4V1Av

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
YRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERRXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4v1av00
4V1Av 3J7Yq
chains in the Genus database with same CATH superfamily
5AQLB 3P4SA 5FMNA 1XNQT 5FL0A 5ABFA 4DBQA 2YINA 4EXTA 1I94T 4DV5T 4LF7T 2QA7A 4UXNB 3TKLB 4ANJA 5DABA 2BS4A 3OYXA 3RRWA 4OX9T 3H3AA 4YHJA 5LHHB 2KZ7B 4GK5E 2X0HA 5HCJA 2WMNA 1M62A 2QYWA 3LBXB 4CXXA 4TV8E 1OXZA 2E2AA 1I6ZA 2J1DG 3SFDA 4P0AA 4H9NC 5EK4A 3RYFE 4PW8A 2DWGA 4HWCA 1J1JA 2Q9QB 2AXDS 2WBLA 4JEUB 3UU3A 5ABHA 1LKXA 3FBZA 3QB5A 1HCIA 4C91A 5ABGA 3LJCA 4MLKA 3R6NA 3V5UA 5HXHA 5LOVE 1ZEEA 2XM1A 2I59A 4TWFA 4WNKA 2KSRA 5FY7A 2D0UA 3AEBA 3DP7A 4ISSA 5LCYA 1WRDA 1J5ET 2IC9A 3ZMVB 2L8KA 3U3IA 3MJXA 3E0ZA 3MKDA 3PUVF 4NUUA 1JNRA 2BS2A 4HE8A 3P4PA 2NR4A 4DIDB 1XNRT 2V7LA 4TWDA 4AQFC 1S94A 4QXCB 5LBQB 4KI0F 3A5XA 4KUMB 3VKHA 3ZEFB 2YDQA 4GOUA 4ZS2A 2LM2A 2E5VA 5AQPB 1T7SA 4ZXLA 2H7VC 5ADXL 3PU3A 2XSBA 2YU2A 1OWAA 2CEAA 3AA6B 3AB3B 4AQYT 4EV6A 2XASB 2FUPA 4HWDA 2WS3A 2I0MA 2YN6A 2X67A 3NZQA 4I43B 2BDEA 3TLVA 3PUQA 4PK6A 2WM9A 3MA9A 4H63V 4WZXA 4DV6T 4KBMB 2UUCT 5FYMA 2C5KT 4I4TE 3LFMA 3NWIA 2Z6EA 4DR1T 2KWIB 3BQIA 3OTOT 1XMOT 5FY1A 5FXZA 3GMIA 3JC6D 4BJMA 5AQKB 1IJ6A 4YHHT 4YTNA 4HWHA 2XJ7A 3OVUA 4PAGA 5IHYA 3T8OA 3UUXB 1IBKT 2AE9A 1CHUA 3ONXA 4K0UA 4JI6T 5HXRA 4U7IA 4IL4A 2CBJA 4HFDA 3LK3B 2UU9T 5LXTE 3T1HT 3PE0A 3C64A 4KP3C 4NXNT 4ILUA 4A97A 4YSYA 4DV7T 5JQGE 4ZI3C 4EIWA 1HFAA 2MYSA 2EHOB 3CKDA 5JVDE 4IT4A 2A3DA 2G0UA 4JEHB 4GYRA 2HPLA 5AQIB 2VKDA 3UTKA 1D1CA 3EDUA 2N9DA 3RGLA 2BS3A 2Y6XA 4YT0A 3C51A 3DJBA 3GN5A 2ACXA 3OJAA 4IE6A 3IA3A 2XQAA 4X20E 1T98A 2F4VT 2X9XA 3PUGA 3RPUA 4IE0A 5L2LA 4IDQA 1UCUA 3Q2MA 2E9XA 4IL9A 2LM9A 4U2YA 5A1LA 2NW9A 3ABVA 4HFEA 4QH4A 2WB5A 1Z8UA 4QX8B 4MBQA 1FMVA 5KXJA 4DV2T 2DI4A 4MFRA 2LSKA 2W61A 2X0LB 4U72A 2E9XD 3N2GE 4HTEA 2X51A 5AQSB 5HXEA 3MACA 2PJQA 5AQVB 4LF4T 2LRKA 3AAAB 4ZZCA 3RKOA 3WAJA 4NPPA 4U3CA 1D0ZA 3BQKA 3KV6A 4U2ZA 5LJMA 4YFSA 4UEMA 5LNKA 4PJJA 4KHPT 4DV4T 3I1AA 4JI3T 4JUYA 4DR7T 2A9UA 2PBIA 2VWAA 4OYJA 2Q9QC 2UUAT 4IHJE 4LFCT 3P4WA 3CIRA 4Z8XA 4NUVA 1Y01A 2Q9QA 3VR8A 4I0UA 4GIWA 2XQYA 5J2UE 4DR6T 3GWHA 1D1AA 1MNDA 2C0SA 3SWHA 3HR0A 4YJ2E 2LSJA 2VKOA 3PU8A 5JR9A 1IAPA 3ZSTA 2LLYA 2MBGA 1B7TA 3I9YA 5LGUB 4N78D 1MIVA 4PFPA 4M1PA 2M67A 2YU1A 3ETVA 1W0AA 5LA6E 5JR9C 3L09A 2IAKA 3AVSA 4I50E 4HWIB 3SRZA 2NP9A 1MIWA 2XZEA 1KF6A 5C8YE 4UR9A 5L4EA 2X66A 3KBTA 3SS1A 5LHGB 2W67A 4ISTA 4QXHB 3N9QA 1AJ3A 2JJ9A 4IDPA 5CA1E 1E7PA 4JI5T 2XQ8A 4H63H 3PUYF 3AA1B 3V5SA 4UVAB 5JDLA 5J0ZA 1UX5A 3KFWX 3RH3A 2ODUA 1OEDC 3ZLIA 1UK5A 1W09A 2ES0A 3TLWA 5HYAA 3AE1A 1FMWA 2BG9A 3S4UA 3TLUA 2JPFA 2PTFA 1XWMA 5LB7B 4B6XA 2WQYA 3E08A 1N36T 3N9LA 4L5GA 2XQ6A 3UT5E 2WZHA 1D0YA 2EHOA 4O4JE 5AQTB 1J5WA 4PK5A 4AKRB 5F5WA 3VKGA 1HS7A 2VQFT 2CHOA 1OEDE 3R84B 3RRCA 4HFVA 4L0RA 5JDNA 2LE8A 2XAHB 4U74A 2LT3A 5KMGP 3ZJ1A 3GN5B 4HKAA 1L0VA 2WDVA 2WU2A 3Q5EA 3NZPA 2W0GA 2YEVC 4KMCA 3P4RA 4X5TA 1HG5A 5FXWA 3O9XA 2LRLA 1M7KA 4EEBA 2VQET 4GKJT 2CRBA 2VB6A 2JMHA 2XQ4A 5C3JA 5FL1A 4TN7B 1QUUA 5LYJE 2W2UA 3JADA 1XMQT 2LEHA 3O1HA 3ONJA 5L4HA 3VRBA 2UXDT 5JDFA 2XQ7A 1UURA 2FJAA 4TWHA 3UU5A 4OHFA 4ZEYA 3I0OA 2UXBT 3KV5A 3UUBA 4A56A 4EB6E 3PURA 2X9YA 3ZMZB 3CQGB 4AXPA 4UIGA 2FJDA 4GYSA 4GK0E 4DMWA 2CM0A 4EEDA 2DNXA 4Z90A 5JREA 3AE7A 2RP4A 5LJNA 2NOXA 2H3RA 4HFIA 4IREA 4AKLA 1SUMB 2VK9A 3M3ZB 2V6XA 1NAFA 2P9BA 3OKQA 3X1DA 3P7IA 1XZYA 3ETUA 2J62A 2GK9A 3JAFA 4I55E 4X1YE 2B1EA 1BR2A 3GA8A 5H6QB 4ASKA 1MIYA 2DCFA 2XHEB 5HEJA 1WFDA 2OA5A 2WY2A 1CUNA 3TLTA 2BVLA 1WLXA 2A2FX 2XTLA 5EZYE 3RX6A 3EDVA 2FJEA 4V1Av 2LOPA 2IMLA 5HAXA 2CBIA 1W9RA 2V26A 5FXVA 4AQGA 3B13A 4AQFA 3CK6A 2V1DB 4AKHA 2VL0A 4EZ4A 4ZZBA 3ZCIA 4CI1B 2CCQA 1U5PA 2YDRA 2WSSV 3SFEA 4O2AE 4EOZB 4ZHQE 2EHOD 2CMRA 3BQLA 2V5CA 4H9RC 3MZKB 4ZI2C 1D1BA 2DL1A 3ZYKA 2DHRA 2J47A 2MTQA 3H3MA 5L47A 4DUYT 3NVOA 5JR9B 3A7MA 3HKDE 3Q5WA 2E9XB 4IE7A 2C5JA 4X1KE 4YSZA 2LSGA 3I0QA 3HA4A 5AQFB 4BAYB 3O4XE 2Y48B 3CX7B 2RPAA 4OK0A 4YJ3E 4MALA 4CZZB 3EAMA 4NIQA 3Q5XA 4IIJE 3L8RA 5LMNT 4U31A 4H9QC 5FKYA 4ILCA 3RYIE 1BR0A 5DQWA 3RKGA 4LF5T 3CQXC 2XSAA 4ILAA 