4V1Av

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
YRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERRXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4v1av00
3J7Yq 4V1Av
chains in the Genus database with same CATH superfamily
5FVLA 1MIYA 3QK6A 4HWIB 4OHFA 1IJ5A 3IF8B 3WAJA 4HFIA 1OEDB 4WW0A 4YY3T 2A3DA 5L3GB 4YHJA 1UX5A 2LOSA 3N9OA 2NW9A 3PUZF 2HPLA 1BR2A 3O4XE 2HN2A 3RRCA 3ONXA 4HE8A 4EYYR 1ZV4X 4QX8B 4Z8XA 2ZM8A 4U31A 2K24A 4B3ST 2MYSA 3QUJA 1XMQT 3OBVE 5TAOA 4WBNE 4ZHQE 2CCQA 2WAUA 4DV6T 3Q9DA 4G2AA 1MMNA 2UU9T 1H7CA 2HH7A 5LB7B 3JAEA 1GQEA 3HI2A 4NXMT 3FZLB 1Y01A 4L9IA 2HHHT 2OLTA 4AQYT 3EDUA 3UQ7A 2X67A 4YSXA 2XM1A 1QLBA 3AECA 3Q5WA 2J4GA 3UUMA 3N5LA 2CPTA 2DI4A 2LJLA 3AE4A 2YINA 4TN7B 2CBJA 4DR4T 3RYHE 3C51A 4JI8T 5EZYE 2WS3A 4E7SA 1YKHB 4DIDB 2J47A 2YDRA 5FKYA 5HXSA 3AE6A 3PUXF 5HAXA 2WWUA 4H9PC 4UR9A 2JQQA 2WWVA 3Q5XA 2A9UA 1Z0PA 2CEAA 4ASKA 2D0UA 4QXHB 4CN1A 2V7MA 4EZ4A 5CFBA 3P7IA 2V7LA 4QH1A 5LYJE 4X66T 4CI3B 4HFEA 2FJAA 3E22E 3RF1A 3DP7A 2YEVC 2I0MA 5AQHB 3PUWF 5HCMA 4P1NA 3N9MA 3ESLA 5CA1E 1ZP0A 2PBIA 2ZLYA 3N9LA 4EV6A 3PJAJ 3IA3A 4QH5A 1M62A 4EB6E 2DCFA 5HXRA 2YK0A 3LJCA 4H9NC 2VASA 5IUXA 3HKBE 4MLKA 4A98A 4I43B 3X1DA 4AKLA 2ODVA 1S94A 3SS1A 2MOZA 2IUBA 2E5LT 4GYSA 4JI4T 3I9YA 1HX8A 4JI0T 3ZYKA 3WAKA 2LOPA 4COFA 3RYFE 1IAPA 3EDVA 2CXFA 4X1YE 3C64A 4LFAT 2BS2A 5LG3A 1M7KA 3HR0A 3ZYLA 3LK42 3ZCIA 4ADZA 3KV6A 4IDPA 3SRZA 2VKJA 4PW8A 2A72A 4AQGA 2BDEA 3QOFA 3ZSSA 1N34T 5CJ5A 5FY0A 4DMVA 2JRKA 2NTXA 5FL0A 3DJBA 3UU4A 3OKQA 1FMVA 2JJ9A 1XNRT 3MACA 4IE7A 3ZMVB 4YJ3E 4X1KE 5LBQB 4YJ2E 4OYJA 4HWDA 1KFYA 2VURA 5L3DB 3UU6A 4ZI2C 1WRDA 5CA0E 2XQYA 4KHZF 1ZHCA 2OA5A 4MFRA 4DO0A 2CWYA 5JDLA 3OTOT 4U7IA 4PK4A 3BQKA 3VRBA 2CHOA 4TNWA 4IIJE 3ZT6A 2LSKA 2UXXB 1SE7A 4NUUA 2VWAA 4AKHA 4ZI3D 3FZKB 3L39A 4C90A 4B3RT 2W67A 2IHR1 4O2BE 5L47A 4K0UA 1KNZA 3F2EA 1T8BA 4I0UA 4JI1T 2MPKA 3P4QA 3AB3B 4DR2T 3KBUA 4NXNT 4A5XA 4UF0A 1N36T 2XUEA 1US7B 2LSIA 2BVLA 3DTOA 2H89A 4AIUA 2XQ9A 1N33T 4MHCA 2XZEA 2BG9C 1YW0A 4LMKA 2X9WA 5HXEA 3JC6C 4ILCA 2ZM6T 4HWHA 3AAAB 2UXBT 4DV7T 3AA0B 4WZXA 1UX4A 5HEUA 3WI3A 3NRYA 3L3PA 5IWAT 4LF4T 2IAKA 3T1HT 1Z8UA 3RYCE 5LGNB 5AQMB 5AQLB 3NKZA 4EOZB 3UTKA 3M65A 5LMUT 1WFDA 3P4PA 3PU8A 2HN1A 4DR1T 2WY2A 3AXJA 1HNZT 2KWHA 3PUYF 1LVFA 3UT5E 2MBGA 1SUMB 3ONJA 3F31A 3J7Yq 4B3TT 3RPUA 3C4XA 3PJAA 4V1Av 2YOEA 1MMGA 2W66A 4JI6T 3CX7B 2X66A 4AI6A 5JRCB 1X79A 2DNXA 4JI3T 3TLVA 3I1AA 4IGUA 3LK2B 3KV9A 4TWHA 2CXLA 3K1SA 3EAMA 4HFCA 3P50A 4XBFB 4CZZB 5KXJA 2FJEA 5JDFA 3ANWB 4KX6A 4DNDA 5LMNT 5HYAA 4U72A 2XQ3A 2QA7A 5DJQC 2SPCA 2K9AA 3SFDA 4FJOA 2KZ7B 5DQWA 5E0OA 3ZYMA 3LSVA 1HCIA 3QB5K 4AQFA 4ZI2D 2YDQA 2VL8A 5J0ZA 5EK3A 4HWCA 2WDQA 4XAXB 3UFGA 2BG9E 2V6YA 3MXZA 4JV5T 4H9RC 2AE9A 1R8IA 3UU8A 4HKAA 3ETUA 4I50E 4KI0F 2XQ7A 3GN5B 2LRKA 2H88A 2VKHA 1Y64B 2K5BB 4JEHB 3ZEFB 2UUCT 4IE5A 3O1JA 3AE5A 1S35A 4A56A 3AVSA 5ABFA 2QRXA 2BKNA 4JLEA 2IW5B 4DV1T 3EHZA 4ZI7E 4UEMA 5IYZE 5JTGA 3GWHA 5LHGB 2CA5A 2MTQA 3LG7A 5AQJB 4TNVA 4LMJA 2BG9B 3CQXC 2K48A 4DV2T 5L3EB 5C2TA 4IE6A 1D0ZA 2FJBA 5BMVE 2V6XA 5AQFB 4ZOLE 1HNXT 1LVKA 1FMWA 1G73A 1D1BA 3PV0F 1IBKT 3ZSTA 5JQGE 2WU5A 1T98A 5CB4E 4ERRA 4TWDA 5F5WA 1ZOYA 2E8IA 2NP9A 2PJQA 4TZ4C 5AQKB 4MBQA 4AISA 2XSAA 1UUSA 2XAGB 2WMOA 5J1GA 5J2TE 4GYRA 4YSZA 2V7IA 2EHOA 3ABVA 3CMLA 2XQ8A 2N9DA 5AQTB 2CRBA 3ZMTB 4F6RC 2BS4A 3P8CD 1QSDA 4ZS2A 4U7YA 4CXYA 4UVBB 3EABA 3CK6A 5L4EA 4DUZT 3K8PC 2DL1A 2V7JA 3UUNA 1BR1A 4IDNA 2W0GA 2X0YA 5JR9A 4F8HA 2XAHB 3R84B 2W00A 2B1EA 4EGWA 5FVKA 4TX5A 1FJGT 1HG5A 2UUAT 3LDQB 1XMOT 3AA7B 2H3RA 2BKOA 2H7VC 2VQET 2VKOA 3EVYA 2KMFA 3RLFF 3IBPA 3FB2A 2LHNA 4PJMA 2XPKA 2WP9A 1MNDA 4IE4A 2KSRA 2BKPA 3B57A 3MKDA 3LBXB 4HFDA 1J5ET 4WBOA 3CPZA 5JDHA 1D0XA 4JI7T 3RGLA 2V8SV 4AXPA 2RP4A 1OWAA 5L4HA 2VVSA 5C3JA 3ZMZB 1NENA 5AQUB 4Q25A 2C5JA 3RYIE 2LE8A 2XJ7A 4UXNB 2KINB 4CN6A 3N2KE 5F8PA 2QGSA 4NPPA 3CIRA 5HEJA 2NW8A 3OPCA 4X65T 2Y8DA 4H9SE 3A5XA 3A8YC 2XAQB 1JNRA 1SHZC 2N1GA 5DQVA 4JI2T 2ZM2A 3ZLIA 3GMIA 2IC6A 1WLXA 1HFAA 2Q9QA 4OK0A 1V9DA 4GKJT 2WM9A 4YTMA 5HXCA 2NWBA 4AKIA 1XDOA 3KVAA 3RIUA 4IT4A 4ZS3A 3AEDA 2CE7A 4DVDA 4YTNA 2I59A 5FL1A 2ACZA 3O1HA 3PUVF 5AQGB 