIJ 2E35A 3U1DA 2IS1A 5LRRA 1H9GA 3ESWB 3QODA 3MFKA 3OR2C 3SFIA 1F1ZA 1LEAA 2IJLA 5IP7J 5JVGF 3SJMA 3HHGA 1PUEE 4KIBA 4LD5A 1EV7A 1VQLI 5JR3A 3OOUA 5D5VB 4RA2A 5DD4A 4ASNA 3K4KA 2HYJA 2QYOA 2QENA 1BI2A 4CCKA 3RDIA 2Q0OA 2HEOA 2VPRA 1TW2A 2ISYA 5TISC 3LQQA 4CCLA 2V26A 3NAUA 4A3LJ 1IN6A 2MC4A 3S3MA 3I71A 3T8TA 2NAZA 4AYBA 1WRJA 2M7AA 2X1DA 2R5YA 1IUYA 3WTWC 3OYIA 4WXDA 3A4CA 2OF7A 1U5TA 2X85A 3DBRB 3DQVC 1T98A 2VKDA 1MKMA 3KETA 3L2UA 2WADA 2STTA 2ESNA 2FNPA 2GAUA 2EH3A 2RAEA 1SMTA 5LHIA 2P4WA 1WI3A 1S7AA 3M8FA 3HOSA 2IA1A 2QQBA 1ULYA 2HZDA 5A2QZ 3W6VA 4ZYAA 2ADUA 3J7AO 1YE9A 2JSCA 4A69C 1BL0A 3G4SI 4XOTA 2G9WA 2M2EA 2ZXIA 3K7AJ 4B3AA 4HA8A 4CYCB 1JHHA 2KKOA 1TWGJ 3ABMH 3E1SA 5L3GA 2E7XA 3B6CA 3CMYA 3K4JA 4A3GJ 2EV6A 2XAFA 1BOBA 5GPCA 4FE7A 3BR5A 2EIKH 3BROA 2VE9A 3F9KA 1G4DA 4MNUA 2R5ZB 4BJ6C 1ETXA 5JLWA 4XLHA 2DODA 3IWFA 4ZDOA 1ON2A 3DPLC 3A03A 3JRBA 4ENNA 9ANTA 3DBHB 3OSGA 2Q8KA 3KZIC 4CO8A 2EZKA 1GDTA 2D1VA 1GV5A 3BTIA 4LK1F 4XKVA 2DLLA 2LR8A 2IXSA 1U5TC 3U21A 5LEJA 2JA7J 2EV0A 2KIUA 4P5OA 1QZYA 1IZ1A 2I5UA 4BJTA 4GXOA 2HU9A 2V7FA 4ZTFA 5H20A 2V4JC 4XLEA 4ABZA 4EGYA 4I76A 4V19K 3I4MJ 5E3OA 3TO7A 2E1MC 2CQQA 3UR3C 2VOPA 1YS7A 4ZZDA 3GF2A 4P96A 4LITA 2XF5A 4PJ0C 2XAJA 2JA5J 2QEXI 3T8RA 1MH4A 4HLXA 2P81A 4B44A 3RZDJ 3WGHA 1LPQA 5KK1A 4RM3A 2M1BA 2CFOA 1VTNC 4LB5A 1H8AC 3GXOA 2K85A 3WTZA 2XKOA 1XSDA 1DU0A 5BMZA 1HKQA 2OPTA 3D1NI 1F4KA 3S1QJ 1WVRA 4PFOA 3QPSA 5E20A 2FBIA 2TDXA 5JLXA 3WODF 4WXCA 2CW0F 2EZLA 4A0YA 2ZB9A 3KZYA 1Z9CA 2CUEA 2IRFG 4BEHA 1TQPA 2FQ4A 1F9NA 1YX5A 2PMUA 2FMLA 3DLAA 4NQWB 1JKRC 2AS5F 2YX4A 4FX0A 4KYWA 1FYMA 3ZMTA 3C3WA 3G73A 2X9DA 2N8GA 2LBFA 3FXUA 3P9CA 3K4CA 2G7UA 4AM3A 5E18F 2HS5A 4BY7J 2FJ1A 1IN7A 2LKPA 1AKHB 4M3DA 2UV1A 1D3YA 4DW6A 1ZREA 2GXBA 1TL8A 2DJIA 4M3BA 3GTJJ 4E7HA 5KAIC 4ETSA 2MLKA 3KFWX 2GXGA 2PBIA 1IGNA 5BNGA 1J7KA 1OQYA 4BAYA 1O3SA 3HOVJ 2L9VA 4A3MJ 1FJLA 3T0YA 4M6VA 1JHFA 3KPHA 4B4CA 3A2KA 1EJ9A 5CVVA 1XS9A 3ZP5A 4A93J 4F92B 3CUQB 3JRCA 5FKMA 2R7RA 4BGDA 3BLYA 4BE0A 3GTMJ 3X2QH 4L9VA 4RB3C 5EDNA 2CO5A 2CUZA 1RUOA 2DT7B 3I54A 4YIRX 1IDYA 3C2BA 1O3RA 5GADJ 2E2IJ 2ZNZA 3GTLJ 2HVRA 1LUJB 2DXIA 1MBGA 2QGUA 2HPMA 2EA2A 3KP2A 4OIPF 1T38A 2Y0MA 2IEKA 2MA3A 3O6BB 2JK3A 3CD6I 2DK8A 3MQ0A 2HDCA 1KQ8A 2DJNA 2CQKA 1JUSA 2M3AA 2LF8A 4AD9A 4PGGA 1Q1HA 1WKMA 1B4AA 1U0JA 4MFDA 4HYEA 2C6YA 3FIWA 1RR8C 1IN8A 5F08A 1B59A 3H9GA 2COBA 3OIPA 2R7VA 1IO2A 2FNAA 4BACA 3FX3A 3HTUA 1MBEA 4XRSG 3FXJA 2BOLA 1OYYA 2DPUA 2HXOA 2Q2EB 3MZYA 5K7HA 3J81Z 1QGPA 2B9SA 5F1RA 4D9JA 1PUFA 1YITI 1ZARA 3BP8A 1G3YA 1LB2A 2E71A 4U88A 1P4WA 2FEZA 4KT6A 4PDKA 2Q1ZB 5ICEA 5ERIA 3HSRA 2JA6J 3I9V2 4XRFA 4DZPA 2VUMJ 1Z1DA 4RM2A 1G3TA 5H2FC 4HG2A 4MEXF 4BXXJ 3L9FA 3HSEA 1P92A 3W6KB 3L09A 1FOKA 2QCOA 4Y17A 2GWRA 2F5VA 4GYGA 3ABKH 1HOMA 2LKSA 2ZMEB 3C1DA 3M1EA 4G94A 4EV0A 2HKOA 3BPXA 3OS2A 1JTXA 1IXRC 2NVXJ 3A1YA 1RI7A 2ZJ2A 5E3MA 2A5YB 2OUMA 4RB0A 4F55A 2Y9YA 4CCNA 3BR0A 4KUMA 3DTEA 5CKTA 3A01B 1J2XA 1S6LA 2GLOA 1X3ZB 2M0CA 3OIOA 1BIAA 4B48A 5EYRA 4P55A 1R5GA 1U9NA 5DUIA 1X2NA 3E0JB 2KLOA 5HLIA 1HKSA 2GIVA 1JGGA 3RPUA 1WJBA 3JAMZ 1OMIA 1WJEA 4RGUA 5ICCA 4FT8A 4KDPA 5K7ZA 3TQNA 4HSRA 1IAWA 1W5CC 1FC3A 3PUBA 4Y4RA 5J8FA 1T2KA 2D5VA 3RYPA 3CESA 3ECHA 1E2XA 2BXZA 4G6TB 1ZR2A 3KYCB 4L9TA 3QYFA 2MD5A 2JVGA 5D4SA 4DBQA 5C4XJ 5LD2C 3WGIA 2V9PA 5E3LA 2FF4A 4A5NA 4XORA 3OYKA 1T0FA 2Z2SB 2A6HF 2L02A 3K69A 4PJLA 4RLQA 1GV2A 2XAHA 2VKEA 4L0YB 3ABUA 3BCAA 1JUPA 3H36A 2XB0X 3DTKA 2XAQA 4MTDA 2WV1A 1BC7C 2VBWA 4B3XA 4QTRA 1FSHA 4Q47A 2NOJB 1K6OA 4PJMA 3DV8A 4BDZA 1ERDA 4M72A 1DP7P 3LAJA 5LGNA 1GUUA 2Z99A 2L3DA 2Z1DA 4HPQA 5BOXA 3BQYA 1PJRA 1MBJA 1JKQC 1T6SA 3TP3A 3LSRA 2VJJA 2P6TA 1TNTA 1HLVA 1VZ0A 3CCUI 2JA8J 5KVRA 1IRFA 3OY9A 4KICA 4XONA 3RYRA 2H94A 2M34A 5GAEJ 2FUG2 1Z7LA 3E5QA 2P6SA 4HV6A 2DN0A 4ITVA 1VQPI 4RLFA 2QLZA 4Y33A 1OCZH 2HOSA 4XSXF 4I0BA 2AXTC 1E17A 2HOEA 2DAOA 4XL9A 2EBIA 2EV5A 4L5IA 3RTRA 1A36A 3GMEA 3DKXA 2HTJA 1IF1A 1T95A 1K6YA 2LDUA 1A35A 4CH7A 3SXYA 1TWFJ 4ZJZA 3VFZA 4BY1J 1R00A 2VT2A 3DEUA 4AVPA 1EH6A 4BE1A 5DM7F 1IN4A 5LRSA 3B02A 3V7RA 3F6OA 3OYNA 4PZJA 4BYYA 2F2EA 2NOGA 5HS7A 4L9NA 4E7LA 5FKNA 2RQQA 2HVQA 1F36A 1T0FC 1W36C 2R7OA 2LVSA 2RN7A 2A3SA 2E19A 2K9NA 2KHMA 3G1MA 2KRHA 1MMDA 2EINH 1HKTA 2E34A 4V2FA 2W1OA 2WBMA 3JR9A 3AG2H 3CCYA 1YHQI 3BG6A 4I02A 3VSKA 3F23A 1I6XA 3LFKA 4A3CJ 3CJRB 3RKYA 2A07F 2XF7A 1YJWI 5EG0B 5CLSA 3H0DA 4E7IA 2Z5UA 2NVYJ 4BH9A 1SC7A 4YELA 3G71I 2VJIA 2Y75A 2MH2A 2OD5A 3ZQHA 2CUFA 1R4MB 3HOXJ 3QAHA 5EGOA 1G2HA 1UELB 1F5TA 2H1KA 3JTHA 1B8IA 1EKEA 1WFXA 1B72B 1D5YA 2MFZA 1V4RA 3H5NA 5HLHA 1OCOH 2L7FP 1Z3XA 2K9QA 2F5DA 2XAUA 3S2WA 4WK8F 2XKPA 2GOMA 4PJNA 2CG4A 2UUZA 2LRDA 3ZPLA 1IRGA 2RREA 4II3A 3KEOA 2H6CA 1HC8A 3F8NA 4L18B 4XM3A 2LREA 2ZKZA 3G1OA 3HKZN 4EJOA 4CZZA 1J0RA 5B1AH 4DJAA 3BQZA 4IOCF 2VBYA 2LTPA 2E1CA 4CICA 2GBYA 2DA7A 2L54A 2Y0SA 1VQ8I 3BZ6A 4IEJA 4P9UA 1IJWC 3KP4A 1IG7A 4M71A 3CQZJ 3TGNA 2GQQA 2CGPA 2DO7A 3ZQFA 4E7SA 2IP2A 3VB2A 1S7OA 2L9SA 3L2QA 3LA7A 4MEYF 2M5WA 3PL8A 1TWHJ 3CUOA 4QWQA 3JRGA 1U3EM 2VXZA 2MD0A 4ON0A 