4V19K

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
SGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
K PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4v19K02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 4v19K01
1FOWA 2ZJQF 1YJ9I 2FOWA 1VQ8I 3EGVB 1VQPI 3J7YJ 5GADJ 1YI2I 3CD6I 3CCRI 3CMEI 1YIJI 2JQ7A 4V19K 5GAGJ 2ZJRF 2OTLI 3CCLI 3CCUI 1ACIA 3J7ZI 2QA4I 3I56I 2ZJPF 3CJQB 1VQ7I 1YJWI 5GAEJ 2H8WA 4UY8I 1VQ4I 1YITI 1Y39A 1VQ5I 4IOAF 3G4SI 1VQOI 3PIOF 3G71I 2E34A 3CMAI 5DM6F 3DLLF 2E36A 3I55I 3CC7I 5GAHJ 1VQLI 1HC8A 3CCVI 1FOYA 3CJTB 1FOXA 1S72I 3PIPF 1VQMI 2QEXI 5DM7F 3CC4I 4IO9F 1VQNI 2OTJI 1VQ9I 3CC2I 1YJNI 1YHQI 3CF5F 3CCMI 3G6EI 2E35A 1QA6A 3CCEI 3CJRB 2NXNB 3CJSB 4IOCF 1WIBA 3CCJI 3CCSI 1VQKI 2K3FA 1VQ6I 3CCQI 1MMSA 5JVGF
chains in the Genus database with same CATH superfamily
4EJUA 1B4AA 3PNYA 1YE9A 1FYKA 3HXLA 4XK4A 5LHGA 1H9GA 1KU2A 2BEOA 3M7GA 4UVBA 1NH3A 1G4DA 2CU7A 3P9KA 4IEJA 1IAWA 1LDDA 5J8FA 5LRSA 3MQ0A 1ZAOA 2ESHA 3CLQA 3U2RA 4GFBA 2HDWA 5EZHA 2DLLA 1IRXA 2VBXA 2Y0SN 2IT0A 1W5TA 1K78B 2QUFA 1PUFA 2Y48A 3GZ5A 3HGGA 2QQ9A 2ZBKA 4DW6A 4CYCA 1U3EM 4HSRA 2M0CA 5FFZA 4ASNA 1BI2A 3ZQ7A 3JR9A 3PJRA 3G1OA 1FYMA 2BZTA 1UG0A 2VXZA 4X6AJ 4U7DA 3HEFA 1RR7A 5CVIA 2CW8A 1K83J 3JAMZ 2DTRA 1ODDA 1R7JA 1B6AA 3ZPLA 1D8JA 2JJ7A 2HVSA 5LEKA 2OAZA 1LKXA 1EH8A 4WX9A 3AL0C 1K4TA 2P6TA 2ZFWA 4D1QA 3A03A 1IN5A 3FHNA 1FBQA 2KZVA 5HODA 1D1BA 1Z7LA 1BOAA 4EM1A 4G7ZF 1FBUA 4EM2A 2WC2A 2DU9A 4MFEA 2OJED 1O3QA 2LF7A 4BQAA 3F8BA 3A1YA 4XKVA 1MMGA 2I5UA 1TQPA 1MW7A 1T0FC 3RCOA 2FX0A 2R5ZA 1K78A 3BT9A 3QPTA 3ZR8X 2VJ5A 3ZQLA 5F0CA 2HDCA 1IN8A 3TO9A 1SEUA 5EEHA 1H89C 2LSOA 4BL0B 1UELB 5FKLA 1VNDA 1JXSA 1KGSA 3CCEI 5HDNA 3GBGA 2LH9A 1TWAJ 1D3YA 5AIPA 4CDGA 4L5IA 2M2EA 1IO2A 1SAUA 1O3RA 2W48A 3BC8A 3QP6A 1B9MA 2QSHX 3FIWA 4P9UA 2OUMA 2DA5A 4BXUA 1MBKA 3BG5A 4Z6YA 4OAZA 3OYHA 4IRIA 4W1UA 1VQ6I 1MMSA 4A6DA 1XGMA 1X19A 5E17F 3UKGA 2V9PA 3F0CA 2ZJQF 1OFCX 3ZCOA 1BI3A 3OOUA 4ABZA 2DMNA 3SZTA 4S05A 2Z1DA 1JKPC 1FJLA 3EQLF 4IRHA 1SFEA 3CJNA 1XGOA 3ESWB 1XSDA 3RKQA 2KFDA 4A3DJ 3AG3H 4LOCA 5DS9A 1PYVA 5M5WJ 5F27A 4BYYA 5E3NA 2Z9OA 4CGZA 1OJLA 1HLVA 5DYMA 2DT6A 1TT0A 1J09A 2FU4A 3F8MA 3H9JA 4FX0A 1WRJA 3BR0A 4NQWB 3BLYA 5J1UA 1IGNA 3GWZA 4FETA 1OCTC 1L3LA 2AQEA 2JUCA 1VQ4I 2LTPA 4XLNF 2NAZA 3ROUA 3G1MA 3PIOF 2DYRH 3EUHA 5CKTA 2E34A 3CMAI 1LDKB 3LA3A 4EJTA 3OYLA 1YW7A 1JE8A 1MSFC 3HHHA 4AYBA 1Z3YA 4GYIA 2CUJA 2D1HA 2V1NA 1MNDA 3KX2A 4BJ5C 4ZYGA 3WG9A 5D5XB 2E2IJ 3HYIA 4HX7A 1LFBA 1HC8A 2XROA 3OWTA 5FB2A 2EIJH 1WJEA 2KKOA 2RNJA 3OYNA 2D5VA 4BXXJ 1MSEC 1GXPA 1P9QC 2BGCA 3VOEA 3QPHA 4RGUA 1A36A 2IAIA 3V7SA 2YX7A 1YRNB 3RPQA 3H0DA 4HOBA 2LNBA 5ICFA 1KQ8A 5LBQA 5FD6A 3LNQA 2GBYA 3VYRB 4P96A 1IDYA 4NQWA 3VDXA 2QBYA 1V4RA 2JZYA 4AU7A 3JCUC 4IQJA 3KIOA 2TCTA 2ZC2A 3H5AA 5GPAA 4EGZA 1OYWA 4H4KC 1FSHA 5CPRB 2V1XA 3DXJF 2HFHA 2K40A 4OMZA 3CJRB 4D7NA 1QVTA 1EJ9A 4A3EJ 2KJCA 1ZRDA 5IYDJ 3OYEA 1FSEA 4II2A 5F6FA 2VE9A 4QPQA 5CVVA 4IHTA 1HBXG 2UV1A 3TP3A 3I9V2 1D1CA 1MBEA 2E5NA 3I54A 2K9SA 3UNGC 2X4HA 4DJAA 4E7KA 2A5YB 1BM9A 3HRUA 3EPZA 4G7HF 2X51A 1FC3A 2ACJA 1DU6A 1LE8B 3ELKA 2CV0A 2H27A 2HQNA 4LFUA 1VQPI 1YS6A 5DD4A 4RGSA 3OR1C 1NK2P 5IYBJ 1MBJA 2XIGA 5B1BH 2VOPA 3HUGB 1NHAA 3JRIA 2D45A 3P5JA 1RUOA 2QZ8A 3CCLI 1IUFA 3SHFA 3JRDA 1X3WB 4P1WA 4M9SA 1ACIA 3IUOA 2Z99A 1WVRA 3I56I 4KUMA 2DMPA 4DOZA 1WZ2A 2LRDA 4CXFA 1F1ZA 1IXCA 4KN4X 1A04A 2IPQX 1D8KA 2RV8A 3S2WA 2VODA 4BU2A 2O3FA 4YIIA 3TDZC 3VFZA 5B5EC 4L0ZB 3KZZA 3HOUJ 1W7PD 1R5HA 3K4BA 2YX4A 4PUSA 1Y6IA 3U1KA 2A07F 3P9IA 2RREA 3F22A 3GTKJ 1YFHA 1QO0D 1IF1A 4XM3A 2ZNZA 3KP5A 5DCMA 1YTYA 2LYCA 3F9KA 1HW2A 4JBAA 3S2DJ 2O6GE 3CC7I 1J75A 3CMMA 3Q5FA 1S8NA 4UHTA 1LE8A 2MFZA 2IS6A 3VYTB 3K69A 1MD0A 5IT3A 2VOOA 1AKHA 4JX5A 2CFXA 4JP0A 3C18A 1HDPA 4WWCA 4I0BA 1SVLA 4N9HA 3A0HC 3FXRA 3HUGA 3HPHA 5EDNA 3H35A 2W25A 3JREA 2HDDA 4IO9F 4BGDA 1SD7A 4Q4ZF 1FX7A 2E1OA 1POGA 1W0TA 2NYXA 4M6VA 4PJMA 3CF5F 1TW3A 1SVMA 4R8HA 2KHMA 3BG6A 4EJVA 3D5LA 3S8PA 2NVTJ 3BOQA 2GWRA 3OYAA 2R7ZJ 1KU7A 3NEUA 1NG7A 2ZXHA 4ZC3A 3T5XA 4EM0B 2HYFA 3CDLA 4YRVA 3S1MJ 2A69F 2R92J 2EH3A 4X1EA 1V55H 1FOKA 2ECCA 3DEWA 4LMYA 3LSRA 2XGCA 4XLEA 4CUGA 2IXSA 5TJJA 4FE7A 1UB9A 2A6EF 2EV0A 1MBGA 4MEYF 2V1DA 4F92B 3LSJA 5EG0B 2AQFA 4CCLA 2K86A 3DU5A 1J2XA 1T39A 2MC4A 2KRFA 3BDDA 4MQVA 3EYYA 1G3WA 4UVCA 4BXFA 2M8EA 5JR3A 1ERDA 3EGVB 1YOVB 4B3AA 2LY1A 2EK5A 3MWMA 4PGHA 4L9NA 4BAYA 1TQIA 2R7UA 5GADJ 1WJFA 4IPAA 5DUIA 1UMQA 3VYSB 1P4WA 2LY2A 5GAGJ 1FZPB 4LK1F 3ZQFA 4WF2A 3RYPA 2KIQA 3KFWX 1ETYA 3GF2A 5LFAA 3JRCA 3J80K 1DP3A 2GXAA 1NK3P 3WTUC 1LDJA 2EZHA 3FBNB 1L0OC 3FK7A 5FRNA 3F21A 2K02A 3L2VA 1USTA 1IZ1A 3PUFA 3MFKA 3W6KB 1E3HA 5DM6F 2IEKA 3TEDA 3AG1H 3S1QJ 3PFIA 4ZZDA 1REPC 4EJWA 1Q1VA 1W7PA 5F0HA 2L02A 2NVYJ 2CJJA 2P7VB 1WQ2A 2K9MA 2L4MA 3AL0B 3LSTA 1FYLA 5DCFA 3S14J 1KA8A 1QQIA 2XAHA 3QU3A 3F8CA 3FZVA 2PI0A 3SZGA 3LMMA 2GLOA 2M8GX 1LQ1A 3S93A 4EV0A 2CV2A 2K27A 3TW6A 3D0SA 3RQIA 1B8IB 2P5KA 3DCFA 1S29A 2Z2SB 4A6EA 1F5TA 2K4JA 3PUBA 2DA7A 4OIRF 3F72A 1LPQA 2IA0A 2M0MA 1QA6A 1BR4A 3H1CA 3TO7A 2IGNA 3QWLA 1Y8RB 3ONQA 1A6IA 3KZIC 5D6EA 1K4SA 4G6DA 1YX3A 4Q48A 1UG2A 2M34A 1G3TA 3AG4H 1YQAA 2DBBA 1MJ9A 3ASOH 5IYCJ 3SDGA 5K7HA 1SFOJ 3Q0WA 4F93B 1WGXA 1WHUA 4LLGF 2F2EA 1FMWA 4EATA 4RAGA 1X1CA 4XIDA 2V9VA 5GPCA 3EDPA 4HLXA 3W2WA 2YSRA 1RR8C 3FXQA 4E7IA 3NWTA 1E0EA 4RB0A 5TISC 2VJIA 2F4MB 3HM5A 3L2UA 1ZYRF 4IVNA 3G73A 3B6CA 1WH5A 3K1MA 2QVOA 4NDLA 2DT7B 1TWHJ 2O8XA 5CVRA 3DFGA 4N4NB 1U2WA 2MSYA 3E6MA 1B8IA 1ZGAA 3MKYB 3HOZJ 1F43A 2GQQA 3CMEI 3GTPJ 3FKJA 3FK6A 4MFDA 4V19K 5JVTA 2Y69H 2IVMA 2VPRA 2VQLA 3MZ8A 2KDOA 4BDZA 2CG4A 1H8AC 5LHIA 2VC0A 2CH0A 2OA4A 2JUGA 3P7NA 2M1BA 2DDBA 4FQGA 3IHUA 1XX5A 1R36A 2COMA 4FHTA 1FNNA 4O3MA 5JI6A 3S1RJ 4AC0A 5IP6A 3E3VA 5D5VB 2DQRA 2K85A 5GAEJ 1MDMA 5EYRA 3WGGA 4H0EA 3GTGJ 1OISA 4XICA 1IXRC 2FRHA 3K4MA 3HZJA 5D4RA 3VWBA 1R6RA 4ZDOA 3R0JA 3VSKA 2X6YA 4XNFA 1BIBA 1XMAA 2HKXA 5K5RA 3GCMA 3GFMA 2BHYA 3QYFA 5HNHA 3DPUA 2ISYA 3FF5A 1IW7F 2GIVA 4BBRJ 5C44J 3R6SA 1W0UA 2MABA 1SD4A 3J80Z 3FX3A 4XONA 2CRGA 1JGSA 2EZLA 2F4IA 2VI6A 3BWGA 1S72I 1P6RA 2COBA 2IA2A 1YS7A 1ETXA 4Q47A 3IP4B 3K4LA 2ZXIA 3PFYA 3MD2A 3HBLA 3UR3C 3L2RA 3CC4I 1MNMC 1ON2A 5E3LA 3GXOA 2N8GA 2OTJI 3CC2I 3HTUA 1B72B 5JLWA 3ML6A 4IX7A 2FQ4A 3EYIA 3DBRB 2UXNA 4YEJA 2YUSA 4BH9A 