2VB6A 2KLQA 4TUYE 4PAGA 2WB5A 3A7MA 3AE8A 5LOVE 2VVNA 1AJ3A 2WZIA 3N9QA 2NTYA 2V26A 2M6BA 3N9PA 3VU7H 3GA8A 1ZEEA 4X20E 4U33A 3ZT7A 4KBMB 4MALA 3AEEA 3AEGA 5LXTE 4NIQA 1FEWA 5HEHA 2JQHA 2LM9A 2X9YA 4U2YA 3OVUA 3FXDB 3P4RA 3J9X1 2WU2A 3T8OA 3H3MA 3SFEA 5AFUL 1MMAA 2CXDA 1E7PA 2LSGA 2KT9A 4HTEA 3H3AA 4TV9E 3AEAA 3MJXA 2E9XA 5ABGA 4PJLA 2YU2A 3PUSA 2XY8B 3FHNA 3SWHA 3KBTA 1WYBA 2X68A 1YQ4A 2V7KA 2LLYA 3AE3A 1YD8G 4X62T 1W9RA 1HG2A 3I0OA 4CN4A 5BR8T 2WZHA 3RX6A 5KDMC 2WSSV 2RA1A 3O1IA 3UUBA 4AQFC 4QXBB 2XQAA 3VKGA 4QX7B 2JQ9A 5AQVB 3ZJ2A 3ZCJA 5L3FB 4IDOA 4UIGA 4HFBA 5JRCA 2X51A 3RI5A 4GK5E 3SOLA 5AQRB 3U78A 1VCSA 1OXZA 4J2CA 3FZMB 3MA9A 4LF7T 1T7SA 4A97A 3CQGB 2LT3A 4IL4A 3RIFA 4UVCB 5L2LA 3PTRB 3K3OA 3V5UA 3L09A 4UF0B 4OYKA 4DUYT 4EIWA 2D9DA 4LF6T 3EI0A 2L8KA 3B5MA 3CWZB 5HXHA 4UVAB 4L0RA 3FZFB 2L3LA 4UELA 4CXWA 2RPAA 4DV3T 1HF8A 2WCAA 4CI2B 3UUXB 1N32T 4ZZCA 3GN5A 5LG4A 3P4SA 2A2FX 3OYZA 1UCUA 4KHPT 2XASB 2XTLA 4YXDA 2KWIB 4L5GA 2XAFB 3NWIA 2VQFT 4HGAA 4BA9A 5ABEA 5FXZA 1T72A 2GK9A 3AE7A 3UULA 5M4YA 4KMCA 1EZ3A 2UXDT 1IBLT 4P0BA 1LRZA 3CX8B 4YLHA 2EHOC 3N2OA 1OEDA 3RQWA 4ILAA 2J1DG 2W2UA 4IDZA 2E5VA 3AXJB 4IE0A 1CHUA 1XZYA 3MK7C 4DV5T 2D5UA 2X9XA 3C4WA 1HS7A 2Z6EA 3C50A 5L3CB 2ODUA 4TWFA 2BVMA 3KDSE 1D0YA 4H9OC 2W4XA 2XQ5A 1BR4A 2M67A 2CWOA 5JR9C 3NZPA 4QHOA 4LMLA 4LFBT 3HKCE 5F3JA 5AQIB 1XNQT 1D1AA 4OFZA 4KP3C 5KMGP 1VCTA 3RH3A 2WBLA 2X0LB 2YU1A 3IHRA 3CX6B 2XSBA 4YTPA 3CVRA 1HNWT 1G8XA 1E2AA 4ILBA 5FYMA 4BJMA 3RRWA 3AEFA 3ZMSB 5IHYA 3ZT5A 5FMNA 4DBQA 1JNZA 3AE2A 3JC6D 5AQPB 4LF9T 3K3NA 4QH4A 3NZQA 2LKGA 3JCFA 4DR6T 4P0AA 1IZNB 3PDYA 2X0HA 3AEBA 2B76A 4O4HE 2V6YB 5J2UE 3KV4A 4PFPA 3Q2MA 4H63V 4E7ZA 4DMWA 4UV9B 1L0VA 1KNRA 2XQ6A 2JPFA 2LSYA 4OX9T 1FIOA 5LGUB 5FXWA 2DHRA 4ZI3C 2XQ4A 2QYWA 2YDSA 1YXRA 3ZKRA 4GOUA 5FNVE 4AKRB 2DLRA 4DR5T 3LBXA 4YSYA 4X64T 4LFCT 5CGMA 5ABFB 2Q9QC 3N2GE 3OJAA 1W09A 1UGOA 2Y6XA 3TLUA 2CM0A 4UV8B 5HWXA 3FZHB 3VR9A 1NEKA 3RIUC 3TLWA 3ETVA 5LA6E 4CXXA 5FY1A 5LHIB 4EXTA 3RKGA 3PU3A 3E08A 5LHHB 3KINB 2V5DA 3C4ZA 5C8YE 1J1JA 2D0TA 4BJNA 3RHWA 5LBMA 4WNKA 3AE9A 1W0AA 3KVBA 4ZXLA 4EZHA 4ZZBA 2BZBA 2JMHA 1O3XA 1MIWA 2K3WA 2EHOB 3OYXA 2KXPB 1MNEA 3UQ4A 2CBIA 2BBJA 3ZMUB 3VKHA 1J5WA 2EHOD 4CI1B 4YHHT 2FUPA 5FXXA 2C5KT 3ZC0A 3S4UA 2Y48B 4KUMB 2E9XC 1BR0A 2VKDA 2LKHA 1WR0A 1XWMA 5KX5E 4DV0T 3RKOA 4JYAT 2FJDA 3QB5A 2UUBT 3AE1A 5JR9B 5HEGA 5LCYA 2HPJA 4U3CA 2ZMAA 3TLTA 5EK4A 4HFHA 2CLYC 4EYUA 1KNPA 3G06A 4U2ZA 3B13A 1MIVA 1HR0T 3VHLA 4X1IE 4ZEYA 4Z91A 4O4JE 5ETWA 1U5PA 1NWMX 3Q5DA 2LSJA 4NUVA 2JIWA 3BQIA 3ZN1B 4G63A 4HWFA 5AQOB 4Z90A 4B6XA 3R6NA 5HEOA 3H37A 1QUUA 1UURA 3TKLB 3T1YT 1I94T 2UXNB 4LF5T 4LF8T 2M6IA 3NRXA 2VK9A 2E2AA 5JDQA 5JDNA 3BQLA 4K0KT 3FBLA 3RC3A 1WCRA 3IEEA 3I9WA 4M1PA 3AA1B 3KV5A 3N9NA 5HCJA 1X9BA 3I0QA 4X5TA 3QC9A 3PURA 2IDOB 2QVAA 3LFMA 2ES0A 4H9QC 3AAIA 3HKDE 3AVRA 4GK0E 5ADXL 3ZPOA 4HN9A 3ZJ1A 2D2SA 2R6GF 4EEBA 1IJ6A 2JQKA 3AA6B 2NR4A 4DR7T 4O8SA 2PG8A 2L9QA 3AAEB 2WDVA 3Q5EA 4I4TE 3K3QC 2Q9QB 4GKKT 3ONLC 4PNIA 3RC8A 3W15B 2N2NA 2YKSA 2WMNA 2J62A 1YQ3A 4EEDA 2Q9QD 5JVDE 3JAFA 3M3ZB 4QKNA 2UXCT 3EUHA 5JDMA 2LEHA 1E1HB 4IREA 5A1LA 2VL0A 3F57A 1OEDC 4I55E 4QWNB 2H7OA 3RIAA 1ZKEA 4HEAA 4IDQA 2PFVA 1KF6A 3ZC1A 5LJNA 2WQYA 2W63A 1XDPA 2DWGA 5AQNB 4PFOA 2BBHA 4DR3T 1IBMT 2CMRA 2XAJB 3MZKB 5FP3A 4BAYB 3FXEB 4B3MT 2BS3A 4O2AE 4WYVA 2C0SA 2X9HA 2ZM0A 5GONE 4O4LE 3ANWA 2V1DB 3UU3A 1MMDA 4YT0A 2DWKA 2FBWA 2LM2A 3HKEE 1UK5A 3TLSA 5AQQB 4O4IE 2E9XB 4EAHA 1LKXA 2KNDA 3JADA 3LK3B 5JREA 2JMKA 4U74A 3C98B 3CKDA 1WR6A 2E9XD 2XM2A 3QNUA 4ISTA 4JBWF 3VRAA 4AKGA 4ANJA 2CLYB 5L3BB 3PUAA 5JH7E 2IIUA 4IHJE 4GIWA 1YKEB 4P09A 3L8RA 1I6ZA 4ILUA 2LHRA 4JI5T 3PUQA 5FY7A 3E0ZA 3PE0A 2NOXA 4JEUB 3KFWX 2XHEB 2OV9A 3O9XA 1SA0E 4ISSA 5FXVA 4DBRA 5H6RB 3PUGA 1B7TA 1W0BA 2C5IT 4C91A 3VR8A 5HWYA 2V5CA 5JDGA 2AXDS 3UU5A 3P4WA 4HFVA 2BG9A 3RQUA 2LRLA 3D0TA 3U3IA 2CHNA 5LGTB 2YN6A 5LP6E 1HTJF 1KEYA 4H63H 2F4VT 1WYCA 5LJMA 3BK9A 3HL6A 4TV8E 3UFEA 1OEDE 1DU2A 4N78D 2ACXA 2MAWA 4FI5A 5EK2A 2W62A 4XZCA 1KK7A 3ZN0B 4DV4T 2P9BA 2PTFA 2G0UA 4CQIA 1CUNA 1NAFA 1VOMA 4PJJA 2IC9A 5DABA 4PK6A 2NW7A 4PJNA 3HA4A 4JUYA 4IL9A 3CQCB 4QXCB 1U4QA 1D1CA 5LNKA 3NBXX 1HX1B 3V5SA 4PK5A 2I6HA 3FBZA 1VRBA 2WDRA 3NVOA 4YFSA 5H6QB 2W61A 2IMLA 5AQSB 5ABHA