4AISA 3QB5K 4O8SA 4COFA 2NWBA 2ZLYA 2ZMAA 1US7B 3ZYLA 5IWAT 2D0TA 1IJ5A 2JQHA 4QXBB 3F57A 3C4XA 3FZFB 5FXXA 3N2KE 4YTMA 4YTPA 2KXPB 3D0TA 5LBMA 2LHRA 3AXJA 5AQHB 1KK7A 1SE7A 2L3LA 4K0KT 2VL8A 3AA0B 5HEHA 3WI3A 4DR3T 2XAGB 2CA5A 2XQ5A 3PV0F 4H9SE 4U33A 5AFUL 4DV3T 1HX1B 3AEFA 5FVKA 3AAIA 2DWKA 1LVFA 1T8BA 2BBJA 4UF0A 5FP3A 3RF1A 2WDQA 3ZT7A 3K3QC 2D9DA 4CI3B 3QOFA 3Q5DA 2LHNA 4LMJA 4LFBT 5AQRB 2CXFA 4ZI7E 4DV1T 2LOSA 3FXDB 2JQQA 2X9HA 3N9NA 2D2SA 4CXWA 1KEYA 3A8YC 4TZ4C 4XAXB 5AQMB 3UFEA 3QUJA 3IF8B 2VKJA 3LK2B 3BK9A 2DLRA 1KFYA 3F2EA 4DMVA 2NTYA 1XDPA 2LSIA 3HKBE 5L3DB 4JI0T 5J2TE 3VU7H 1MMAA 1WR0A 4AI6A 2ZM2A 3IEEA 3PTRB 2NW8A 2LJLA 3KDSE 1OEDB 1ZP0A 4HEAA 4HFCA 3NKZA 3RIUA 5HWXA 5IYZE 3PUZF 3ZSSA 4PFOA 4QH5A 4HN9A 4O4IE 1Y64B 4DUZT 3RC8A 3H37A 5JDMA 3K3NA 4EAHA 1IZNB 4O2BE 3AEDA 4LF8T 3ZN0B 3J7Yq 2MPKA 2Y8DA 3ZMSB 3OPCA 5JDHA 3G06A 5H6RB 3UUMA 2K5BB 2R6GF 3ZC1A 1N34T 2KINB 4LMLA 3RQUA 5L3CB 4DR5T 3UFGA 2WWUA 1GQEA 2ZM8A 4JI8T 1T72A 3JAEA 2XM2A 3K8PC 5GONE 5E0OA 3AAEB 1NENA 2LSYA 2CHNA 2VKHA 3N9MA 3K3OA 2IIUA 1HG2A 3AEAA 3ANWA 3O1IA 4FJOA 2W63A 4KHZF 3DTOA 2BKNA 2WMOA 5EK2A 2K3WA 4DR4T 2WP9A 4TUYE 3OBVE 4CXYA 4E7ZA 5AQUB 2HN1A 3PDYA 2IC6A 2UXNB 2UXCT 2V7IA 4UVCB 4LFAT 1N33T 2XQ3A 2V7KA 2XPKA 1X79A 3CX6B 2HH7A 4DV0T 2HN2A 2V8SV 4A5XA 2JQ9A 1HF8A 3KVAA 3N2OA 2BG9B 5AQOB 3RC3A 1YXRA 2Q9QD 1ZKEA 1VCSA 3AA7B 3AVRA 4KX6A 3WAKA 1SHZC 2EHOC 2XY8B 3FXEB 1KNPA 4IDNA 4TX5A 1WYCA 4U7YA 5F8PA 5HXCA 4EYYR 3ZKRA 5ABFB 1HX8A 3U78A 2KNDA 5HCMA 2WWVA 5BMVE 2YKSA 4JYAT 2H88A 3P4QA 1WR6A 3LK42 4OYKA 4HGAA 3EABA 2L9QA 3CVRA 4X65T 5J1GA 4X66T 3RI5A 1MMGA 3W15B 5CJ5A 2XUEA 5AQJB 3O1JA 4XBFB 4GKKT 5KDMC 3LBXA 4X1IE 3F31A 2W66A 1N32T 4JI7T 4AIUA 2K24A 2XQ9A 4MHCA 3CWZB 4X64T 2OLTA 1BR1A 4G63A 4F6RC 4NXMT 5JH7E 2CWYA 3T1YT 2BBHA 3OYZA 3UUNA 3ZT5A 3I9WA 4PJLA 2CE7A 4HWFA 3ZMTB 3C50A 3KV9A 5JTGA 3Q9DA 3QC9A 4YSXA 5LHIB 3AE3A 3C4WA 1E2AA 4WYVA 5FNVE 3FZLB 1ZHCA 2SPCA 3NBXX 2VVSA 5FY0A 3M65A 1VCTA 3HKCE 3ZJ2A 4A98A 5M4YA 3AE9A 2PG8A 3HI2A 3AXJB 2NTXA 3P8CD 3ZCJA 1X9BA 3ZYMA 5C2TA 5KX5E 4IE5A 4DBRA 4H9OC 3CX8B 1UGOA 4ZI3D 4IDZA 5LG4A 1HNXT 2IHR1 2IUBA 2A72A 3AE6A 1LRZA 2BKOA 3CPZA 4UVBB 2WU5A 1KNRA 2CXDA 2K9AA 3AE5A 3AEEA 1FIOA 4IE4A 4YY3T 4EGWA 1WYBA 1Z0PA 3VHLA 4HFHA 1JNZA 4CQIA 1BR4A 4QWNB 2BG9E 2JRKA 5JDGA 1FEWA 3AE8A 3AE2A 4TNWA 2IW5B 3C4ZA 3JC6C 4EYUA 4P09A 3P50A 4Q25A 2V6YB 4XZCA 5HEGA 2UUBT 3N9PA 3EHZA 3RYHE 3ZC0A 1QSDA 1NWMX 3FB2A 3VRAA 5FVLA 3FZKB 3ZMUB 3CMLA 5HXSA 3UQ7A 1VOMA 1OEDA 2V5DA 3ANWB 3UU8A 5L3EB 3PUAA 2K48A 2VASA 3E22E 2BZBA 2FBWA 1H7CA 2MAWA 3FBLA 3MK7C 4WBOA 2CWOA 2N2NA 4JLEA 4DO0A 2OV9A 3IHRA 2M6IA 4O4LE 2JMKA 4IGUA 4C90A 4JV5T 2ACZA 4QHOA 4TNVA 4TV9E 1HNZT 4OFZA 3RLFF 3KBUA 4WBNE 4QH1A 3RYCE 4L9IA 2QVAA 2X0YA 4PK4A 5DQVA 1SA0E 3KINB 4P0BA 5EK3A 3N5LA 2H89A 3HKEE 1ZOYA 3JCFA 4UV8B 3C98B 2QGSA 3K1SA 3KVBA 3NRXA 4ERRA 5BR8T 3LSVA 1IBMT 1D0XA 2RA1A 3KV4A 5HEOA 4F8HA 4X62T 2HHHT 4AKGA 1YKHB 4WW0A 5ETWA 3UULA 2WAUA 1MNEA 1G8XA 2W62A 3RIAA 1U4QA 4O4HE 5L3GB 3AECA 3PUSA 2LKGA 3ZT6A 2YOEA 4CN1A 4DNDA 1HR0T 4E7SA 4DR2T 4PNIA 1QLBA 4PJMA 3RIUC 4ADZA 3ZN1B 4PJNA 5JRCA 3ONLC 3UU6A 3TLSA 5HEUA 4B3ST 2FJBA 4YXDA 3PUXF 4UF0B 5AQGB 1UUSA 2BKPA 3QK6A 3IBPA 1ZV4X 1WCRA 3B57A 3FZMB 5CGMA 5TAOA 3L39A 4BA9A 3PUWF 3MXZA 2NW7A 4CI2B 4LF6T 4CN6A 4QKNA 4EZHA 1YQ4A 2CLYB 3NRYA 4G2AA 1UX4A 1KNZA 3EVYA 1HNWT 4B3TT 2LKHA 2KWHA 2PFVA 3AE4A 2XAJB 2ZM0A 2QRXA 2N1GA 3AEGA 3RIFA 3SOLA 1R8IA 2V7MA 1W0BA 4JI1T 3QNUA 2X68A 2C5IT 3L3PA 2M6BA 4LF9T 3LG7A 2JQKA 1YD8G 2MOZA 2W4XA 2KMFA 2YDSA 3N9OA 2D5UA 3ESLA 4YLHA 2BG9C 4HFBA 5L3BB 4B3MT 4JI4T 2I6HA 4LMKA 4BJNA 1YKEB 2ODVA 1V9DA 2VURA 3CQCB 3LDQB 5LGNB 5L3FB 4CN4A 1IBLT 1XDOA 2CLYC 3EUHA 4J2CA 1O3XA 1S35A 1HTJF 3B5MA 4QX7B 4UELA 2V7JA 5AQNB 3UQ4A 2WZIA 3ZPOA 2YK0A 4ZOLE 5LP6E 5AQQB 1VRBA 5CA0E 1FJGT 2V6YA 3J9X1 5LGTB 1NEKA 2E8IA 5JRCB 4JI2T 2X9WA 5HWYA 3RHWA 1LVKA 2JIWA 2KT9A 5F3JA 1YQ3A 2HPJA 2CXLA 2WDRA 2XAFB 2KLQA 3PJAJ 4JBWF 4ZI2D 3UU4A 5CFBA 2VVNA 1EZ3A 4DVDA 2J4GA 5LMUT 4ZS3A 3RQWA 1YW0A 3HL6A 4FI5A 5DJQC 4ILBA 4UV9B 5CB4E 2BVMA 1G73A 3VR9A 2H7OA 2CPTA 3EI0A 5ABEA 2B76A 5LG3A 1DU2A 4B3RT 4IDOA 5JDQA 3FZHB 5IUXA 4Z91A 2E5LT 2WCAA 1E1HB 2XAQB 1MMNA 3PJAA 3FHNA 1MMDA 2E9XC 2UXXB 4H9PC 4P1NA 2IDOB 4AKIA 2ZM6T 2W00A