2ME6A 4Y7NJ 2M30A 4DIQA 3G1LA 3LQRA 2V26A 3L00A 2XB0X 1X1BA 5TGTA 2ESNA 1BW6A 2Q8KA 2VT2A 4ZTFA 4CCJA 3AG2H 3L09A 3OIPA 5LLQA 4RM2A 1GVJA 1OMIA 4E7HA 1HDDC 3O8GA 3P9CA 1ON1A 5ED4A 2IA1A 3RZOJ 4EQQA 3CZ6A 3VYUB 3ECOA 3CCQI 2VE8A 1P4XA 4F3QA 4IHSA 3QQAA 3ABTA 3CLOA 2FOWA 4CYCB 5J3LA 4O6JA 5C3EJ 4QTRA 2CS3A 3REOA 2L0KA 4DNCA 1VQ8I 5EJCA 1S5LC 4XRMA 4A3CJ 1A35A 3BCAA 1KYWA 3VEPA 3J7YJ 5FKNA 3JRHA 5J4YA 1LEAA 4PSWA 2PJPA 1GVDA 3RQ4A 2ZMEC 2WAQN 3OIOA 4LG0B 1ZREA 5ICEA 2H09A 2OTLI 4D0PA 1V5EA 5KAIC 5HVQC 5CQGA 2ECBA 4A3JJ 4KT5C 2XKOA 2DXIA 3V8KA 4OINF 1HA8A 1CF7A 1QHGA 5A2QK 1X4OA 2I8DA 2W4SA 3M07A 4DZJA 1JT6A 5J8CA 1TW2A 2H1LA 4B3XA 3MMYB 2EQRA 3KP6A 2IBDA 1Y0UA 3V4GA 1K6OA 1M1EB 1LFPA 1ZK8A 2XV4S 2DAOA 1BJAA 3QYBA 2X6OA 4OOIA 2ELHA 2V1UA 3KP3A 3S17J 2R5ZB 3DPTA 1IV8A 5E8IA 2G0EA 1Z0XA 2EV5A 2WWYA 4I6ZA 4BS9A 3F8NA 3MN2A 3CCVI 3FM5A 4DYCA 2CMPA 2KLOA 3WTZA 4OMYA 1YW8A 2R7DA 3TW7A 4B43A 1WI3A 5D5WB 2DI3A 3HB9A 4MO7A 4LG0A 3JTGA 5JHFA 2QKMB 2K5CA 4HA8A 4II3A 5FKKA 4JK1X 3HIFA 4LG3A 1V5FA 2BY1A 1MMDA 4NC6A 1IN6A 2X1EA 3IWZA 4AIDA 2NNYA 4E7LA 1JTXA 3I4PA 4AUXA 2V7FA 3LA2A 2HS5A 2E1MC 4HPQA 2ELKA 4OIQF 1IJWC 3HKZA 3KPHA 3DPLC 2BBYA 3TBIA 3MEXA 2EPFA 4LD5A 4ZJZA 2R7VA 3WG7H 3I0TA 1Z6TA 3OIQA 3A4CA 1F4KA 2L9SA 2A5WA 2G9WA 4XN3A 2DA1A 2ME0A 2RKHA 2V79A 3IL2A 4QLCU 2Y0MA 4N9IA 2XGEA 4M3BA 4B48A 4G7OF 2JSPA 1FY7A 1T08B 3OOPA 1I6XA 3OV8A 2PQ8A 3W2VA 3MKWB 4IKFA 3ERED 4KIFA 1YJ9I 2LVSA 2H8RA 2WAEA 3GW2A 2OZ6A 5IP9J 3K70C 4RGXA 4LGWA 2QQBA 3QP5A 2LOOA 3IV5A 5BQTA 4JX4A 4M72A 3JRGA 5LRRA 4MEXF 2OBPA 2R7WA 2DYSH 4NBQA 2XKPA 4A12A 1VF9A 1W1WE 4F91B 1HSTA 4HSTA 2DA2A 3JSPA 4BACA 4RMNA 2R7TA 2F5CA 3QPLA 4FT8A 5FFXA 3CJQB 1VQ7I 4I09A 2MD0A 2NVXJ 2JRMA 3I5UA 4NB5A 1Y39A 1VQ5I 2TDXA 2P7CB 3FXLA 4ZYAA 3S3MA 2YR2A 5K7ZA 2WA0A 2GOXB 2JVGA 4HX8A 2JTVA 2AHQA 5CYVA 4HX4A 1LVAA 1YW9A 2DA3A 1DGWY 2DO7A 4DBQA 2QBYB 1ZQ3P 2Y9ZA 5IP7J 2BY2A 3BG9A 5A2QZ 3PIPF 2R4GA 1ITYA 1R23A 2X6WA 1AOYA 1BBYA 2LKSA 4GCVA 2XPWA 1Z1DA 4WXHA 4OU0A 3WU1B 1VQNI 1J7KA 3HOSA 1VQ9I 2DODA 2G7HA 4BQQA 1HKSA 4M73A 3GMEA 1S7OA 1XMXA 1OLTA 2QSFX 1SD6A 2FJ1A 4Y4RA 4ESJA 3PSIA 4LJZF 4Y17A 3F3XA 1X2MA 1ZRFA 2L7ZA 4D9JA 1YX5A 2X9DA 1B59A 5D4SA 2NXNB 4A3MJ 1MMNA 4XRSG 4LIVA 2GIZA 3Q9VA 5IY5H 2XF7A 3F23A 3K4CA 2VBWA 3NQOA 4KMUX 1Z67A 1LNWA 1S3JA 1VQKI 3Q0VA 5FLXK 1CGPA 1OKRA 3K4NA 1ETQA 3EETA 1QHHD 2KJBA 2EWNA 4GGGA 2AXTC 4IF4A 2HKOA 4M9ZA 1ZGJA 2FNPA 2QLZA 1RIOH 1C0WA 4GDFA 1MJAA 3C3WA 4I2OA 1I1GA 4XSXF 3GFJA 2GZWA 1GXQA 1U9OA 3ABMH 1BA5A 3S2HJ 3S15J 1Z77A 1QBJA 4HDVA 1RNLA 3R60A 3LWFA 4LLNA 2NS0A 1E2XA 2CQNA 1I6HJ 2IJLA 3ZMZA 1SFUA 2M4GA 2XC7A 4IHWA 1FEXA 1DPRA 4CCOA 1OCPA 2MYSA 3WU2C 5DCMB 1J9IA 5JFRA 2J5PA 1QZZA 3CF2A 1JKRC 1WWXA 1R1VA 2HYGD 2ZJPF 1RETA 3ABKH 1JHHA 1SD5A 2WB1N 3GFIA 2RQPA 3NAUA 3GZ6A 2RDPA 2IW5A 2UUZA 2JK3A 3DEUA 2O03A 1AKHB 2LKPA 4U7BA 3ZMVA 4M9XA 2M7BA 1W5SA 1WSUA 2DPUA 2E36A 1S7EA 3TQNA 1HKQA 2BHZA 4BHBA 4HV5A 4HG2A 1KU9A 2QSGX 2VKEA 3CO7C 1MKMA 3BPXA 5C4JJ 5GP9A 1I39A 4EVIA 2H6CA 1KQ9A 5B66C 9ANTA 2CQXA 4E7SA 4A3KJ 3D5SC 2DJIA 3Q3SA 2PJRB 3V8LA 1ZHFA 4A5NA 2Y0SA 4HV6A 5HS8A 2LD5A 2QEXI 3L2QA 4G9YA 5FROA 1U8RA 5ILSA 3M4OJ 1S7AA 2FE3A 2EZIA 3HSFA 5DV5A 2FMLA 4B4CA 4UUSB 2BOLA 2H6BA 3KYLA 4P5OA 1Q1HA 3MCZA 2EINH 2HOTA 3I4MJ 3MKLA 2EBIA 3RPUD 4BJTA 3BP8A 2DCEA 2PG4A 3G2BA 2XAGA 2L54A 2XF5A 4M3FA 4UUVA 3QODA 2ZSIB 2XRNA 2Q1ZB 2XSJC 4UUTA 2MH9A 3LSGA 2K9NA 4OIPF 1I27A 1VTNC 2HR3A 4WXDA 5KAFC 4YFXF 4XLHA 1PP7U 4M3DA 2VQHA 3BR2A 2Y9YA 3ZMSA 4BUPA 5CLSA 2W7NA 3LSKA 1T95A 1QPMA 2M3AA 2KQRA 2W82A 2YPRA 3A01B 1X58A 5E3OA 2HQAA 2UXXA 4HEA2 2R7XA 3W6JB 3BPVA 1IN7A 1TTYA 3BROA 1VZ0A 1OCOH 5LHHA 2M7AA 2FOKA 2MG4A 4Y3OA 3LSMA 2W24A 1OCZH 4RDUA 1IN4A 1P92A 3MZHA 1O3TA 2PJRA 2KDZA 1W36D 2AXLA 2P6SA 1EV7A 4M74A 2XSDC 2IGKA 3OMYA 3HGYA 2W85A 3MKZA 4UUSA 2XAUA 3OL3A 3TL4X 3KLNA 3OYMA 4A3GJ 4AD9A 1YIJI 4IHYA 4BNCA 2DK5A 4OWRB 3PM1A 2EB7A 1XG1A 4S0HB 3H92A 1NTCA 2VUMJ 4KISA 3Q9SA 5FLXZ 4JQFA 4KICA 2A68F 2GAUA 3DQVC 2XRLA 2VB6A 1BC8C 2ZMEB 3DKWA 2A3SA 2LFBA 1XS9A 1LB2A 1W7PB 1WFXA 4FCYA 2NRAC 1GV5A 4CZCA 1ZG1A 4I98B 1ZGWA 2QF7A 4J00A 5BPIA 3X2QH 3ULQB 3A01A 4XL9A 4DBRA 1VQOI 2GXBA 3FXOA 2EZKA 2L2OA 2QQAA 2VBZA 3WGHA 4L5EA 1KZHA 4NUBA 1J59A 4U88A 3OYCA 1MMAA 3M9AA 2OC6A 3V42A 1UHMA 4IXAA 3O3KA 4BY1J 3ZRGA 4XSZF 2MW8A 1MZBA 2R5YB 3DBLB 2NVUB 5FLMJ 2AS5F 1PVEA 2KRCA 2PMUA 2EIMH 2WY7Q 3B6AA 3F6OA 3AAFA 1APLC 3RKYA 1JHFA 5IOZA 3K70D 1J0RA 2XAJA 1T2KA 4HW0A 1XCBA 3JSOA 4UB8C 3RDIA 3LFUA 3OYDA 4XRFA 4ZTJA 1P4AA 3DWLE 1UHSA 4HQEA 3CESA 2VPLA 3HRTA 2XPUA 3C2GA 4F55A 3BTJA 3OYBA 3GFLA 4G6QA 2DOEA 1G59A 4KITB 3ZQIA 1K7AA 3S16J 3PO2J 5E1ZB 4XQFA 3F6VA 2ZKZA 2ZMEA 3HC7A 2PFBA 2E35A 2PMZA 3BR5A 5F64A 5K7FA 1ZH5A 2HVRA 4D7MA 2OQGA 2QWWA 3I64A 3MAJA 1FTZA 4KMFA 2GA2A 4RB3C 3RPUA 4YG2F 1LUJB 4JOMA 1B9NA 3ECHA 2DFIA 3I4NJ 4PFPA 3VODA 1QZEA 1YO5C 3CCJI 5KNLA 1FT9A 2EFOA 2E1MB 1SVOA 2HU9A 2BXYA 2VXDA 4MGRA 1O7LA 4AM3A 1SANA 4BY7J 2OV7A 4YELA 2R5YA 1XDUA 2LREA 1QGPA 2FBHA 3BQZA 2H94A 2JA8J 4Y15A 2HZTA 1CQTA 1AHDP 1WJBA 2BW3A 2DQLA 5F0FA 3ZMTA 1ZR2A 1SC7A 2CW7A 1Z3XA 2L7MP 5EZGA 4CSWA 4Q5SF 3E6DA 4AIHA 2DJNA 2NS7A 1T33A 1MDMB 4CO8A 3CCRI 3HKZN 2D1VA 1KQ0A 2F5VA 1D1AA 3OY9A 5GTHC 1OR7C 1UFMA 2HNHA 3KYCB 1JTYA 2IGMA 5F08A 1JUPA 3H3ZA 4HLYA 2Y2ZA 1I3AA 1LVKA 1O7FA 3QU6A 4UV8A 3I3LA 2A05A 4IJAA 1EF4A 2QQ8A 2DPDA 1HQCA 2HWVA 1MJBA 1IG7A 3SQNA 4BBSJ 2A61A 4HNUA 3OS1A 4ESFA 1HF0A 1I1SA 3OYGA 2H8WA 4UY8I 2OZUA 5J47A 2FBIA 3DF8A 4A0YA 2VKDA 2GXGA 3CUQC 3JW4A 2VLAA 2FQ3A 4O5VA 4U0WA 4JX6A 5D6FA 4KFCA 3R0AA 3GO5A 2ZXJA 1N77A 3GTJJ 1BL0A 2O8KA 1MNEA 3HL2A 3CTAA 3HJEA 1X3UA 3CDHA 2CWEA 1U5TC 2DDAA 4PJLA 1GT0C 3E5XA 1XD7A 4E4HA 1Z6RA 3A2KA 5D8KB 1DUXC 3OYIA 1WCMJ 2XGDA 2ZFUA 4A0ZA 2KP6A 4ON0A 3FXJA 3I71A 2FD5A 3WE2A 3LAPA 1TZLA 2M9HA 2MLGA 2ISZA 4ANJA 2E2HJ 3NARA 3C2BA 2XAQA 4RAYA 5M3MJ 1RC9A 3ISPA 1A6QA 2AO9A 3BY6A 3CUOA 1K61A 4TV7A 1KYZA 2V6CA 3FMSA 4HF2A 3PQJA 4D5CA 5L3FA 2ZNYA 5TRDA 2E19A 5J1YA 3S3NA 1TLHB 2CYYA 2MD5A 2Z33A 1XMKA 2Y31A 4KA4A 4N0BA 1H0MA 4ITVA 3S1NJ 3DU6A 4IOCF 3GTOJ 1RZ4A 4B1RA 5KCMA 4A3LJ 5DTDA 3RYRA 2X6XA 4XKWA 3U1DA 4B09A 1G6NA 2W00A 3TOBA 5K5OA 1E3PA 3HG9A 5IOYA 3C7JA 1DP7P 3GTMJ 3R61A 3H36A 5E1XA 1RKWA 3SYTA 4AYBN 1CF7B 2LP0A 5J40A 3SDBA 5LGNA 3KYDB 1IRFA 3OL4A 3SJMA 3TO6A 3FXMA 2JWTA 1WI9A 1ZLJA 2JQ7A 1AA7A 