chains in the Genus database with same CATH topology
3KVBA 2MBGA 1MIYA 3QK6A 4EZHA 4KBMB 4MALA 4OHFA 2BZBA 2JMHA 3F31A 1IJ5A 3IF8B 5LXTE 3WAJA 1O3XA 4WW0A 1MIWA 1FEWA 3J7Yq 2A3DA 2EHOB 3OYXA 5L3GB 2KXPB 4YHJA 1MNEA 3RPUA 1UX5A 2LOSA 3N9OA 2NW9A 3ZMUB 3C4XA 2HPLA 1BR2A 2LM9A 2X9YA 3VKHA 3O4XE 3FXDB 4V1Av 2EHOD 3J9X1 3RRCA 4CI1B 3ONXA 1MMGA 4HE8A 4EYYR 3T8OA 1ZV4X 5AFUL 3CX7B 1MMAA 4QX8B 5FXXA 2X66A 4AI6A 2CXDA 2C5KT 1X79A 4Z8XA 5JRCB 2LSGA 2KT9A 2ZM8A 2DNXA 2K24A 3S4UA 3ZC0A 3I1AA 4IGUA 4HTEA 3LK2B 2MYSA 3QUJA 3H3AA 3KV9A 3OBVE 2Y48B 4TV9E 4KUMB 2CXLA 2E9XC 5TAOA 3MJXA 4WBNE 4ZHQE 1BR0A 2E9XA 2VKDA 4PJLA 4XBFB 2YU2A 2CCQA 3PUSA 2WAUA 3FHNA 4CZZB 3SWHA 5KX5E 3Q9DA 4G2AA 3RKOA 1MMNA 3KBTA 5JDFA 1WYBA 2X68A 2V7KA 3ANWB 2HPJA 5LCYA 5JR9B 1H7CA 2ZMAA 1YD8G 2HH7A 4DNDA 5EK4A 3HI2A 5HYAA 2CLYC 4EYUA 4U72A 4L9IA 3B13A 1MIVA 3VHLA 1HG2A 2QA7A 3I0OA 5DJQC 4X1IE 2SPCA 2K9AA 3EDUA 3RX6A 5KDMC 4FJOA 4O4JE 2WSSV 5ETWA 2KZ7B 5DQWA 2RA1A 3O1IA 1U5PA 1NWMX 2X67A 5E0OA 3ZYMA 4AQFC 4QXBB 1HCIA 2LSJA 4AQFA 4QX7B 3VKGA 4NUVA 3BQIA 3Q5WA 3UUMA 4ZI2D 3N5LA 2DI4A 3ZN1B 4G63A 3ZJ2A 2LJLA 2VL8A 2YINA 4TN7B 3ZCJA 4B6XA 3RYHE 5L3FB 3R6NA 5EK3A 3C51A 3H37A 1QUUA 4UIGA 5JRCA 2X51A 3TKLB 4GK5E 3SOLA 4XAXB 5EZYE 4E7SA 3MXZA 4H9RC 3U78A 2UXNB 1YKHB 1OXZA 3NRXA 4HKAA 4J2CA 5HXSA 3ETUA 3MA9A 4I50E 3GN5B 5HAXA 2VK9A 2WWUA 3CQGB 4H9PC 5JDQA 5JDNA 2VKHA 2JQQA 3BQLA 1Y64B 2LT3A 3FBLA 3Q5XA 3RC3A 2K5BB 4UVCB 5L2LA 3PTRB 3K3OA 4JEHB 3ZEFB 3IEEA 3I9WA 4M1PA 1Z0PA 2CEAA 4ASKA 2D0UA 3AA1B 3KV5A 4QXHB 3N9NA 2V7MA 4EZ4A 4IE5A 3O1JA 3V5UA 3L09A 3P7IA 1S35A 4A56A 4UF0B 3AVSA 3I0QA 3QC9A 2V7LA 3PURA 4OYKA 4JLEA 2IW5B 3LFMA 5LYJE 2ES0A 4H9QC 4EIWA 3AAIA 3HKDE 4CI3B 3AVRA 4GK0E 4ZI7E 3E22E 4UEMA 5IYZE 3GWHA 5ADXL 5LHGB 3DP7A 3ZPOA 2L8KA 4HN9A 3ZJ1A 2YEVC 3CWZB 2CA5A 2MTQA 3LG7A 5HXHA 2D2SA 4UVAB 3N9MA 3ESLA 3CQXC 5CA1E 4L0RA 2PBIA 1IJ6A 2ZLYA 2K48A 3N9LA 2L3LA 4UELA 5L3EB 4IE6A 3AA6B 1D0ZA 4EB6E 2DCFA 5BMVE 5HXRA 2YK0A 4CXWA 4O8SA 2PG8A 2L9QA 3AAEB 4ZOLE 1HF8A 3LJCA 4CI2B 1LVKA 4H9NC 4I4TE 3UUXB 2VASA 3K3QC 1FMWA 1G73A 2Q9QB 3GN5A 5LG4A 1D1BA 3HKBE 4PNIA 3W15B 3RC8A 4MLKA 2A2FX 3OYZA 1UCUA 2N2NA 2WMNA 2XASB 4I43B 4AKLA 2XTLA 2ODVA 1S94A 3SS1A 2MOZA 2KWIB 4L5GA 1T98A 2Q9QD 5JQGE 2XAFB 4GYSA 4HGAA 5JVDE 4BA9A 5CB4E 4ERRA 3I9YA 2E8IA 1HX8A 4QKNA 2NP9A 3ZYKA 5FXZA 3EUHA 2GK9A 2LOPA 2PJQA 4TZ4C 3RYFE 3WAKA 5JDMA 3UULA 4MBQA 1IAPA 1E1HB 2LEHA 2CXFA 3EDVA 4KMCA 5A1LA 5M4YA 1EZ3A 4X1YE 3C64A 3F57A 2XAGB 2WMOA 1LRZA 4P0BA 5J1GA 3CX8B 4I55E 4YLHA 2EHOC 4QWNB 3N2OA 2H7OA 1ZKEA 4GYRA 4HEAA 5J2TE 2PFVA 2V7IA 2EHOA 3HR0A 3CMLA 2N9DA 3ZYLA 3LK42 3ZC1A 3ZCIA 5LJNA 4ADZA 2J1DG 3ZMTB 4F6RC 3KV6A 2W63A 3SRZA 2VKJA 3P8CD 4IDZA 4PW8A 4IE0A 2DWGA 2A72A 3MK7C 4AQGA 1QSDA 4ZS2A 2D5UA 4CXYA 4PFOA 2X9XA 3C4WA 1HS7A 2CMRA 2XAJB 2BDEA 3MZKB 4UVBB 5FP3A 2Z6EA 4BAYB 3C50A 5L3CB 2ODUA 3FXEB 2BVMA 3KDSE 1D0YA 4H9OC 1BR4A 3K8PC 5FY0A 4O2AE 2M67A 2C0SA 2V7JA 2JRKA 4DMVA 2NTXA 3UUNA 1BR1A 2X9HA 2W0GA 2CWOA 3DJBA 2ZM0A 5JR9C 3OKQA 3NZPA 5GONE 4O4LE 5JR9A 3ANWA 1FMVA 2JJ9A 2V1DB 3MACA 1MMDA 4QHOA 2XAHB 3R84B 4IE7A 3ZMVB 2W00A 2DWKA 4YJ3E 2B1EA 3HKCE 5F3JA 4X1KE 5LBQB 4YJ2E 4OYJA 4TX5A 1HG5A 3HKEE 5L3DB 4ZI2C 1WRDA 1D1AA 4OFZA 4KP3C 5CA0E 3AA7B 5KMGP 2H3RA 4O4IE 2E9XB 3RH3A 2XQYA 4EAHA 2H7VC 1LKXA 2KNDA 1ZHCA 2OA5A 3LK3B 5JREA 2JMKA 4MFRA 4DO0A 4U74A 3C98B 2CWYA 5JDLA 3CKDA 4PK4A 3BQKA 2WBLA 2VKOA 3EVYA 2KMFA 1WR6A 2X0LB 2E9XD 2YU1A 3IBPA 3IHRA 3CX6B 4IIJE 3FB2A 2LHNA 4ISTA 4PJMA 3CVRA 1G8XA 4AKGA 1MNDA 4ANJA 2CLYB 2LSKA 2UXXB 3PUAA 4IE4A 5L3BB 3B57A 5JH7E 4NUUA 3MKDA 2VWAA 3LBXB 4AKHA 4WBOA 3CPZA 4ZI3D 5JDHA 4C90A 4IHJE 5FYMA 4GIWA 1D0XA 4BJMA 4O2BE 4K0UA 3RRWA 1KNZA 3ZMSB 4AXPA 1YKEB 5IHYA 3F2EA 4P09A 2RP4A 1OWAA 5FMNA 4DBQA 4ILUA 2LHRA 3JC6D 3PUQA 3ZMZB 5FY7A 3K3NA 3NZQA 3E0ZA 2C5JA 3PE0A 2NOXA 3RYIE 4P0AA 4JEUB 2LE8A 1IZNB 3PDYA 4UXNB 2KINB 3AB3B 3KBUA 3KFWX 2XHEB 3N2KE 4O4HE 5J2UE 3KV4A 4PFPA 5F8PA 3O9XA 1SA0E 2QGSA 3Q2MA 4H63V 4ISSA 4E7ZA 4UF0A 4DMWA 4UV9B 2NW8A 2XUEA 5FXVA 4DBRA 2JPFA 2LSYA 5H6RB 3PUGA 2Y8DA 1US7B 1B7TA 