chains in the Genus database with same CATH topology
5FMNA 4DBQA 2YINA 4EXTA 2QA7A 4UXNB 3TKLB 4ANJA 5DABA 3OYXA 3RRWA 3H3AA 4YHJA 5LHHB 2KZ7B 4GK5E 2WMNA 3LBXB 4CXXA 4TV8E 1OXZA 2J1DG 4P0AA 4H9NC 5EK4A 3RYFE 4PW8A 2DWGA 2Q9QB 4JEUB 2WBLA 1LKXA 3FBZA 4C91A 1HCIA 3LJCA 4MLKA 3R6NA 3V5UA 5HXHA 5LOVE 1ZEEA 2I59A 4WNKA 5FY7A 2D0UA 3DP7A 4ISSA 5LCYA 1WRDA 2IC9A 3ZMVB 2L8KA 3U3IA 3MJXA 3E0ZA 3MKDA 4NUUA 4HE8A 2V7LA 4AQFC 1S94A 4QXCB 5LBQB 3A5XA 4KUMB 3VKHA 3ZEFB 4GOUA 4ZS2A 5ADXL 2H7VC 3PU3A 2YU2A 1OWAA 2CEAA 3AA6B 3AB3B 2XASB 3NZQA 2X67A 2BDEA 3PUQA 4PK6A 2WM9A 3MA9A 4H63V 4KBMB 5FYMA 2C5KT 4I4TE 3LFMA 2Z6EA 2KWIB 3BQIA 5FY1A 5FXZA 3GMIA 3JC6D 4BJMA 1IJ6A 5IHYA 4PAGA 3T8OA 3UUXB 3ONXA 4K0UA 5HXRA 3LK3B 5LXTE 3PE0A 3C64A 4KP3C 4ILUA 5JQGE 4ZI3C 4EIWA 1HFAA 2MYSA 2EHOB 3CKDA 5JVDE 2A3DA 2G0UA 4JEHB 4GYRA 2HPLA 2VKDA 1D1CA 3EDUA 2N9DA 2Y6XA 3C51A 3DJBA 3GN5A 2ACXA 3OJAA 4IE6A 4X20E 1T98A 2X9XA 3PUGA 3RPUA 4IE0A 5L2LA 1UCUA 3Q2MA 2E9XA 5A1LA 2LM9A 2NW9A 4QX8B 1FMVA 2DI4A 4MFRA 2LSKA 2W61A 2X0LB 4U72A 2E9XD 3N2GE 4HTEA 2X51A 5HXEA 3MACA 2PJQA 3AAAB 3RKOA 3WAJA 1D0ZA 3BQKA 3KV6A 5LJMA 4YFSA 4UEMA 5LNKA 4PJJA 3I1AA 4JUYA 2VWAA 2PBIA 4OYJA 2Q9QC 4IHJE 4Z8XA 4NUVA 2Q9QA 4GIWA 2XQYA 5J2UE 3GWHA 1D1AA 1MNDA 2C0SA 3SWHA 3HR0A 4YJ2E 2LSJA 2VKOA 3PU8A 5JR9A 1IAPA 2MBGA 1B7TA 3I9YA 5LGUB 4N78D 1MIVA 4PFPA 4M1PA 2M67A 2YU1A 3ETVA 5LA6E 5JR9C 3L09A 2IAKA 3AVSA 4I50E 3SRZA 2NP9A 1MIWA 5C8YE 5LHGB 2X66A 3KBTA 3SS1A 4ISTA 4QXHB 3N9QA 1AJ3A 2JJ9A 5CA1E 4H63H 3AA1B 3V5SA 4UVAB 5JDLA 1UX5A 3KFWX 3RH3A 2ODUA 3ZLIA 2ES0A 5HYAA 1FMWA 3S4UA 2JPFA 4B6XA 3E08A 3N9LA 4L5GA 3UT5E 1D0YA 2EHOA 4O4JE 4PK5A 4AKRB 3VKGA 1HS7A 3RRCA 3R84B 4HFVA 4L0RA 5JDNA 2LE8A 2XAHB 4U74A 2LT3A 5KMGP 3ZJ1A 3GN5B 4HKAA 3NZPA 2W0GA 2YEVC 4KMCA 1HG5A 3O9XA 2VB6A 2JMHA 4TN7B 1QUUA 5LYJE 2LEHA 3O1HA 5JDFA 4OHFA 3I0OA 3KV5A 4EB6E 3PURA 2X9YA 3ZMZB 3CQGB 4AXPA 4UIGA 4GYSA 4GK0E 4DMWA 2CM0A 2DNXA 5JREA 2RP4A 5LJNA 2NOXA 2H3RA 4AKLA 2VK9A 1NAFA 2P9BA 3OKQA 3P7IA 4I55E 3ETUA 4X1YE 2GK9A 5H6QB 2B1EA 1BR2A 3GA8A 4ASKA 1MIYA 2DCFA 2XHEB 2OA5A 1CUNA 2BVLA 1WLXA 2A2FX 2XTLA 5EZYE 3RX6A 3EDVA 4V1Av 2LOPA 5HAXA 2V26A 5FXVA 4AQGA 3B13A 4AQFA 2V1DB 4AKHA 4EZ4A 3ZCIA 4CI1B 2CCQA 1U5PA 2WSSV 4O2AE 4EOZB 4ZHQE 2EHOD 2CMRA 3BQLA 4H9RC 3MZKB 4ZI2C 1D1BA 3ZYKA 2DHRA 2MTQA 5JR9B 3HKDE 3Q5WA 2E9XB 4IE7A 2C5JA 4X1KE 2LSGA 3I0QA 3HA4A 4BAYB 3O4XE 2Y48B 3CX7B 4OK0A 4YJ3E 4CZZB 4MALA 3Q5XA 4IIJE 4H9QC 3RYIE 1BR0A 5DQWA 3CQXC 4O8SA 2NWBA 2ZLYA 2ZMAA 1US7B 3ZYLA 2D0TA 1IJ5A 4QXBB 3F57A 3C4XA 5FXXA 3N2KE 2KXPB 3D0TA 5LBMA 2LHRA 1KK7A 2L3LA 2VL8A 3AA0B 3WI3A 2XAGB 2CA5A 4H9SE 5AFUL 3AAIA 2DWKA 1LVFA 5FP3A 4UF0A 4CI3B 3K3QC 2LHNA 2CXFA 4ZI7E 2LOSA 3FXDB 2JQQA 2X9HA 3N9NA 2D2SA 4CXWA 4TZ4C 4XAXB 3UFEA 3QUJA 3IF8B 2VKJA 3LK2B 3BK9A 2DLRA 3F2EA 4DMVA 2NTYA 3HKBE 2LSIA 5L3DB 5J2TE 3VU7H 1MMAA 4AI6A 2ZM2A 3IEEA 3PTRB 2NW8A 2LJLA 3KDSE 4I43B 4A56A 4HEAA 5HWXA 5IYZE 4PFOA 4HN9A 4O4IE 1Y64B 3RC8A 3H37A 5JDMA 3K3NA 4EAHA 1IZNB 4O2BE 3ZN0B 3J7Yq 2Y8DA 3ZMSB 5JDHA 5H6RB 3UUMA 2K5BB 3ZC1A 2KINB 5L3CB 2WWUA 2ZM8A 5GONE 3K8PC 5E0OA 3AAEB 2VKHA 2LSYA 3N9MA 4FJOA 3K3OA 3ANWA 1HG2A 3O1IA 4MBQA 5EK2A 2W63A 3DTOA 2WMOA 4TUYE 3OBVE 4CXYA 4E7ZA 3PDYA 2IC6A 2UXNB 2V7IA 4UVCB 2V7KA 1X79A 3CX6B 2HH7A 1HF8A 3KVAA 3N2OA 3RC3A 2Q9QD 3WAKA 1ZKEA 3AVRA 3AA7B 1SHZC 2EHOC 3FXEB 5HXCA 4TX5A 1WYCA 4EYYR 5F8PA 1HX8A 3U78A 2KNDA 5BMVE 1WR6A 3LK42 4OYKA 4HGAA 2L9QA 3CVRA 5J1GA 1MMGA 3W15B 2XUEA 3O1JA 4XBFB 5KDMC 3LBXA 4X1IE 3F31A 2K24A 4MHCA 3CWZB 4G63A 1BR1A 4F6RC 5JH7E 2CWYA 3OYZA 3UUNA 3I9WA 4PJLA 2CE7A 3ZMTB 3C50A 3KV9A 3Q9DA 3QC9A 5LHIB 3C4WA 5FNVE 5FY0A 1ZHCA 2SPCA 3NBXX 5JRCA 3M65A 3ZJ2A 3HKCE 5M4YA 2PG8A 3HI2A 3P8CD 2NTXA 3ZCJA 3ZYMA 5KX5E 5LG4A 4IE5A 4DBRA 4H9OC 3CX8B 4ZI3D 4IDZA 2A72A 1LRZA 3CPZA 4UVBB 4IE4A 2CXDA 2K9AA 1FIOA 1WYBA 1Z0PA 3VHLA 4CQIA 1BR4A 4QWNB 2JRKA 5JDGA 1FEWA 2IW5B 3C4ZA 3JC6C 4EYUA 4P09A 4XZCA 3N9PA 3RYHE 3ZC0A 1QSDA 1NWMX 3FB2A 3ZMUB 5HXSA 3CMLA 1VOMA 3ANWB 5L3EB 3PUAA 2K48A 2VASA 3E22E 2BZBA 3FBLA 1H7CA 4DO0A 3MK7C 4WBOA 2CWOA 