4V1Av

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
YRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERRXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4v1av00
4V1Av 3J7Yq
chains in the Genus database with same CATH superfamily
5DQWA 2GK9A 4YSYA 4IE5A 3ZMVB 4UV8B 1MMGA 2ZLYA 2CWOA 3WAJA 2BG9A 2Y6XA 2BG9E 2LT3A 3UFGA 5CA0E 1T7SA 1HTJF 3LBXA 1EZ3A 2CBIA 3PUVF 4GK5E 4PW8A 4PJNA 4ZXLA 5F3JA 1WLXA 4YJ2E 4ZZBA 5JR9B 5KX5E 3UU8A 4DV0T 5CFBA 5FL1A 3AA7B 1KNRA 3B5MA 3CK6A 2JIWA 3KINB 3OPCA 5HEGA 1IBKT 3HKCE 2V5DA 2KSRA 3C98B 3PTRB 4TWFA 5FXXA 2BS3A 3B57A 2HN2A 2E9XB 1W9RA 3WAKA 5AQKB 2VVSA 5FXVA 5JDFA 3NZPA 1CHUA 3AE9A 5HAXA 3M65A 2KZ7B 2LSYA 3PU3A 3UUNA 4F8HA 2IUBA 1XDOA 5HXHA 1HCIA 4GYSA 4DNDA 4HWIB 1DU2A 1YXRA 4DR6T 2W00A 2XQ7A 3CWZB 3FBZA 4HFCA 1WYBA 3Q5EA 2DHRA 4TNWA 4H63V 4CN1A 3O1JA 4TNVA 2SPCA 3H3AA 4HWHA 2EHOD 3ZC0A 2VB6A 4EIWA 3C64A 3MZKB 4O4IE 2QRXA 4C90A 2CLYC 3AA6B 4B6XA 5L3FB 2KT9A 3GWHA 3QB5K 4AQGA 4ZI7E 4EB6E 1MNDA 2CPTA 3JAEA 2X9XA 3MKDA 4DBRA 2WQYA 3L39A 5FVLA 1BR0A 1O3XA 3ETUA 4IHJE 2FJBA 4C91A 5CA1E 1FIOA 3L09A 3ZJ2A 3ZT7A 1WRDA 3A5XA 4ISTA 2V26A 5HXCA 4AKLA 4YTNA 3IEEA 4FI5A 2XSAA 2LSKA 5AQHB 2X68A 2LOSA 3AEGA 3N9OA 4HFDA 3NBXX 5CGMA 3K3NA 5AQMB 1SA0E 3RPUA 5FYMA 3J7Yq 2E2AA 1J5WA 2IDOB 1UUSA 2A9UA 3H37A 2XQ6A 3JC6D 3P4PA 3AE6A 5LB7B 2JQHA 1N34T 2Y8DA 4A98A 2ES0A 4HFHA 2XAQB 1U5PA 1XMQT 4P0AA 2BKNA 4Z90A 2X0LB 4JLEA 3AB3B 2P9BA 4H9NC 1M62A 3GMIA 4HEAA 4UVCB 2M6IA 2YEVC 3CKDA 3RH3A 2LSGA 2XUEA 1U4QA 3U3IA 2NTXA 3UULA 4JBWF 4UXNB 4X1KE 2PFVA 3FZMB 1T8BA 4TN7B 5H6QB 4CI3B 3PURA 1E7PA 4WBOA 3K3QC 1IAPA 2XQAA 4I0UA 4ISSA 4WZXA 4XZCA 4IE6A 4X1YE 2I6HA 2Z6EA 3EABA 2XQ8A 4YHJA 3ZT5A 2NW7A 3PUWF 3RHWA 3RQUA 2E5LT 4IE4A 2A72A 2MYSA 2K48A 4EGWA 2WWUA 4H9OC 3FZKB 2LHNA 3C50A 2K5BB 2OLTA 2C5KT 4ILUA 2VURA 3Q5WA 2NOXA 2YDQA 4QHOA 2L3LA 4NXNT 3CX7B 1BR1A 4I50E 1OEDB 2W63A 2LSIA 4ILCA 