2BVLA 2LSIA 3DTOA 1FIOA 5LGUB 2C5IT 4C91A 5FXWA 2DHRA 4H9SE 4ZI3C 5HWYA 5JDGA 4MHCA 3A5XA 4HFVA 4GOUA 1YW0A 5FNVE 2DLRA 2XAQB 4AKRB 3D0TA 3U3IA 5LGTB 1SHZC 2N1GA 3LBXA 2X9WA 5DQVA 5LP6E 1HTJF 5HXEA 3JC6C 2ZM2A 4H63H 3ZLIA 3GMIA 2IC6A 1WLXA 1WYCA 1HFAA 2Q9QC 3N2GE 3AAAB 3OJAA 2Q9QA 5LJMA 4OK0A 3AA0B 3BK9A 3HL6A 2Y6XA 1UX4A 1V9DA 4TV8E 2CM0A 3WI3A 4UV8B 3UFEA 3NRYA 5HWXA 2WM9A 5HXCA 3L3PA 4N78D 2NWBA 2ACXA 4AKIA 4FI5A 5EK2A 2IAKA 2W62A 3ETVA 1KK7A 4XZCA 5LA6E 3ZN0B 3KVAA 3RYCE 5LGNB 2P9BA 4ZS3A 4CXXA 2CE7A 4DVDA 2G0UA 4CQIA 1CUNA 1NAFA 5FY1A 1VOMA 5LHIB 4PJJA 4EOZB 2I59A 4EXTA 2IC9A 5DABA 3PU3A 4PK6A 3UTKA 2NW7A 3E08A 3M65A 3O1HA 4PJNA 5LHHB 3HA4A 3KINB 4JUYA 3CQCB 4QXCB 3C4ZA 1U4QA 1D1CA 2VB6A 5LNKA 3NBXX 2KLQA 4TUYE 3V5SA 3PU8A 4PAGA 4PK5A 5C8YE 3FBZA 1VRBA 4YFSA 5H6QB 5LOVE 2W61A 2D0TA 4BJNA 1AJ3A 3N9QA 2NTYA 2V26A 3N9PA 3VU7H 3GA8A 5LBMA 1ZEEA 2KWHA 1LVFA 4X20E 4WNKA 3UT5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y q;  4V1A v; 
#chains in the Genus database with same CATH topology
 5FVL A;  1MIY A;  3QK6 A;  4HWI B;  4OHF A;  1IJ5 A;  3IF8 B;  3WAJ A;  4HFI A;  1OED B;  4WW0 A;  4YY3 T;  2A3D A;  5L3G B;  4YHJ A;  1UX5 A;  2LOS A;  3N9O A;  2NW9 A;  3PUZ F;  2HPL A;  1BR2 A;  3O4X E;  2HN2 A;  3RRC A;  3ONX A;  4HE8 A;  4EYY R;  1ZV4 X;  4QX8 B;  4Z8X A;  2ZM8 A;  4U31 A;  2K24 A;  4B3S T;  2MYS A;  3QUJ A;  1XMQ T;  3OBV E;  5TAO A;  4WBN E;  4ZHQ E;  2CCQ A;  2WAU A;  4DV6 T;  3Q9D A;  4G2A A;  1MMN A;  2UU9 T;  1H7C A;  2HH7 A;  5LB7 B;  3JAE A;  1GQE A;  3HI2 A;  4NXM T;  3FZL B;  1Y01 A;  4L9I A;  2HHH T;  2OLT A;  4AQY T;  3EDU A;  3UQ7 A;  2X67 A;  4YSX A;  2XM1 A;  1QLB A;  3AEC A;  3Q5W A;  2J4G A;  3UUM A;  3N5L A;  2CPT A;  2DI4 A;  2LJL A;  3AE4 A;  2YIN A;  4TN7 B;  2CBJ A;  4DR4 T;  3RYH E;  3C51 A;  4JI8 T;  5EZY E;  2WS3 A;  4E7S A;  1YKH B;  4DID B;  2J47 A;  2YDR A;  5FKY A;  5HXS A;  3AE6 A;  3PUX F;  5HAX A;  2WWU A;  4H9P C;  4UR9 A;  2JQQ A;  2WWV A;  3Q5X A;  2A9U A;  1Z0P A;  2CEA A;  4ASK A;  2D0U A;  4QXH B;  4CN1 A;  2V7M A;  4EZ4 A;  5CFB A;  3P7I A;  2V7L A;  4QH1 A;  5LYJ E;  4X66 T;  4CI3 B;  4HFE A;  2FJA A;  3E22 E;  3RF1 A;  3DP7 A;  2YEV C;  2I0M A;  5AQH B;  3PUW F;  5HCM A;  4P1N A;  3N9M A;  3ESL A;  5CA1 E;  1ZP0 A;  2PBI A;  2ZLY A;  3N9L A;  4EV6 A;  3PJA J;  3IA3 A;  4QH5 A;  1M62 A;  4EB6 E;  2DCF A;  5HXR A;  2YK0 A;  3LJC A;  4H9N C;  2VAS A;  5IUX A;  3HKB E;  4MLK A;  4A98 A;  4I43 B;  3X1D A;  4AKL A;  2ODV A;  1S94 A;  3SS1 A;  2MOZ A;  2IUB A;  2E5L T;  4GYS A;  4JI4 T;  3I9Y A;  1HX8 A;  4JI0 T;  3ZYK A;  3WAK A;  2LOP A;  4COF A;  3RYF E;  1IAP A;  3EDV A;  2CXF A;  4X1Y E;  3C64 A;  4LFA T;  2BS2 A;  5LG3 A;  1M7K A;  3HR0 A;  3ZYL A;  3LK4 2;  3ZCI A;  4ADZ A;  3KV6 A;  4IDP A;  3SRZ A;  2VKJ A;  4PW8 A;  2A72 A;  4AQG A;  2BDE A;  3QOF A;  3ZSS A;  1N34 T;  5CJ5 A;  5FY0 A;  4DMV A;  2JRK A;  2NTX A;  5FL0 A;  3DJB A;  3UU4 A;  3OKQ A;  1FMV A;  2JJ9 A;  1XNR T;  3MAC A;  4IE7 A;  3ZMV B;  4YJ3 E;  4X1K E;  5LBQ B;  4YJ2 E;  4OYJ A;  4HWD A;  1KFY A;  2VUR A;  5L3D B;  3UU6 A;  4ZI2 C;  1WRD A;  5CA0 E;  2XQY A;  4KHZ F;  1ZHC A;  2OA5 A;  4MFR A;  4DO0 A;  2CWY A;  5JDL A;  3OTO T;  4U7I A;  4PK4 A;  3BQK A;  3VRB A;  2CHO A;  4TNW A;  4IIJ E;  3ZT6 A;  2LSK A;  2UXX B;  1SE7 A;  4NUU A;  2VWA A;  4AKH A;  4ZI3 D;  3FZK B;  3L39 A;  4C90 A;  4B3R T;  2W67 A;  2IHR 1;  4O2B E;  5L47 A;  4K0U A;  1KNZ A;  3F2E A;  1T8B A;  4I0U A;  4JI1 T;  2MPK A;  3P4Q A;  3AB3 B;  4DR2 T;  3KBU A;  4NXN T;  4A5X A;  4UF0 A;  1N36 T;  2XUE A;  1US7 B;  2LSI A;  2BVL A;  3DTO A;  2H89 A;  4AIU A;  2XQ9 A;  1N33 T;  4MHC A;  2XZE A;  2BG9 C;  1YW0 A;  4LMK A;  2X9W A;  5HXE A;  3JC6 C;  4ILC A;  2ZM6 T;  4HWH A;  3AAA B;  2UXB T;  4DV7 T;  3AA0 B;  4WZX A;  1UX4 A;  5HEU A;  3WI3 A;  3NRY A;  3L3P A;  5IWA T;  4LF4 T;  2IAK A;  3T1H T;  1Z8U A;  3RYC E;  5LGN B;  5AQM B;  5AQL B;  3NKZ A;  4EOZ B;  3UTK A;  3M65 A;  5LMU T;  1WFD A;  3P4P A;  3PU8 A;  2HN1 A;  4DR1 T;  2WY2 A;  3AXJ A;  1HNZ T;  2KWH A;  3PUY F;  1LVF A;  3UT5 E;  2MBG A;  1SUM B;  3ONJ A;  3F31 A;  3J7Y q;  