2M30A 3PIPF 5K7FA 2GIZA 3ZCOA 5M5YJ 1PP7U 2QZ8A 5L3BA 3BZKA 2JN6A 4DOZA 1L0OC 4A3JJ 3A01A 3H3UA 3I55I 1YRNA 4CA0A 2O03A 2KJBA 5J8CA 4IHSA 2CWEA 1KQ0A 1LE8B 5FLXK 1AA7A 2BHZA 1WQ2A 1JGSA 3PM1A 2HQRA 3LFUA 5E17F 1ZTRA 4I7HA 4U87A 3R6SA 4UVAA 4CXFA 1IC8A 1U8BA 1JI8A 2ZNYA 4XSZF 3HRTA 1BI1A 2CYYA 5CVUA 4BHBA 1UB9A 3EQLF 4MTEA 2BGCA 2K86A 5LFAA 3BG7A 3HC7A 3KCCA 2ELKA 4LGWA 3OV8A 2LH9A 2X51A 2HYFA 2Z9OA 2I10A 1DGWY 2HYGD 3H3ZA 3PIOF 4MO7A 2K9SA 4P1WA 2DMUA 4FISA 3DP7A 4HNTA 3RQIA 4AIDA 4E7ZA 3LSGA 4AIJA 1XX5A 2P7VB 2CQNA 2KMUA 1HSTA 2ETHA 2XF6A 5E79C 2Z33A 3T1BA 1LVKA 1Y56A 2IVMA 4NBQA 4N9IA 4IVNA 1YS6A 2VI6A 1U2WA 1IV6A 1IW7F 2GA2A 3J7AY 3K4NA 1S8NA 3EETA 2G7HA 4Y7NJ 1FOWA 2ZMEC 3AFHA 3OR1C 1ZELA 1J59A 2QVOA 2DQRA 2K4BA 5KNLA 2F4OB 4RGSA 4AIKA 2EZIA 3SEQA 3QU6A 2M4KA 3BG3A 3JSOA 3DPUA 2PLYA 4BNCA 1XN7A 2QM3A 5AONA 2A6EF 1BIBA 1BR4A 2VLAA 2RQPA 2R7TA 4AYBN 1W5SA 3CJNA 3K6GA 2EB7A 3VYRB 3HZJA 2KZGA 3WGGA 2OZUA 1IV8A 1GXQA 2ISZA 4D0PA 3KZZA 2BE5F 2W48A 2O9LA 1O7FA 2ID3A 1QHHD 1MMNA 4KNYA 3I53A 3V7SA 3CJSB 1ETVA 2LY9A 4IPAA 1BM9A 4O6JA 3ELKA 3GZ6A 2K40A 1WJAA 1XDSA 2PG4A 2LYCA 4B8XA 3K2ZA 4YFKF 2NNYA 2WTEA 3HTSB 4OU0A 3E6CC 2K02A 3BJOA 2HNHA 2R3SA 3HGYA 4CHUA 1GXPA 1QNTA 2OCCH 1TT5B 4XN0A 2GM4A 4A3EJ 2UXNA 4IL6C 5LLQA 3OL3A 5HNFA 1AU7A 3MEXA 2BV6A 3UKGA 2PQ8A 2ME6A 3L2RA 3HM5A 1EF4A 1X1PA 3J80K 3KEYA 1XSVA 3REOA 5F0HA 2XSJC 2WB1A 4ZYDA 4KT5C 4C3IJ 5IY5H 4RB2C 4FQGA 2NNNA 4KMFA 4I01A 1DP3A 3FBIB 1W7PA 3R0JA 3SZGA 4PSXA 2WA0A 2BY0A 2OAZA 1CF7B 2CMPA 3I4PA 1RC9A 2XSDC 2L9RA 4H0EA 1I1GA 2O6GE 1QU3A 1H9TA 3ASOH 1FSEA 1P4XA 1S72I 2QSHX 3OYFA 3KX2A 4EQQA 4HAMA 1IXSB 1G59A 5GP9A 1OCCH 2CUJA 5JHUA 3FXMA 5DS9A 1DUXC 1X3WB 1XCBA 3NWTA 4Y52J 1H88C 1RZ4A 3VDXA 5M5XJ 1K78A 2V9VA 2H09A 3GBGA 5L3EA 1FOXA 4G6QA 2BW3B 4B09A 4IKFA 2VE8A 2O5RA 2RVCA 1Z3YA 3DPTA 5IT9Z 4D5FA 2BVLA 5DUKA 5K1YA 3ZQGA 2NXNB 3HXLA 1SVMA 3BCBA 3H35A 3WG9A 2ICWG 5TGTA 2QBYA 3BG5A 3F3XA 5GAHJ 3VSLA 1ZGWA 2DA5A 3ZMDA 3KYLA 1D8KA 2HOAA 4GO1A 3I59B 3K4LA 5J1UA 3O8GA 1Y8RB 3OYJA 1H0MA 2CW8A 1R58A 4TV7A 4AC0A 3G6EI 4HF1A 1USSA 2HZTA 2M0MA 2IS2A 2KRFA 1A6IA 2A05A 1MNMC 5DCMA 3MVPA 4A12A 3S1NJ 1POGA 1E3PA 1R71A 2DMTA 3HL2A 3CLOA 2DFFA 2ME0A 4ESFA 4PJJA 4PGHA 3RJPA 1HQCA 2GOXB 3FM5A 3U1KA 2VONA 3SYTA 3OYMA 3HPHA 3S3NA 1F43A 3OYEA 4EJUA 5D5UB 3GCMA 1WJDA 1D1BA 4A3IJ 4IQJA 1XGOA 2ZFUA 4JBAA 4XIDA 4N0BA 1D5VA 4CCMA 4U7DA 1J5YA 2JWTA 3LA3A 3S1MJ 4KJZA 5HLGA 3KP3A 2PJPA 1D0YA 1IUFA 1OKRA 3L7WA 3N4MA 2X1EA 2BVMA 1W5TA 2Y2ZA 2IS4A 5LHHA 3I3LA 3IH3A 3TL4X 2WAQA 2DT5A 2LK2A 5IOYA 4XRSA 2LC2A 4B43A 1R23A 3G3ZA 2JRTA 4MLOA 2CV2A 2EFNA 3HOUJ 3CP2A 3P9IA 3E3VA 2KJCA 5J1RA 3O3KA 5J4YA 3HUGB 3VYSB 3WG7H 4D1QA 2WC2A 3FXKA 3I58A 2DA6A 2DU9A 1HBXG 1UAAA 4JK1X 1FOYA 2LP0A 3BJAA 4Q4ZF 2DA3A 3D5RC 5D6EA 3COAC 4S0HB 3OYHA 3ZRGA 2R7FA 5IOZA 1L3LA 1DU6A 5F0CA 4F93B 4CYDA 4LG0B 1TQMA 2Y69H 4BE2A 1TC3C 3WHCA 2RGVA 5M3MJ 2WV0A 3OYCA 3ERED 3PO3J 1ZRCA 2E36A 4DZJA 1VFCA 2KDOA 1XDUA 1ZK8A 2DMPA 1Z6RA 4OAYA 4D5CA 4KMUX 2VQHA 3R60A 3CCRI 4CUGA 3DXJF 4FTHA 5D8KB 4CCOA 4GCVA 3KP7A 4EJTA 4NC8A 5A2QK 3UNGC 2BYVE 3FK6A 3KEQA 3ZMUA 4BQOA 3O8HA 3HBLA 1XSXA 3K4BA 3DEEA 3P7NA 3OS0A 2FOKA 1WGXA 3Q0UA 3EYYA 1GVDA 3RIRA 4EJWA 2H27A 4M6YA 2XROA 4MQVA 4BDYA 1QZZA 5KCMA 2P8TA 1Z67A 1ZGAA 4M74A 3GO5A 4Y13A 1SFEA 1MZBA 5AIPA 5BPDA 1KU7A 1FTTA 2E1NA 1LKXA 1CQTA 1SVLA 5IP9J 4DGWB 4W97A 1LVAA 2FXAA 2MH9A 4GYIA 2JPBA 3QP6A 4RAYA 3SZPA 3M8JA 4LLNA 4HOBA 2W82A 3PQJA 3WU1B 3IV5A 1O4XA 1LQ1A 1VI0A 3KP6A 2EJRA 3K70C 4RS8A 4KITB 1BBYA 1D1CA 1WJ5A 3MKYB 1KQ9A 3IC7A 4B47A 1U9OA 4R79A 2BW3A 2EK5A 3BC8A 4KN4X 3CMMA 2MC3A 1TT0A 1T8IA 1R49A 2P5KA 3PNYA 4U7BA 3HDDA 3EUHA 1E3OC 5IYCJ 1OCRH 3FXRA 4A3BJ 5D6FA 5AIQA 3FISA 5HS9A 4CYCA 2R7ZJ 1Y1VJ 4PSWA 3ZQ7A 3FHNA 1UHSA 2XRNA 3GFJA 4NC7A 3MZHA 1Y39A 3D5LA 6PAXA 2V1UA 2DBBA 1P7JA 4V2GA 4LFUA 2JUGA 3AG1H 3CMAI 4J01A 3BG9A 3M1CA 1R5HA 3QYEA 4BJ5C 5F1JA 2QA4I 4R8HA 2A5WA 1ACIA 1NG7A 3C2HA 3OMYA 3CJQB 1ETKA 5FKLA 4Z2YA 1OLTA 4MGRA 3E5UA 5D8LB 4EM2A 2XUBA 5C44J 4QLCU 5LBQA 4IHXA 2R5ZA 3Q0WA 3CCLI 1ZG5A 2BY3A 4ANJA 4N4OB 5ILUA 1K4SA 1XMAA 1S9HA 1BN5A 5KHDA 1VQ4I 2DTZA 5CYVA 3GYHX 2TCTA 4HEA2 2HQNA 2K27A 3N97A 2PMZA 1EH8A 1UMQA 2M7BA 3AG3H 2RDPA 4II2A 3OYGA 4LK0F 3FF5A 3JSPA 3ROUA 3QOEA 2QQ8A 2VBZA 2AQFA 3ZMVA 2XASA 4FX4A 3M8EA 3CCSI 1R22A 3VOEA 1R1VA 2NYXA 5J6XA 3GTKJ 4I0AA 2FE3A 4WWCA 1ODDA 3I4NJ 1DQUA 1VF9A 2VKHA 1T33A 1FT9A 1BI0A 2A6TA 2O3FA 3SDBA 3EUHC 3E7LA 1KONA 2LLKA 3MD2A 4HW0A 4OMYA 4BQQA 5H6QA 4OAZA 5CQEA 3BT9A 3DKWA 3KIOA 2B0LA 1FPQA 1ZGJA 3F8FA 2W24A 1I1SA 3ZGKA 2DA2A
chains in the Genus database with same CATH topology