3LOCA 1R49A 3WTVC 4C30A 3WODF 4ZDLA 1V54H 2EV6A 4PDKA 3LA7A 4ENMA 2QENA 2J5OA 3KLOA 2E5ZA 2F48A 4KNYA 4C3JJ 3BJOA 3BCBA 4UXNA 1HKTA 2MH2A 1LEBA 3G4SI 4XLAA 2VIXA 3G71I 1XDSA 3E97A 4U0VA 3WTSC 2M5WA 3HHGA 3FKIJ 1IDZA 3DTEA 4LITA 1ETVA 3H9QA 3KP2A 3J81Z 2JSCA 1HSJA 3FMQA 1ZTRA 4RAFA 4E70A 3CQZJ 1Z91A 2RGVA 4CCMA 2EFWA 3KETA 3N4MA 2HQ5A 1P7JA 4ZZLA 2E1NA 3G3ZA 4G12A 1DGRM 2I10A 4NNJA 2DFHA 3TOAA 1Z7UA 3J7AO 2LDUA 1QPIA 1K6YA 5ERIA 5ILVA 1X1PA 3DP7A 4ENKA 2E60A 3AKZA 3ABUA 5D5UB 2Q2EA 2E7WA 3DKYA 4FISA 4HF1A 1ZARA 3V8JA 1EH7A 4B47A 4HNTA 1R22A 4P9FA 2P8TA 5IPAA 3LSIA 1U78A 4PJNA 2EILH 4F52A 3TGNA 3WTWC 2BV6A 5L3EA 5GTIC 2FXAA 5EGOA 4KDPA 4PCQA 2ID3A 3K1PA 2DMTA 3CO6C 1UAAA 1JKQC 1ULYA 1XGSA 5L3GA 5FKMA 1T56A 1JT0A 3ZMDA 2YU3A 5LD2C 1PUEE 4UVAA 4DYRA 2NVQJ 1ZG5A 1W36C 3B73A 5AONA 1TWFJ 2KIUA 2KIMA 3I58A 1Y56A 2KPMA 3WE3A 4D5FA 1ZG3A 2K3FA 2X1DA 4BQNA 4ZYEA 2X85A 2CQ7A 3LL7A 4RA2A 3IC7A 3K2AA 2HTSA 1MBHA 3C2HA 2KRHA 3KP7A 5CVUA 4CCNA 5ILUA 3DBHB 1WJAA 2HVQA 2OU2A 2DK8A 2L7FP 1Z21A 4B8XA 1OYIA 3IH4A 3H3UA 2O61A 1A5JA 3OR2C 2Y75A 3L2WA 1W4MA 2WV1A 3ZN0A 5KVRA 4KN7X 5FRMA 4GO1A 3OSFA 3BR1A 2BVLA 3K2ZA 1G2HA 3E6CC 1ONVA 3GTLJ 2HOEA 2KT0A 4S04A 4KYWA 2VL8A 2VASA 4HQMA 2KIFA 4XOTA 1XN7A 1GV2A 4HDUA 3JRBA 4GRIA 4M6YA 2DN0A 4HRIA 2QA4I 4A3IJ 2JA6J 2MC3A 2E7XA 5H6RA 2W1OA 1RI7A 4FX4A 4KIGA 3H5NA 1R4NB 1D0XA 3SFIA 3U21A 3FXKA 3CMYA 2IP2A 5IT9K 3E0JB 3BZ6A 1KONA 1W5CC 1ZN2A 2QYOA 2LK2A 3K6GA 1YG2A 1U6GA 4EGYA 2CUFA 4FE4A 1DDNA 2OCCH 3DV8A 4MTEA 1XPXA 1RKTA 5CQEA 2DT5A 1JKOC 1H9TA 4MHGA 5DDGA 3FMRA 1X1AA 4IQ4A 3ZN1A 3J7AY 2GA1A 4LIUA 2O9LA 2O0YA 2CQKA 4XBFA 4IZZA 2LC2A 2FSWA 2WV0A 3DLAA 3RTRA 1NG6A 1Y8QB 2R7FA 1FP2A 3PL8A 4CA0A 1JUSA 5EF6A 4QSHA 3A0BC 1R00A 2X0LA 3VPRA 3IAS2 3I59B 4L9VA 3H0GJ 3K1NA 2PMHA 3CCYA 1FLIA 1QNTA 3BQYA 1YJNI 1R9TJ 3V7CA 5F1RA 3HTSB 2XVCA 1MH3A 3O8HA 3HOXJ 2HI3A 2TRTA 3KCCA 4JYKA 4ETSA 5LEJA 2A6TA 2Z3YA 2B63J 3L7WA 1ZR4A 4L0YB 1JJ6C 3FM3A 4XKBA 2V4JC 3LQQA 3GEZA 2JA5J 3U9GA 4I76A 3ZOBA 4XR6A 4MLOA 2X48A 4LK0F 5HNFA 4B44A 4KIBA 4PK4A 2ZXWH 4M6XA 4WCGA 2XGXA 3FXUA 5FLVA 2A6HF 2ETHA 4CYDA 3GTQJ 4M71A 1J5YA 5D8LB 2P5LC 2P4WA 5BOXA 2PMZN 6PAXA 2H1KA 3FHZA 2VONA 3RJPA 4DZPA 4QIWN 1D0ZA 5E20A 2D2WA 2STWA 2R93J 4XOPA 1JI8A 4BHPA 3I59A 2K9QA 1MGTA 5FGMA 1YI2I 4L5JA 4NC7A 2OPTA 4CHUA 5HLIA 3IH2A 3E5UA 1ETWA 4CCKA 2O5RA 1Y1WJ 1R1UA 4XKCA 4PJJA 2ZJRF 1RESA 2ZJ2A 2RVCA 3RKWA 2JT1A 1OQYA 3COAC 3CCUI 2EFNA 4L18B 4A3BJ 1N75A 5H6QA 1FPQA 3DTKA 3I53A 2LY9A 3M8FA 2DFFA 1BR1A 2IGOA 2QCOA 3QPSA 1FTTA 1STZA 1TBXA 3DEEA 4MQ9F 1MIJA 4C2TA 4MIMA 3WU0A 2M45A 2FA5A 2HYJA 2EFQA 1LJ9A 3W2AA 3HOYJ 2L3DA 1OCRH 4BE1A 2CW0F 1SFXA 2MLKA 4HZFA 4A69C 3GUDA 4A3FJ 1PP8F 3K10A 5E79C 4ZH4F 1R4MB 2CSOA 3SFZA 3CUQB 3BR6A 2KZGA 3IH3A 2L9NA 3QRFF 1BC7C 2DA6A 2FBKA 3GLXA 2PEXA 4U0YA 3CJTB 1FIAA 2ICWG 3KEOA 2YU9J 2WAQA 1TL8A 3IKTA 4P55A 5ICGA 1PDNC 3DKXA 1U5TB 1G8XA 1OYYA 1I50J 5IT9Z 1WJ5A 4DQ2A 2OCEA 2IS4A 2VKHA 4CICA 3HSRA 4PFOA 2WTEA 1TWGJ 2QM3A 3CCMI 2LR8A 3LSPA 4C9YA 1XCVA 4E7ZA 4F7ZA 4Y33A 1OR7A 3HRMA 2F5DA 2VBYA 4BJ6C 2R0QC 4G6TB 4V2GA 3K7AJ 2JPBA 2WY8Q 1YRNA 1XSVA 3ZQHA 4RLQA 2R3SA 3O2PE 3VSLA 1SAXA 3CCSI 3OYFA 1USSA 4AIJA 2K9LA 5B3SH 1RRJA 1UHWA 2HQRA 2HXIA 3CUQA 2L9RA 4V2FA 5H2FC 1ZLKA 1G3SA 1AWCA 2BXZA 2NS8A 2RC4A 2MBFA 5JVGF 1FOWA 4RM3A 2R7QA 2VJJA 2L4AA 2PN6A 2F5EA 1K79A 3C1DA 2E1CA 3JRAA 1U0JA 4IHXA 1U5TA 5CVJA 2XPVA 3RZDJ 2VQGA 2PX9A 1WJCA 1R1TA 4RLFA 4YFKF 3OYKA 4K2EA 4ENNA 4HNVA 3CD6I 1IC8A 2BY3A 1UCRA 3H3VK 2RQQA 4WK8F 4HAMA 5J4VA 1YYVA 4A2UA 5HOOA 2PLYA 3IRQA 4OIOF 1Y1VJ 1T6SA 1ENHA 2P0WA 3K4KA 4XMYA 1D0YA 5J1RA 4R79A 4YIFA 4R1HA 2K7LA 3IAM2 2HPMA 5B1AH 1R71A 1TC3C 2IS1A 2M87A 1YJWI 2EA2A 3TP0A 1HW1A 1ZKGA 2NOJB 3RI4A 4G8XA 1RUNA 1EKEA 1BOBA 1DQUA 3W6VA 4IOAF 3HOVJ 3K9TA 1WPKA 1TP4A 2FUG2 4XLFA 4I7HA 1UJ8A 3K4JA 3I55I 3FDYA 2HEOA 2PBIA 3N05A 3LAJA 1ETKA 2HGCA 2VC1A 4IRGA 3WHBA 5FJ8J 1YLFA 4E7JA 5GAHJ 1T8IA 3ASNH 3BZCA 3TDUC 3M1EA 3HDDA 1FMVA 1FOYA 3M3YJ 1V5GA 2CUZA 3PO3J 3HSEA 4QPOA 3S3OA 2BVMA 1VQMI 1U9NA 3OS2A 2JMWA 4CZZA 4KJZA 3SEQA 4XN0A 2NNNA 3EUKL 4CH7A 1AU7A 3ZQGA 4EJOA 1BI1A 1F36A 2XDVA 4GYGA 2IRFG 4Z2YA 3MZYA 2CUEA 4LB6B 1MH4A 5CJ9A 4ENJA 2B9SA 4RBOA 4C3IJ 5M3FJ 1H88C 5ICCA 2YS9A 4IL6C 2LKXA 1O3SA 3PSFA 3M8EA 2DA4A 3PNVA 3W3CA 1JUMA 5HS7A 4W97A 3KEYA 3GZNB 5F04A 3FBIB 3EUHC 1BIAA 3JRFA 4LB5A 2K4BA 2BW3B 4BEHB 5HDGA 3V7RA 3FISA 4N4OB 5HLTA 5K1YA 3BTCA 1IRZA 3T0YA 5FO5A 4IHVA 2HTJA 1BW5A 4XLPF 1UZCA 3EUAA 2VN2A 3E1SA 2BY0A 3FWEA 2WBMA 5DEQA 5LGTA 4A0XA 1TQMA 2XAFA 3QYEA 2FEZA 4ZYDA 3GX4X 3D1NI 5E1WA 2W57A 1VI0A 3SEZA 1VFCA 4RS8A 1FP1D 1YIOA 2ID6A 3OYJA 2QKLB 2FNAA 5JLXA 1QZYA 1X3ZB 2LBFB 3JTHA 3ZGKA 1JJ8C 5EEGA 2K3PA 1R58A 2IS2A 4BKXA 4AVZA 1HOMA 3LSHA 4QWQA 2OQRA 2UWMA 1KU3A 3ERMA 4I0AA 2ZB9A 1ETOA 2DOFA 3QAHA 4U87A 2P5VA 5EG0A 1XC5A 3ZXSA 4EEFG 1FIPA 2ZCWA 4AVPA 3L9FA 3J7ZI 5L3BA 3OSGA 1P2FA 2XUBA 3BJ6A 4UB6C 5BS6A 3H9GA 1EH6A 2KMUA 2KL4A 5BMZA 2CO5A 3KE2A 2JPCA 4BEHA 4Y52J 4XLCA 1YITI 5K5QA 4C2UA 2L01A 2XASA 3T8RA 3J81K 3B02A 4RAZA 4KT6A 1XGNA 2L7KA 1S6LA 3F8FA 4UV9A 5E3MA 3DLLF 1OCCH 1WJDA 3BTLA 3E7LA 3TKYA 4NHJA 3GVAA 2RAEA 1R5GA 1N25A 3BG7A 2ZO4A 2GOMA 2NOGA 1T38A 3S32A 1OPCA 2E2JJ 1F9NA 4XORA 3IKVA 4M3EA 1SFKA 1WKMA 1U8BA 1O57A 2LBFA 2HPIA 2FF4A 1GDTA 4EMSA 1WH7A 4YIRX 1ZELA 2L5QA 1TT5B 3BZKA 3RIRA 1I5ZA 5BNGA 4RB2C 1O4XA 2HXOA 2DW4A 4A5MA 2ELJA 3GYHX 3L1PA 4C3HJ 1S9HA 1GLNA 1X4PA 5C4XJ 2EA4A 3K0LA 4A93J 4YFNF 1R5ID 2JVHA 5AIQA 5F1JA 4RB1A 4MTDA 1HCRA 1GHCA 5HS9A 3N97A 2CGPA 3DTIA 4I99C 2WB1A 4PSXA 3G6EI 5LGUA 1QU3A 1BN5A 2QGUA 2MGQA 1MBFA 3HPGA 4FTHA 1SMTA 5HLGA 2DMUA 4ESBA 1IUYA 2JA2A 4OAYA 5KHDA 4NC8A 3L2CA 4AWXB 1BJZA 2JN6A 2R7OA 3E6BA 3E5QA 2F5FA 4X0GA 1SMYF 2HZDA 2OD5A 3M8JA 5L3DA 1IXSB 3HRSA 3IWFA 2VT3A 3BTIA 4HBLA 4GXOA 1D5YA 1EA3A 4L9JA 2EJRA 1TNTA 4AIKA 4G94A 1T0FA 3BJAA 1JGGA 2G7UA 3BG3A 2F6CA 2OF7A 2EFPA 4ZYHA 1BR2A 1E3OC 2XF6A 3CDIA 4C2MJ 4J19A 1RPWA 1V3FA 3JAMK 1PJRA 2VQCA 3ZP5A 3RSNA 2FMYA 3ZQCA 2JA7J 2LF8A 2W84A 3WHCA 5KK1A 1GUUA 2B0LA 2X1CA 5DUKA 2Z5UA 3MVPA 2CFOA 2V6EA 5DD8A 3NRVA 3QOEA 3O6BB 3GLLA 3VB2A 4FASD 3WGIA 2HOSA 1BI0A 3ZQQA 2Z16A 4E6KG 1P7IA 2LMDA 1X1DA 2UZKA 1D5VA 4XRSA 2O7OA 3WTYC 3WTXC 2WADA 3RKXA 4MNUA 3QOPA 1TNSA 2B7EA 2Q0OA 4RGRA 5H20A 5FKOA 2WAFA 5FD5A 5J6XA 5L3CA 1N78A 3KEQA 2XB5A 3CP2A 1TWCJ 4BQOA 1HXDA 4LLLA 3A02A 1B1BA 1XB4A 2Y30A 4ZDPA 2BE5F 1LFUP 1FBSA 2E71A 2Q2EB 3TMOA 4DYQA 2XHKA 1ORKA 4BE0A 1FWZA 3T8TA 5BPDA 1DPUA 1Y0NA 5E8GA 2V9KA 2GM4A 3SZPA 4DGWB 5E18F 3R4KA 2VJ4A 1A31A 1VQLI 3H5RA 2BYVE 1Z05A 2R7RA 3LFKA 2EIKH 4L9TA 2LG4A 4UNOA 5EGOB 2DOAA 4BHCA 1FOXA 4Y13A 5M5XJ 3IRRA 2DFEA 2CQQA 4M3GA 1QVUA 1Z9CA 3BR3A 3T1BA 1X2NA 3HOTA 2HOAA 3KZYA 5DM7F 4I01A 3HOWJ 1HW5A 3ZMUA 3CP8A 3NWSA 3M1CA 3KP4A 4PZJA 2STTA 3Q0UA 4WXCA 1YHQI 2P81A 1I3QJ 2CV1A 5HDKA 3AFHA 2MA3A 3WTTC 1PUFB 1ZRCA 4HYEA 2JRTA 2ADUA 2DTZA 3PQKA 1T98A 1XTAA 5EEAA 2R7SA 3CJSB 2M4KA 3SXYA 5M5YJ 4J01A 1WIBA 2RNGA 1IRGA 4BDYA 4I02A 2L9VA 2LLKA 4PGGA 1IV6A 2F4OB 4PJ0C 3OS0A 5JHUA 4BE2A 1XSXA 2C6YA 1DU0A 1B72A 1QRYA 2KISA 2RN7A 2ZSHB 1E17A 4HF0A 2DMQA 2VKVA 3D5RC 3PNTA 3ABLH 1G3YA 5HLHA