4B3T T;  3RPU A;  3C4X A;  3PJA A;  4V1A v;  2YOE A;  1MMG A;  2W66 A;  4JI6 T;  3CX7 B;  2X66 A;  4AI6 A;  5JRC B;  1X79 A;  2DNX A;  4JI3 T;  3TLV A;  3I1A A;  4IGU A;  3LK2 B;  3KV9 A;  4TWH A;  2CXL A;  3K1S A;  3EAM A;  4HFC A;  3P50 A;  4XBF B;  4CZZ B;  5KXJ A;  2FJE A;  5JDF A;  3ANW B;  4KX6 A;  4DND A;  5LMN T;  5HYA A;  4U72 A;  2XQ3 A;  2QA7 A;  5DJQ C;  2SPC A;  2K9A A;  3SFD A;  4FJO A;  2KZ7 B;  5DQW A;  5E0O A;  3ZYM A;  3LSV A;  1HCI A;  3QB5 K;  4AQF A;  4ZI2 D;  2YDQ A;  2VL8 A;  5J0Z A;  5EK3 A;  4HWC A;  2WDQ A;  4XAX B;  3UFG A;  2BG9 E;  2V6Y A;  3MXZ A;  4JV5 T;  4H9R C;  2AE9 A;  1R8I A;  3UU8 A;  4HKA A;  3ETU A;  4I50 E;  4KI0 F;  2XQ7 A;  3GN5 B;  2LRK A;  2H88 A;  2VKH A;  1Y64 B;  2K5B B;  4JEH B;  3ZEF B;  2UUC T;  4IE5 A;  3O1J A;  3AE5 A;  1S35 A;  4A56 A;  3AVS A;  5ABF A;  2QRX A;  2BKN A;  4JLE A;  2IW5 B;  4DV1 T;  3EHZ A;  4ZI7 E;  4UEM A;  5IYZ E;  5JTG A;  3GWH A;  5LHG B;  2CA5 A;  2MTQ A;  3LG7 A;  5AQJ B;  4TNV A;  4LMJ A;  2BG9 B;  3CQX C;  2K48 A;  4DV2 T;  5L3E B;  5C2T A;  4IE6 A;  1D0Z A;  2FJB A;  5BMV E;  2V6X A;  5AQF B;  4ZOL E;  1HNX T;  1LVK A;  1FMW A;  1G73 A;  1D1B A;  3PV0 F;  1IBK T;  3ZST A;  5JQG E;  2WU5 A;  1T98 A;  5CB4 E;  4ERR A;  4TWD A;  5F5W A;  1ZOY A;  2E8I A;  2NP9 A;  2PJQ A;  4TZ4 C;  5AQK B;  4MBQ A;  4AIS A;  2XSA A;  1UUS A;  2XAG B;  2WMO A;  5J1G A;  5J2T E;  4GYR A;  4YSZ A;  2V7I A;  2EHO A;  3ABV A;  3CML A;  2XQ8 A;  2N9D A;  5AQT B;  2CRB A;  3ZMT B;  4F6R C;  2BS4 A;  3P8C D;  1QSD A;  4ZS2 A;  4U7Y A;  4CXY A;  4UVB B;  3EAB A;  3CK6 A;  5L4E A;  4DUZ T;  3K8P C;  2DL1 A;  2V7J A;  3UUN A;  1BR1 A;  4IDN A;  2W0G A;  2X0Y A;  5JR9 A;  4F8H A;  2XAH B;  3R84 B;  2W00 A;  2B1E A;  4EGW A;  5FVK A;  4TX5 A;  1FJG T;  1HG5 A;  2UUA T;  3LDQ B;  1XMO T;  3AA7 B;  2H3R A;  2BKO A;  2H7V C;  2VQE T;  2VKO A;  3EVY A;  2KMF A;  3RLF F;  3IBP A;  3FB2 A;  2LHN A;  4PJM A;  2XPK A;  2WP9 A;  1MND A;  4IE4 A;  2KSR A;  2BKP A;  3B57 A;  3MKD A;  3LBX B;  4HFD A;  1J5E T;  4WBO A;  3CPZ A;  5JDH A;  1D0X A;  4JI7 T;  3RGL A;  2V8S V;  4AXP A;  2RP4 A;  1OWA A;  5L4H A;  2VVS A;  5C3J A;  3ZMZ B;  1NEN A;  5AQU B;  4Q25 A;  2C5J A;  3RYI E;  2LE8 A;  2XJ7 A;  4UXN B;  2KIN B;  4CN6 A;  3N2K E;  5F8P A;  2QGS A;  4NPP A;  3CIR A;  5HEJ A;  2NW8 A;  3OPC A;  4X65 T;  2Y8D A;  4H9S E;  3A5X A;  3A8Y C;  2XAQ B;  1JNR A;  1SHZ C;  2N1G A;  5DQV A;  4JI2 T;  2ZM2 A;  3ZLI A;  3GMI A;  2IC6 A;  1WLX A;  1HFA A;  2Q9Q A;  4OK0 A;  1V9D A;  4GKJ T;  2WM9 A;  4YTM A;  5HXC A;  2NWB A;  4AKI A;  1XDO A;  3KVA A;  3RIU A;  4IT4 A;  4ZS3 A;  3AED A;  2CE7 A;  4DVD A;  4YTN A;  2I59 A;  5FL1 A;  2ACZ A;  3O1H A;  3PUV F;  5AQG B;  2VB6 A;  2KLQ A;  4TUY E;  4PAG A;  2WB5 A;  3A7M A;  3AE8 A;  5LOV E;  2VVN A;  1AJ3 A;  2WZI A;  3N9Q A;  2NTY A;  2V26 A;  2M6B A;  3N9P A;  3VU7 H;  3GA8 A;  1ZEE A;  4X20 E;  4U33 A;  3ZT7 A;  4KBM B;  4MAL A;  3AEE A;  3AEG A;  5LXT E;  4NIQ A;  1FEW A;  5HEH A;  2JQH A;  2LM9 A;  2X9Y A;  4U2Y A;  3OVU A;  3FXD B;  3P4R A;  3J9X 1;  2WU2 A;  3T8O A;  3H3M A;  3SFE A;  5AFU L;  1MMA A;  2CXD A;  1E7P A;  2LSG A;  2KT9 A;  4HTE A;  3H3A A;  4TV9 E;  3AEA A;  3MJX A;  2E9X A;  5ABG A;  4PJL A;  2YU2 A;  3PUS A;  2XY8 B;  3FHN A;  3SWH A;  3KBT A;  1WYB A;  2X68 A;  1YQ4 A;  2V7K A;  2LLY A;  3AE3 A;  1YD8 G;  4X62 T;  1W9R A;  1HG2 A;  3I0O A;  4CN4 A;  5BR8 T;  2WZH A;  3RX6 A;  5KDM C;  2WSS V;  2RA1 A;  3O1I A;  3UUB A;  4AQF C;  4QXB B;  2XQA A;  3VKG A;  4QX7 B;  2JQ9 A;  5AQV B;  3ZJ2 A;  3ZCJ A;  5L3F B;  4IDO A;  4UIG A;  4HFB A;  5JRC A;  2X51 A;  3RI5 A;  4GK5 E;  3SOL A;  5AQR B;  3U78 A;  1VCS A;  1OXZ A;  4J2C A;  3FZM B;  3MA9 A;  4LF7 T;  1T7S A;  4A97 A;  3CQG B;  2LT3 A;  4IL4 A;  3RIF A;  4UVC B;  5L2L A;  3PTR B;  3K3O A;  3V5U A;  3L09 A;  4UF0 B;  4OYK A;  4DUY T;  4EIW A;  2D9D A;  4LF6 T;  3EI0 A;  2L8K A;  3B5M A;  3CWZ B;  5HXH A;  4UVA B;  4L0R A;  3FZF B;  2L3L A;  4UEL A;  4CXW A;  2RPA A;  4DV3 T;  1HF8 A;  2WCA A;  4CI2 B;  3UUX B;  1N32 T;  4ZZC A;  3GN5 A;  5LG4 A;  3P4S A;  2A2F X;  3OYZ A;  1UCU A;  4KHP T;  