1VQPI 3I55I 3CCJI 2H8WA 1YIJI 3CC2I 1VQMI 5GAGJ 1VQ5I 2ZJQF 5DM7F 2JQ7A 1VQOI 3CMEI 3PIOF 3G4SI 3DLLF 1S72I 1VQ7I 3CCQI 2E34A 1QA6A 1FOYA 3CF5F 1Y39A 1YHQI 2ZJRF 3J7ZI 3CJRB 3CMAI 3EGVB 1YJWI 2QA4I 1ACIA 1FOXA 3CJQB 2OTJI 1WIBA 3G71I 2K3FA 2ZJPF 1FOWA 3CCLI 2OTLI 2E36A 3CCVI 2NXNB 5DM6F 3CCRI 1VQ4I 5GAHJ 5GADJ 3I56I 2FOWA 3J7YJ 1VQ9I 1HC8A 3CJTB 1YI2I 3CCEI 4IOCF 1YJNI 1VQ6I 1VQNI 3CC7I 4IOAF 3G6EI 3CD6I 2E35A 3CCSI 3CC4I 1VQ8I 4IO9F 4V19K 5JVGF 3CJSB 1VQLI 1VQKI 3CCMI 2QEXI 4UY8I 1MMSA 3CCUI 3PIPF 5GAEJ 1YJ9I 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP I;  3I55 I;  3CCJ I;  2H8W A;  1YIJ I;  3CC2 I;  1VQM I;  5GAG J;  1VQ5 I;  2ZJQ F;  5DM7 F;  2JQ7 A;  1VQO I;  3CME I;  3PIO F;  3G4S I;  3DLL F;  1S72 I;  1VQ7 I;  3CCQ I;  2E34 A;  1QA6 A;  1FOY A;  3CF5 F;  1Y39 A;  1YHQ I;  2ZJR F;  3J7Z I;  3CJR B;  3CMA I;  3EGV B;  1YJW I;  2QA4 I;  1ACI A;  1FOX A;  3CJQ B;  2OTJ I;  1WIB A;  3G71 I;  2K3F A;  2ZJP F;  1FOW A;  3CCL I;  2OTL I;  2E36 A;  3CCV I;  2NXN B;  5DM6 F;  3CCR I;  1VQ4 I;  5GAH J;  5GAD J;  3I56 I;  2FOW A;  3J7Y J;  1VQ9 I;  1HC8 A;  3CJT B;  1YI2 I;  3CCE I;  4IOC F;  1YJN I;  1VQ6 I;  1VQN I;  3CC7 I;  4IOA F;  3G6E I;  3CD6 I;  2E35 A;  3CCS I;  3CC4 I;  1VQ8 I;  4IO9 F;  4V19 K;  5JVG F;  3CJS B;  1VQL I;  1VQK I;  3CCM I;  2QEX I;  4UY8 I;  1MMS A;  3CCU I;  3PIP F;  5GAE J;  1YJ9 I;  1YIT I; 
#chains in the Genus database with same CATH topology
 2MYS A;  3TOB A;  2HDD A;  1SAX A;  3G1L A;  1MW7 A;  4BUP A;  1WH7 A;  1J75 A;  3BTC A;  1X3U A;  3GFI A;  2PMH A;  5HDK A;  4CDG A;  2D2W A;  3RKW A;  2ACJ A;  5F04 A;  3RSN A;  4NQW A;  3R61 A;  3HG9 A;  2H8R A;  2UZK A;  3QPL A;  2V6C A;  2HGC A;  2JSP A;  1VQ5 I;  3BR2 A;  2DPD A;  3F0C A;  2M8E A;  1AKH A;  2YU9 J;  3OL4 A;  3S32 A;  2NRA C;  5J40 A;  4BQA A;  4YIF A;  5HVQ C;  3JRE A;  3HOY J;  4G7O F;  1YTY A;  1XMX A;  1APL C;  3CDI A;  1V5F A;  3B73 A;  4OMZ A;  2XPV A;  1ZG3 A;  4UNO A;  3OYB A;  4E4H A;  3SZT A;  1I27 A;  4E7J A;  1BR1 A;  3PNT A;  3ZN1 A;  1ZN2 A;  3WE3 A;  4XLP F;  2K9L A;  3J81 K;  2Y0S N;  2OU2 A;  2Y48 A;  4IQ4 A;  4Z6Y A;  4LMY A;  3R4K A;  1X1D A;  1LFB A;  1JE8 A;  1S29 A;  3CUQ A;  3HHH A;  2OTJ I;  2JA2 A;  3H9J A;  2HDW A;  4HZF A;  1YFH A;  2O7O A;  5HLT A;  2QSF X;  1I50 J;  1WSU A;  4GFB A;  2QSG X;  1V5E A;  1HDD C;  4F52 A;  2K9M A;  4HNU A;  1G3W A;  2KQR A;  4ZTJ A;  1SFX A;  1NK2 P;  5FGM A;  1DPR A;  5FD6 A;  3GFM A;  1DGR M;  5CVR A;  5HOD A;  3FBN B;  2DW4 A;  2VC1 A;  3CTA A;  1O7L A;  3DCF A;  2E60 A;  1YW8 A;  2PJR B;  2QQ9 A;  2BZT A;  3B6A A;  1TQI A;  2QF7 A;  4XOP A;  4OIR F;  5FRN A;  1R4N B;  4RGR A;  4C2U A;  5DD8 A;  3E6B A;  3ZOB A;  2IGK A;  3CC4 I;  4HDU A;  3BPV A;  3HJE A;  4C9Y A;  4L0Z B;  3S16 J;  1FZP B;  3WE2 A;  3OIQ A;  5DEQ A;  1FX7 A;  3GUD A;  3S8P A;  4IHV A;  3JAM K;  1I5Z A;  4GGG A;  4E6K G;  4WF2 A;  2XDV A;  3QP5 A;  4F3Q A;  1TBX A;  2P5L C;  2Q2E A;  3OYD A;  1N77 A;  3K4M A;  2DDB A;  4A0Z A;  5FLV A;  1Z7U A;  3ZR8 X;  4ZYE A;  3IHU A;  4OIN F;  4XKW A;  2V1N A;  1UG0 A;  2VL8 A;  1IRX A;  3BWG A;  2R7X A;  3TP0 A;  3FXL A;  3CCJ I;  4CGZ A;  2IS6 A;  3CUQ C;  2H8W A;  1RIO H;  2WY7 Q;  4N9H A;  4EM0 B;  3M3Y J;  4DNC A;  3FK7 A;  1RET A;  2R0Q C;  1PP8 F;  2HPI A;  1XTA A;  1W0U A;  3VYU B;  1U5T B;  3BR3 A;  3VEP A;  1BW6 A;  3H3V K;  5L3F A;  4ENK A;  2ZME A;  2KZV A;  1AHD P;  1X4P A;  3F21 A;  5HDG A;  3PO2 J;  3JRH A;  1RUN A;  4IRI A;  1HF0 A;  4MHG A;  3BR6 A;  5FFZ A;  2J5O A;  2ZO4 A;  2JQ7 A;  2DOE A;  2XPU A;  4BHC A;  1I3A A;  2BBY A;  2EA4 A;  5D4R A;  1ETY A;  2HWV A;  4ESB A;  1T39 A;  2L4A A;  2B7E A;  2EIL H;  4KN7 X;  2E5N A;  2XAG A;  4ZC3 A;  2TRT A;  2XGC A;  1QRY A;  3V8K A;  2F4M B;  3QPT A;  1ZRF A;  2HFH A;  1YW7 A;  1HW5 A;  2ID6 A;  3HRS A;  2CSO A;  2VC0 A;  3QWL A;  4KIS A;  2ZJR F;  5F64 A;  2XGE A;  4IRH A;  5BQT A;  3GW2 A;  3K2A A;  1FIA A;  5IP6 A;  2NS0 A;  3JRI A;  2HVS A;  4BXF A;  1XGM A;  2M45 A;  1Y6I A;  4I99 C;  2IT0 A;  1S5L C;  1ZRD A;  3PQK A;  2YU3 A;  4UV9 A;  1FYK A;  1K83 J;  2H1L A;  4ZZL A;  2XIG A;  3IUO A;  4HX4 A;  2FSW A;  2IBD A;  3EUA A;  3HRM A;  4E7K A;  2CV1 A;  4Q5S F;  3H92 A;  4FCY A;  1MBK A;  3LSI A;  5DM6 F;  2JT1 A;  3NAR A;  1SFU A;  4DYQ A;  1ZG1 A;  1BOA A;  2FOW A;  1P2F A;  2MAB A;  4UUV A;  3ECO A;  3HPG A;  3EUK L;  2E5Z A;  4YII A;  2WB1 N;  2VN2 A;  4X1E A;  1O3T A;  1IXC A;  4LIU A;  3DBL B;  1WI9 A;  1MDM B;  2LNB A;  2RV8 A;  1K7A A;  4G9Y A;  1KYZ A;  2Z16 A;  4IO9 F;  1Z21 A;  2XV4 S;  4LJZ F;  2X4H A;  2Y31 A;  4M3G A;  1JTY A;  1SAN A;  2CQX A;  2GXA A;  2NVQ J;  1BR2 A;  2VAS A;  4DIQ A;  3RKQ A;  2V79 A;  3IP4 B;  5J3L A;  3WTV C;  1WCM J;  1HSJ A;  1FMW A;  1B6A A;  2DYR H;  4LLG F;  3RI4 A;  1QQI A;  3NWS A;  2MG4 A;  3BJ6 A;  4QPQ A;  4U0Y A;  3DFG A;  1IN5 A;  5E1X A;  3CZ6 A;  2IGN A;  4UB6 C;  1ON1 A;  2L0K A;  4C2T A;  3TW6 A;  1GHC A;  3GWZ A;  1CGP A;  1SEU A;  3E5X A;  4ZDL A;  2OA4 A;  3LL7 A;  4L5J A;  1AWC A;  1NH3 A;  2V1D A;  1X1A A;  1PDN C;  2DQL A;  5DYM A;  5JI6 A;  4XMY A;  2UXX A;  3TDZ C;  5D5W B;  4RAZ A;  5FRO A;  2W4S A;  3LSM A;  5EEH A;  3OYL A;  3W3C A;  1VND A;  2M87 A;  4BEH B;  3WTU C;  2WY8 Q;  1MNE A;  2JMW A;  1FNN A;  1FBU A;  4UHT A;  1TWC J;  3OSF A;  2QKM B;  2L9N A;  4AUX A;  2PFB A;  1WPK A;  1TW3 A;  1ITY A;  4DQ2 A;  3K1P A;  3IRQ A;  4UVC A;  1QZE