5AQRB 3P8CD 3ETVA 4I55E 5LG3A 1LRZA 1V9DA 2H88A 2VKOA 2W0GA 1J1JA 2WP9A 3I1AA 4LFCT 1IBMT 4UVAB 4AI6A 3B13A 3ZMTB 4HKAA 4MFRA 3AAAB 5HEHA 3ZT6A 4KMCA 5LG4A 1XMOT 3RC8A 3E08A 3EHZA 3N2GE 4PJMA 3VKHA 2LEHA 2LRKA 5AQQB 3ZCJA 4PAGA 3SOLA 1GQEA 2VASA 4KBMB 5JDNA 4HTEA 4EXTA 4DR4T 3JCFA 5AQNB 4HWCA 1MMNA 2Q9QC 3RYIE 5LGUB 3MK7C 3QOFA 3KV4A 4QH5A 4QXBB 2CXDA 4LF5T 3LK2B 2I0MA 4YHHT 3ONJA 3C4XA 5E0OA 1SHZC 2M6BA 5FY0A 2ZM8A 2CWYA 3N2KE 4OX9T 1R8IA 4L9IA 2X0HA 4HE8A 1OEDA 1OXZA 2ODVA 4KP3C 3AA1B 4QX8B 4YJ3E 3OYXA 4GIWA 4LF9T 4JEUB 2DWKA 3QB5A 2KWIB 4UR9A 1CUNA 3RIFA 5LJMA 2IHR1 5JDMA 5AQSB 3VU7H 1BR2A 3LFMA 5EZYE 5JVDE 2B76A 5CJ5A 3UU5A 1QUUA 4PFPA 4JYAT 2V6XA 3AE8A 4DR2T 2WCAA 4CQIA 2CM0A 2V1DB 1I6ZA 5AQUB 2A2FX 2YOEA 4YXDA 5FY7A 2BS2A 4OK0A 5AQTB 2IW5B 4AKGA 1UK5A 5L3EB 4U3CA 3JAFA 4O4JE 5AQVB 2PBIA 4CXWA 3LK3B 4JI6T 1HG5A 2ZM0A 1YKEB 2XTLA 3SWHA 2C5IT 5HCMA 3VHLA 4DUZT 2LOPA 2PG8A 1N33T 4CN6A 4PJLA 3RQWA 4B3TT 4DV5T 1IJ6A 2KLQA 3RIAA 3AE1A 3AXJA 2FUPA 4TUYE 4MHCA 5JQGE 3UFEA 3KV9A 5AQOB 4EAHA 3VR9A 1WYCA 3I0QA 4U2ZA 3EDUA 2D5UA 3EVYA 3PJAA 5DQVA 5CB4E 3RYFE 1D1BA 5A1LA 3CX6B 4CI2B 2VK9A 5JDQA 2XPKA 3FB2A 3GA8A 1ZP0A 2CBJA 2CHOA 2Y48B 4WNKA 5FNVE 5LMNT 4YLHA 3LK42 2R6GF 4MLKA 4A97A 4X20E 4AQFC 1D0ZA 2IAKA 1HF8A 1OEDC 4HFBA 4HFVA 4H9SE 2E8IA 1YW0A 2X0YA 4X66T 4DR7T 4AXPA 4L0RA 4O8SA 4GK0E 5LA6E 1HX1B 5JDGA 3FZLB 1HNZT 3AE3A 1KFYA 3OKQA 2YK0A 3VRBA 2BKOA 3AAEB 1YKHB 2IIUA 4KHPT 3I9WA 4WYVA 2PJQA 4MALA 1YQ3A 1QSDA 1ZKEA 4CZZB 4PJJA 5LHHB 3PUXF 3F31A 3Q2MA 4X1IE 3RIUA 4AISA 4N78D 1KNZA 2NP9A 3OJAA 2E9XA 4DR1T 2AXDS 4UVBB 3R84B 3V5SA 2XAHB 1XWMA 2VQET 2LRLA 3ZYKA 1YQ4A 3GN5A 5J1GA 3ONXA 2CCQA 4TWDA 1WCRA 1KK7A 2UXXB 2YU2A 3IBPA 1D0YA 2IC6A 2DI4A 3P4QA 5AQPB 3AA0B 4TZ4C 4BA9A 5JR9A 4JV5T 3RLFF 5LCYA 4JI0T 2VKDA 2WDQA 3TLUA 4EEDA 2KMFA 3O1HA 5ABHA 2K3WA 2BG9B 2WWVA 3UQ4A 5IHYA 2UXCT 3AEEA 4U2YA 3V5UA 3DJBA 4WBNE 2H7OA 