2N2NA 4JLEA 3IHRA 4O4LE 2JMKA 4IGUA 4C90A 4QHOA 4TV9E 4OFZA 4WBNE 3KBUA 3RYCE 4L9IA 4PK4A 5DQVA 1SA0E 3KINB 4P0BA 5EK3A 3N5LA 5FXWA 3HKEE 3UTKA 4UV8B 3C98B 2QGSA 3KVBA 3NRXA 4ERRA 1D0XA 2RA1A 3KV4A 4AKGA 1YKHB 4WW0A 5ETWA 3UULA 2WAUA 1MNEA 1G8XA 2W62A 1U4QA 4O4HE 3PUSA 4DNDA 4E7SA 4PNIA 4PJMA 4ADZA 3ZN1B 4PJNA 4UF0B 3QK6A 3IBPA 1ZV4X 3B57A 5TAOA 4BA9A 3MXZA 2NW7A 4CI2B 4QKNA 4EZHA 4G2AA 2CLYB 3NRYA 1KNZA 1UX4A 2PFVA 2KWHA 3SOLA 2XAJB 2ZM0A 2N1GA 2V7MA 2X68A 2C5IT 3L3PA 3LG7A 5L3GB 1YD8G 2MOZA 3N9OA 2KMFA 2D5UA 3ESLA 4YLHA 5L3BB 3CQCB 1YKEB 2ODVA 1V9DA 5LGNB 5L3FB 3EUHA 2CLYC 4QX7B 4J2CA 1O3XA 1S35A 1HTJF 4UELA 2V7JA 3ZPOA 5LP6E 2YK0A 4ZOLE 1VRBA 5CA0E 5JRCB 3J9X1 5LGTB 2E8IA 2X9WA 5HWYA 1LVKA 2KT9A 5F3JA 2HPJA 2CXLA 2XAFB 2KLQA 4ZI2D 1EZ3A 4DVDA 4ZS3A 1YW0A 3HL6A 4FI5A 5DJQC 4UV9B 5CB4E 4BJNA 2BVMA 1G73A 2H7OA 5JDQA 1E1HB 2XAQB 1MMNA 3FHNA 1MMDA 2E9XC 2UXXB 4H9PC 3EVYA 4AKIA 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A v;  3J7Y q; 
#chains in the Genus database with same CATH topology
 5AQL B;  3P4S A;  5FMN A;  1XNQ T;  5FL0 A;  5ABF A;  4DBQ A;  2YIN A;  4EXT A;  1I94 T;  4DV5 T;  4LF7 T;  2QA7 A;  4UXN B;  3TKL B;  4ANJ A;  5DAB A;  2BS4 A;  3OYX A;  3RRW A;  4OX9 T;  3H3A A;  4YHJ A;  5LHH B;  2KZ7 B;  4GK5 E;  2X0H A;  5HCJ A;  2WMN A;  1M62 A;  2QYW A;  3LBX B;  4CXX A;  4TV8 E;  1OXZ A;  2E2A A;  1I6Z A;  2J1D G;  3SFD A;  4P0A A;  4H9N C;  5EK4 A;  3RYF E;  4PW8 A;  2DWG A;  4HWC A;  1J1J A;  2Q9Q B;  2AXD S;  2WBL A;  4JEU B;  3UU3 A;  5ABH A;  1LKX A;  3FBZ A;  3QB5 A;  1HCI A;  4C91 A;  5ABG A;  3LJC A;  4MLK A;  3R6N A;  3V5U A;  5HXH A;  5LOV E;  1ZEE A;  2XM1 A;  2I59 A;  4TWF A;  4WNK A;  2KSR A;  5FY7 A;  2D0U A;  3AEB A;  3DP7 A;  4ISS A;  5LCY A;  1WRD A;  1J5E T;  2IC9 A;  3ZMV B;  2L8K A;  3U3I A;  3MJX A;  3E0Z A;  3MKD A;  3PUV F;  4NUU A;  1JNR A;  2BS2 A;  4HE8 A;  3P4P A;  2NR4 A;  4DID B;  1XNR T;  2V7L A;  4TWD A;  4AQF C;  1S94 A;  4QXC B;  5LBQ B;  4KI0 F;  3A5X A;  4KUM B;  3VKH A;  3ZEF B;  2YDQ A;  4GOU A;  4ZS2 A;  2LM2 A;  2E5V A;  5AQP B;  1T7S A;  4ZXL A;  2H7V C;  5ADX L;  3PU3 A;  2XSB A;  2YU2 A;  1OWA A;  2CEA A;  3AA6 B;  3AB3 B;  4AQY T;  4EV6 A;  2XAS B;  2FUP A;  4HWD A;  2WS3 A;  2I0M A;  2YN6 A;  2X67 A;  3NZQ A;  4I43 B;  2BDE A;  3TLV A;  3PUQ A;  4PK6 A;  2WM9 A;  3MA9 A;  4H63 V;  4WZX A;  4DV6 T;  4KBM B;  2UUC T;  5FYM A;  2C5K T;  4I4T E;  3LFM A;  3NWI A;  2Z6E A;  4DR1 T;  2KWI B;  3BQI A;  3OTO T;  1XMO T;  5FY1 A;  5FXZ A;  3GMI A;  3JC6 D;  4BJM A;  5AQK B;  1IJ6 A;  4YHH T;  4YTN A;  4HWH A;  2XJ7 A;  3OVU A;  4PAG A;  5IHY A;  3T8O A;  3UUX B;  1IBK T;  2AE9 A;  1CHU A;  3ONX A;  4K0U A;  4JI6 T;  5HXR A;  4U7I A;  4IL4 A;  2CBJ A;  4HFD A;  3LK3 B;  2UU9 T;  5LXT E;  3T1H T;  3PE0 A;  3C64 A;  4KP3 C;  4NXN T;  4ILU A;  4A97 A;  4YSY A;  4DV7 T;  5JQG E;  4ZI3 C;  4EIW A;  1HFA A;  2MYS A;  2EHO B;  3CKD A;  5JVD E;  4IT4 A;  2A3D A;  2G0U A;  4JEH B;  4GYR A;  2HPL A;  5AQI B;  2VKD A;  3UTK A;  1D1C A;  3EDU A;  2N9D A;  3RGL A;  2BS3 A;  2Y6X A;  4YT0 A;  3C51 A;  3DJB A;  3GN5 A;  2ACX A;  3OJA A;  4IE6 A;  3IA3 A;  2XQA A;  4X20 E;  1T98 A;  2F4V T;  2X9X A;  3PUG A;  3RPU A;  4IE0 A;  5L2L A;  4IDQ A;  1UCU A;  3Q2M A;  2E9X A;  4IL9 A;  2LM9 A;  4U2Y A;  5A1L A;  2NW9 A;  3ABV A;  4HFE A;  4QH4 A;  2WB5 A;  1Z8U A;  4QX8 B;  4MBQ A;  1FMV A;  5KXJ A;  4DV2 T;  2DI4 A;  4MFR A;  2LSK A;  2W61 A;  2X0L B;  4U72 A;  2E9X D;  3N2G E;  4HTE A;  2X51 A;  5AQS B;  5HXE A;  3MAC A;  2PJQ A;  5AQV B;  4LF4 T;  2LRK A;  3AAA B;  4ZZC A;  3RKO A;  3WAJ A;  4NPP A;  4U3C A;  1D0Z A;  3BQK A;  3KV6 A;  4U2Z A;  5LJM A;  4YFS A;  4UEM A;  5LNK A;  4PJJ A;  4KHP T;  4DV4 T;  3I1A A;  4JI3 T;  4JUY A;  4DR7 T;  2A9U A;  2PBI A;  2VWA A;  4OYJ A;  2Q9Q C;  2UUA T;  4IHJ E;  4LFC T;  3P4W A;  3CIR A;  4Z8X A;  4NUV A;  1Y01 A;  2Q9Q A;  3VR8 A;  4I0U A;  4GIW A;  2XQY A;  5J2U E;  4DR6 T;  3GWH A;  1D1A A;  1MND A;  2C0S A;  3SWH A;  3HR0 A;  4YJ2 E;  2LSJ A;  2VKO A;  3PU8 A;  5JR9 A;  1IAP A;  3ZST A;  2LLY A;  2MBG A;  1B7T A;  3I9Y A;  5LGU B;  4N78 D;  1MIV A;  