A;  4D7M A;  3ABL H;  1OIS A;  1RRJ A;  2MLG A;  1IRZ A;  5EJC A;  3MCZ A;  4HQM A;  2L01 A;  2LF7 A;  2PI0 A;  3SQN A;  1LNW A;  5EG0 A;  3DTI A;  4RDU A;  3FWE A;  2R7Q A;  3EGV B;  2FU4 A;  2FA5 A;  2LKX A;  3HB9 A;  3F6V A;  4HV5 A;  1XGN A;  1QPI A;  3ABT A;  3RPU D;  3MZ8 A;  3M7G A;  4FHT A;  1RKT A;  2VBX A;  3ZQQ A;  1Y0N A;  2CQ7 A;  2V9K A;  3S93 A;  4CCJ A;  4JX4 A;  1G3S A;  5E1W A;  1WHU A;  1B72 A;  3TMO A;  4LIV A;  3CCV I;  2EFO A;  3H5R A;  3EYI A;  3W2V A;  1YG2 A;  1FIP A;  2G0E A;  2K7L A;  2OQR A;  4CSW A;  1HXD A;  4UUT A;  4JP0 A;  1X1B A;  3HIF A;  1IDZ A;  1P7I A;  3RQ4 A;  2L7M P;  1KU3 A;  4EVI A;  4WXH A;  1ZR4 A;  4XQF A;  5M5W J;  2JJ7 A;  3OWT A;  4JYK A;  2MSY A;  5H6R A;  2LSO A;  1FTZ A;  2QQA A;  1W36 D;  3CJT B;  3ZN0 A;  1KA8 A;  1VQ6 I;  3F8B A;  2ZSI B;  4YFN F;  2WAF A;  3L2W A;  3E6M A;  4UB8 C;  3V8J A;  5EF6 A;  3P9K A;  2WAQ N;  3NQO A;  2Y30 A;  3ZQL A;  2B63 J;  5C3E J;  3QOP A;  4IHT A;  2X0L A;  5ICF A;  1TZL A;  2CRG A;  4EM1 A;  2EIM H;  4O3M A;  1RKW A;  4NB5 A;  3GTG J;  5K5R A;  4UY8 I;  3KLN A;  4BXU A;  5FFX A;  1LDK B;  3L00 A;  1A5J A;  2WAE A;  2DA1 A;  1QPM A;  5DCF A;  5HDN A;  4NUB A;  1YQA A;  3FZV A;  5J4V A;  2IAI A;  2VJ5 A;  2VPL A;  1RPW A;  5E8I A;  1LE8 A;  1PUF B;  4HDV A;  4XR6 A;  3V42 A;  4ESJ A;  4QSH A;  3ONQ A;  2EPF A;  1N75 A;  2DMN A;  1ZLK A;  2E2J J;  2VQG A;  3A0H C;  1Y1W J;  1XMK A;  2PN6 A;  1SD7 A;  3OOP A;  1SD4 A;  1R6R A;  5GAG J;  3FMR A;  4RGX A;  3IRR A;  4PFP A;  3S2D J;  3R0A A;  2CFX A;  2IA0 A;  1MMG A;  1ZHF A;  5EZH A;  1V5G A;  3F72 A;  4M3F A;  4ZYH A;  2OC6 A;  1LDD A;  2X6W A;  1S3J A;  1FMV A;  1UG2 A;  3N05 A;  4AWX B;  3ZMS A;  5FRM A;  2R92 J;  1FP2 A;  2AO9 A;  2DTR A;  3S17 J;  3JRA A;  1N78 A;  4HX7 A;  4H4K C;  1VQ7 I;  4UUS B;  2HQA A;  2ZXW H;  3AAF A;  3NRV A;  2WWY A;  3LSP A;  1R36 A;  1D0Z A;  3J7Z I;  2VJ4 A;  2HKX A;  1BI3 A;  3JRD A;  1RES A;  2BY2 A;  4AVZ A;  3K10 A;  4HQE A;  1OJL A;  1FLI A;  1MDM A;  5ILS A;  2NVT J;  5FB2 A;  1M1E B;  1PVE A;  2R7D A;  5EEG A;  3RKX A;  3TBI A;  3H0G J;  1QHG A;  2KP6 A;  4A3K J;  1UHW A;  2KRC A;  2EFP A;  2D45 A;  1K61 A;  2L2O A;  1HW1 A;  4IJA A;  3WU2 C;  2IA2 A;  2XRL A;  4BU2 A;  2DFE A;  4YFX F;  2GZW A;  1HW2 A;  4QIW N;  4A5M A;  1YX3 A;  2IPQ X;  1B1B A;  4F7Z A;  2XHK A;  1R1T A;  5L3C A;  2JZY A;  1YIO A;  2QKL B;  4YRV A;  3TO9 A;  2W85 A;  2KDZ A;  3ZQI A;  1VQ9 I;  3BTL A;  1X2M A;  1FY7 A;  1O57 A;  4W1U A;  3K1N A;  2FRH A;  4O5V A;  1YJN I;  2F4I A;  2A69 F;  1K79 A;  1EA3 A;  4RMN A;  1GLN A;  1OR7 A;  2KT0 A;  2LY1 A;  2O61 A;  4IRG A;  3TKY A;  2CV0 A;  2DT6 A;  3AG4 H;  2OBP A;  2FQ3 A;  4UV8 A;  1LFP A;  3CDH A;  4K2E A;  2OZ6 A;  1UZC A;  1UCR A;  4BHP A;  2F6C A;  1UHM A;  4OOI A;  3GTP J;  1DDN A;  2W57 A;  3PFY A;  3F8C A;  4XNF A;  1BA5 A;  2JPC A;  3PFI A;  2F48 A;  1NK3 P;  1V54 H;  1I3Q J;  1U6G A;  5IT9 K;  2PX9 A;  1MMS A;  1SD5 A;  1C0W A;  1LJ9 A;  2LOO A;  2YS9 A;  2VOD A;  4JOM A;  4B1R A;  3WTX C;  1FYL A;  2IW5 A;  4AIH A;  2AQE A;  1YIJ I;  4LB6 B;  1MJ9 A;  1Q1V A;  1HA8 A;  1ZH5 A;  3I0T A;  3AL0 B;  2ZFW A;  2DOA A;  4C3J J;  3FM3 A;  3HSF A;  2A61 A;  2ZJQ F;  2ZCW A;  3JCU C;  5BS6 A;  1I6H J;  1CF7 A;  4G12 A;  5M3F J;  1NHA A;  3QRF F;  1SFO J;  4WCG A;  3EPZ A;  2PMZ N;  2DK5 A;  4PK4 A;  3JTG A;  1GVJ A;  1SVO A;  2KIM A;  2R4G A;  2XPW A;  3QYB A;  1W0T A;  2K4J A;  1JJ8 C;  2RNJ A;  3TDU C;  2Z3Y A;  4DBR A;  3C7J A;  3C2G A;  1OR7 C;  2L7K A;  1SMY F;  1UFM A;  1QA6 A;  1KU2 A;  3CLQ A;  5ILV A;  1WH5 A;  2IGM A;  3CF5 F;  1JUM A;  2EWN A;  1LEB A;  3S15 J;  5ED4 A;  4I98 B;  3ULQ B;  5CQG A;  5F6F A;  2KIS A;  4CZC A;  1DPU A;  1WIB A;  3BR1 A;  3GEZ A;  4XN3 A;  5DV5 A;  5DDG A;  5LGU A;  2XVC A;  1MD0 A;  4A2U A;  2VXD A;  4HX8 A;  4YG2 F;  3M9A A;  3VPR A;  3P5J A;  3WTY C;  3OS1 A;  2XGD A;  5EGO B;  2YSR A;  2OJE D;  4PCQ A;  3RCO A;  2JVH A;  1GT0 C;  1B8I B;  3BZC A;  1A31 A;  4J19 A;  5DTD A;  1Z77 A;  2VT3 A;  5J1Y A;  2VKV A;  3CDL A;  3CF2 A;  5FKO A;  5J47 A;  3H5A A;  2AHQ A;  3MAJ A;  2EFW A;  1OYI A;  1YOV B;  3I59 A;  2A68 F;  2IGO A;  4MIM A;  2V1X A;  1EH7 A;  3V7C A;  1WJC A;  2DMQ A;  2P0W A;  1MH3 A;  4E70 A;  3L1P A;  4I09 A;  5FLM J;  1BW5 A;  1YO5 C;  2EQR A;  2MW8 A;  3MN2 A;  4M6X A;  4RAG A;  2O8X A;  2FX0 A;  4OIO F;  4J00 A;  1XB4 A;  4M3E A;  3K0L A;  4OWR B;  2COM A;  2EZH A;  1MSE C;  4BBR J;  5CJ9 A;  1FWZ A;  2ELJ A;  3TOA A;  4IX7 A;  3V8L A;  3DEW A;  3Q5F A;  2R7W A;  1X4O A;  2OCE A;  3HEF A;  3QU3 A;  5LHG A;  5HOO A;  2CU7 A;  1YJ9 I;  2YPR A;  3GTQ J;  2OV7 A;  2R7S A;  4D7N A;  5B3S H;  1E3H A;  1OCP A;  1MMA A;  1V55 H;  3TO6 A;  3KP5 A;  1HDP A;  2NVU B;  5HS8 A;  4UUS A;  1MGT A;  1YRN B;  1ENH A;  5L3D A;  5TJJ A;  4ZH4 F;  3MKZ A;  2STW A;  4I2O A;  1I39 A;  3GTO J;  3DU5 A;  1WWX A;  3EDP A;  5JHF A;  1QVT A;  5JVT A;  4HF0 A;  4AU7 A;  5CVI A;  3A02 A;  3Q9V A;  1TTY A;  3A0B C;  3E6D