2HPJA 3HKDE 4EEBA 3NKZA 1VRBA 5L2LA 1OEDE 5FKYA 5LHGB 5AQJB 4GYRA 4DBQA 3PUSA 3ZSSA 3PJAJ 4ZEYA 1W09A 5JREA 4OYKA 3FHNA 3IF8B 5HWXA 4DV3T 3LSVA 2KXPB 2X51A 4Z91A 4NIQA 4U74A 2AE9A 2ZMAA 4IL9A 4QXHB 1HNWT 2WBLA 2RPAA 4ASKA 2CXLA 4U33A 2YN6A 3N9LA 3RYHE 4IREA 4PK6A 3QNUA 5JR9C 3AEDA 3ZJ1A 4ZHQE 4UF0A 3T8OA 3W15B 4G2AA 3K3OA 4YSZA 4ZI2D 3N9MA 2XQ5A 5AQIB 3OTOT 4JI1T 4JI5T 2N1GA 4A56A 5L3GB 4DV7T 4ILAA 3S4UA 4DMWA 3PUAA 3GN5B 3NRXA 2UU9T 4JI4T 2ZM2A 2XY8B 4UV9B 4I43B 3TLTA 1IZNB 5J0ZA 2UUCT 2J47A 2X9HA 3T1HT 1MIYA 2WS3A 4DV4T 1X9BA 2V7MA 3KVAA 2N2NA 3N9PA 4HFEA 5HYAA 1T72A 4YTMA 1NENA 2VKHA 1ZOYA 2LLYA 3ZMZB 4NXMT 2EHOC 3TLSA 1L0VA 2X9YA 3HR0A 3VKGA 4ZS3A 2UUBT 5HEJA 1W0BA 2VL0A 2W2UA 2ZM6T 4O2AE 4DR3T 4K0UA 3RKOA 4AKRB 5LGNB 3RGLA 3PUGA 1HG2A 4LFBT 3RX6A 1NWMX 1Y64B 4H9RC 3Q9DA 4EYYR 1UGOA 3QK6A 1XNQT 2XHEB 4ILBA 2WDVA 4KHZF 4P0BA 3UU4A 4K0KT 4GKKT 1UURA 2WZIA 5DABA 5AQFB 1MIWA 2CMRA 3HKBE 2W61A 2VKJA 3D0TA 3PV0F 4QH4A 5LBMA 2DL1A 5L3DB 3ZN1B 2IMLA 2BBJA 3HL6A 1MNEA 2X9WA 2XM1A 2HN1A 2XZEA 2JMHA 4COFA 4DR5T 1S94A 3OYZA 3T1YT 4O4LE 4IE0A 4AIUA 1G8XA 4U7YA 4CN4A 4QWNB 4KUMB 5HCJA 1NEKA 3CMLA 3FXDB 3RKGA 2LKGA 4TV9E 3BQKA 3UQ7A 4X64T 3ABVA 2BVLA 3AXJB 4ZS2A 4DO0A 1MMAA 2JJ9A 2WMOA 1X79A 2WAUA 3NWIA 3J9X1 3ZEFB 4HWDA 5L4EA 2XQ3A 4JI3T 3UTKA 2BDEA 2XSBA 4IDOA 4X62T 2BZBA 4IDQA 1S35A 2E9XC 4E7ZA 4XAXB 3G06A 3KVBA 1HNXT 2V7LA 3P50A 3P7IA 2RP4A 3KBTA 2C0SA 3ZMUB 3O1IA 3TLWA 2NR4A 3ZKRA 5LNKA 4DV6T 3P4SA 4B3RT 5TAOA 2E5VA 4MBQA 4P1NA 4O4HE 4OHFA 5LHIB 5JDLA 2ACXA 3I0OA 4JI7T 5LJNA 5FVKA 1LVFA 3ZPOA 5LMUT 4LFAT 2XM2A 5LOVE 3N5LA 5FL0A 4IL4A 4QXCB 2QYWA 3OVUA 3RF1A 2FJEA 1FMVA 2UXNB 3ZN0B 4U7IA 1US7B 2B1EA 4CXYA 5BMVE 2X67A 2XQYA 1H7CA 2RA1A 2W67A 3AE2A 3NVOA 3Q5XA 4IT4A 4ZI3D 1YD8G 3RYCE 4QH1A 2HHHT 5EK4A 1UCUA 2OA5A 2VL8A 2H89A 2WB5A 3CQCB 1ZEEA 2K9AA 3NRYA 5DJQC 1VCTA 5ABEA 2CXFA 2XAGB 3CPZA 3P4WA 2QGSA 1OWAA 2E9XD 