2XAS B;  2XTL A;  4YXD A;  2KWI B;  4L5G A;  2XAF B;  3NWI A;  2VQF T;  4HGA A;  4BA9 A;  5ABE A;  5FXZ A;  1T72 A;  2GK9 A;  3AE7 A;  3UUL A;  5M4Y A;  4KMC A;  1EZ3 A;  2UXD T;  1IBL T;  4P0B A;  1LRZ A;  3CX8 B;  4YLH A;  2EHO C;  3N2O A;  1OED A;  3RQW A;  4ILA A;  2J1D G;  2W2U A;  4IDZ A;  2E5V A;  3AXJ B;  4IE0 A;  1CHU A;  1XZY A;  3MK7 C;  4DV5 T;  2D5U A;  2X9X A;  3C4W A;  1HS7 A;  2Z6E A;  3C50 A;  5L3C B;  2ODU A;  4TWF A;  2BVM A;  3KDS E;  1D0Y A;  4H9O C;  2W4X A;  2XQ5 A;  1BR4 A;  2M67 A;  2CWO A;  5JR9 C;  3NZP A;  4QHO A;  4LML A;  4LFB T;  3HKC E;  5F3J A;  5AQI B;  1XNQ T;  1D1A A;  4OFZ A;  4KP3 C;  5KMG P;  1VCT A;  3RH3 A;  2WBL A;  2X0L B;  2YU1 A;  3IHR A;  3CX6 B;  2XSB A;  4YTP A;  3CVR A;  1HNW T;  1G8X A;  1E2A A;  4ILB A;  5FYM A;  4BJM A;  3RRW A;  3AEF A;  3ZMS B;  5IHY A;  3ZT5 A;  5FMN A;  4DBQ A;  1JNZ A;  3AE2 A;  3JC6 D;  5AQP B;  4LF9 T;  3K3N A;  4QH4 A;  3NZQ A;  2LKG A;  3JCF A;  4DR6 T;  4P0A A;  1IZN B;  3PDY A;  2X0H A;  3AEB A;  2B76 A;  4O4H E;  2V6Y B;  5J2U E;  3KV4 A;  4PFP A;  3Q2M A;  4H63 V;  4E7Z A;  4DMW A;  4UV9 B;  1L0V A;  1KNR A;  2XQ6 A;  2JPF A;  2LSY A;  4OX9 T;  1FIO A;  5LGU B;  5FXW A;  2DHR A;  4ZI3 C;  2XQ4 A;  2QYW A;  2YDS A;  1YXR A;  3ZKR A;  4GOU A;  5FNV E;  4AKR B;  2DLR A;  4DR5 T;  3LBX A;  4YSY A;  4X64 T;  4LFC T;  5CGM A;  5ABF B;  2Q9Q C;  3N2G E;  3OJA A;  1W09 A;  1UGO A;  2Y6X A;  3TLU A;  2CM0 A;  4UV8 B;  5HWX A;  3FZH B;  3VR9 A;  1NEK A;  3RIU C;  3TLW A;  3ETV A;  5LA6 E;  4CXX A;  5FY1 A;  5LHI B;  4EXT A;  3RKG A;  3PU3 A;  3E08 A;  5LHH B;  3KIN B;  2V5D A;  3C4Z A;  5C8Y E;  1J1J A;  2D0T A;  4BJN A;  3RHW A;  5LBM A;  4WNK A;  3AE9 A;  1W0A A;  3KVB A;  4ZXL A;  4EZH A;  4ZZB A;  2BZB A;  2JMH A;  1O3X A;  1MIW A;  2K3W A;  2EHO B;  3OYX A;  2KXP B;  1MNE A;  3UQ4 A;  2CBI A;  2BBJ A;  3ZMU B;  3VKH A;  1J5W A;  2EHO D;  4CI1 B;  4YHH T;  2FUP A;  5FXX A;  2C5K T;  3ZC0 A;  3S4U A;  2Y48 B;  4KUM B;  2E9X C;  1BR0 A;  2VKD A;  2LKH A;  1WR0 A;  1XWM A;  5KX5 E;  4DV0 T;  3RKO A;  4JYA T;  2FJD A;  3QB5 A;  2UUB T;  3AE1 A;  5JR9 B;  5HEG A;  5LCY A;  2HPJ A;  4U3C A;  2ZMA A;  3TLT A;  5EK4 A;  4HFH A;  2CLY C;  4EYU A;  1KNP A;  3G06 A;  4U2Z A;  3B13 A;  1MIV A;  1HR0 T;  3VHL A;  4X1I E;  4ZEY A;  4Z91 A;  4O4J E;  5ETW A;  1U5P A;  1NWM X;  3Q5D A;  2LSJ A;  4NUV A;  2JIW A;  3BQI A;  3ZN1 B;  4G63 A;  4HWF A;  5AQO B;  4Z90 A;  4B6X A;  3R6N A;  5HEO A;  3H37 A;  1QUU A;  1UUR A;  3TKL B;  3T1Y T;  1I94 T;  2UXN B;  4LF5 T;  4LF8 T;  2M6I A;  3NRX A;  2VK9 A;  2E2A A;  5JDQ A;  5JDN A;  3BQL A;  4K0K T;  3FBL A;  3RC3 A;  1WCR A;  3IEE A;  3I9W A;  4M1P A;  3AA1 B;  3KV5 A;  3N9N A;  5HCJ A;  1X9B A;  3I0Q A;  4X5T A;  3QC9 A;  3PUR A;  2IDO B;  2QVA A;  3LFM A;  2ES0 A;  4H9Q C;  3AAI A;  3HKD E;  3AVR A;  4GK0 E;  5ADX L;  3ZPO A;  4HN9 A;  3ZJ1 A;  2D2S A;  2R6G F;  4EEB A;  1IJ6 A;  2JQK A;  3AA6 B;  2NR4 A;  4DR7 T;  4O8S A;  2PG8 A;  2L9Q A;  3AAE B;  2WDV A;  3Q5E A;  4I4T E;  3K3Q C;  2Q9Q B;  4GKK T;  3ONL C;  4PNI A;  3RC8 A;  3W15 B;  2N2N A;  2YKS A;  2WMN A;  2J62 A;  1YQ3 A;  4EED A;  2Q9Q D;  5JVD E;  3JAF A;  3M3Z B;  4QKN A;  2UXC T;  3EUH A;  5JDM A;  2LEH A;  1E1H B;  4IRE A;  5A1L A;  2VL0 A;  3F57 A;  1OED C;  4I55 E;  4QWN B;  2H7O A;  3RIA A;  1ZKE A;  4HEA A;  4IDQ A;  2PFV A;  1KF6 A;  3ZC1 A;  5LJN A;  2WQY A;  2W63 A;  1XDP A;  2DWG A;  5AQN B;  4PFO A;  2BBH A;  4DR3 T;  1IBM T;  2CMR A;  2XAJ B;  3MZK B;  5FP3 A;  4BAY B;  3FXE B;  4B3M T;  2BS3 A;  4O2A E;  4WYV A;  2C0S A;  2X9H A;  2ZM0 A;  5GON E;  4O4L E;  3ANW A;  2V1D B;  3UU3 A;  1MMD A;  4YT0 A;  2DWK A;  2FBW A;  2LM2 A;  3HKE E;  1UK5 A;  3TLS A;  5AQQ B;  4O4I E;  2E9X B;  4EAH A;  1LKX A;  2KND A;  3JAD A;  3LK3 B;  5JRE A;  2JMK A;  4U74 A;  3C98 B;  3CKD A;  1WR6 A;  2E9X D;  2XM2 A;  3QNU A;  4IST A;  4JBW F;  3VRA A;  4AKG A;  4ANJ A;  2CLY B;  5L3B B;  3PUA A;  5JH7 E;  2IIU A;  4IHJ E;  4GIW A;  1YKE B;  4P09 A;  3L8R A;  1I6Z A;  4ILU A;  2LHR A;  4JI5 T;  3PUQ A;  5FY7 A;  3E0Z A;  3PE0 A;  2NOX A;  4JEU B;  3KFW X;  2XHE B;  2OV9 