4PFP A;  4M1P A;  2M67 A;  2YU1 A;  3ETV A;  1W0A A;  5LA6 E;  5JR9 C;  3L09 A;  2IAK A;  3AVS A;  4I50 E;  4HWI B;  3SRZ A;  2NP9 A;  1MIW A;  2XZE A;  1KF6 A;  5C8Y E;  4UR9 A;  5L4E A;  2X66 A;  3KBT A;  3SS1 A;  5LHG B;  2W67 A;  4IST A;  4QXH B;  3N9Q A;  1AJ3 A;  2JJ9 A;  4IDP A;  5CA1 E;  1E7P A;  4JI5 T;  2XQ8 A;  4H63 H;  3PUY F;  3AA1 B;  3V5S A;  4UVA B;  5JDL A;  5J0Z A;  1UX5 A;  3KFW X;  3RH3 A;  2ODU A;  1OED C;  3ZLI A;  1UK5 A;  1W09 A;  2ES0 A;  3TLW A;  5HYA A;  3AE1 A;  1FMW A;  2BG9 A;  3S4U A;  3TLU A;  2JPF A;  2PTF A;  1XWM A;  5LB7 B;  4B6X A;  2WQY A;  3E08 A;  1N36 T;  3N9L A;  4L5G A;  2XQ6 A;  3UT5 E;  2WZH A;  1D0Y A;  2EHO A;  4O4J E;  5AQT B;  1J5W A;  4PK5 A;  4AKR B;  5F5W A;  3VKG A;  1HS7 A;  2VQF T;  2CHO A;  1OED E;  3R84 B;  3RRC A;  4HFV A;  4L0R A;  5JDN A;  2LE8 A;  2XAH B;  4U74 A;  2LT3 A;  5KMG P;  3ZJ1 A;  3GN5 B;  4HKA A;  1L0V A;  2WDV A;  2WU2 A;  3Q5E A;  3NZP A;  2W0G A;  2YEV C;  4KMC A;  3P4R A;  4X5T A;  1HG5 A;  5FXW A;  3O9X A;  2LRL A;  1M7K A;  4EEB A;  2VQE T;  4GKJ T;  2CRB A;  2VB6 A;  2JMH A;  2XQ4 A;  5C3J A;  5FL1 A;  4TN7 B;  1QUU A;  5LYJ E;  2W2U A;  3JAD A;  1XMQ T;  2LEH A;  3O1H A;  3ONJ A;  5L4H A;  3VRB A;  2UXD T;  5JDF A;  2XQ7 A;  1UUR A;  2FJA A;  4TWH A;  3UU5 A;  4OHF A;  4ZEY A;  3I0O A;  2UXB T;  3KV5 A;  3UUB A;  4A56 A;  4EB6 E;  3PUR A;  2X9Y A;  3ZMZ B;  3CQG B;  4AXP A;  4UIG A;  2FJD A;  4GYS A;  4GK0 E;  4DMW A;  2CM0 A;  4EED A;  2DNX A;  4Z90 A;  5JRE A;  3AE7 A;  2RP4 A;  5LJN A;  2NOX A;  2H3R A;  4HFI A;  4IRE A;  4AKL A;  1SUM B;  2VK9 A;  3M3Z B;  2V6X A;  1NAF A;  2P9B A;  3OKQ A;  3X1D A;  3P7I A;  1XZY A;  3ETU A;  2J62 A;  2GK9 A;  3JAF A;  4I55 E;  4X1Y E;  2B1E A;  1BR2 A;  3GA8 A;  5H6Q B;  4ASK A;  1MIY A;  2DCF A;  2XHE B;  5HEJ A;  1WFD A;  2OA5 A;  2WY2 A;  1CUN A;  3TLT A;  2BVL A;  1WLX A;  2A2F X;  2XTL A;  5EZY E;  3RX6 A;  3EDV A;  2FJE A;  4V1A v;  2LOP A;  2IML A;  5HAX A;  2CBI A;  1W9R A;  2V26 A;  5FXV A;  4AQG A;  3B13 A;  4AQF A;  3CK6 A;  2V1D B;  4AKH A;  2VL0 A;  4EZ4 A;  4ZZB A;  3ZCI A;  4CI1 B;  2CCQ A;  1U5P A;  2YDR A;  2WSS V;  3SFE A;  4O2A E;  4EOZ B;  4ZHQ E;  2EHO D;  2CMR A;  3BQL A;  2V5C A;  4H9R C;  3MZK B;  4ZI2 C;  1D1B A;  2DL1 A;  3ZYK A;  2DHR A;  2J47 A;  2MTQ A;  3H3M A;  5L47 A;  4DUY T;  3NVO A;  5JR9 B;  3A7M A;  3HKD E;  3Q5W A;  2E9X B;  4IE7 A;  2C5J A;  4X1K E;  4YSZ A;  2LSG A;  3I0Q A;  3HA4 A;  5AQF B;  4BAY B;  3O4X E;  2Y48 B;  3CX7 B;  2RPA A;  4OK0 A;  4YJ3 E;  4MAL A;  4CZZ B;  3EAM A;  4NIQ A;  3Q5X A;  4IIJ E;  3L8R A;  5LMN T;  4U31 A;  4H9Q C;  5FKY A;  4ILC A;  3RYI E;  1BR0 A;  5DQW A;  3RKG A;  4LF5 T;  3CQX C;  2XSA A;  4ILA A;  4AIS A;  3QB5 K;  4O8S A;  4COF A;  2NWB A;  2ZLY A;  2ZMA A;  1US7 B;  3ZYL A;  5IWA T;  2D0T A;  1IJ5 A;  2JQH A;  4QXB B;  3F57 A;  3C4X A;  3FZF B;  5FXX A;  3N2K E;  4YTM A;  4YTP A;  2KXP B;  3D0T A;  5LBM A;  2LHR A;  3AXJ A;  5AQH B;  1KK7 A;  1SE7 A;  2L3L A;  4K0K T;  2VL8 A;  3AA0 B;  5HEH A;  3WI3 A;  4DR3 T;  2XAG B;  2CA5 A;  2XQ5 A;  3PV0 F;  4H9S E;  4U33 A;  5AFU L;  4DV3 T;  1HX1 B;  3AEF A;  5FVK A;  3AAI A;  2DWK A;  1LVF A;  1T8B A;  2BBJ A;  4UF0 A;  5FP3 A;  3RF1 A;  2WDQ A;  3ZT7 A;  3K3Q C;  2D9D A;  4CI3 B;  3QOF A;  3Q5D A;  2LHN A;  4LMJ A;  4LFB T;  5AQR B;  2CXF A;  4ZI7 E;  4DV1 T;  2LOS A;  3FXD B;  2JQQ A;  2X9H A;  3N9N A;  2D2S A;  4CXW A;  1KEY A;  3A8Y C;  4TZ4 C;  4XAX B;  5AQM B;  3UFE A;  3QUJ A;  3IF8 B;  2VKJ A;  3LK2 B;  3BK9 A;  2DLR A;  1KFY A;  3F2E A;  4DMV A;  2NTY A;  1XDP A;  2LSI A;  3HKB E;  5L3D B;  4JI0 T;  5J2T E;  3VU7 H;  1MMA A;  1WR0 A;  4AI6 A;  2ZM2 A;  3IEE A;  3PTR B;  2NW8 A;  2LJL A;  3KDS E;  1OED B;  1ZP0 A;  4HEA A;  4HFC A;  3NKZ A;  3RIU A;  5HWX A;  5IYZ E;  3PUZ F;  3ZSS A;  4PFO A;  4QH5 A;  4HN9 A;  4O4I E;  1Y64 B;  4DUZ T;  3RC8 A;  3H37 A;  5JDM A;  3K3N A;  4EAH A;  1IZN B;  4O2B E;  3AED A;  4LF8 T;  3ZN0 B;  3J7Y q;  2MPK A;  2Y8D A;  3ZMS B;  3OPC A;  5JDH A;  3G06 A;  5H6R B;  3UUM A;  2K5B B;  2R6G F;  3ZC1 A;  1N34 T;  2KIN B;  4LML A;  3RQU A;  5L3C B;  4DR5 