3QUJA 5ETWA 5LP6E 5LYJE 4V1Av 4A5XA 5AQGB 5C3JA 2V6YB 1KF6A 4GKJT 3FXEB 2JQQA 2CA5A 2WU2A 3OBVE 1IJ5A 4O2BE 5L3CB 4PFOA 4F6RC 3AVRA 2KINB 2VVNA 3IHRA 1JNRA 3KFWX 2CRBA 4IDZA 2LE8A 4YTPA 2Q9QD 4HWFA 2WSSV 2K24A 2KWHA 3AE5A 3JC6C 5IUXA 3RI5A 5JRCB 1SE7A 4H9QC 4B3ST 3ZCIA 4YFSA 2FBWA 4E7SA 3ANWB 3E22E 3EUHA 4HN9A 1FEWA 3A8YC 3SS1A 4ZI3C 5J2TE 2UXBT 2X66A 4H63H 4BJNA 1D0XA 2XQ9A 3SRZA 3Q5DA 2H7VC 5L47A 4IIJE 3AEBA 5FY1A 1UX5A 5JTGA 5C8YE 5KXJA 1J5ET 4AKHA 2LM2A 2UXDT 3UUMA 3N9NA 3KDSE 4P09A 2EHOA 1B7TA 5FP3A 4LMLA 1Z0PA 3KV5A 4FJOA 4AKIA 4PK5A 2F4VT 2YKSA 1LKXA 3LBXB 5KDMC 3KBUA 2DCFA 3K8PC 2V7KA 3PUYF 5JDHA 1G73A 2J62A 2W4XA 2JQKA 3EAMA 3AE4A 1D1AA 5HEUA 2QA7A 5HEOA 2G0UA 3ZLIA 3TLVA 5ADXL 2MPKA 2MAWA 2A3DA 2JQ9A 4IDPA 4UELA 4ZOLE 2MOZA 2WU5A 3M3ZB 3N9QA 4LMJA 2QVAA 4TV8E 5AFUL 1E2AA 4UIGA 2WM9A 4NUVA 3CIRA 3PDYA 4H9PC 3UT5E 1MMDA 3DP7A 3UU3A 3WI3A 3C4WA 3X1DA 3ZMSB 4X5TA 3ZYLA 2DLRA 2V6YA 2VWAA 2XAFB 3C4ZA 3CVRA 1W0AA 2CEAA 3AEFA 3N2OA 3ZC1A 4ERRA 2BG9C 2Q9QB 5LGTB 4XBFB 2ACZA 3PUQA 3AE7A 4TWHA 5L3BB 1KEYA 2BS4A 1HFAA 2MBGA 2L9QA 2C5JA 4EYUA 4I4TE 2VQFT 4DUYT 5AQLB 3RC3A 4NPPA 4PK4A 4QKNA 1IBLT 5IYZE 3RRCA 3UU6A 4CI1B 2YDRA 4J2CA 2Q9QA 5FMNA 2DNXA 2NW9A 4HFIA 4ZZCA 4LF6T 5C2TA 5LXTE 2XAJB 2D0UA 3H3MA 2XASB 4YSXA 2L8KA 2N9DA 4BJMA 3MJXA 4X65T 5BR8T 5EK3A 2YINA 3RRWA 4M1PA 2NW8A 3ZSTA 5KMGP 2DWGA 4IGUA 3MACA 2WY2A 1N36T 3LG7A 3EI0A 1MIVA 5H6RB 3BK9A 3FZHB 3SFDA 1FMWA 5F8PA 4CXXA 4DV1T 3PE0A 4B3MT 3R6NA 1WFDA 4IDNA 2M67A 4OFZA 3F2EA 1T98A 1Z8UA 4EOZB 2XJ7A 3AVSA 3U78A 1SUMB 1AJ3A 3AECA 3C51A 3E0ZA 4LF7T 4JI2T 1XNRT 4PNIA 5ABFB 1WR0A 1LVKA 4KI0F 3RIUC 3VRAA 4EZHA 5HWYA 1N32T 2J4GA 4GOUA 3EDVA 2CHNA 3AEAA 4WW0A 5ABGA 2WMNA 3HKEE 2J1DG 2V8SV 3I9YA 2EHOB 3ESLA 3P4RA 1I94T 4LF8T 1JNZA 1M7KA 2W66A 1D1CA 5HXSA 3O9XA 3HA4A 5HXRA 2KNDA 2V7JA 5ABFA 4EV6A 4OYJA 2HH7A 3A7MA 3ONLC 5FXZA 3PU8A 4YY3T 2D0TA 1HX8A 5F5WA 1KNPA 