A;  1W7P D;  4IHW A;  4ENM A;  3GLX A;  1YW9 A;  2BY1 A;  4KFC A;  4FE4 A;  4HNV A;  3M4O J;  3L2V A;  3S3O A;  1VQO I;  3ZXS A;  3HUG A;  1P9Q C;  2ELH A;  3PUF A;  3U9G A;  3MWM A;  5KAF C;  3HGG A;  3WTT C;  5CPR B;  1RNL A;  2X1C A;  4KIF A;  4Y3O A;  3SHF A;  2DFH A;  5C4J J;  1B9M A;  2P5V A;  4XKC A;  3PSI A;  3TED A;  2E2H J;  2BXY A;  2KIQ A;  2F5C A;  1XCV A;  4P9F A;  3K1M A;  2W7N A;  3D5S C;  3HOW J;  4ENJ A;  3FXO A;  3LOC A;  4LG0 A;  3ASN H;  3GZ5 A;  2F5F A;  5FJ8 J;  4M73 A;  1BC8 C;  2W84 A;  2QWW A;  1Y8Q B;  2LY2 A;  4KIG A;  3S1R J;  3S2H J;  3FXQ A;  1AOY A;  3W2A A;  1PYV A;  4HLY A;  3VWB A;  4XBF A;  1KYW A;  2HQ5 A;  1MJA A;  4JX6 A;  1FBS A;  5GTI C;  4EGZ A;  4HF2 A;  4JX5 A;  1J09 A;  2DA4 A;  4A0X A;  1MBH A;  3DF8 A;  1W4M A;  3H9Q A;  3ZMZ A;  2XB5 A;  3GX4 X;  5EZG A;  4NDL A;  2BEO A;  1E0E A;  5EEA A;  4FAS D;  3I56 I;  2L7Z A;  5K5O A;  2EFQ A;  5FLX Z;  4XKB A;  1W1W E;  2KL4 A;  2X6Y A;  3SFZ A;  1ZAO A;  5IYD J;  1A6Q A;  1S7E A;  2M9H A;  2W25 A;  3FMQ A;  1OYW A;  1YI2 I;  1XGS A;  3DWL E;  3FKJ A;  3LSK A;  3CCE I;  3CC7 I;  1STZ A;  1HCR A;  2RNG A;  5LEK A;  3HOT A;  2CS3 A;  4IF4 A;  4A3D J;  3RPQ A;  5ICG A;  3GFL A;  1UJ8 A;  4BQN A;  2JRM A;  1REP C;  1KZH A;  1Z91 A;  3HOZ J;  3IH2 A;  3M07 A;  2KFD A;  4MFE A;  1VQK I;  2YR2 A;  3SDG A;  1V3F A;  3CO6 C;  4HBL A;  3WHB A;  3BTJ A;  3IWZ A;  3GLL A;  4RAF A;  2V6E A;  1OCT C;  3WTS C;  2KPM A;  3FDY A;  4HST A;  2NS8 A;  4JQF A;  2LMD A;  4I6Z A;  1B9N A;  2DOF A;  5GPA A;  1KGS A;  1XC5 A;  2Y9Z A;  3LMM A;  1JT6 A;  4MQ9 F;  4EJV A;  1TWA J;  1QBJ A;  1K4T A;  5JFR A;  4X0G A;  3O2P E;  3LST A;  2FBK A;  2YX7 A;  1JJ6 C;  2FD5 A;  3CO7 C;  1T08 B;  1XD7 A;  3E97 A;  4UXN A;  1BJA A;  2X6O A;  4L5E A;  5D5X B;  3DKY A;  1Z05 A;  4M9S A;  3JW4 A;  2R7U A;  4XLC A;  4DYC A;  3CC2 I;  2ECB A;  5FKK A;  2P7C B;  1VQM I;  3VYT B;  4NC6 A;  1R5I D;  2JUC A;  1U8R A;  1X1C A;  1P6R A;  1UST A;  2GA1 A;  1MBF A;  1W7P B;  2ZXJ A;  4IXA A;  4EEF G;  4X6A J;  2X6X A;  3KE2 A;  4A6E A;  4M9X A;  4XLA A;  2VB6 A;  4RBO A;  1MSF C;  1BJZ A;  1Y0U A;  2FMY A;  2E1O A;  2L5Q A;  4N4N B;  3FMS A;  2QUF A;  2R5Y B;  5LGT A;  4WX9 A;  1D1A A;  2VIX A;  2ZXH A;  4NNJ A;  5IPA A;  5FD5 A;  3SEZ A;  3IAS 2;  3FHZ A;  3LNQ A;  3D0S A;  1JKP C;  4BS9 A;  3AL0 C;  1SD6 A;  4YEJ A;  4DYR A;  1K78 B;  2K3F A;  2M8G X;  2VQL A;  3BOQ A;  3K70 D;  3LWF A;  2ZJP F;  1ZQ3 P;  1MJB A;  3U2R A;  3ZQC A;  1QVU A;  2LD5 A;  3LQR A;  2HTS A;  2E1M B;  3MKL A;  4QPO A;  1A04 A;  2D1H A;  4G6D A;  4KA4 A;  2XC7 A;  3Q3S A;  2I8D A;  3PNV A;  2KIF A;  1NG6 A;  1X19 A;  2YUS A;  1LDJ A;  3F8M A;  1RR7 A;  3IH4 A;  4G7H F;  1TNS A;  1ETO A;  1X58 A;  2O0Y A;  2VQC A;  5F0F A;  2QBY B;  3TW7 A;  4ZDP A;  3J80 Z;  2J5P A;  4XIC A;  3LA2 A;  2X48 A;  2ZBK A;  4EMS A;  5BPI A;  2DYS H;  4UVB A;  4IOA F;  1WZ2 A;  4XK4 A;  2CH0 A;  1QO0 D;  1NTC A;  1SAU A;  3S14 J;  3V4G A;  2LG4 A;  1ETW A;  2UWM A;  3RZO J;  1J9I A;  4LLL A;  1ONV A;  3PSF A;  1JKO C;  1JXS A;  2EIJ H;  5DCM B;  3LSJ A;  5HNH A;  2HOT A;  3L2C A;  3PJR A;  2K5C A;  1MND A;  2JTV A;  3W6J B;  3BY6 A;  2RC4 A;  3GZN B;  1MIJ A;  3CCM I;  2MGQ A;  3HRU A;  1Z6T A;  3AKZ A;  2RKH A;  3HYI A;  4R1H A;  5F27 A;  2ZC2 A;  3IKV A;  3Q9S A;  5K5Q A;  3ML6 A;  3C18 A;  3J7Y J;  3ERM A;  1R1U A;  3LSH A;  4GDF A;  4L9J A;  4S05 A;  1XPX A;  3KLO A;  2LFB A;  5E8G A;  2H6B A;  3MMY B;  1TLH B;  1JT0 A;  2CJJ A;  4GRI A;  2NS7 A;  1FP1 D;  1G8X A;  1YYV A;  4F91 B;  4BBS J;  2MBF A;  1FBQ A;  3HKZ A;  5CVJ A;  4XLF A;  4A6D A;  4C2M J;  2K3P A;  2VOO A;  5E1Z B;  2DFI A;  3Q0V A;  4XLN F;  1ZLJ A;  1T56 A;  3DU6 A;  2BHY A;  2AXL A;  3VOD A;  4IHY A;  5IYB J;  5B1B H;  1TP4 A;  3K9T A;  2ECC A;  1H89 C;  2E7W A;  2XGX A;  4OIQ F;  1Z0X A;  2F5E A;  5B66 C;  2HI3 A;  4BKX A;  3QPH A;  3IAM 2;  2ZSH B;  2HXI A;  3LAP A;  2O8K A;  1KU9 A;  1OFC X;  3I64 A;  2DCE A;  4G8X A;  4LOC A;  3CME I;  4C30 A;  2M4G A;  4IZZ A;  4A3F J;  1WJF A;  5FO5 A;  3DLL F;  1OPC A;  4C3H J;  3CCQ I;  1R9T J;  2R93 J;  5E3N A;  2W00 A;  2FBH A;  1O3Q A;  3IKT A;  1SFK A;  3W2W A;  4BL0 B;  4RB1 A;  2DI3 A;  4EAT A;  3BDD A;  4PUS A;  2HR3 A;  3GVA A;  3G2B A;  1YLF A;  5B5E C;  1ORK A;  2CW7 A;  3T5X A;  1P4A A;  4Q48 A;  3JRF A;  3OYA A;  4LG3 A;  2LBF B;  3ISP A;  3NEU A;  4U0W A;  2DDA A;  2OTL I;  2ESH A;  1ZKG A;  4Y15 A;  3IL2 A;  4NHJ A;  3CP8 A;  5TRD A;  4ZYG A;  1LFU P;  3QQA A;  2OQG A;  4HRI A;  2PEX A;  1U78 A;  1D8J A;  4FET A;  4G7Z F;  4U0V A;  5IT3 A;  4S04 A;  1D0X A;  3H1C A;  5GTH C;  3I5U A;  1G6N A;  1R7J A;  1XG1 A;  2PJR A;  3F22 A;  4M9Z A;  1ETQ A;  4XRM A;  1N25 A;  3WU0 A;  1ZYR F;  1VQN I;  2L4M A;  1FEX A;  3KYD B;  3MKW B;  3FKI J;  2E35 A;  3U1D A;  2IS1 A;  5LRR A;  1H9G A;  3ESW B;  3QOD A;  3MFK A;  3OR2 C;  3SFI A;  1F1Z A;  1LEA A;  2IJL A;  5IP7 J;  5JVG F;  3SJM A;  3HHG A;  1PUE E;  4KIB A;  4LD5 A;  1EV7 A;  1VQL