T;  3UFG A;  2WWU A;  1GQE A;  2ZM8 A;  4JI8 T;  1T72 A;  3JAE A;  2XM2 A;  3K8P C;  5GON E;  5E0O A;  3AAE B;  1NEN A;  2LSY A;  2CHN A;  2VKH A;  3N9M A;  3K3O A;  2IIU A;  1HG2 A;  3AEA A;  3ANW A;  3O1I A;  4FJO A;  2W63 A;  4KHZ F;  3DTO A;  2BKN A;  2WMO A;  5EK2 A;  2K3W A;  4DR4 T;  2WP9 A;  4TUY E;  3OBV E;  4CXY A;  4E7Z A;  5AQU B;  2HN1 A;  3PDY A;  2IC6 A;  2UXN B;  2UXC T;  2V7I A;  4UVC B;  4LFA T;  1N33 T;  2XQ3 A;  2V7K A;  2XPK A;  1X79 A;  3CX6 B;  2HH7 A;  4DV0 T;  2HN2 A;  2V8S V;  4A5X A;  2JQ9 A;  1HF8 A;  3KVA A;  3N2O A;  2BG9 B;  5AQO B;  3RC3 A;  1YXR A;  2Q9Q D;  1ZKE A;  1VCS A;  3AA7 B;  3AVR A;  4KX6 A;  3WAK A;  1SHZ C;  2EHO C;  2XY8 B;  3FXE B;  1KNP A;  4IDN A;  4TX5 A;  1WYC A;  4U7Y A;  5F8P A;  5HXC A;  4EYY R;  3ZKR A;  5ABF B;  1HX8 A;  3U78 A;  2KND A;  5HCM A;  2WWV A;  5BMV E;  2YKS A;  4JYA T;  2H88 A;  3P4Q A;  1WR6 A;  3LK4 2;  4OYK A;  4HGA A;  3EAB A;  2L9Q A;  3CVR A;  4X65 T;  5J1G A;  4X66 T;  3RI5 A;  1MMG A;  3W15 B;  5CJ5 A;  2XUE A;  5AQJ B;  3O1J A;  4XBF B;  4GKK T;  5KDM C;  3LBX A;  4X1I E;  3F31 A;  2W66 A;  1N32 T;  4JI7 T;  4AIU A;  2K24 A;  2XQ9 A;  4MHC A;  3CWZ B;  4X64 T;  2OLT A;  1BR1 A;  4G63 A;  4F6R C;  4NXM T;  5JH7 E;  2CWY A;  3T1Y T;  2BBH A;  3OYZ A;  3UUN A;  3ZT5 A;  3I9W A;  4PJL A;  2CE7 A;  4HWF A;  3ZMT B;  3C50 A;  3KV9 A;  5JTG A;  3Q9D A;  3QC9 A;  4YSX A;  5LHI B;  3AE3 A;  3C4W A;  1E2A A;  4WYV A;  5FNV E;  3FZL B;  1ZHC A;  2SPC A;  3NBX X;  2VVS A;  5FY0 A;  3M65 A;  1VCT A;  3HKC E;  3ZJ2 A;  4A98 A;  5M4Y A;  3AE9 A;  2PG8 A;  3HI2 A;  3AXJ B;  2NTX A;  3P8C D;  3ZCJ A;  1X9B A;  3ZYM A;  5C2T A;  5KX5 E;  4IE5 A;  4DBR A;  4H9O C;  3CX8 B;  1UGO A;  4ZI3 D;  4IDZ A;  5LG4 A;  1HNX T;  2IHR 1;  2IUB A;  2A72 A;  3AE6 A;  1LRZ A;  2BKO A;  3CPZ A;  4UVB B;  2WU5 A;  1KNR A;  2CXD A;  2K9A A;  3AE5 A;  3AEE A;  1FIO A;  4IE4 A;  4YY3 T;  4EGW A;  1WYB A;  1Z0P A;  3VHL A;  4HFH A;  1JNZ A;  4CQI A;  1BR4 A;  4QWN B;  2BG9 E;  2JRK A;  5JDG A;  1FEW A;  3AE8 A;  3AE2 A;  4TNW A;  2IW5 B;  3C4Z A;  3JC6 C;  4EYU A;  4P09 A;  3P50 A;  4Q25 A;  2V6Y B;  4XZC A;  5HEG A;  2UUB T;  3N9P A;  3EHZ A;  3RYH E;  3ZC0 A;  1QSD A;  1NWM X;  3FB2 A;  3VRA A;  5FVL A;  3FZK B;  3ZMU B;  3CML A;  5HXS A;  3UQ7 A;  1VOM A;  1OED A;  2V5D A;  3ANW B;  3UU8 A;  5L3E B;  3PUA A;  2K48 A;  2VAS A;  3E22 E;  2BZB A;  2FBW A;  1H7C A;  2MAW A;  3FBL A;  3MK7 C;  4WBO A;  2CWO A;  2N2N A;  4JLE A;  4DO0 A;  2OV9 A;  3IHR A;  2M6I A;  4O4L E;  2JMK A;  4IGU A;  4C90 A;  4JV5 T;  2ACZ A;  4QHO A;  4TNV A;  4TV9 E;  1HNZ T;  4OFZ A;  3RLF F;  3KBU A;  4WBN E;  4QH1 A;  3RYC E;  4L9I A;  2QVA A;  2X0Y A;  4PK4 A;  5DQV A;  1SA0 E;  3KIN B;  4P0B A;  5EK3 A;  3N5L A;  2H89 A;  3HKE E;  1ZOY A;  3JCF A;  4UV8 B;  3C98 B;  2QGS A;  3K1S A;  3KVB A;  3NRX A;  4ERR A;  5BR8 T;  3LSV A;  1IBM T;  1D0X A;  2RA1 A;  3KV4 A;  5HEO A;  4F8H A;  4X62 T;  2HHH T;  4AKG A;  1YKH B;  4WW0 A;  5ETW A;  3UUL A;  2WAU A;  1MNE A;  1G8X A;  2W62 A;  3RIA A;  1U4Q A;  4O4H E;  5L3G B;  3AEC A;  3PUS A;  2LKG A;  3ZT6 A;  2YOE A;  4CN1 A;  4DND A;  1HR0 T;  4E7S A;  4DR2 T;  4PNI A;  1QLB A;  4PJM A;  3RIU C;  4ADZ A;  3ZN1 B;  4PJN A;  5JRC A;  3ONL C;  3UU6 A;  3TLS A;  5HEU A;  4B3S T;  2FJB A;  4YXD A;  3PUX F;  4UF0 B;  5AQG B;  1UUS A;  2BKP A;  3QK6 A;  3IBP A;  1ZV4 X;  1WCR A;  3B57 A;  3FZM B;  5CGM A;  5TAO A;  3L39 A;  4BA9 A;  3PUW F;  3MXZ A;  2NW7 A;  4CI2 B;  4LF6 T;  4CN6 A;  4QKN A;  4EZH A;  1YQ4 A;  2CLY B;  3NRY A;  4G2A A;  1UX4 A;  1KNZ A;  3EVY A;  1HNW T;  4B3T T;  2LKH A;  2KWH A;  2PFV A;  3AE4 A;  2XAJ B;  2ZM0 A;  2QRX A;  2N1G A;  3AEG A;  3RIF A;  3SOL A;  1R8I A;  2V7M A;  1W0B A;  4JI1 T;  3QNU A;  2X68 A;  2C5I T;  3L3P A;  2M6B A;  4LF9 T;  3LG7 A;  2JQK A;  1YD8 G;  2MOZ A;  2W4X A;  2KMF A;  2YDS A;  3N9O A;  2D5U A;  3ESL A;  4YLH A;  2BG9 C;  4HFB A;  5L3B B;  4B3M T;  4JI4 T;  2I6H A;  4LMK A;  4BJN A;  1YKE B;  2ODV A;  1V9D A;  2VUR A;  3CQC B;  3LDQ B;  5LGN B;  5L3F B;  4CN4 A;  1IBL T;  1XDO A;  2CLY C;  3EUH A;  4J2C A;  1O3X A;  1S35 A;  