3IA3A 4HGAA 5EK2A 3PUZF 3DTOA 2LJLA 5HXEA 4AQYT 1Y01A 2PTFA 1ZHCA 1NAFA 2JRKA 3ANWA 3KV6A 4U31A 4NUUA 4BAYB 1HS7A 2XQ4A 4U72A 5JRCA 2LM9A 2V5CA 3FZFB 4YT0A 2CLYB 3CQXC 4Q25A 4DV2T 3MXZA 4UEMA 3BQLA 5L4HA 4ZI2C 5J2UE 4AQFA 2BKPA 3L3PA 2WDRA 4JUYA 4DMVA 2D9DA 2LHRA 3ZYMA 5LBQB 5IWAT 1VCSA 4ADZA 4EZ4A 3LJCA 3HI2A 2LKHA 2MTQA 2NTYA 2YU1A 3UUBA 2LSJA 2NWBA 2WZHA 2I59A 3BQIA 2W62A 1BR4A 3K1SA 2FJAA 3VR8A 4G63A 2D2SA 2YDSA 4KX6A 3JADA 1UX4A 1ZV4X 2IC9A 3QC9A 4UF0B 2CE7A 1XZYA 2H3RA 2ODUA 2BVMA 3FBLA 3NZQA 4IE7A 1VOMA 4JEHB 4TX5A 4Z8XA 4DVDA 4LMKA 2V7IA 4L5GA 2UUAT 3CQGB 2BBHA 4DIDB 1QLBA 4QX7B 3MA9A 3AAIA 3LDQB 5FXWA 2JPFA 1WR6A 3L8RA 3TKLB 5JH7E 1HR0T 1FJGT 1E1HB 3UUXB 4LF4T 5M4YA 3O4XE 3SFEA 2OV9A 3F57A 5GONE 4JI8T 4ANJA 1XDPA 2HPLA 3CX8B 2JMKA 2FJDA
chains in the Genus database with same CATH topology
5DQWA 2GK9A 4IE5A 3ZMVB 4UV8B 1MMGA 2ZLYA 2CWOA 3WAJA 2Y6XA 2LT3A 5CA0E 3LBXA 1HTJF 1EZ3A 4GK5E 4PW8A 4PJNA 5F3JA 5KX5E 1WLXA 4YJ2E 5JR9B 3AA7B 3KINB 3HKCE 3C98B 3PTRB 5FXXA 3B57A 2E9XB 3WAKA 5FXVA 5JDFA 3NZPA 5HAXA 3M65A 2KZ7B 2LSYA 3PU3A 3UUNA 5HXHA 1HCIA 4GYSA 4DNDA 2W00A 3CWZB 3FBZA 1WYBA 2DHRA 4H63V 3O1JA 3ZC0A 2SPCA 3H3AA 2EHOD 2VB6A 4EIWA 3C64A 3MZKB 4O4IE 4C90A 2CLYC 3AA6B 4B6XA 5L3FB 2KT9A 3GWHA 4ZI7E 4AQGA 4EB6E 1MNDA 2X9XA 3MKDA 4DBRA 1O3XA 3ETUA 4IHJE 4C91A 5CA1E 1FIOA 3L09A 3ZJ2A 1WRDA 3A5XA 4ISTA 2V26A 5HXCA 4AKLA 3IEEA 4FI5A 2LSKA 2X68A 2LOSA 3N9OA 3NBXX 3K3NA 1SA0E 3RPUA 5FYMA 3J7Yq 3H37A 3JC6D 1BR0A 2Y8DA 2ES0A 2XAQB 1U5PA 4P0AA 2X0LB 4JLEA 3AB3B 2P9BA 4H9NC 4HEAA 3GMIA 4UVCB 4DO0A 2YEVC 3CKDA 3RH3A 2LSGA 2XUEA 1U4QA 3U3IA 2NTXA 3UULA 4UXNB 4X1KE 2PFVA 4TN7B 5H6QB 4CI3B 3PURA 4WBOA 3K3QC 1IAPA 4ISSA 4IE6A 4X1YE 2Z6EA 4YHJA 2NW7A 4IE4A 2A72A 2MYSA 2K48A 2WWUA 4H9OC 2LHNA 3C50A 2K5BB 2C5KT 4ILUA 3Q5WA 2NOXA 4QHOA 2L3LA 3CX7B 1BR1A 4I50E 2W63A 2LSIA 3P8CD 3ETVA 4I55E 1LRZA 1V9DA 2VKOA 2W0GA 3I1AA 