I;  5JR3 A;  3OOU A;  5D5V B;  4RA2 A;  5DD4 A;  4ASN A;  3K4K A;  2HYJ A;  2QYO A;  2QEN A;  1BI2 A;  4CCK A;  3RDI A;  2Q0O A;  2HEO A;  2VPR A;  1TW2 A;  2ISY A;  5TIS C;  3LQQ A;  4CCL A;  2V26 A;  3NAU A;  4A3L J;  1IN6 A;  2MC4 A;  3S3M A;  3I71 A;  3T8T A;  2NAZ A;  4AYB A;  1WRJ A;  2M7A A;  2X1D A;  2R5Y A;  1IUY A;  3WTW C;  3OYI A;  4WXD A;  3A4C A;  2OF7 A;  1U5T A;  2X85 A;  3DBR B;  3DQV C;  1T98 A;  2VKD A;  1MKM A;  3KET A;  3L2U A;  2WAD A;  2STT A;  2ESN A;  2FNP A;  2GAU A;  2EH3 A;  2RAE A;  1SMT A;  5LHI A;  2P4W A;  1WI3 A;  1S7A A;  3M8F A;  3HOS A;  2IA1 A;  2QQB A;  1ULY A;  2HZD A;  5A2Q Z;  3W6V A;  4ZYA A;  2ADU A;  3J7A O;  1YE9 A;  2JSC A;  4A69 C;  1BL0 A;  3G4S I;  4XOT A;  2G9W A;  2M2E A;  2ZXI A;  3K7A J;  4B3A A;  4HA8 A;  4CYC B;  1JHH A;  2KKO A;  1TWG J;  3ABM H;  3E1S A;  5L3G A;  2E7X A;  3B6C A;  3CMY A;  3K4J A;  4A3G J;  2EV6 A;  2XAF A;  1BOB A;  5GPC A;  4FE7 A;  3BR5 A;  2EIK H;  3BRO A;  2VE9 A;  3F9K A;  1G4D A;  4MNU A;  2R5Z B;  4BJ6 C;  1ETX A;  5JLW A;  4XLH A;  2DOD A;  3IWF A;  4ZDO A;  1ON2 A;  3DPL C;  3A03 A;  3JRB A;  4ENN A;  9ANT A;  3DBH B;  3OSG A;  2Q8K A;  3KZI C;  4CO8 A;  2EZK A;  1GDT A;  2D1V A;  1GV5 A;  3BTI A;  4LK1 F;  4XKV A;  2DLL A;  2LR8 A;  2IXS A;  1U5T C;  3U21 A;  5LEJ A;  2JA7 J;  2EV0 A;  2KIU A;  4P5O A;  1QZY A;  1IZ1 A;  2I5U A;  4BJT A;  4GXO A;  2HU9 A;  2V7F A;  4ZTF A;  5H20 A;  2V4J C;  4XLE A;  4ABZ A;  4EGY A;  4I76 A;  4V19 K;  3I4M J;  5E3O A;  3TO7 A;  2E1M C;  2CQQ A;  3UR3 C;  2VOP A;  1YS7 A;  4ZZD A;  3GF2 A;  4P96 A;  4LIT A;  2XF5 A;  4PJ0 C;  2XAJ A;  2JA5 J;  2QEX I;  3T8R A;  1MH4 A;  4HLX A;  2P81 A;  4B44 A;  3RZD J;  3WGH A;  1LPQ A;  5KK1 A;  4RM3 A;  2M1B A;  2CFO A;  1VTN C;  4LB5 A;  1H8A C;  3GXO A;  2K85 A;  3WTZ A;  2XKO A;  1XSD A;  1DU0 A;  5BMZ A;  1HKQ A;  2OPT A;  3D1N I;  1F4K A;  3S1Q J;  1WVR A;  4PFO A;  3QPS A;  5E20 A;  2FBI A;  2TDX A;  5JLX A;  3WOD F;  4WXC A;  2CW0 F;  2EZL A;  4A0Y A;  2ZB9 A;  3KZY A;  1Z9C A;  2CUE A;  2IRF G;  4BEH A;  1TQP A;  2FQ4 A;  1F9N A;  1YX5 A;  2PMU A;  2FML A;  3DLA A;  4NQW B;  1JKR C;  2AS5 F;  2YX4 A;  4FX0 A;  4KYW A;  1FYM A;  3ZMT A;  3C3W A;  3G73 A;  2X9D A;  2N8G A;  2LBF A;  3FXU A;  3P9C A;  3K4C A;  2G7U A;  4AM3 A;  5E18 F;  2HS5 A;  4BY7 J;  2FJ1 A;  1IN7 A;  2LKP A;  1AKH B;  4M3D A;  2UV1 A;  1D3Y A;  4DW6 A;  1ZRE A;  2GXB A;  1TL8 A;  2DJI A;  4M3B A;  3GTJ J;  4E7H A;  5KAI C;  4ETS A;  2MLK A;  3KFW X;  2GXG A;  2PBI A;  1IGN A;  5BNG A;  1J7K A;  1OQY A;  4BAY A;  1O3S A;  3HOV J;  2L9V A;  4A3M J;  1FJL A;  3T0Y A;  4M6V A;  1JHF A;  3KPH A;  4B4C A;  3A2K A;  1EJ9 A;  5CVV A;  1XS9 A;  3ZP5 A;  4A93 J;  4F92 B;  3CUQ B;  3JRC A;  5FKM A;  2R7R A;  4BGD A;  3BLY A;  4BE0 A;  3GTM J;  3X2Q H;  4L9V A;  4RB3 C;  5EDN A;  2CO5 A;  2CUZ A;  1RUO A;  2DT7 B;  3I54 A;  4YIR X;  1IDY A;  3C2B A;  1O3R A;  5GAD J;  2E2I J;  2ZNZ A;  3GTL J;  2HVR A;  1LUJ B;  2DXI A;  1MBG A;  2QGU A;  2HPM A;  2EA2 A;  3KP2 A;  4OIP F;  1T38 A;  2Y0M A;  2IEK A;  2MA3 A;  3O6B B;  2JK3 A;  3CD6 I;  2DK8 A;  3MQ0 A;  2HDC A;  1KQ8 A;  2DJN A;  2CQK A;  1JUS A;  2M3A A;  2LF8 A;  4AD9 A;  4PGG A;  1Q1H A;  1WKM A;  1B4A A;  1U0J A;  4MFD A;  4HYE A;  2C6Y A;  3FIW A;  1RR8 C;  1IN8 A;  5F08 A;  1B59 A;  3H9G A;  2COB A;  3OIP A;  2R7V A;  1IO2 A;  2FNA A;  4BAC A;  3FX3 A;  3HTU A;  1MBE A;  4XRS G;  3FXJ A;  2BOL A;  1OYY A;  2DPU A;  2HXO A;  2Q2E B;  3MZY A;  5K7H A;  3J81 Z;  1QGP A;  2B9S A;  5F1R A;  4D9J A;  1PUF A;  1YIT I;  1ZAR A;  3BP8 A;  1G3Y A;  1LB2 A;  2E71 A;  4U88 A;  1P4W A;  2FEZ A;  4KT6 A;  4PDK A;  2Q1Z B;  5ICE A;  5ERI A;  3HSR A;  2JA6 J;  3I9V 2;  4XRF A;  4DZP A;  2VUM J;  1Z1D A;  4RM2 A;  1G3T A;  5H2F C;  4HG2 A;  4MEX F;  4BXX J;  3L9F A;  3HSE A;  1P92 A;  3W6K B;  3L09 A;  1FOK A;  2QCO A;  4Y17 A;  2GWR A;  2F5V A;  4GYG A;  3ABK H;  1HOM A;  2LKS A;  2ZME B;  3C1D A;  3M1E A;  4G94 A;  4EV0 A;  2HKO A;  3BPX A;  3OS2 A;  1JTX A;  1IXR C;  2NVX J;  3A1Y A;  1RI7 A;  2ZJ2 A;  5E3M A;  2A5Y B;  2OUM A;  4RB0 A;  4F55 A;  2Y9Y A;  4CCN A;  3BR0 A;  4KUM A;  3DTE A;  5CKT A;  3A01 B;  1J2X A;  1S6L A;  2GLO A;  1X3Z B;  2M0C A;  3OIO A;  1BIA A;  4B48 A;  5EYR A;  4P55 A;  1R5G A;  1U9N A;  5DUI A;  1X2N A;  3E0J B;  2KLO A;  5HLI A;  1HKS A;  2GIV A;  1JGG A;  3RPU A;  1WJB A;  3JAM Z;  1OMI A;  1WJE A;  4RGU A;  5ICC A;  4FT8 A;  4KDP A;  5K7Z A;  3TQN A;  4HSR A;  1IAW A;  1W5C C;  1FC3 A;  3PUB A;  4Y4R A;  5J8F A;  1T2K A;  2D5V A;  3RYP A;  3CES A;  3ECH A;  1E2X A;  2BXZ A;  4G6T B;  1ZR2 A;  3KYC B;  4L9T A;  3QYF A;  2MD5 A;  2JVG A;  5D4S A;  4DBQ A;  5C4X J;  5LD2 C;  3WGI A;  2V9P A;  5E3L A;  2FF4 A;  4A5N A;  4XOR A;  3OYK A;  1T0F A;  2Z2S B;  2A6H F;  2L02 A;  3K69 A;  4PJL A;  4RLQ A;  1GV2 A;  2XAH A;  2VKE A;  4L0Y B;  3ABU A;  3BCA A;  1JUP A;  3H36 A;  2XB0 X;  3DTK A;  2XAQ A;  4MTD A;  2WV1 A;  1BC7 C;  2VBW A;  4B3X A;  4QTR A;  