chains in the Genus database with same CATH topology
1FOWA 2ZJQF 1YJ9I 2FOWA 1VQ8I 3EGVB 1VQPI 3J7YJ 5GADJ 1YI2I 3CD6I 3CCRI 3CMEI 1YIJI 2JQ7A 4V19K 5GAGJ 2ZJRF 2OTLI 3CCLI 3CCUI 1ACIA 3J7ZI 2QA4I 3I56I 2ZJPF 3CJQB 1VQ7I 1YJWI 5GAEJ 2H8WA 4UY8I 1VQ4I 1YITI 1Y39A 1VQ5I 4IOAF 3G4SI 1VQOI 3PIOF 3G71I 2E34A 3CMAI 5DM6F 3DLLF 2E36A 3I55I 3CC7I 5GAHJ 1VQLI 1HC8A 3CCVI 1FOYA 3CJTB 1FOXA 1S72I 3PIPF 1VQMI 2QEXI 5DM7F 3CC4I 4IO9F 1VQNI 2OTJI 1VQ9I 3CC2I 1YJNI 1YHQI 3CF5F 3CCMI 3G6EI 2E35A 1QA6A 3CCEI 3CJRB 2NXNB 3CJSB 4IOCF 1WIBA 3CCJI 3CCSI 1VQKI 2K3FA 1VQ6I 3CCQI 1MMSA 5JVGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOW A;  2ZJQ F;  1YJ9 I;  2FOW A;  1VQ8 I;  3EGV B;  1VQP I;  3J7Y J;  5GAD J;  1YI2 I;  3CD6 I;  3CCR I;  3CME I;  1YIJ I;  2JQ7 A;  4V19 K;  5GAG J;  2ZJR F;  2OTL I;  3CCL I;  3CCU I;  1ACI A;  3J7Z I;  2QA4 I;  3I56 I;  2ZJP F;  3CJQ B;  1VQ7 I;  1YJW I;  5GAE J;  2H8W A;  4UY8 I;  1VQ4 I;  1YIT I;  1Y39 A;  1VQ5 I;  4IOA F;  3G4S I;  1VQO I;  3PIO F;  3G71 I;  2E34 A;  3CMA I;  5DM6 F;  3DLL F;  2E36 A;  3I55 I;  3CC7 I;  5GAH J;  1VQL I;  1HC8 A;  3CCV I;  1FOY A;  3CJT B;  1FOX A;  1S72 I;  3PIP F;  1VQM I;  2QEX I;  5DM7 F;  3CC4 I;  4IO9 F;  1VQN I;  2OTJ I;  1VQ9 I;  3CC2 I;  1YJN I;  1YHQ I;  3CF5 F;  3CCM I;  3G6E I;  2E35 A;  1QA6 A;  3CCE I;  3CJR B;  2NXN B;  3CJS B;  4IOC F;  1WIB A;  3CCJ I;  3CCS I;  1VQK I;  2K3F A;  1VQ6 I;  3CCQ I;  1MMS A;  5JVG F; 
#chains in the Genus database with same CATH topology
 4EJU A;  1B4A A;  3PNY A;  1YE9 A;  1FYK A;  3HXL A;  4XK4 A;  5LHG A;  1H9G A;  1KU2 A;  2BEO A;  3M7G A;  4UVB A;  1NH3 A;  1G4D A;  2CU7 A;  3P9K A;  4IEJ A;  1IAW A;  1LDD A;  5J8F A;  5LRS A;  3MQ0 A;  1ZAO A;  2ESH A;  3CLQ A;  3U2R A;  4GFB A;  2HDW A;  5EZH A;  2DLL A;  1IRX A;  2VBX A;  2Y0S N;  2IT0 A;  1W5T A;  1K78 B;  2QUF A;  1PUF A;  2Y48 A;  3GZ5 A;  3HGG A;  2QQ9 A;  2ZBK A;  4DW6 A;  4CYC A;  1U3E M;  4HSR A;  2M0C A;  5FFZ A;  4ASN A;  1BI2 A;  3ZQ7 A;  3JR9 A;  3PJR A;  3G1O A;  1FYM A;  2BZT A;  1UG0 A;  2VXZ A;  4X6A J;  4U7D A;  3HEF A;  1RR7 A;  5CVI A;  2CW8 A;  1K83 J;  3JAM Z;  2DTR A;  1ODD A;  1R7J A;  1B6A A;  3ZPL A;  1D8J A;  2JJ7 A;  2HVS A;  5LEK A;  2OAZ A;  1LKX A;  1EH8 A;  4WX9 A;  3AL0 C;  1K4T A;  2P6T A;  2ZFW A;  4D1Q A;  3A03 A;  1IN5 A;  3FHN A;  1FBQ A;  2KZV A;  5HOD A;  1D1B A;  1Z7L A;  1BOA A;  4EM1 A;  4G7Z F;  1FBU A;  4EM2 A;  2WC2 A;  2DU9 A;  4MFE A;  2OJE D;  1O3Q A;  2LF7 A;  4BQA A;  3F8B A;  3A1Y A;  4XKV A;  1MMG A;  2I5U A;  1TQP A;  1MW7 A;  1T0F C;  3RCO A;  2FX0 A;  2R5Z A;  1K78 A;  3BT9 A;  3QPT A;  3ZR8 X;  2VJ5 A;  3ZQL A;  5F0C A;  2HDC A;  1IN8 A;  3TO9 A;  1SEU A;  5EEH A;  1H89 C;  2LSO A;  4BL0 B;  1UEL B;  5FKL A;  1VND A;  1JXS A;  1KGS A;  3CCE I;  5HDN A;  3GBG A;  2LH9 A;  1TWA J;  1D3Y A;  5AIP A;  4CDG A;  4L5I A;  2M2E A;  1IO2 A;  1SAU A;  1O3R A;  2W48 A;  3BC8 A;  3QP6 A;  1B9M A;  2QSH X;  3FIW A;  4P9U A;  2OUM A;  2DA5 A;  4BXU A;  1MBK A;  3BG5 A;  4Z6Y A;  4OAZ A;  3OYH A;  4IRI A;  4W1U A;  1VQ6 I;  1MMS A;  4A6D A;  1XGM A;  1X19 A;  5E17 F;  3UKG A;  2V9P A;  3F0C A;  2ZJQ F;  1OFC X;  3ZCO A;  1BI3 A;  3OOU A;  4ABZ A;  2DMN A;  3SZT A;  4S05 A;  2Z1D A;  1JKP C;  1FJL A;  3EQL F;  4IRH A;  1SFE A;  3CJN A;  1XGO A;  3ESW B;  1XSD A;  3RKQ A;  2KFD A;  4A3D J;  3AG3 H;  4LOC A;  5DS9 A;  1PYV A;  5M5W J;  5F27 A;  4BYY A;  5E3N A;  2Z9O A;  4CGZ A;  1OJL A;  1HLV A;  5DYM A;  2DT6 A;  1TT0 A;  1J09 A;  2FU4 A;  3F8M A;  3H9J A;  4FX0 A;  1WRJ A;  3BR0 A;  4NQW B;  3BLY A;  5J1U A;  1IGN A;  3GWZ A;  4FET A;  1OCT C;  1L3L A;  2AQE A;  2JUC A;  1VQ4 I;  2LTP A;  4XLN F;  2NAZ A;  3ROU A;  3G1M A;  3PIO F;  2DYR H;  3EUH A;  5CKT A;  2E34 A;  3CMA I;  1LDK B;  3LA3 A;  4EJT A;  3OYL A;  1YW7 A;  1JE8 A;  1MSF C;  3HHH A;  4AYB A;  1Z3Y A;  4GYI A;  2CUJ A;  2D1H A;  2V1N A;  1MND A;  3KX2 A;  4BJ5 C;  4ZYG A;  3WG9 A;  5D5X B;  2E2I J;  3HYI A;  4HX7 A;  1LFB A;  1HC8 A;  2XRO A;  3OWT A;  5FB2 A;  2EIJ H;  1WJE A;  2KKO A;  2RNJ A;  3OYN A;  2D5V A;  4BXX J;  1MSE C;  1GXP A;  1P9Q C;  2BGC A;  3VOE A;  3QPH A;  4RGU A;  1A36 A;  2IAI A;  3V7S A;  2YX7 A;  1YRN B;  3RPQ A;  3H0D A;  4HOB A;  2LNB A;  5ICF A;  1KQ8 A;  5LBQ A;  5FD6 A;  3LNQ A;  2GBY A;  3VYR B;  4P96 A;  1IDY A;  4NQW A;  3VDX A;  2QBY A;  1V4R A;  2JZY A;  4AU7 A;  3JCU C;  4IQJ A;  3KIO A;  2TCT A;  2ZC2 A;  3H5A A;  5GPA A;  4EGZ A;  1OYW A;  4H4K C;  1FSH A;  5CPR B;  2V1X A;  3DXJ F;  2HFH A;  2K40 A;  4OMZ A;  3CJR B;  4D7N A;  1QVT A;  1EJ9 A;  4A3E J;  2KJC A;  1ZRD A;  5IYD J;  3OYE A;  1FSE A;  4II2 A;  5F6F A;  2VE9 A;  4QPQ A;  5CVV A;  4IHT A;  1HBX G;  2UV1 A;  3TP3 A;  3I9V 2;  1D1C A;  1MBE A;  2E5N A;  3I54 A;  2K9S A;  3UNG C;  2X4H A;  4DJA A;  4E7K A;  2A5Y B;  1BM9 A;  3HRU A;  3EPZ A;  4G7H F;  2X51 A;  1FC3 A;  2ACJ A;  1DU6 A;  1LE8 B;  3ELK A;  2CV0 A;  2H27 A;  2HQN A;  4LFU A;  1VQP I;  1YS6 A;  5DD4 A;  4RGS A;  3OR1 C;  1NK2 P;  5IYB J;  1MBJ A;  2XIG A;  5B1B H;  2VOP A;  3HUG B;  1NHA A;  3JRI A;  2D45 A;  3P5J A;  1RUO A;  2QZ8 A;  3CCL I;  1IUF A;  3SHF A;  3JRD A;  1X3W B;  4P1W A;  4M9S A;  1ACI A;  3IUO A;  2Z99 A;  1WVR A;  3I56 I;  4KUM A;  2DMP A;  4DOZ A;  1WZ2 A;  2LRD A;  4CXF A;  1F1Z A;  1IXC A;  4KN4 X;  1A04 A;  2IPQ X;  1D8K A;  2RV8 A;  3S2W A;  2VOD A;  4BU2 A;  2O3F A;  4YII A;  3TDZ C;  3VFZ A;  5B5E C;  4L0Z B;  3KZZ A;  3HOU J;  1W7P D;  1R5H