4UVAB 4AI6A 3B13A 3ZMTB 4HKAA 4MFRA 3AAAB 4KMCA 5LG4A 3RC8A 3E08A 3N2GE 4PJMA 3VKHA 2LEHA 3ZCJA 4PAGA 3SOLA 4KBMB 2VASA 5JDNA 4HTEA 4EXTA 1MMNA 2Q9QC 3RYIE 5LGUB 3MK7C 4QXBB 3KV4A 2CXDA 3LK2B 5FY0A 3C4XA 5E0OA 1SHZC 2ZM8A 2CWYA 3N2KE 4L9IA 4HE8A 1OXZA 2ODVA 4QX8B 4KP3C 3AA1B 4YJ3E 3OYXA 4GIWA 4JEUB 2DWKA 2KWIB 1CUNA 5LJMA 5JDMA 3VU7H 1BR2A 3LFMA 5EZYE 5JVDE 1QUUA 4PFPA 4CQIA 2CM0A 2V1DB 2A2FX 5FY7A 4OK0A 2IW5B 4AKGA 5L3EB 4O4JE 4CXWA 2PBIA 3LK3B 1HG5A 2ZM0A 1YKEB 2XTLA 3SWHA 2C5IT 3VHLA 2LOPA 2PG8A 4PJLA 1IJ6A 2KLQA 4TUYE 4MHCA 5JQGE 3UFEA 3KV9A 4EAHA 1WYCA 3I0QA 3EDUA 2D5UA 3EVYA 5DQVA 5CB4E 3RYFE 1D1BA 5A1LA 3CX6B 4CI2B 2VK9A 5JDQA 3GA8A 3FB2A 4WNKA 5FNVE 2Y48B 4YLHA 3LK42 4MLKA 4X20E 4AQFC 1D0ZA 2IAKA 1HF8A 4HFVA 4H9SE 2E8IA 1YW0A 4AXPA 4L0RA 4O8SA 4GK0E 5LA6E 5JDGA 3OKQA 2YK0A 3AAEB 1YKHB 3I9WA 2PJQA 4MALA 1QSDA 1ZKEA 4CZZB 4PJJA 5LHHB 3F31A 3Q2MA 4X1IE 4N78D 1KNZA 2NP9A 3OJAA 2E9XA 4UVBB 3R84B 3V5SA 2XAHB 3ZYKA 3GN5A 5J1GA 3ONXA 2CCQA 1KK7A 2UXXB 2YU2A 3IBPA 1D0YA 2IC6A 2DI4A 3AA0B 4TZ4C 4BA9A 5JR9A 5LCYA 2VKDA 2KMFA 3O1HA 5IHYA 3V5UA 3DJBA 4WBNE 2H7OA 2HPJA 3HKDE 5L2LA 1VRBA 5LHGB 4GYRA 4DBQA 3PUSA 5JREA 4OYKA 3FHNA 3IF8B 5HWXA 2KXPB 2X51A 4U74A 2ZMAA 4QXHB 2WBLA 4ASKA 2CXLA 3N9LA 3RYHE 5JR9C 4PK6A 3ZJ1A 4ZHQE 4UF0A 3T8OA 3W15B 4G2AA 3K3OA 4ZI2D 3N9MA 4A56A 2N1GA 5L3GB 3S4UA 4DMWA 3PUAA 3GN5B 3NRXA 2ZM2A 4UV9B 4I43B 1IZNB 2X9HA 1MIYA 2V7MA 3KVAA 2N2NA 3N9PA 5HYAA 2VKHA 3ZMZB 2EHOC 2X9YA 3HR0A 4ZS3A 4O2AE 4K0UA 3RKOA 4AKRB 5LGNB 3PUGA 1HG2A 3RX6A 1NWMX 1Y64B 4H9RC 3Q9DA 4EYYR 3QK6A 2XHEB 4P0BA 5DABA 1MIWA 2CMRA 3HKBE 2W61A 2VKJA 3D0TA 5LBMA 5L3DB 3ZN1B 3HL6A 1MNEA 2X9WA 2JMHA 1S94A 3OYZA 4O4LE 4IE0A 1G8XA 4QWNB 4KUMB 3VKGA 3CMLA 3FXDB 4TV9E 3BQKA 2BVLA 4ZS2A 1MMAA 2JJ9A 2WMOA 1X79A 2WAUA 3J9X1 3ZEFB 3UTKA 2BDEA 2BZBA 1S35A 2E9XC 4E7ZA 4XAXB 3KVBA 2V7LA 3P7IA 2RP4A 3KBTA 2C0SA 3ZMUB 3O1IA 5LNKA 5TAOA 