A;  3O9X A;  1SA0 E;  4ISS A;  5FXV A;  4DBR A;  5H6R B;  3PUG A;  1B7T A;  1W0B A;  2C5I T;  4C91 A;  3VR8 A;  5HWY A;  2V5C A;  5JDG A;  2AXD S;  3UU5 A;  3P4W A;  4HFV A;  2BG9 A;  3RQU A;  2LRL A;  3D0T A;  3U3I A;  2CHN A;  5LGT B;  2YN6 A;  5LP6 E;  1HTJ F;  1KEY A;  4H63 H;  2F4V T;  1WYC A;  5LJM A;  3BK9 A;  3HL6 A;  4TV8 E;  3UFE A;  1OED E;  1DU2 A;  4N78 D;  2ACX A;  2MAW A;  4FI5 A;  5EK2 A;  2W62 A;  4XZC A;  1KK7 A;  3ZN0 B;  4DV4 T;  2P9B A;  2PTF A;  2G0U A;  4CQI A;  1CUN A;  1NAF A;  1VOM A;  4PJJ A;  2IC9 A;  5DAB A;  4PK6 A;  2NW7 A;  4PJN A;  3HA4 A;  4JUY A;  4IL9 A;  3CQC B;  4QXC B;  1U4Q A;  1D1C A;  5LNK A;  3NBX X;  1HX1 B;  3V5S A;  4PK5 A;  2I6H A;  3FBZ A;  1VRB A;  2WDR A;  3NVO A;  4YFS A;  5H6Q B;  2W61 A;  2IML A;  5AQS B;  5ABH A; 
#chains in the Genus database with same CATH homology
 3KVB A;  2MBG A;  1MIY A;  3QK6 A;  4EZH A;  4KBM B;  4MAL A;  4OHF A;  2BZB A;  2JMH A;  3F31 A;  1IJ5 A;  3IF8 B;  5LXT E;  3WAJ A;  1O3X A;  4WW0 A;  1MIW A;  1FEW A;  3J7Y q;  2A3D A;  2EHO B;  3OYX A;  5L3G B;  2KXP B;  4YHJ A;  1MNE A;  3RPU A;  1UX5 A;  2LOS A;  3N9O A;  2NW9 A;  3ZMU B;  3C4X A;  2HPL A;  1BR2 A;  2LM9 A;  2X9Y A;  3VKH A;  3O4X E;  3FXD B;  4V1A v;  2EHO D;  3J9X 1;  3RRC A;  4CI1 B;  3ONX A;  1MMG A;  4HE8 A;  4EYY R;  3T8O A;  1ZV4 X;  5AFU L;  3CX7 B;  1MMA A;  4QX8 B;  5FXX A;  2X66 A;  4AI6 A;  2CXD A;  2C5K T;  1X79 A;  4Z8X A;  5JRC B;  2LSG A;  2KT9 A;  2ZM8 A;  2DNX A;  2K24 A;  3S4U A;  3ZC0 A;  3I1A A;  4IGU A;  4HTE A;  3LK2 B;  2MYS A;  3QUJ A;  3H3A A;  3KV9 A;  3OBV E;  2Y48 B;  4TV9 E;  4KUM B;  2CXL A;  2E9X C;  5TAO A;  3MJX A;  4WBN E;  4ZHQ E;  1BR0 A;  2E9X A;  2VKD A;  4PJL A;  4XBF B;  2YU2 A;  2CCQ A;  3PUS A;  2WAU A;  3FHN A;  4CZZ B;  3SWH A;  5KX5 E;  3Q9D A;  4G2A A;  3RKO A;  1MMN A;  3KBT A;  5JDF A;  1WYB A;  2X68 A;  2V7K A;  3ANW B;  2HPJ A;  5LCY A;  5JR9 B;  1H7C A;  2ZMA A;  1YD8 G;  2HH7 A;  4DND A;  5EK4 A;  3HI2 A;  5HYA A;  2CLY C;  4EYU A;  4U72 A;  4L9I A;  3B13 A;  1MIV A;  3VHL A;  1HG2 A;  2QA7 A;  3I0O A;  5DJQ C;  4X1I E;  2SPC A;  2K9A A;  3EDU A;  3RX6 A;  5KDM C;  4FJO A;  4O4J E;  2WSS V;  5ETW A;  2KZ7 B;  5DQW A;  2RA1 A;  3O1I A;  1U5P A;  1NWM X;  2X67 A;  5E0O A;  3ZYM A;  4AQF C;  4QXB B;  1HCI A;  2LSJ A;  4AQF A;  4QX7 B;  3VKG A;  4NUV A;  3BQI A;  3Q5W A;  3UUM A;  4ZI2 D;  3N5L A;  2DI4 A;  3ZN1 B;  4G63 A;  3ZJ2 A;  2LJL A;  2VL8 A;  2YIN A;  4TN7 B;  3ZCJ A;  4B6X A;  3RYH E;  5L3F B;  3R6N A;  5EK3 A;  3C51 A;  3H37 A;  1QUU A;  4UIG A;  5JRC A;  2X51 A;  3TKL B;  4GK5 E;  3SOL A;  4XAX B;  5EZY E;  4E7S A;  3MXZ A;  4H9R C;  3U78 A;  2UXN B;  1YKH B;  1OXZ A;  3NRX A;  4HKA A;  4J2C A;  5HXS A;  3ETU A;  3MA9 A;  4I50 E;  3GN5 B;  5HAX A;  2VK9 A;  2WWU A;  3CQG B;  4H9P C;  5JDQ A;  5JDN A;  2VKH A;  2JQQ A;  3BQL A;  1Y64 B;  2LT3 A;  3FBL A;  3Q5X A;  3RC3 A;  2K5B B;  4UVC B;  5L2L A;  3PTR B;  3K3O A;  4JEH B;  3ZEF B;  3IEE A;  3I9W A;  4M1P A;  1Z0P A;  2CEA A;  4ASK A;  2D0U A;  3AA1 B;  3KV5 A;  4QXH B;  3N9N A;  2V7M A;  4EZ4 A;  4IE5 A;  3O1J A;  3V5U A;  3L09 A;  3P7I A;  1S35 A;  4A56 A;  4UF0 B;  3AVS A;  3I0Q A;  3QC9 A;  2V7L A;  3PUR A;  4OYK A;  4JLE A;  2IW5 B;  3LFM A;  5LYJ E;  2ES0 A;  4H9Q C;  4EIW A;  3AAI A;  3HKD E;  4CI3 B;  3AVR A;  4GK0 E;  4ZI7 E;  3E22 E;  4UEM A;  5IYZ E;  3GWH A;  5ADX L;  5LHG B;  3DP7 A;  3ZPO A;  2L8K A;  4HN9 A;  3ZJ1 A;  2YEV C;  3CWZ B;  2CA5 A;  2MTQ A;  3LG7 A;  5HXH A;  2D2S A;  4UVA B;  3N9M A;  3ESL A;  3CQX C;  5CA1 E;  4L0R A;  2PBI A;  1IJ6 A;  2ZLY A;  2K48 A;  3N9L A;  2L3L A;  4UEL A;  5L3E B;  4IE6 A;  3AA6 B;  1D0Z A;  4EB6 E;  2DCF A;  5BMV E;  5HXR A;  2YK0 A;  4CXW A;  4O8S A;  2PG8 A;  2L9Q A;  3AAE B;  4ZOL E;  1HF8 A;  3LJC A;  4CI2 B;  1LVK A;  4H9N C;  4I4T E;  3UUX B;  2VAS A;  3K3Q C;  1FMW A;  1G73 A;  2Q9Q B;  3GN5 A;  5LG4 A;  1D1B A;  3HKB E;  4PNI A;  3W15 B;  3RC8 A;  4MLK A;  2A2F X;  3OYZ A;  1UCU A;  2N2N A;  2WMN A;  2XAS B;  4I43 B;  4AKL A;  2XTL A;  2ODV A;  1S94 A;  3SS1 A;  2MOZ A;  2KWI B;  4L5G A;  1T98 A;  2Q9Q D;  5JQG E;  