1FSH A;  4Q47 A;  2NOJ B;  1K6O A;  4PJM A;  3DV8 A;  4BDZ A;  1ERD A;  4M72 A;  1DP7 P;  3LAJ A;  5LGN A;  1GUU A;  2Z99 A;  2L3D A;  2Z1D A;  4HPQ A;  5BOX A;  3BQY A;  1PJR A;  1MBJ A;  1JKQ C;  1T6S A;  3TP3 A;  3LSR A;  2VJJ A;  2P6T A;  1TNT A;  1HLV A;  1VZ0 A;  3CCU I;  2JA8 J;  5KVR A;  1IRF A;  3OY9 A;  4KIC A;  4XON A;  3RYR A;  2H94 A;  2M34 A;  5GAE J;  2FUG 2;  1Z7L A;  3E5Q A;  2P6S A;  4HV6 A;  2DN0 A;  4ITV A;  1VQP I;  4RLF A;  2QLZ A;  4Y33 A;  1OCZ H;  2HOS A;  4XSX F;  4I0B A;  2AXT C;  1E17 A;  2HOE A;  2DAO A;  4XL9 A;  2EBI A;  2EV5 A;  4L5I A;  3RTR A;  1A36 A;  3GME A;  3DKX A;  2HTJ A;  1IF1 A;  1T95 A;  1K6Y A;  2LDU A;  1A35 A;  4CH7 A;  3SXY A;  1TWF J;  4ZJZ A;  3VFZ A;  4BY1 J;  1R00 A;  2VT2 A;  3DEU A;  4AVP A;  1EH6 A;  4BE1 A;  5DM7 F;  1IN4 A;  5LRS A;  3B02 A;  3V7R A;  3F6O A;  3OYN A;  4PZJ A;  4BYY A;  2F2E A;  2NOG A;  5HS7 A;  4L9N A;  4E7L A;  5FKN A;  2RQQ A;  2HVQ A;  1F36 A;  1T0F C;  1W36 C;  2R7O A;  2LVS A;  2RN7 A;  2A3S A;  2E19 A;  2K9N A;  2KHM A;  3G1M A;  2KRH A;  1MMD A;  2EIN H;  1HKT A;  2E34 A;  4V2F A;  2W1O A;  2WBM A;  3JR9 A;  3AG2 H;  3CCY A;  1YHQ I;  3BG6 A;  4I02 A;  3VSK A;  3F23 A;  1I6X A;  3LFK A;  4A3C J;  3CJR B;  3RKY A;  2A07 F;  2XF7 A;  1YJW I;  5EG0 B;  5CLS A;  3H0D A;  4E7I A;  2Z5U A;  2NVY J;  4BH9 A;  1SC7 A;  4YEL A;  3G71 I;  2VJI A;  2Y75 A;  2MH2 A;  2OD5 A;  3ZQH A;  2CUF A;  1R4M B;  3HOX J;  3QAH A;  5EGO A;  1G2H A;  1UEL B;  1F5T A;  2H1K A;  3JTH A;  1B8I A;  1EKE A;  1WFX A;  1B72 B;  1D5Y A;  2MFZ A;  1V4R A;  3H5N A;  5HLH A;  1OCO H;  2L7F P;  1Z3X A;  2K9Q A;  2F5D A;  2XAU A;  3S2W A;  4WK8 F;  2XKP A;  2GOM A;  4PJN A;  2CG4 A;  2UUZ A;  2LRD A;  3ZPL A;  1IRG A;  2RRE A;  4II3 A;  3KEO A;  2H6C A;  1HC8 A;  3F8N A;  4L18 B;  4XM3 A;  2LRE A;  2ZKZ A;  3G1O A;  3HKZ N;  4EJO A;  4CZZ A;  1J0R A;  5B1A H;  4DJA A;  3BQZ A;  4IOC F;  2VBY A;  2LTP A;  2E1C A;  4CIC A;  2GBY A;  2DA7 A;  2L54 A;  2Y0S A;  1VQ8 I;  3BZ6 A;  4IEJ A;  4P9U A;  1IJW C;  3KP4 A;  1IG7 A;  4M71 A;  3CQZ J;  3TGN A;  2GQQ A;  2CGP A;  2DO7 A;  3ZQF A;  4E7S A;  2IP2 A;  3VB2 A;  1S7O A;  2L9S A;  3L2Q A;  3LA7 A;  4MEY F;  2M5W A;  3PL8 A;  1TWH J;  3CUO A;  4QWQ A;  3JRG A;  1U3E M;  2VXZ A;  2MD0 A;  4ON0 A;  2M30 A;  3PIP F;  5K7F A;  2GIZ A;  3ZCO A;  5M5Y J;  1PP7 U;  2QZ8 A;  5L3B A;  3BZK A;  2JN6 A;  4DOZ A;  1L0O C;  4A3J J;  3A01 A;  3H3U A;  3I55 I;  1YRN A;  4CA0 A;  2O03 A;  2KJB A;  5J8C A;  4IHS A;  2CWE A;  1KQ0 A;  1LE8 B;  5FLX K;  1AA7 A;  2BHZ A;  1WQ2 A;  1JGS A;  3PM1 A;  2HQR A;  3LFU A;  5E17 F;  1ZTR A;  4I7H A;  4U87 A;  3R6S A;  4UVA A;  4CXF A;  1IC8 A;  1U8B A;  1JI8 A;  2ZNY A;  4XSZ F;  3HRT A;  1BI1 A;  2CYY A;  5CVU A;  4BHB A;  1UB9 A;  3EQL F;  4MTE A;  2BGC A;  2K86 A;  5LFA A;  3BG7 A;  3HC7 A;  3KCC A;  2ELK A;  4LGW A;  3OV8 A;  2LH9 A;  2X51 A;  2HYF A;  2Z9O A;  2I10 A;  1DGW Y;  2HYG D;  3H3Z A;  3PIO F;  4MO7 A;  2K9S A;  4P1W A;  2DMU A;  4FIS A;  3DP7 A;  4HNT A;  3RQI A;  4AID A;  4E7Z A;  3LSG A;  4AIJ A;  1XX5 A;  2P7V B;  2CQN A;  2KMU A;  1HST A;  2ETH A;  2XF6 A;  5E79 C;  2Z33 A;  3T1B A;  1LVK A;  1Y56 A;  2IVM A;  4NBQ A;  4N9I A;  4IVN A;  1YS6 A;  2VI6 A;  1U2W A;  1IV6 A;  1IW7 F;  2GA2 A;  3J7A Y;  3K4N A;  1S8N A;  3EET A;  2G7H A;  4Y7N J;  1FOW A;  2ZME C;  3AFH A;  3OR1 C;  1ZEL A;  1J59 A;  2QVO A;  2DQR A;  2K4B A;  5KNL A;  2F4O B;  4RGS A;  4AIK A;  2EZI A;  3SEQ A;  3QU6 A;  2M4K A;  3BG3 A;  3JSO A;  3DPU A;  2PLY A;  4BNC A;  1XN7 A;  2QM3 A;  5AON A;  2A6E F;  1BIB A;  1BR4 A;  2VLA A;  2RQP A;  2R7T A;  4AYB N;  1W5S A;  3CJN A;  3K6G A;  2EB7 A;  3VYR B;  3HZJ A;  2KZG A;  3WGG A;  2OZU A;  1IV8 A;  1GXQ A;  2ISZ A;  4D0P A;  3KZZ A;  2BE5 F;  2W48 A;  2O9L A;  1O7F A;  2ID3 A;  1QHH D;  1MMN A;  4KNY A;  3I53 A;  3V7S A;  3CJS B;  1ETV A;  2LY9 A;  4IPA A;  1BM9 A;  4O6J A;  3ELK A;  3GZ6 A;  2K40 A;  1WJA A;  1XDS A;  2PG4 A;  2LYC A;  4B8X A;  3K2Z A;  4YFK F;  2NNY A;  2WTE A;  3HTS B;  4OU0 A;  3E6C C;  2K02 A;  3BJO A;  2HNH A;  2R3S A;  3HGY A;  4CHU A;  1GXP A;  1QNT A;  2OCC H;  1TT5 B;  4XN0 A;  2GM4 A;  4A3E J;  2UXN A;  4IL6 C;  5LLQ A;  3OL3 A;  5HNF A;  1AU7 A;  3MEX A;  2BV6 A;  3UKG A;  2PQ8 A;  2ME6 A;  3L2R A;  3HM5 A;  1EF4 A;  1X1P A;  3J80 K;  3KEY A;  1XSV A;  3REO A;  5F0H A;  2XSJ C;  2WB1 A;  4ZYD A;  4KT5 C;  4C3I J;  5IY5 H;  4RB2 C;  4FQG A;  2NNN A;  4KMF A;  4I01 A;  1DP3 A;  3FBI B;  1W7P A;  3R0J A;  3SZG A;  4PSX A;  2WA0 A;  2BY0 A;  2OAZ A;  1CF7 B;  2CMP A;  3I4P A;  1RC9 A;  2XSD C;  2L9R A;  4H0E A;  1I1G A;  2O6G E;  1QU3 A;  1H9T A;  3ASO H;  1FSE A;  1P4X A;  1S72 I;  2QSH X;  3OYF A;  3KX2 A;  4EQQ A;  4HAM A;  1IXS B;  1G59 A;  5GP9 A;  1OCC H;  2CUJ A;  5JHU A;  3FXM A;  5DS9 A;  1DUX C;  1X3W B;  1XCB A;  3NWT A;  4Y52 J;  1H88 C;  1RZ4 A;  3VDX A;  5M5X J;  1K78 A;  2V9V A;  2H09 A;  3GBG A;  5L3E A;  1FOX A;  4G6Q A;  2BW3 B;  4B09 A;  4IKF A;  2VE8 A;  