4MBQA 4O4HE 4OHFA 5LHIB 5JDLA 2ACXA 3I0OA 5LJNA 1LVFA 3ZPOA 5LOVE 3N5LA 4QXCB 1FMVA 2UXNB 3ZN0B 4CXYA 1US7B 2B1EA 5BMVE 2X67A 2XQYA 1H7CA 2RA1A 3Q5XA 4ZI3D 4XBFB 1YD8G 3RYCE 5EK4A 1UCUA 2OA5A 2VL8A 3CQCB 3NRYA 5DJQC 1ZEEA 2K9AA 1HS7A 2CXFA 2XAGB 3CPZA 2QGSA 1OWAA 2E9XD 3QUJA 5ETWA 5LP6E 5LYJE 4V1Av 3FXEB 2JQQA 2CA5A 3OBVE 1IJ5A 4O2BE 5L3CB 4PFOA 4F6RC 3AVRA 2KINB 3IHRA 4IDZA 3KFWX 2LE8A 2Q9QD 2WSSV 2K24A 2KWHA 3JC6C 5JRCB 4H9QC 3ZCIA 4YFSA 4E7SA 3ANWB 3E22E 3EUHA 4HN9A 1FEWA 3SS1A 4ZI3C 5J2TE 2X66A 4H63H 4BJNA 1D0XA 3SRZA 2H7VC 4IIJE 5FY1A 1UX5A 4AKHA 5C8YE 3UUMA 3N9NA 3KDSE 4P09A 2EHOA 1B7TA 5FP3A 1Z0PA 3KV5A 4FJOA 4AKIA 4PK5A 1LKXA 3LBXB 5KDMC 3KBUA 2DCFA 3K8PC 2V7KA 5JDHA 1G73A 1D1AA 2QA7A 3ZLIA 2G0UA 5ADXL 2A3DA 4UELA 4ZOLE 2MOZA 3N9QA 4TV8E 5AFUL 4UIGA 2WM9A 4NUVA 3PDYA 3UT5E 4H9PC 1MMDA 3DP7A 3WI3A 3ZYLA 3C4WA 3ZMSB 5LGTB 2DLRA 2XAFB 2VWAA 4ERRA 3C4ZA 3CVRA 2CEAA 3N2OA 3ZC1A 2Q9QB 3PUQA 5L3BB 1HFAA 2MBGA 2L9QA 2C5JA 4EYUA 4I4TE 3RC3A 4PK4A 4QKNA 5IYZE 3RRCA 4CI1B 4J2CA 2Q9QA 5FMNA 2DNXA 2NW9A 5LXTE 2XAJB 2D0UA 2XASB 2L8KA 2N9DA 4BJMA 3MJXA 5EK3A 2YINA 3RRWA 4M1PA 2NW8A 5KMGP 2DWGA 4IGUA 3MACA 3LG7A 4CXXA 1MIVA 5H6RB 3BK9A 1FMWA 5F8PA 3PE0A 3R6NA 2M67A 4OFZA 3F2EA 1T98A 4EOZB 3U78A 3AVSA 1AJ3A 3C51A 3E0ZA 4PNIA 1LVKA 4EZHA 5HWYA 4GOUA 3EDVA 4WW0A 2WMNA 3HKEE 2J1DG 3I9YA 2EHOB 3ESLA 5HXSA 3O9XA 1D1CA 3HA4A 5HXRA 2KNDA 2V7JA 4OYJA 2HH7A 5FXZA 3PU8A 2D0TA 1HX8A 4HGAA 5EK2A 3DTOA 2LJLA 5HXEA 3KV6A 1ZHCA 1NAFA 2JRKA 3ANWA 4BAYB 4NUUA 4U72A 5JRCA 2LM9A 2CLYB 3CQXC 3MXZA 4UEMA 3BQLA 4ZI2C 5J2UE 4AQFA 3L3PA 4JUYA 4DMVA 2LHRA 3ZYMA 5LBQB 4ADZA 4EZ4A 3LJCA 3HI2A 2MTQA 2NTYA 2YU1A 2LSJA 2NWBA 2I59A 3BQIA 2W62A 1BR4A 4G63A 2D2SA 1UX4A 1ZV4X 2IC9A 3QC9A 4UF0B 2CE7A 2H3RA 2ODUA 3FBLA 2BVMA 3NZQA 4IE7A 4JEHB 1VOMA 4TX5A 4Z8XA 4DVDA 2V7IA 4L5GA 3CQGB 4QX7B 3MA9A 3AAIA 5FXWA 2JPFA 1WR6A 3TKLB 5JH7E 1E1HB 3UUXB 5M4YA 3O4XE 5GONE 3F57A 4ANJA 2HPLA 3CX8B 2JMKA 4XZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A v;  3J7Y q; 