A;  3K4B A;  2YX4 A;  4PUS A;  1Y6I A;  3U1K A;  2A07 F;  3P9I A;  2RRE A;  3F22 A;  3GTK J;  1YFH A;  1QO0 D;  1IF1 A;  4XM3 A;  2ZNZ A;  3KP5 A;  5DCM A;  1YTY A;  2LYC A;  3F9K A;  1HW2 A;  4JBA A;  3S2D J;  2O6G E;  3CC7 I;  1J75 A;  3CMM A;  3Q5F A;  1S8N A;  4UHT A;  1LE8 A;  2MFZ A;  2IS6 A;  3VYT B;  3K69 A;  1MD0 A;  5IT3 A;  2VOO A;  1AKH A;  4JX5 A;  2CFX A;  4JP0 A;  3C18 A;  1HDP A;  4WWC A;  4I0B A;  1SVL A;  4N9H A;  3A0H C;  3FXR A;  3HUG A;  3HPH A;  5EDN A;  3H35 A;  2W25 A;  3JRE A;  2HDD A;  4IO9 F;  4BGD A;  1SD7 A;  4Q4Z F;  1FX7 A;  2E1O A;  1POG A;  1W0T A;  2NYX A;  4M6V A;  4PJM A;  3CF5 F;  1TW3 A;  1SVM A;  4R8H A;  2KHM A;  3BG6 A;  4EJV A;  3D5L A;  3S8P A;  2NVT J;  3BOQ A;  2GWR A;  3OYA A;  2R7Z J;  1KU7 A;  3NEU A;  1NG7 A;  2ZXH A;  4ZC3 A;  3T5X A;  4EM0 B;  2HYF A;  3CDL A;  4YRV A;  3S1M J;  2A69 F;  2R92 J;  2EH3 A;  4X1E A;  1V55 H;  1FOK A;  2ECC A;  3DEW A;  4LMY A;  3LSR A;  2XGC A;  4XLE A;  4CUG A;  2IXS A;  5TJJ A;  4FE7 A;  1UB9 A;  2A6E F;  2EV0 A;  1MBG A;  4MEY F;  2V1D A;  4F92 B;  3LSJ A;  5EG0 B;  2AQF A;  4CCL A;  2K86 A;  3DU5 A;  1J2X A;  1T39 A;  2MC4 A;  2KRF A;  3BDD A;  4MQV A;  3EYY A;  1G3W A;  4UVC A;  4BXF A;  2M8E A;  5JR3 A;  1ERD A;  3EGV B;  1YOV B;  4B3A A;  2LY1 A;  2EK5 A;  3MWM A;  4PGH A;  4L9N A;  4BAY A;  1TQI A;  2R7U A;  5GAD J;  1WJF A;  4IPA A;  5DUI A;  1UMQ A;  3VYS B;  1P4W A;  2LY2 A;  5GAG J;  1FZP B;  4LK1 F;  3ZQF A;  4WF2 A;  3RYP A;  2KIQ A;  3KFW X;  1ETY A;  3GF2 A;  5LFA A;  3JRC A;  3J80 K;  1DP3 A;  2GXA A;  1NK3 P;  3WTU C;  1LDJ A;  2EZH A;  3FBN B;  1L0O C;  3FK7 A;  5FRN A;  3F21 A;  2K02 A;  3L2V A;  1UST A;  1IZ1 A;  3PUF A;  3MFK A;  3W6K B;  1E3H A;  5DM6 F;  2IEK A;  3TED A;  3AG1 H;  3S1Q J;  3PFI A;  4ZZD A;  1REP C;  4EJW A;  1Q1V A;  1W7P A;  5F0H A;  2L02 A;  2NVY J;  2CJJ A;  2P7V B;  1WQ2 A;  2K9M A;  2L4M A;  3AL0 B;  3LST A;  1FYL A;  5DCF A;  3S14 J;  1KA8 A;  1QQI A;  2XAH A;  3QU3 A;  3F8C A;  3FZV A;  2PI0 A;  3SZG A;  3LMM A;  2GLO A;  2M8G X;  1LQ1 A;  3S93 A;  4EV0 A;  2CV2 A;  2K27 A;  3TW6 A;  3D0S A;  3RQI A;  1B8I B;  2P5K A;  3DCF A;  1S29 A;  2Z2S B;  4A6E A;  1F5T A;  2K4J A;  3PUB A;  2DA7 A;  4OIR F;  3F72 A;  1LPQ A;  2IA0 A;  2M0M A;  1QA6 A;  1BR4 A;  3H1C A;  3TO7 A;  2IGN A;  3QWL A;  1Y8R B;  3ONQ A;  1A6I A;  3KZI C;  5D6E A;  1K4S A;  4G6D A;  1YX3 A;  4Q48 A;  1UG2 A;  2M34 A;  1G3T A;  3AG4 H;  1YQA A;  2DBB A;  1MJ9 A;  3ASO H;  5IYC J;  3SDG A;  5K7H A;  1SFO J;  3Q0W A;  4F93 B;  1WGX A;  1WHU A;  4LLG F;  2F2E A;  1FMW A;  4EAT A;  4RAG A;  1X1C A;  4XID A;  2V9V A;  5GPC A;  3EDP A;  4HLX A;  3W2W A;  2YSR A;  1RR8 C;  3FXQ A;  4E7I A;  3NWT A;  1E0E A;  4RB0 A;  5TIS C;  2VJI A;  2F4M B;  3HM5 A;  3L2U A;  1ZYR F;  4IVN A;  3G73 A;  3B6C A;  1WH5 A;  3K1M A;  2QVO A;  4NDL A;  2DT7 B;  1TWH J;  2O8X A;  5CVR A;  3DFG A;  4N4N B;  1U2W A;  2MSY A;  3E6M A;  1B8I A;  1ZGA A;  3MKY B;  3HOZ J;  1F43 A;  2GQQ A;  3CME I;  3GTP J;  3FKJ A;  3FK6 A;  4MFD A;  4V19 K;  5JVT A;  2Y69 H;  2IVM A;  2VPR A;  2VQL A;  3MZ8 A;  2KDO A;  4BDZ A;  2CG4 A;  1H8A C;  5LHI A;  2VC0 A;  2CH0 A;  2OA4 A;  2JUG A;  3P7N A;  2M1B A;  2DDB A;  4FQG A;  3IHU A;  1XX5 A;  1R36 A;  2COM A;  4FHT A;  1FNN A;  4O3M A;  5JI6 A;  3S1R J;  4AC0 A;  5IP6 A;  3E3V A;  5D5V B;  2DQR A;  2K85 A;  5GAE J;  1MDM A;  5EYR A;  3WGG A;  4H0E A;  3GTG J;  1OIS A;  4XIC A;  1IXR C;  2FRH A;  3K4M A;  3HZJ A;  5D4R A;  3VWB A;  1R6R A;  4ZDO A;  3R0J A;  3VSK A;  2X6Y A;  4XNF A;  1BIB A;  1XMA A;  2HKX A;  5K5R A;  3GCM A;  3GFM A;  2BHY A;  3QYF A;  5HNH A;  3DPU A;  2ISY A;  3FF5 A;  1IW7 F;  2GIV A;  4BBR J;  5C44 J;  3R6S A;  1W0U A;  2MAB A;  1SD4 A;  3J80 Z;  3FX3 A;  4XON A;  2CRG A;  1JGS A;  2EZL A;  2F4I A;  2VI6 A;  3BWG A;  1S72 I;  1P6R A;  2COB A;  2IA2 A;  1YS7 A;  1ETX A;  4Q47 A;  3IP4 B;  3K4L A;  2ZXI A;  3PFY A;  3MD2 A;  3HBL A;  3UR3 C;  3L2R A;  3CC4 I;  1MNM C;  1ON2 A;  5E3L A;  3GXO A;  2N8G A;  2OTJ I;  3CC2 I;  3HTU A;  1B72 B;  5JLW A;  3ML6 A;  4IX7 A;  2FQ4 A;  3EYI A;  3DBR B;  2UXN A;  4YEJ A;  2YUS A;  4BH9 A;  2ME6 A;  4Y7N J;  2M30 A;  4DIQ A;  3G1L A;  3LQR A;  2V26 A;  3L00 A;  2XB0 X;  1X1B A;  5TGT A;  2ESN A;  1BW6 A;  2Q8K A;  2VT2 A;  4ZTF A;  4CCJ A;  3AG2 H;  3L09 A;  3OIP A;  5LLQ A;  4RM2 A;  1GVJ A;  1OMI A;  4E7H A;  1HDD C;  3O8G A;  3P9C A;  1ON1 A;  5ED4 A;  2IA1 A;  3RZO J;  4EQQ A;  3CZ6 A;  3VYU B;  3ECO A;  3CCQ I;  2VE8 A;  1P4X A;  4F3Q A;  4IHS A;  3QQA A;  3ABT A;  3CLO A;  2FOW A;  4CYC B;  5J3L A;  4O6J A;  5C3E J;  4QTR A;  2CS3 A;  3REO A;  2L0K A;  4DNC A;  1VQ8 I;  5EJC A;  1S5L C;  4XRM A;  4A3C J;  1A35 A;  3BCA A;  1KYW A;  3VEP A;  3J7Y J;  5FKN A;  3JRH A;  5J4Y A;  1LEA A;  4PSW A;  2PJP A;  1GVD A;  3RQ4 A;  2ZME C;  2WAQ N;  3OIO A;  4LG0 B;  1ZRE A;  5ICE A;  2H09 A;  2OTL I;  4D0P A;  1V5E A;  5KAI C;  5HVQ C;  5CQG A;  2ECB A;  4A3J J;  4KT5 C;  2XKO A;  2DXI A;  3V8K A;  4OIN F;  1HA8 A;  1CF7 A;  1QHG A;  5A2Q K;  1X4O A;  2I8D A;  2W4S A;  3M07 A;  4DZJ A;  1JT6 A;  5J8C A;  1TW2 A;  2H1L A;  4B3X A;  3MMY B;  2EQR A;  3KP6 A;  2IBD A;  1Y0U A;  3V4G A;  1K6O A;  1M1E B;  1LFP A;  1ZK8 A;  2XV4 S;  2DAO A;  1BJA A;  3QYB A;  2X6O A;  4OOI A;  2ELH A;  2V1U A;  3KP3 A;  3S17 J;  2R5Z B;  3DPT A;  1IV8 A;  5E8I A;  2G0E A;  1Z0X A;  2EV5 A;  2WWY A;  4I6Z A;  4BS9 A;  3F8N A;  3MN2 A;  3CCV I;  3FM5 A;  4DYC A;  2CMP A;  2KLO A;  3WTZ A;  4OMY A;  1YW8 A;  2R7D A;  3TW7 A;  4B43 A;  1WI3 A;  5D5W B;  2DI3 A;  3HB9 A;  4MO7 A;  4LG0 A;  3JTG A;  5JHF A;  2QKM B;  2K5C A;  4HA8 A;  4II3 A;  5FKK A;  4JK1 X;  3HIF A;  4LG3 A;  1V5F A;  2BY1 A;  1MMD A;  4NC6 A;  1IN6 A;  2X1E A;  3IWZ A;  4AID A;  2NNY A;  4E7L A;  1JTX A;  3I4P A;  4AUX A;  2V7F A;  3LA2 A;  2HS5 A;  2E1M C;  4HPQ A;  2ELK A;  4OIQ F;  1IJW C;  3HKZ A;  3KPH A;  3DPL C;  2BBY A;  3TBI A;  3MEX A;  2EPF A;  4LD5 A;  4ZJZ A;  2R7V A;  3WG7 H;  3I0T A;  1Z6T A;  3OIQ A;  3A4C A;  1F4K A;  2L9S A;  2A5W A;  2G9W A;  4XN3 A;  2DA1 A;  2ME0 A;  2RKH A;  2V79 A;  3IL2 A;  4QLC U;  2Y0M A;  4N9I A;  2XGE A;  4M3B A;  4B48 A;  4G7O F;  2JSP A;  1FY7 A;  1T08 B;  3OOP A;  1I6X A;  3OV8 A;  2PQ8 A;  3W2V A;  3MKW B;  4IKF A;  3ERE D;  4KIF A;  1YJ9 I;  2LVS A;  2H8R A;  2WAE A;  3GW2 A;  2OZ6 A;  5IP9 J;  3K70 C;  4RGX A;  4LGW A;  2QQB A;  3QP5 A;  2LOO A;  3IV5 A;  5BQT A;  4JX4 A;  4M72 A;  3JRG A;  5LRR A;  4MEX F;  2OBP A;  2R7W A;  2DYS H;  4NBQ A;  2XKP A;  4A12 A;  1VF9 A;  1W1W E;  4F91 B;  1HST A;  4HST A;  2DA2 A;  3JSP A;  4BAC A;  4RMN A;  2R7T A;  2F5C A;  3QPL A;  4FT8 A;  5FFX A;  3CJQ B;  1VQ7 I;  4I09 A;  2MD0 A;  2NVX J;  2JRM A;  3I5U A;  4NB5 A;  1Y39 A;  1VQ5 I;  2TDX A;  2P7C B;  3FXL A;  4ZYA A;  3S3M A;  2YR2 A;  5K7Z A;  2WA0 A;  2GOX B;  2JVG A;  4HX8 A;  2JTV A;  2AHQ A;  5CYV A;  4HX4 A;  1LVA A;  1YW9 A;  2DA3 A;  1DGW Y;  2DO7 A;  4DBQ A;  2QBY B;  1ZQ3 P;  2Y9Z A;  5IP7 J;  2BY2 A;  3BG9 A;  5A2Q Z;  3PIP F;  2R4G A;  1ITY A;  1R23 A;  2X6W A;  1AOY A;  1BBY A;  2LKS A;  4GCV A;  2XPW A;  1Z1D A;  4WXH A;  4OU0 A;  3WU1 B;  1VQN I;  1J7K A;  3HOS A;  1VQ9 I;  2DOD A;  2G7H A;  4BQQ A;  1HKS A;  4M73 A;  3GME A;  1S7O A;  1XMX A;  1OLT A;  2QSF X;  1SD6 A;  2FJ1 A;  4Y4R A;  4ESJ A;  3PSI A;  4LJZ F;  4Y17 A;  3F3X A;  1X2M A;  1ZRF A;  2L7Z A;  4D9J A;  1YX5 A;  2X9D A;  1B59 A;  5D4S A;  2NXN B;  4A3M J;  1MMN A;  4XRS G;  4LIV A;  2GIZ A;  3Q9V A;  5IY5 H;  2XF7 A;  3F23 A;  3K4C A;  2VBW A;  3NQO A;  4KMU X;  1Z67 A;  1LNW A;  1S3J A;  1VQK I;  3Q0V A;  5FLX K;  1CGP A;  1OKR A;  3K4N A;  1ETQ A;  3EET A;  1QHH D;  2KJB A;  2EWN A;  4GGG A;  2AXT C;  4IF4 A;  2HKO A;  4M9Z A;  1ZGJ A;  2FNP A;  2QLZ A;  1RIO H;  1C0W A;  4GDF A;  1MJA A;  3C3W A;  4I2O A;  1I1G A;  4XSX F;  3GFJ A;  2GZW A;  1GXQ A;  1U9O A;  3ABM H;  1BA5 A;  3S2H J;  3S15 J;  1Z77 A;  1QBJ A;  4HDV A;  1RNL A;  3R60 A;  3LWF A;  4LLN A;  2NS0 A;  1E2X A;  2CQN A;  1I6H J;  2IJL A;  3ZMZ A;  1SFU A;  2M4G A;  2XC7 A;  4IHW A;  1FEX A;  1DPR A;  4CCO A;  1OCP A;  2MYS A;  3WU2 C;  5DCM B;  1J9I A;  5JFR A;  2J5P A;  1QZZ A;  3CF2 A;  1JKR C;  1WWX A;  1R1V A;  2HYG D;  2ZJP F;  1RET A;  3ABK H;  1JHH A;  1SD5 A;  2WB1 N;  3GFI A;  2RQP A;  3NAU A;  3GZ6 A;  2RDP A;  2IW5 A;  2UUZ A;  2JK3 A;  3DEU A;  2O03 A;  1AKH B;  2LKP A;  4U7B A;  3ZMV A;  4M9X A;  2M7B A;  1W5S A;  1WSU A;  2DPU A;  2E36 A;  1S7E A;  3TQN A;  1HKQ A;  2BHZ A;  4BHB A;  4HV5 A;  4HG2 A;  1KU9 A;  2QSG X;  2VKE A;  3CO7 C;  1MKM A;  3BPX A;  5C4J J;  5GP9 A;  1I39 A;  4EVI A;  2H6C A;  1KQ9 A;  5B66 C;  9ANT A;  2CQX A;  4E7S A;  4A3K J;  3D5S C;  2DJI A;  3Q3S A;  2PJR B;  3V8L A;  1ZHF A;  4A5N A;  2Y0S A;  4HV6 A;  5HS8 A;  2LD5 A;  2QEX I;  3L2Q A;  4G9Y A;  5FRO A;  1U8R A;  5ILS A;  3M4O J;  1S7A A;  2FE3 A;  2EZI A;  3HSF A;  5DV5 A;  2FML A;  4B4C A;  4UUS B;  2BOL A;  2H6B A;  3KYL A;  4P5O A;  1Q1H A;  3MCZ A;  2EIN H;  2HOT A;  3I4M J;  3MKL A;  2EBI A;  3RPU D;  4BJT A;  3BP8 A;  2DCE A;  2PG4 A;  3G2B A;  2XAG A;  2L54 A;  2XF5 A;  4M3F A;  4UUV A;  3QOD A;  2ZSI B;  2XRN A;  2Q1Z B;  2XSJ C;  4UUT A;  2MH9 A;  3LSG A;  2K9N A;  4OIP F;  1I27 A;  1VTN C;  2HR3 A;  4WXD A;  5KAF C;  4YFX F;  4XLH A;  1PP7 U;  4M3D A;  2VQH A;  3BR2 A;  2Y9Y A;  3ZMS A;  4BUP A;  5CLS A;  2W7N A;  3LSK A;  1T95 A;  1QPM A;  2M3A A;  2KQR A;  2W82 A;  2YPR A;  3A01 B;  1X58 A;  5E3O A;  2HQA A;  2UXX A;  4HEA 2;  2R7X A;  3W6J B;  3BPV A;  1IN7 A;  1TTY A;  3BRO A;  1VZ0 A;  1OCO H;  5LHH A;  2M7A A;  2FOK A;  2MG4 A;  4Y3O A;  3LSM A;  2W24 A;  1OCZ H;  4RDU A;  1IN4 A;  1P92 A;  3MZH A;  1O3T A;  2PJR A;  2KDZ A;  1W36 D;  2AXL A;  2P6S A;  1EV7 A;  4M74 A;  2XSD C;  2IGK A;  3OMY A;  3HGY A;  2W85 A;  3MKZ A;  4UUS A;  2XAU A;  3OL3 A;  3TL4 X;  3KLN A;  3OYM A;  4A3G J;  4AD9 A;  1YIJ I;  4IHY A;  4BNC A;  2DK5 A;  4OWR B;  3PM1 A;  2EB7 A;  1XG1 A;  4S0H B;  3H92 A;  1NTC A;  2VUM J;  4KIS A;  3Q9S A;  5FLX Z;  4JQF A;  4KIC A;  2A68 F;  2GAU A;  3DQV C;  2XRL A;  2VB6 A;  1BC8 C;  2ZME B;  3DKW A;  2A3S A;  2LFB A;  1XS9 A;  1LB2 A;  1W7P B;  1WFX A;  4FCY A;  2NRA C;  1GV5 A;  4CZC A;  1ZG1 A;  4I98 B;  1ZGW A;  2QF7 A;  4J00 A;  5BPI A;  3X2Q H;  3ULQ B;  3A01 A;  4XL9 A;  4DBR A;  1VQO I;  2GXB A;  3FXO A;  2EZK A;  2L2O A;  2QQA A;  2VBZ A;  3WGH A;  4L5E A;  1KZH A;  4NUB A;  1J59 A;  4U88 A;  3OYC A;  1MMA A;  3M9A A;  2OC6 A;  3V42 A;  1UHM A;  4IXA A;  3O3K A;  4BY1 J;  3ZRG A;  4XSZ F;  2MW8 A;  1MZB A;  2R5Y B;  3DBL B;  2NVU B;  5FLM J;  2AS5 F;  1PVE A;  2KRC A;  2PMU A;  2EIM H;  2WY7 Q;  3B6A A;  3F6O A;  3AAF A;  1APL C;  3RKY A;  1JHF A;  5IOZ A;  3K70 D;  1J0R A;  2XAJ A;  1T2K A;  4HW0 A;  1XCB A;  3JSO A;  4UB8 C;  3RDI A;  3LFU A;  3OYD A;  4XRF A;  4ZTJ A;  1P4A A;  3DWL E;  1UHS A;  4HQE A;  3CES A;  2VPL A;  3HRT A;  2XPU A;  3C2G A;  4F55 A;  3BTJ A;  3OYB A;  3GFL A;  4G6Q A;  2DOE A;  1G59 A;  4KIT B;  3ZQI A;  1K7A A;  3S16 J;  3PO2 J;  5E1Z B;  4XQF A;  3F6V A;  2ZKZ A;  2ZME A;  3HC7 A;  2PFB A;  2E35 A;  2PMZ A;  3BR5 A;  5F64 A;  5K7F A;  1ZH5 A;  2HVR A;  4D7M A;  2OQG A;  2QWW A;  3I64 A;  3MAJ A;  1FTZ A;  4KMF A;  2GA2 A;  4RB3 C;  3RPU A;  4YG2 F;  1LUJ B;  4JOM A;  1B9N A;  3ECH A;  2DFI A;  3I4N J;  4PFP A;  3VOD A;  1QZE A;  1YO5 C;  3CCJ I;  5KNL A;  1FT9 A;  2EFO A;  2E1M B;  1SVO A;  2HU9 A;  2BXY A;  2VXD A;  4MGR A;  1O7L A;  4AM3 A;  1SAN A;  4BY7 J;  2OV7 A;  4YEL A;  2R5Y A;  1XDU A;  2LRE A;  1QGP A;  2FBH A;  3BQZ A;  2H94 A;  2JA8 J;  4Y15 A;  2HZT A;  1CQT A;  1AHD P;  1WJB A;  2BW3 A;  2DQL A;  5F0F A;  3ZMT A;  1ZR2 A;  1SC7 A;  2CW7 A;  1Z3X A;  2L7M P;  5EZG A;  4CSW A;  4Q5S F;  3E6D A;  4AIH A;  2DJN A;  2NS7 A;  1T33 A;  1MDM B;  4CO8 A;  3CCR I;  3HKZ N;  2D1V A;  1KQ0 A;  2F5V A;  1D1A A;  3OY9 A;  5GTH C;  1OR7 C;  1UFM A;  2HNH A;  3KYC B;  1JTY A;  2IGM A;  5F08 A;  1JUP A;  3H3Z A;  4HLY A;  2Y2Z A;  1I3A A;  1LVK A;  1O7F A;  3QU6 A;  4UV8 A;  3I3L A;  2A05 A;  4IJA A;  1EF4 A;  2QQ8 A;  2DPD A;  1HQC A;  2HWV A;  1MJB A;  1IG7 A;  3SQN A;  4BBS J;  2A61 A;  4HNU A;  3OS1 A;  4ESF A;  1HF0 A;  1I1S A;  3OYG A;  2H8W A;  4UY8 I;  2OZU A;  5J47 A;  2FBI A;  3DF8 A;  4A0Y A;  2VKD A;  2GXG A;  3CUQ C;  3JW4 A;  2VLA A;  2FQ3 A;  4O5V A;  4U0W A;  4JX6 A;  5D6F A;  4KFC A;  3R0A A;  3GO5 A;  2ZXJ A;  1N77 A;  3GTJ J;  1BL0 A;  2O8K A;  1MNE A;  3HL2 A;  3CTA A;  3HJE A;  1X3U A;  3CDH A;  2CWE