2O5R A;  2RVC A;  1Z3Y A;  3DPT A;  5IT9 Z;  4D5F A;  2BVL A;  5DUK A;  5K1Y A;  3ZQG A;  2NXN B;  3HXL A;  1SVM A;  3BCB A;  3H35 A;  3WG9 A;  2ICW G;  5TGT A;  2QBY A;  3BG5 A;  3F3X A;  5GAH J;  3VSL A;  1ZGW A;  2DA5 A;  3ZMD A;  3KYL A;  1D8K A;  2HOA A;  4GO1 A;  3I59 B;  3K4L A;  5J1U A;  3O8G A;  1Y8R B;  3OYJ A;  1H0M A;  2CW8 A;  1R58 A;  4TV7 A;  4AC0 A;  3G6E I;  4HF1 A;  1USS A;  2HZT A;  2M0M A;  2IS2 A;  2KRF A;  1A6I A;  2A05 A;  1MNM C;  5DCM A;  3MVP A;  4A12 A;  3S1N J;  1POG A;  1E3P A;  1R71 A;  2DMT A;  3HL2 A;  3CLO A;  2DFF A;  2ME0 A;  4ESF A;  4PJJ A;  4PGH A;  3RJP A;  1HQC A;  2GOX B;  3FM5 A;  3U1K A;  2VON A;  3SYT A;  3OYM A;  3HPH A;  3S3N A;  1F43 A;  3OYE A;  4EJU A;  5D5U B;  3GCM A;  1WJD A;  1D1B A;  4A3I J;  4IQJ A;  1XGO A;  2ZFU A;  4JBA A;  4XID A;  4N0B A;  1D5V A;  4CCM A;  4U7D A;  1J5Y A;  2JWT A;  3LA3 A;  3S1M J;  4KJZ A;  5HLG A;  3KP3 A;  2PJP A;  1D0Y A;  1IUF A;  1OKR A;  3L7W A;  3N4M A;  2X1E A;  2BVM A;  1W5T A;  2Y2Z A;  2IS4 A;  5LHH A;  3I3L A;  3IH3 A;  3TL4 X;  2WAQ A;  2DT5 A;  2LK2 A;  5IOY A;  4XRS A;  2LC2 A;  4B43 A;  1R23 A;  3G3Z A;  2JRT A;  4MLO A;  2CV2 A;  2EFN A;  3HOU J;  3CP2 A;  3P9I A;  3E3V A;  2KJC A;  5J1R A;  3O3K A;  5J4Y A;  3HUG B;  3VYS B;  3WG7 H;  4D1Q A;  2WC2 A;  3FXK A;  3I58 A;  2DA6 A;  2DU9 A;  1HBX G;  1UAA A;  4JK1 X;  1FOY A;  2LP0 A;  3BJA A;  4Q4Z F;  2DA3 A;  3D5R C;  5D6E A;  3COA C;  4S0H B;  3OYH A;  3ZRG A;  2R7F A;  5IOZ A;  1L3L A;  1DU6 A;  5F0C A;  4F93 B;  4CYD A;  4LG0 B;  1TQM A;  2Y69 H;  4BE2 A;  1TC3 C;  3WHC A;  2RGV A;  5M3M J;  2WV0 A;  3OYC A;  3ERE D;  3PO3 J;  1ZRC A;  2E36 A;  4DZJ A;  1VFC A;  2KDO A;  1XDU A;  1ZK8 A;  2DMP A;  1Z6R A;  4OAY A;  4D5C A;  4KMU X;  2VQH A;  3R60 A;  3CCR I;  4CUG A;  3DXJ F;  4FTH A;  5D8K B;  4CCO A;  4GCV A;  3KP7 A;  4EJT A;  4NC8 A;  5A2Q K;  3UNG C;  2BYV E;  3FK6 A;  3KEQ A;  3ZMU A;  4BQO A;  3O8H A;  3HBL A;  1XSX A;  3K4B A;  3DEE A;  3P7N A;  3OS0 A;  2FOK A;  1WGX A;  3Q0U A;  3EYY A;  1GVD A;  3RIR A;  4EJW A;  2H27 A;  4M6Y A;  2XRO A;  4MQV A;  4BDY A;  1QZZ A;  5KCM A;  2P8T A;  1Z67 A;  1ZGA A;  4M74 A;  3GO5 A;  4Y13 A;  1SFE A;  1MZB A;  5AIP A;  5BPD A;  1KU7 A;  1FTT A;  2E1N A;  1LKX A;  1CQT A;  1SVL A;  5IP9 J;  4DGW B;  4W97 A;  1LVA A;  2FXA A;  2MH9 A;  4GYI A;  2JPB A;  3QP6 A;  4RAY A;  3SZP A;  3M8J A;  4LLN A;  4HOB A;  2W82 A;  3PQJ A;  3WU1 B;  3IV5 A;  1O4X A;  1LQ1 A;  1VI0 A;  3KP6 A;  2EJR A;  3K70 C;  4RS8 A;  4KIT B;  1BBY A;  1D1C A;  1WJ5 A;  3MKY B;  1KQ9 A;  3IC7 A;  4B47 A;  1U9O A;  4R79 A;  2BW3 A;  2EK5 A;  3BC8 A;  4KN4 X;  3CMM A;  2MC3 A;  1TT0 A;  1T8I A;  1R49 A;  2P5K A;  3PNY A;  4U7B A;  3HDD A;  3EUH A;  1E3O C;  5IYC J;  1OCR H;  3FXR A;  4A3B J;  5D6F A;  5AIQ A;  3FIS A;  5HS9 A;  4CYC A;  2R7Z J;  1Y1V J;  4PSW A;  3ZQ7 A;  3FHN A;  1UHS A;  2XRN A;  3GFJ A;  4NC7 A;  3MZH A;  1Y39 A;  3D5L A;  6PAX A;  2V1U A;  2DBB A;  1P7J A;  4V2G A;  4LFU A;  2JUG A;  3AG1 H;  3CMA I;  4J01 A;  3BG9 A;  3M1C A;  1R5H A;  3QYE A;  4BJ5 C;  5F1J A;  2QA4 I;  4R8H A;  2A5W A;  1ACI A;  1NG7 A;  3C2H A;  3OMY A;  3CJQ B;  1ETK A;  5FKL A;  4Z2Y A;  1OLT A;  4MGR A;  3E5U A;  5D8L B;  4EM2 A;  2XUB A;  5C44 J;  4QLC U;  5LBQ A;  4IHX A;  2R5Z A;  3Q0W A;  3CCL I;  1ZG5 A;  2BY3 A;  4ANJ A;  4N4O B;  5ILU A;  1K4S A;  1XMA A;  1S9H A;  1BN5 A;  5KHD A;  1VQ4 I;  2DTZ A;  5CYV A;  3GYH X;  2TCT A;  4HEA 2;  2HQN A;  2K27 A;  3N97 A;  2PMZ A;  1EH8 A;  1UMQ A;  2M7B A;  3AG3 H;  2RDP A;  4II2 A;  3OYG A;  4LK0 F;  3FF5 A;  3JSP A;  3ROU A;  3QOE A;  2QQ8 A;  2VBZ A;  2AQF A;  3ZMV A;  2XAS A;  4FX4 A;  3M8E A;  3CCS I;  1R22 A;  3VOE A;  1R1V A;  2NYX A;  5J6X A;  3GTK J;  4I0A A;  2FE3 A;  4WWC A;  1ODD A;  3I4N J;  1DQU A;  1VF9 A;  2VKH A;  1T33 A;  1FT9 A;  1BI0 A;  2A6T A;  2O3F A;  3SDB A;  3EUH C;  3E7L A;  1KON A;  2LLK A;  3MD2 A;  4HW0 A;  4OMY A;  4BQQ A;  5H6Q A;  4OAZ A;  5CQE A;  3BT9 A;  3DKW A;  3KIO A;  2B0L A;  1FPQ A;  1ZGJ A;  3F8F A;  2W24 A;  1I1S A;  3ZGK A;  2DA2 A; 
#chains in the Genus database with same CATH homology
 1VQP I;  3I55 I;  3CCJ I;  2H8W A;  1YIJ I;  3CC2 I;  1VQM I;  5GAG J;  1VQ5 I;  2ZJQ F;  5DM7 F;  2JQ7 A;  1VQO I;  3CME I;  3PIO F;  3G4S I;  3DLL F;  1S72 I;  1VQ7 I;  3CCQ I;  2E34 A;  1QA6 A;  1FOY A;  3CF5 F;  1Y39 A;  1YHQ I;  2ZJR F;  3J7Z I;  3CJR B;  3CMA I;  3EGV B;  1YJW I;  2QA4 I;  1ACI A;  1FOX A;  3CJQ B;  2OTJ I;  1WIB A;  3G71 I;  2K3F A;  2ZJP F;  1FOW A;  3CCL I;  2OTL I;  2E36 A;  3CCV I;  2NXN B;  5DM6 F;  3CCR I;  1VQ4 I;  5GAH J;  5GAD J;  3I56 I;  2FOW A;  3J7Y J;  1VQ9 I;  1HC8 A;  3CJT B;  1YI2 I;  3CCE I;  4IOC F;  1YJN I;  1VQ6 I;  1VQN I;  3CC7 I;  4IOA F;  3G6E I;  3CD6 I;  2E35 A;  3CCS I;  3CC4 I;  1VQ8 I;  4IO9 F;  4V19 K;  5JVG F;  3CJS B;  1VQL I;  1VQK I;  3CCM I;  2QEX I;  4UY8 I;  1MMS A;  3CCU I;  3PIP F;  5GAE J;  1YJ9 I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...