1HTJ F;  3B5M A;  4QX7 B;  4UEL A;  2V7J A;  5AQN B;  3UQ4 A;  2WZI A;  3ZPO A;  2YK0 A;  4ZOL E;  5LP6 E;  5AQQ B;  1VRB A;  5CA0 E;  1FJG T;  2V6Y A;  3J9X 1;  5LGT B;  1NEK A;  2E8I A;  5JRC B;  4JI2 T;  2X9W A;  5HWY A;  3RHW A;  1LVK A;  2JIW A;  2KT9 A;  5F3J A;  1YQ3 A;  2HPJ A;  2CXL A;  2WDR A;  2XAF B;  2KLQ A;  3PJA J;  4JBW F;  4ZI2 D;  3UU4 A;  5CFB A;  2VVN A;  1EZ3 A;  4DVD A;  2J4G A;  5LMU T;  4ZS3 A;  3RQW A;  1YW0 A;  3HL6 A;  4FI5 A;  5DJQ C;  4ILB A;  4UV9 B;  5CB4 E;  2BVM A;  1G73 A;  3VR9 A;  2H7O A;  2CPT A;  3EI0 A;  5ABE A;  2B76 A;  5LG3 A;  1DU2 A;  4B3R T;  4IDO A;  5JDQ A;  3FZH B;  5IUX A;  4Z91 A;  2E5L T;  2WCA A;  1E1H B;  2XAQ B;  1MMN A;  3PJA A;  3FHN A;  1MMD A;  2E9X C;  2UXX B;  4H9P C;  4P1N A;  2IDO B;  4AKI A;  2ZM6 T;  2W00 A; 
#chains in the Genus database with same CATH homology
 5FMN A;  4DBQ A;  2YIN A;  4EXT A;  2QA7 A;  4UXN B;  3TKL B;  4ANJ A;  5DAB A;  3OYX A;  3RRW A;  3H3A A;  4YHJ A;  5LHH B;  2KZ7 B;  4GK5 E;  2WMN A;  3LBX B;  4CXX A;  4TV8 E;  1OXZ A;  2J1D G;  4P0A A;  4H9N C;  5EK4 A;  3RYF E;  4PW8 A;  2DWG A;  2Q9Q B;  4JEU B;  2WBL A;  1LKX A;  3FBZ A;  4C91 A;  1HCI A;  3LJC A;  4MLK A;  3R6N A;  3V5U A;  5HXH A;  5LOV E;  1ZEE A;  2I59 A;  4WNK A;  5FY7 A;  2D0U A;  3DP7 A;  4ISS A;  5LCY A;  1WRD A;  2IC9 A;  3ZMV B;  2L8K A;  3U3I A;  3MJX A;  3E0Z A;  3MKD A;  4NUU A;  4HE8 A;  2V7L A;  4AQF C;  1S94 A;  4QXC B;  5LBQ B;  3A5X A;  4KUM B;  3VKH A;  3ZEF B;  4GOU A;  4ZS2 A;  5ADX L;  2H7V C;  3PU3 A;  2YU2 A;  1OWA A;  2CEA A;  3AA6 B;  3AB3 B;  2XAS B;  3NZQ A;  2X67 A;  2BDE A;  3PUQ A;  4PK6 A;  2WM9 A;  3MA9 A;  4H63 V;  4KBM B;  5FYM A;  2C5K T;  4I4T E;  3LFM A;  2Z6E A;  2KWI B;  3BQI A;  5FY1 A;  5FXZ A;  3GMI A;  3JC6 D;  4BJM A;  1IJ6 A;  5IHY A;  4PAG A;  3T8O A;  3UUX B;  3ONX A;  4K0U A;  5HXR A;  3LK3 B;  5LXT E;  3PE0 A;  3C64 A;  4KP3 C;  4ILU A;  5JQG E;  4ZI3 C;  4EIW A;  1HFA A;  2MYS A;  2EHO B;  3CKD A;  5JVD E;  2A3D A;  2G0U A;  4JEH B;  4GYR A;  2HPL A;  2VKD A;  1D1C A;  3EDU A;  2N9D A;  2Y6X A;  3C51 A;  3DJB A;  3GN5 A;  2ACX A;  3OJA A;  4IE6 A;  4X20 E;  1T98 A;  2X9X A;  3PUG A;  3RPU A;  4IE0 A;  5L2L A;  1UCU A;  3Q2M A;  2E9X A;  5A1L A;  2LM9 A;  2NW9 A;  4QX8 B;  1FMV A;  2DI4 A;  4MFR A;  2LSK A;  2W61 A;  2X0L B;  4U72 A;  2E9X D;  3N2G E;  4HTE A;  2X51 A;  5HXE A;  3MAC A;  2PJQ A;  3AAA B;  3RKO A;  3WAJ A;  1D0Z A;  3BQK A;  3KV6 A;  5LJM A;  4YFS A;  4UEM A;  5LNK A;  4PJJ A;  3I1A A;  4JUY A;  2VWA A;  2PBI A;  4OYJ A;  2Q9Q C;  4IHJ E;  4Z8X A;  4NUV A;  2Q9Q A;  4GIW A;  2XQY A;  5J2U E;  3GWH A;  1D1A A;  1MND A;  2C0S A;  3SWH A;  3HR0 A;  4YJ2 E;  2LSJ A;  2VKO A;  3PU8 A;  5JR9 A;  1IAP A;  2MBG A;  1B7T A;  3I9Y A;  5LGU B;  4N78 D;  1MIV A;  4PFP A;  4M1P A;  2M67 A;  2YU1 A;  3ETV A;  5LA6 E;  5JR9 C;  3L09 A;  2IAK A;  3AVS A;  4I50 E;  3SRZ A;  2NP9 A;  1MIW A;  5C8Y E;  5LHG B;  2X66 A;  3KBT A;  3SS1 A;  4IST A;  4QXH B;  3N9Q A;  1AJ3 A;  2JJ9 A;  5CA1 E;  4H63 H;  3AA1 B;  3V5S A;  4UVA B;  5JDL A;  1UX5 A;  3KFW X;  3RH3 A;  2ODU A;  3ZLI A;  2ES0 A;  5HYA A;  1FMW A;  3S4U A;  2JPF A;  4B6X A;  3E08 A;  3N9L A;  4L5G A;  3UT5 E;  1D0Y A;  2EHO A;  4O4J E;  4PK5 A;  4AKR B;  3VKG A;  1HS7 A;  3RRC A;  3R84 B;  4HFV A;  4L0R A;  5JDN A;  2LE8 A;  2XAH B;  4U74 A;  2LT3 A;  5KMG P;  3ZJ1 A;  3GN5 B;  4HKA A;  3NZP A;  2W0G A;  2YEV C;  4KMC A;  1HG5 A;  3O9X A;  2VB6 A;  2JMH A;  4TN7 B;  1QUU A;  5LYJ E;  2LEH A;  3O1H A;  5JDF A;  4OHF A;  3I0O A;  3KV5 A;  4EB6 E;  3PUR A;  2X9Y A;  3ZMZ B;  3CQG B;  4AXP A;  4UIG A;  4GYS A;  4GK0 E;  4DMW A;  2CM0 A;  2DNX A;  5JRE A;  2RP4 A;  5LJN A;  2NOX A;  2H3R A;  4AKL A;  2VK9 A;  1NAF A;  2P9B A;  3OKQ A;  3P7I A;  4I55 E;  3ETU A;  4X1Y E;  2GK9 A;  5H6Q B;  2B1E A;  1BR2 A;  3GA8 A;  4ASK A;  1MIY A;  2DCF A;  2XHE B;  2OA5 A;  1CUN A;  2BVL A;  1WLX A;  2A2F X;  2XTL A;  5EZY E;  3RX6 A;  3EDV A;  4V1A v;  2LOP A;  5HAX A;  2V26 A;  5FXV A;  4AQG A;  3B13 A;  4AQF A;  2V1D B;  4AKH A;  4EZ4 A;  3ZCI A;  4CI1 B;  2CCQ A;  1U5P A;  2WSS V;  4O2A E;  4EOZ B;  4ZHQ E;  2EHO D;  2CMR A;  3BQL A;  4H9R C;  3MZK B;  4ZI2 C;  1D1B A;  3ZYK A;  2DHR A;  2MTQ A;  5JR9 B;  3HKD E;  3Q5W A;  2E9X B;  4IE7 A;  2C5J A;  4X1K E;  2LSG A;  3I0Q A;  3HA4 A;  4BAY B;  3O4X E;  2Y48 B;  3CX7 B;  4OK0 A;  4YJ3 E;  4CZZ B;  4MAL A;  3Q5X A;  4IIJ E;  4H9Q C;  3RYI E;  1BR0 A;  5DQW A;  3CQX C;  4O8S A;  2NWB A;  2ZLY A;  2ZMA A;  1US7 B;  3ZYL A;  2D0T A;  1IJ5 A;  4QXB B;  3F57 A;  3C4X A;  5FXX A;  3N2K E;  2KXP B;  3D0T A;  5LBM A;  2LHR A;  1KK7 A;  2L3L A;  2VL8 A;  3AA0 B;  3WI3 A;  2XAG B;  2CA5 A;  4H9S E;  5AFU L;  3AAI A;  2DWK A;  1LVF A;  5FP3 A;  4UF0 A;  4CI3 B;  3K3Q C;  2LHN A;  2CXF A;  4ZI7 E;  2LOS A;  3FXD B;  2JQQ A;  2X9H A;  3N9N A;  2D2S A;  4CXW A;  4TZ4 C;  4XAX B;  3UFE A;  3QUJ A;  3IF8 B;  2VKJ A;  3LK2 B;  3BK9 A;  2DLR A;  3F2E A;  4DMV A;  2NTY A;  3HKB E;  2LSI A;  5L3D B;  5J2T E;  3VU7 H;  1MMA A;  4AI6 A;  2ZM2 A;  3IEE A;  3PTR B;  2NW8 A;  2LJL A;  3KDS E;  4I43 B;  4A56 A;  4HEA A;  5HWX A;  5IYZ E;  4PFO A;  4HN9 A;  4O4I E;  1Y64 B;  3RC8 A;  3H37 A;  5JDM A;  3K3N A;  4EAH A;  1IZN B;  4O2B E;  3ZN0 B;  3J7Y q;  2Y8D A;  3ZMS B;  5JDH A;  5H6R B;  3UUM A;  2K5B B;  3ZC1 A;  2KIN B;  5L3C B;  2WWU A;  2ZM8 A;  5GON E;  3K8P C;  5E0O A;  3AAE B;  2VKH A;  2LSY A;  3N9M A;  4FJO A;  3K3O A;  3ANW A;  1HG2 A;  3O1I A;  4MBQ A;  5EK2 A;  2W63 A;  3DTO A;  2WMO A;  4TUY E;  3OBV E;  4CXY A;  4E7Z A;  3PDY A;  2IC6 A;  2UXN B;  2V7I A;  4UVC B;  2V7K A;  1X79 A;  3CX6 B;  2HH7 A;  1HF8 A;  3KVA A;  3N2O A;  3RC3 A;  2Q9Q D;  3WAK A;  1ZKE A;  3AVR A;  3AA7 B;  1SHZ C;  2EHO C;  3FXE B;  5HXC A;  4TX5 A;  1WYC A;  4EYY R;  5F8P A;  1HX8 A;  3U78 A;  2KND A;  5BMV E;  1WR6 A;  3LK4 2;  4OYK A;  4HGA A;  2L9Q A;  3CVR A;  5J1G A;  1MMG A;  3W15 B;  2XUE A;  3O1J A;  4XBF B;  5KDM C;  3LBX A;  4X1I E;  3F31 A;  2K24 A;  4MHC A;  3CWZ B;  4G63 A;  1BR1 A;  4F6R C;  5JH7 E;  2CWY A;  3OYZ A;  3UUN A;  3I9W A;  4PJL A;  2CE7 A;  3ZMT B;  3C50 A;  3KV9 A;  3Q9D A;  3QC9 A;  5LHI B;  3C4W A;  5FNV E;  5FY0 A;  1ZHC A;  2SPC A;  3NBX X;  5JRC A;  3M65 A;  3ZJ2 A;  3HKC E;  5M4Y A;  2PG8 A;  3HI2 A;  3P8C D;  2NTX A;  3ZCJ A;  3ZYM A;  5KX5 E;  5LG4 A;  4IE5 A;  4DBR A;  4H9O C;  3CX8 B;  4ZI3 D;  4IDZ A;  2A72 A;  1LRZ A;  3CPZ A;  4UVB B;  4IE4 A;  2CXD A;  2K9A A;  1FIO A;  1WYB A;  1Z0P A;  3VHL A;  4CQI A;  1BR4 A;  4QWN B;  2JRK A;  5JDG A;  1FEW A;  2IW5 B;  3C4Z A;  3JC6 C;  4EYU A;  4P09 A;  4XZC A;  3N9P A;  3RYH E;  3ZC0 A;  1QSD A;  1NWM X;  3FB2 A;  3ZMU B;  5HXS A;  3CML A;  1VOM A;  3ANW B;  5L3E B;  3PUA A;  2K48 A;  2VAS A;  3E22 E;  2BZB A;  3FBL A;  1H7C A;  4DO0 A;  3MK7 C;  4WBO A;  2CWO A;  2N2N A;  4JLE A;  3IHR A;  4O4L E;  2JMK A;  4IGU A;  4C90 A;  4QHO A;  4TV9 E;  4OFZ A;  4WBN E;  3KBU A;  3RYC E;  4L9I A;  4PK4 A;  5DQV A;  1SA0 E;  3KIN B;  4P0B A;  5EK3 A;  3N5L A;  5FXW A;  3HKE E;  3UTK A;  4UV8 B;  3C98 B;  2QGS A;  3KVB A;  3NRX A;  4ERR A;  1D0X A;  2RA1 A;  3KV4 A;  4AKG A;  1YKH B;  4WW0 A;  5ETW A;  3UUL A;  2WAU A;  1MNE A;  1G8X A;  2W62 A;  1U4Q A;  4O4H E;  3PUS A;  4DND A;  4E7S A;  4PNI A;  4PJM A;  4ADZ A;  3ZN1 B;  4PJN A;  4UF0 B;  3QK6 A;  3IBP A;  1ZV4 X;  3B57 A;  5TAO A;  4BA9 A;  3MXZ A;  2NW7 A;  4CI2 B;  4QKN A;  4EZH A;  4G2A A;  2CLY B;  3NRY A;  1KNZ A;  1UX4 A;  2PFV A;  2KWH A;  3SOL A;  2XAJ B;  2ZM0 A;  2N1G A;  2V7M A;  2X68 A;  2C5I T;  3L3P A;  3LG7 A;  5L3G B;  1YD8 G;  2MOZ A;  3N9O A;  2KMF A;  2D5U A;  3ESL A;  4YLH A;  5L3B B;  3CQC B;  1YKE B;  2ODV A;  1V9D A;  5LGN B;  5L3F B;  3EUH A;  2CLY C;  4QX7 B;  4J2C A;  1O3X A;  1S35 A;  1HTJ F;  4UEL A;  2V7J A;  3ZPO A;  5LP6 E;  2YK0 A;  4ZOL E;  1VRB A;  5CA0 E;  5JRC B;  3J9X 1;  5LGT B;  2E8I A;  2X9W A;  5HWY A;  1LVK A;  2KT9 A;  5F3J A;  2HPJ A;  2CXL A;  2XAF B;  2KLQ A;  4ZI2 D;  1EZ3 A;  4DVD A;  4ZS3 A;  1YW0 A;  3HL6 A;  4FI5 A;  5DJQ C;  4UV9 B;  5CB4 E;  4BJN A;  2BVM A;  1G73 A;  2H7O A;  5JDQ A;  1E1H B;  2XAQ B;  1MMN A;  3FHN A;  1MMD A;  2E9X C;  2UXX B;  4H9P C;  3EVY A;  4AKI A;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...