A;  1U5T C;  2DDA A;  4PJL A;  1GT0 C;  3E5X A;  1XD7 A;  4E4H A;  1Z6R A;  3A2K A;  5D8K B;  1DUX C;  3OYI A;  1WCM J;  2XGD A;  2ZFU A;  4A0Z A;  2KP6 A;  4ON0 A;  3FXJ A;  3I71 A;  2FD5 A;  3WE2 A;  3LAP A;  1TZL A;  2M9H A;  2MLG A;  2ISZ A;  4ANJ A;  2E2H J;  3NAR A;  3C2B A;  2XAQ A;  4RAY A;  5M3M J;  1RC9 A;  3ISP A;  1A6Q A;  2AO9 A;  3BY6 A;  3CUO A;  1K61 A;  4TV7 A;  1KYZ A;  2V6C A;  3FMS A;  4HF2 A;  3PQJ A;  4D5C A;  5L3F A;  2ZNY A;  5TRD A;  2E19 A;  5J1Y A;  3S3N A;  1TLH B;  2CYY A;  2MD5 A;  2Z33 A;  1XMK A;  2Y31 A;  4KA4 A;  4N0B A;  1H0M A;  4ITV A;  3S1N J;  3DU6 A;  4IOC F;  3GTO J;  1RZ4 A;  4B1R A;  5KCM A;  4A3L J;  5DTD A;  3RYR A;  2X6X A;  4XKW A;  3U1D A;  4B09 A;  1G6N A;  2W00 A;  3TOB A;  5K5O A;  1E3P A;  3HG9 A;  5IOY A;  3C7J A;  1DP7 P;  3GTM J;  3R61 A;  3H36 A;  5E1X A;  1RKW A;  3SYT A;  4AYB N;  1CF7 B;  2LP0 A;  5J40 A;  3SDB A;  5LGN A;  3KYD B;  1IRF A;  3OL4 A;  3SJM A;  3TO6 A;  3FXM A;  2JWT A;  1WI9 A;  1ZLJ A;  2JQ7 A;  1AA7 A;  3LOC A;  1R49 A;  3WTV C;  4C30 A;  3WOD F;  4ZDL A;  1V54 H;  2EV6 A;  4PDK A;  3LA7 A;  4ENM A;  2QEN A;  2J5O A;  3KLO A;  2E5Z A;  2F48 A;  4KNY A;  4C3J J;  3BJO A;  3BCB A;  4UXN A;  1HKT A;  2MH2 A;  1LEB A;  3G4S I;  4XLA A;  2VIX A;  3G71 I;  1XDS A;  3E97 A;  4U0V A;  3WTS C;  2M5W A;  3HHG A;  3FKI J;  1IDZ A;  3DTE A;  4LIT A;  1ETV A;  3H9Q A;  3KP2 A;  3J81 Z;  2JSC A;  1HSJ A;  3FMQ A;  1ZTR A;  4RAF A;  4E70 A;  3CQZ J;  1Z91 A;  2RGV A;  4CCM A;  2EFW A;  3KET A;  3N4M A;  2HQ5 A;  1P7J A;  4ZZL A;  2E1N A;  3G3Z A;  4G12 A;  1DGR M;  2I10 A;  4NNJ A;  2DFH A;  3TOA A;  1Z7U A;  3J7A O;  2LDU A;  1QPI A;  1K6Y A;  5ERI A;  5ILV A;  1X1P A;  3DP7 A;  4ENK A;  2E60 A;  3AKZ A;  3ABU A;  5D5U B;  2Q2E A;  2E7W A;  3DKY A;  4FIS A;  4HF1 A;  1ZAR A;  3V8J A;  1EH7 A;  4B47 A;  4HNT A;  1R22 A;  4P9F A;  2P8T A;  5IPA A;  3LSI A;  1U78 A;  4PJN A;  2EIL H;  4F52 A;  3TGN A;  3WTW C;  2BV6 A;  5L3E A;  5GTI C;  2FXA A;  5EGO A;  4KDP A;  4PCQ A;  2ID3 A;  3K1P A;  2DMT A;  3CO6 C;  1UAA A;  1JKQ C;  1ULY A;  1XGS A;  5L3G A;  5FKM A;  1T56 A;  1JT0 A;  3ZMD A;  2YU3 A;  5LD2 C;  1PUE E;  4UVA A;  4DYR A;  2NVQ J;  1ZG5 A;  1W36 C;  3B73 A;  5AON A;  1TWF J;  2KIU A;  2KIM A;  3I58 A;  1Y56 A;  2KPM A;  3WE3 A;  4D5F A;  1ZG3 A;  2K3F A;  2X1D A;  4BQN A;  4ZYE A;  2X85 A;  2CQ7 A;  3LL7 A;  4RA2 A;  3IC7 A;  3K2A A;  2HTS A;  1MBH A;  3C2H A;  2KRH A;  3KP7 A;  5CVU A;  4CCN A;  5ILU A;  3DBH B;  1WJA A;  2HVQ A;  2OU2 A;  2DK8 A;  2L7F P;  1Z21 A;  4B8X A;  1OYI A;  3IH4 A;  3H3U A;  2O61 A;  1A5J A;  3OR2 C;  2Y75 A;  3L2W A;  1W4M A;  2WV1 A;  3ZN0 A;  5KVR A;  4KN7 X;  5FRM A;  4GO1 A;  3OSF A;  3BR1 A;  2BVL A;  3K2Z A;  1G2H A;  3E6C C;  1ONV A;  3GTL J;  2HOE A;  2KT0 A;  4S04 A;  4KYW A;  2VL8 A;  2VAS A;  4HQM A;  2KIF A;  4XOT A;  1XN7 A;  1GV2 A;  4HDU A;  3JRB A;  4GRI A;  4M6Y A;  2DN0 A;  4HRI A;  2QA4 I;  4A3I J;  2JA6 J;  2MC3 A;  2E7X A;  5H6R A;  2W1O A;  1RI7 A;  4FX4 A;  4KIG A;  3H5N A;  1R4N B;  1D0X A;  3SFI A;  3U21 A;  3FXK A;  3CMY A;  2IP2 A;  5IT9 K;  3E0J B;  3BZ6 A;  1KON A;  1W5C C;  1ZN2 A;  2QYO A;  2LK2 A;  3K6G A;  1YG2 A;  1U6G A;  4EGY A;  2CUF A;  4FE4 A;  1DDN A;  2OCC H;  3DV8 A;  4MTE A;  1XPX A;  1RKT A;  5CQE A;  2DT5 A;  1JKO C;  1H9T A;  4MHG A;  5DDG A;  3FMR A;  1X1A A;  4IQ4 A;  3ZN1 A;  3J7A Y;  2GA1 A;  4LIU A;  2O9L A;  2O0Y A;  2CQK A;  4XBF A;  4IZZ A;  2LC2 A;  2FSW A;  2WV0 A;  3DLA A;  3RTR A;  1NG6 A;  1Y8Q B;  2R7F A;  1FP2 A;  3PL8 A;  4CA0 A;  1JUS A;  5EF6 A;  4QSH A;  3A0B C;  1R00 A;  2X0L A;  3VPR A;  3IAS 2;  3I59 B;  4L9V A;  3H0G J;  3K1N A;  2PMH A;  3CCY A;  1FLI A;  1QNT A;  3BQY A;  1YJN I;  1R9T J;  3V7C A;  5F1R A;  3HTS B;  2XVC A;  1MH3 A;  3O8H A;  3HOX J;  2HI3 A;  2TRT A;  3KCC A;  4JYK A;  4ETS A;  5LEJ A;  2A6T A;  2Z3Y A;  2B63 J;  3L7W A;  1ZR4 A;  4L0Y B;  1JJ6 C;  3FM3 A;  4XKB A;  2V4J C;  3LQQ A;  3GEZ A;  2JA5 J;  3U9G A;  4I76 A;  3ZOB A;  4XR6 A;  4MLO A;  2X48 A;  4LK0 F;  5HNF A;  4B44 A;  4KIB A;  4PK4 A;  2ZXW H;  4M6X A;  4WCG A;  2XGX A;  3FXU A;  5FLV A;  2A6H F;  2ETH A;  4CYD A;  3GTQ J;  4M71 A;  1J5Y A;  5D8L B;  2P5L C;  2P4W A;  5BOX A;  2PMZ N;  6PAX A;  2H1K A;  3FHZ A;  2VON A;  3RJP A;  4DZP A;  4QIW N;  1D0Z A;  5E20 A;  2D2W A;  2STW A;  2R93 J;  4XOP A;  1JI8 A;  4BHP A;  3I59 A;  2K9Q A;  1MGT A;  5FGM A;  1YI2 I;  4L5J A;  4NC7 A;  2OPT A;  4CHU A;  5HLI A;  3IH2 A;  3E5U A;  1ETW A;  4CCK A;  2O5R A;  1Y1W J;  1R1U A;  4XKC A;  4PJJ A;  2ZJR F;  1RES A;  2ZJ2 A;  2RVC A;  3RKW A;  2JT1 A;  1OQY A;  3COA C;  3CCU I;  2EFN A;  4L18 B;  4A3B J;  1N75 A;  5H6Q A;  1FPQ A;  3DTK A;  3I53 A;  2LY9 A;  3M8F A;  2DFF A;  1BR1 A;  2IGO A;  2QCO A;  3QPS A;  1FTT A;  1STZ A;  1TBX A;  3DEE A;  4MQ9 F;  1MIJ A;  4C2T A;  4MIM A;  3WU0 A;  2M45 A;  2FA5 A;  2HYJ A;  2EFQ A;  1LJ9 A;  3W2A A;  3HOY J;  2L3D A;  1OCR H;  4BE1 A;  2CW0 F;  1SFX A;  2MLK A;  4HZF A;  4A69 C;  3GUD A;  4A3F J;  1PP8 F;  3K10 A;  5E79 C;  4ZH4 F;  1R4M B;  2CSO A;  3SFZ A;  3CUQ B;  3BR6 A;  2KZG A;  3IH3 A;  2L9N A;  3QRF F;  1BC7 C;  2DA6 A;  2FBK A;  3GLX A;  2PEX A;  4U0Y A;  3CJT B;  1FIA A;  2ICW G;  3KEO A;  2YU9 J;  2WAQ A;  1TL8 A;  3IKT A;  4P55 A;  5ICG A;  1PDN C;  3DKX A;  1U5T B;  1G8X A;  1OYY A;  1I50 J;  5IT9 Z;  1WJ5 A;  4DQ2 A;  2OCE A;  2IS4 A;  2VKH A;  4CIC A;  3HSR A;  4PFO A;  2WTE A;  1TWG J;  2QM3 A;  3CCM I;  2LR8 A;  3LSP A;  4C9Y A;  1XCV A;  4E7Z A;  4F7Z A;  4Y33 A;  1OR7 A;  3HRM A;  2F5D A;  2VBY A;  4BJ6 C;  2R0Q C;  4G6T B;  4V2G A;  3K7A J;  2JPB A;  2WY8 Q;  1YRN A;  1XSV A;  3ZQH A;  4RLQ A;  2R3S A;  3O2P E;  3VSL A;  1SAX A;  3CCS I;  3OYF A;  1USS A;  4AIJ A;  2K9L A;  5B3S H;  1RRJ A;  1UHW A;  2HQR A;  2HXI A;  3CUQ A;  2L9R A;  4V2F A;  5H2F C;  1ZLK A;  1G3S A;  1AWC A;  2BXZ A;  2NS8 A;  2RC4 A;  2MBF A;  5JVG F;  1FOW A;  4RM3 A;  2R7Q A;  2VJJ A;  2L4A A;  2PN6 A;  2F5E A;  1K79 A;  3C1D A;  2E1C A;  3JRA A;  1U0J A;  4IHX A;  1U5T A;  5CVJ A;  2XPV A;  3RZD J;  2VQG A;  2PX9 A;  1WJC A;  1R1T A;  4RLF A;  4YFK F;  3OYK A;  4K2E A;  4ENN A;  4HNV A;  3CD6 I;  1IC8 A;  2BY3 A;  1UCR A;  3H3V K;  2RQQ A;  4WK8 F;  4HAM A;  