2XAF B;  4GYS A;  4HGA A;  5JVD E;  4BA9 A;  5CB4 E;  4ERR A;  3I9Y A;  2E8I A;  1HX8 A;  4QKN A;  2NP9 A;  3ZYK A;  5FXZ A;  3EUH A;  2GK9 A;  2LOP A;  2PJQ A;  4TZ4 C;  3RYF E;  3WAK A;  5JDM A;  3UUL A;  4MBQ A;  1IAP A;  1E1H B;  2LEH A;  2CXF A;  3EDV A;  4KMC A;  5A1L A;  5M4Y A;  1EZ3 A;  4X1Y E;  3C64 A;  3F57 A;  2XAG B;  2WMO A;  1LRZ A;  4P0B A;  5J1G A;  3CX8 B;  4I55 E;  4YLH A;  2EHO C;  4QWN B;  3N2O A;  2H7O A;  1ZKE A;  4GYR A;  4HEA A;  5J2T E;  2PFV A;  2V7I A;  2EHO A;  3HR0 A;  3CML A;  2N9D A;  3ZYL A;  3LK4 2;  3ZC1 A;  3ZCI A;  5LJN A;  4ADZ A;  2J1D G;  3ZMT B;  4F6R C;  3KV6 A;  2W63 A;  3SRZ A;  2VKJ A;  3P8C D;  4IDZ A;  4PW8 A;  4IE0 A;  2DWG A;  2A72 A;  3MK7 C;  4AQG A;  1QSD A;  4ZS2 A;  2D5U A;  4CXY A;  4PFO A;  2X9X A;  3C4W A;  1HS7 A;  2CMR A;  2XAJ B;  2BDE A;  3MZK B;  4UVB B;  5FP3 A;  2Z6E A;  4BAY B;  3C50 A;  5L3C B;  2ODU A;  3FXE B;  2BVM A;  3KDS E;  1D0Y A;  4H9O C;  1BR4 A;  3K8P C;  5FY0 A;  4O2A E;  2M67 A;  2C0S A;  2V7J A;  2JRK A;  4DMV A;  2NTX A;  3UUN A;  1BR1 A;  2X9H A;  2W0G A;  2CWO A;  3DJB A;  2ZM0 A;  5JR9 C;  3OKQ A;  3NZP A;  5GON E;  4O4L E;  5JR9 A;  3ANW A;  1FMV A;  2JJ9 A;  2V1D B;  3MAC A;  1MMD A;  4QHO A;  2XAH B;  3R84 B;  4IE7 A;  3ZMV B;  2W00 A;  2DWK A;  4YJ3 E;  2B1E A;  3HKC E;  5F3J A;  4X1K E;  5LBQ B;  4YJ2 E;  4OYJ A;  4TX5 A;  1HG5 A;  3HKE E;  5L3D B;  4ZI2 C;  1WRD A;  1D1A A;  4OFZ A;  4KP3 C;  5CA0 E;  3AA7 B;  5KMG P;  2H3R A;  4O4I E;  2E9X B;  3RH3 A;  2XQY A;  4EAH A;  2H7V C;  1LKX A;  2KND A;  1ZHC A;  2OA5 A;  3LK3 B;  5JRE A;  2JMK A;  4MFR A;  4DO0 A;  4U74 A;  3C98 B;  2CWY A;  5JDL A;  3CKD A;  4PK4 A;  3BQK A;  2WBL A;  2VKO A;  3EVY A;  2KMF A;  1WR6 A;  2X0L B;  2E9X D;  2YU1 A;  3IBP A;  3IHR A;  3CX6 B;  4IIJ E;  3FB2 A;  2LHN A;  4IST A;  4PJM A;  3CVR A;  1G8X A;  4AKG A;  1MND A;  4ANJ A;  2CLY B;  2LSK A;  2UXX B;  3PUA A;  4IE4 A;  5L3B B;  3B57 A;  5JH7 E;  4NUU A;  3MKD A;  2VWA A;  3LBX B;  4AKH A;  4WBO A;  3CPZ A;  4ZI3 D;  5JDH A;  4C90 A;  4IHJ E;  5FYM A;  4GIW A;  1D0X A;  4BJM A;  4O2B E;  4K0U A;  3RRW A;  1KNZ A;  3ZMS B;  4AXP A;  1YKE B;  5IHY A;  3F2E A;  4P09 A;  2RP4 A;  1OWA A;  5FMN A;  4DBQ A;  4ILU A;  2LHR A;  3JC6 D;  3PUQ A;  3ZMZ B;  5FY7 A;  3K3N A;  3NZQ A;  3E0Z A;  2C5J A;  3PE0 A;  2NOX A;  3RYI E;  4P0A A;  4JEU B;  2LE8 A;  1IZN B;  3PDY A;  4UXN B;  2KIN B;  3AB3 B;  3KBU A;  3KFW X;  2XHE B;  3N2K E;  4O4H E;  5J2U E;  3KV4 A;  4PFP A;  5F8P A;  3O9X A;  1SA0 E;  2QGS A;  3Q2M A;  4H63 V;  4ISS A;  4E7Z A;  4UF0 A;  4DMW A;  4UV9 B;  2NW8 A;  2XUE A;  5FXV A;  4DBR A;  2JPF A;  2LSY A;  5H6R B;  3PUG A;  2Y8D A;  1US7 B;  1B7T A;  2BVL A;  2LSI A;  3DTO A;  1FIO A;  5LGU B;  2C5I T;  4C91 A;  5FXW A;  2DHR A;  4H9S E;  4ZI3 C;  5HWY A;  5JDG A;  4MHC A;  3A5X A;  4HFV A;  4GOU A;  1YW0 A;  5FNV E;  2DLR A;  2XAQ B;  4AKR B;  3D0T A;  3U3I A;  5LGT B;  1SHZ C;  2N1G A;  3LBX A;  2X9W A;  5DQV A;  5LP6 E;  1HTJ F;  5HXE A;  3JC6 C;  2ZM2 A;  4H63 H;  3ZLI A;  3GMI A;  2IC6 A;  1WLX A;  1WYC A;  1HFA A;  2Q9Q C;  3N2G E;  3AAA B;  3OJA A;  2Q9Q A;  5LJM A;  4OK0 A;  3AA0 B;  3BK9 A;  3HL6 A;  2Y6X A;  1UX4 A;  1V9D A;  4TV8 E;  2CM0 A;  3WI3 A;  4UV8 B;  3UFE A;  3NRY A;  5HWX A;  2WM9 A;  5HXC A;  3L3P A;  4N78 D;  2NWB A;  2ACX A;  4AKI A;  4FI5 A;  5EK2 A;  2IAK A;  2W62 A;  3ETV A;  1KK7 A;  4XZC A;  5LA6 E;  3ZN0 B;  3KVA A;  3RYC E;  5LGN B;  2P9B A;  4ZS3 A;  4CXX A;  2CE7 A;  4DVD A;  2G0U A;  4CQI A;  1CUN A;  1NAF A;  5FY1 A;  1VOM A;  5LHI B;  4PJJ A;  4EOZ B;  2I59 A;  4EXT A;  2IC9 A;  5DAB A;  3PU3 A;  4PK6 A;  3UTK A;  2NW7 A;  3E08 A;  3M65 A;  3O1H A;  4PJN A;  5LHH B;  3HA4 A;  3KIN B;  4JUY A;  3CQC B;  4QXC B;  3C4Z A;  1U4Q A;  1D1C A;  2VB6 A;  5LNK A;  3NBX X;  2KLQ A;  4TUY E;  3V5S A;  3PU8 A;  4PAG A;  4PK5 A;  5C8Y E;  3FBZ A;  1VRB A;  4YFS A;  5H6Q B;  5LOV E;  2W61 A;  2D0T A;  4BJN A;  1AJ3 A;  3N9Q A;  2NTY A;  2V26 A;  3N9P A;  3VU7 H;  3GA8 A;  5LBM A;  1ZEE A;  2KWH A;  1LVF A;  4X20 E;  4WNK A;  3UT5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...