5J4V A;  1YYV A;  4A2U A;  5HOO A;  2PLY A;  3IRQ A;  4OIO F;  1Y1V J;  1T6S A;  1ENH A;  2P0W A;  3K4K A;  4XMY A;  1D0Y A;  5J1R A;  4R79 A;  4YIF A;  4R1H A;  2K7L A;  3IAM 2;  2HPM A;  5B1A H;  1R71 A;  1TC3 C;  2IS1 A;  2M87 A;  1YJW I;  2EA2 A;  3TP0 A;  1HW1 A;  1ZKG A;  2NOJ B;  3RI4 A;  4G8X A;  1RUN A;  1EKE A;  1BOB A;  1DQU A;  3W6V A;  4IOA F;  3HOV J;  3K9T A;  1WPK A;  1TP4 A;  2FUG 2;  4XLF A;  4I7H A;  1UJ8 A;  3K4J A;  3I55 I;  3FDY A;  2HEO A;  2PBI A;  3N05 A;  3LAJ A;  1ETK A;  2HGC A;  2VC1 A;  4IRG A;  3WHB A;  5FJ8 J;  1YLF A;  4E7J A;  5GAH J;  1T8I A;  3ASN H;  3BZC A;  3TDU C;  3M1E A;  3HDD A;  1FMV A;  1FOY A;  3M3Y J;  1V5G A;  2CUZ A;  3PO3 J;  3HSE A;  4QPO A;  3S3O A;  2BVM A;  1VQM I;  1U9N A;  3OS2 A;  2JMW A;  4CZZ A;  4KJZ A;  3SEQ A;  4XN0 A;  2NNN A;  3EUK L;  4CH7 A;  1AU7 A;  3ZQG A;  4EJO A;  1BI1 A;  1F36 A;  2XDV A;  4GYG A;  2IRF G;  4Z2Y A;  3MZY A;  2CUE A;  4LB6 B;  1MH4 A;  5CJ9 A;  4ENJ A;  2B9S A;  4RBO A;  4C3I J;  5M3F J;  1H88 C;  5ICC A;  2YS9 A;  4IL6 C;  2LKX A;  1O3S A;  3PSF A;  3M8E A;  2DA4 A;  3PNV A;  3W3C A;  1JUM A;  5HS7 A;  4W97 A;  3KEY A;  3GZN B;  5F04 A;  3FBI B;  3EUH C;  1BIA A;  3JRF A;  4LB5 A;  2K4B A;  2BW3 B;  4BEH B;  5HDG A;  3V7R A;  3FIS A;  4N4O B;  5HLT A;  5K1Y A;  3BTC A;  1IRZ A;  3T0Y A;  5FO5 A;  4IHV A;  2HTJ A;  1BW5 A;  4XLP F;  1UZC A;  3EUA A;  2VN2 A;  3E1S A;  2BY0 A;  3FWE A;  2WBM A;  5DEQ A;  5LGT A;  4A0X A;  1TQM A;  2XAF A;  3QYE A;  2FEZ A;  4ZYD A;  3GX4 X;  3D1N I;  5E1W A;  2W57 A;  1VI0 A;  3SEZ A;  1VFC A;  4RS8 A;  1FP1 D;  1YIO A;  2ID6 A;  3OYJ A;  2QKL B;  2FNA A;  5JLX A;  1QZY A;  1X3Z B;  2LBF B;  3JTH A;  3ZGK A;  1JJ8 C;  5EEG A;  2K3P A;  1R58 A;  2IS2 A;  4BKX A;  4AVZ A;  1HOM A;  3LSH A;  4QWQ A;  2OQR A;  2UWM A;  1KU3 A;  3ERM A;  4I0A A;  2ZB9 A;  1ETO A;  2DOF A;  3QAH A;  4U87 A;  2P5V A;  5EG0 A;  1XC5 A;  3ZXS A;  4EEF G;  1FIP A;  2ZCW A;  4AVP A;  3L9F A;  3J7Z I;  5L3B A;  3OSG A;  1P2F A;  2XUB A;  3BJ6 A;  4UB6 C;  5BS6 A;  3H9G A;  1EH6 A;  2KMU A;  2KL4 A;  5BMZ A;  2CO5 A;  3KE2 A;  2JPC A;  4BEH A;  4Y52 J;  4XLC A;  1YIT I;  5K5Q A;  4C2U A;  2L01 A;  2XAS A;  3T8R A;  3J81 K;  3B02 A;  4RAZ A;  4KT6 A;  1XGN A;  2L7K A;  1S6L A;  3F8F A;  4UV9 A;  5E3M A;  3DLL F;  1OCC H;  1WJD A;  3BTL A;  3E7L A;  3TKY A;  4NHJ A;  3GVA A;  2RAE A;  1R5G A;  1N25 A;  3BG7 A;  2ZO4 A;  2GOM A;  2NOG A;  1T38 A;  3S32 A;  1OPC A;  2E2J J;  1F9N A;  4XOR A;  3IKV A;  4M3E A;  1SFK A;  1WKM A;  1U8B A;  1O57 A;  2LBF A;  2HPI A;  2FF4 A;  1GDT A;  4EMS A;  1WH7 A;  4YIR X;  1ZEL A;  2L5Q A;  1TT5 B;  3BZK A;  3RIR A;  1I5Z A;  5BNG A;  4RB2 C;  1O4X A;  2HXO A;  2DW4 A;  4A5M A;  2ELJ A;  3GYH X;  3L1P A;  4C3H J;  1S9H A;  1GLN A;  1X4P A;  5C4X J;  2EA4 A;  3K0L A;  4A93 J;  4YFN F;  1R5I D;  2JVH A;  5AIQ A;  5F1J A;  4RB1 A;  4MTD A;  1HCR A;  1GHC A;  5HS9 A;  3N97 A;  2CGP A;  3DTI A;  4I99 C;  2WB1 A;  4PSX A;  3G6E I;  5LGU A;  1QU3 A;  1BN5 A;  2QGU A;  2MGQ A;  1MBF A;  3HPG A;  4FTH A;  1SMT A;  5HLG A;  2DMU A;  4ESB A;  1IUY A;  2JA2 A;  4OAY A;  5KHD A;  4NC8 A;  3L2C A;  4AWX B;  1BJZ A;  2JN6 A;  2R7O A;  3E6B A;  3E5Q A;  2F5F A;  4X0G A;  1SMY F;  2HZD A;  2OD5 A;  3M8J A;  5L3D A;  1IXS B;  3HRS A;  3IWF A;  2VT3 A;  3BTI A;  4HBL A;  4GXO A;  1D5Y A;  1EA3 A;  4L9J A;  2EJR A;  1TNT A;  4AIK A;  4G94 A;  1T0F A;  3BJA A;  1JGG A;  2G7U A;  3BG3 A;  2F6C A;  2OF7 A;  2EFP A;  4ZYH A;  1BR2 A;  1E3O C;  2XF6 A;  3CDI A;  4C2M J;  4J19 A;  1RPW A;  1V3F A;  3JAM K;  1PJR A;  2VQC A;  3ZP5 A;  3RSN A;  2FMY A;  3ZQC A;  2JA7 J;  2LF8 A;  2W84 A;  3WHC A;  5KK1 A;  1GUU A;  2B0L A;  2X1C A;  5DUK A;  2Z5U A;  3MVP A;  2CFO A;  2V6E A;  5DD8 A;  3NRV A;  3QOE A;  3O6B B;  3GLL A;  3VB2 A;  4FAS D;  3WGI A;  2HOS A;  1BI0 A;  3ZQQ A;  2Z16 A;  4E6K G;  1P7I A;  2LMD A;  1X1D A;  2UZK A;  1D5V A;  4XRS A;  2O7O A;  3WTY C;  3WTX C;  2WAD A;  3RKX A;  4MNU A;  3QOP A;  1TNS A;  2B7E A;  2Q0O A;  4RGR A;  5H20 A;  5FKO A;  2WAF A;  5FD5 A;  5J6X A;  5L3C A;  1N78 A;  3KEQ A;  2XB5 A;  3CP2 A;  1TWC J;  4BQO A;  1HXD A;  4LLL A;  3A02 A;  1B1B A;  1XB4 A;  2Y30 A;  4ZDP A;  2BE5 F;  1LFU P;  1FBS A;  2E71 A;  2Q2E B;  3TMO A;  4DYQ A;  2XHK A;  1ORK A;  4BE0 A;  1FWZ A;  3T8T A;  5BPD A;  1DPU A;  1Y0N A;  5E8G A;  2V9K A;  2GM4 A;  3SZP A;  4DGW B;  5E18 F;  3R4K A;  2VJ4 A;  1A31 A;  1VQL I;  3H5R A;  2BYV E;  1Z05 A;  2R7R A;  3LFK A;  2EIK H;  4L9T A;  2LG4 A;  4UNO A;  5EGO B;  2DOA A;  4BHC A;  1FOX A;  4Y13 A;  5M5X J;  3IRR A;  2DFE A;  2CQQ A;  4M3G A;  1QVU A;  1Z9C A;  3BR3 A;  3T1B A;  1X2N A;  3HOT A;  2HOA A;  3KZY A;  5DM7 F;  4I01 A;  3HOW J;  1HW5 A;  3ZMU A;  3CP8 A;  3NWS A;  3M1C A;  3KP4 A;  4PZJ A;  2STT A;  3Q0U A;  4WXC A;  1YHQ I;  2P81 A;  1I3Q J;  2CV1 A;  5HDK A;  3AFH A;  2MA3 A;  3WTT C;  1PUF B;  1ZRC A;  4HYE A;  2JRT A;  2ADU A;  2DTZ A;  3PQK A;  1T98 A;  1XTA A;  5EEA A;  2R7S A;  3CJS B;  2M4K A;  3SXY A;  5M5Y J;  4J01 A;  1WIB A;  2RNG A;  1IRG A;  4BDY A;  4I02 A;  2L9V A;  2LLK A;  4PGG A;  1IV6 A;  2F4O B;  4PJ0 C;  3OS0 A;  5JHU A;  4BE2 A;  1XSX A;  2C6Y A;  1DU0 A;  1B72 A;  1QRY A;  2KIS A;  2RN7 A;  2ZSH B;  1E17 A;  4HF0 A;  2DMQ A;  2VKV A;  3D5R C;  3PNT A;  3ABL H;  1G3Y A;  5HLH A; 
#chains in the Genus database with same CATH homology
 1FOW A;  2ZJQ F;  1YJ9 I;  2FOW A;  1VQ8 I;  3EGV B;  1VQP I;  3J7Y J;  5GAD J;  1YI2 I;  3CD6 I;  3CCR I;  3CME I;  1YIJ I;  2JQ7 A;  4V19 K;  5GAG J;  2ZJR F;  2OTL I;  3CCL I;  3CCU I;  1ACI A;  3J7Z I;  2QA4 I;  3I56 I;  2ZJP F;  3CJQ B;  1VQ7 I;  1YJW I;  5GAE J;  2H8W A;  4UY8 I;  1VQ4 I;  1YIT I;  1Y39 A;  1VQ5 I;  4IOA F;  3G4S I;  1VQO I;  3PIO F;  3G71 I;  2E34 A;  3CMA I;  5DM6 F;  3DLL F;  2E36 A;  3I55 I;  3CC7 I;  5GAH J;  1VQL I;  1HC8 A;  3CCV I;  1FOY A;  3CJT B;  1FOX A;  1S72 I;  3PIP F;  1VQM I;  2QEX I;  5DM7 F;  3CC4 I;  4IO9 F;  1VQN I;  2OTJ I;  1VQ9 I;  3CC2 I;  1YJN I;  1YHQ I;  3CF5 F;  3CCM I;  3G6E I;  2E35 A;  1QA6 A;  3CCE I;  3CJR B;  2NXN B;  3CJS B;  4IOC F;  1WIB A;  3CCJ I;  3CCS I;  1VQK I;  2K3F A;  1VQ6 I;  3CCQ I;  1MMS A;  5JVG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...