#chains in the Genus database with same CATH topology
 5DQW A;  2GK9 A;  4YSY A;  4IE5 A;  3ZMV B;  4UV8 B;  1MMG A;  2ZLY A;  2CWO A;  3WAJ A;  2BG9 A;  2Y6X A;  2BG9 E;  2LT3 A;  3UFG A;  5CA0 E;  1T7S A;  1HTJ F;  3LBX A;  1EZ3 A;  2CBI A;  3PUV F;  4GK5 E;  4PW8 A;  4PJN A;  4ZXL A;  5F3J A;  1WLX A;  4YJ2 E;  4ZZB A;  5JR9 B;  5KX5 E;  3UU8 A;  4DV0 T;  5CFB A;  5FL1 A;  3AA7 B;  1KNR A;  3B5M A;  3CK6 A;  2JIW A;  3KIN B;  3OPC A;  5HEG A;  1IBK T;  3HKC E;  2V5D A;  2KSR A;  3C98 B;  3PTR B;  4TWF A;  5FXX A;  2BS3 A;  3B57 A;  2HN2 A;  2E9X B;  1W9R A;  3WAK A;  5AQK B;  2VVS A;  5FXV A;  5JDF A;  3NZP A;  1CHU A;  3AE9 A;  5HAX A;  3M65 A;  2KZ7 B;  2LSY A;  3PU3 A;  3UUN A;  4F8H A;  2IUB A;  1XDO A;  5HXH A;  1HCI A;  4GYS A;  4DND A;  4HWI B;  1DU2 A;  1YXR A;  4DR6 T;  2W00 A;  2XQ7 A;  3CWZ B;  3FBZ A;  4HFC A;  1WYB A;  3Q5E A;  2DHR A;  4TNW A;  4H63 V;  4CN1 A;  3O1J A;  4TNV A;  2SPC A;  3H3A A;  4HWH A;  2EHO D;  3ZC0 A;  2VB6 A;  4EIW A;  3C64 A;  3MZK B;  4O4I E;  2QRX A;  4C90 A;  2CLY C;  3AA6 B;  4B6X A;  5L3F B;  2KT9 A;  3GWH A;  3QB5 K;  4AQG A;  4ZI7 E;  4EB6 E;  1MND A;  2CPT A;  3JAE A;  2X9X A;  3MKD A;  4DBR A;  2WQY A;  3L39 A;  5FVL A;  1BR0 A;  1O3X A;  3ETU A;  4IHJ E;  2FJB A;  4C91 A;  5CA1 E;  1FIO A;  3L09 A;  3ZJ2 A;  3ZT7 A;  1WRD A;  3A5X A;  4IST A;  2V26 A;  5HXC A;  4AKL A;  4YTN A;  3IEE A;  4FI5 A;  2XSA A;  2LSK A;  5AQH B;  2X68 A;  2LOS A;  3AEG A;  3N9O A;  4HFD A;  3NBX X;  5CGM A;  3K3N A;  5AQM B;  1SA0 E;  3RPU A;  5FYM A;  3J7Y q;  2E2A A;  1J5W A;  2IDO B;  1UUS A;  2A9U A;  3H37 A;  2XQ6 A;  3JC6 D;  3P4P A;  3AE6 A;  5LB7 B;  2JQH A;  1N34 T;  2Y8D A;  4A98 A;  2ES0 A;  4HFH A;  2XAQ B;  1U5P A;  1XMQ T;  4P0A A;  2BKN A;  4Z90 A;  2X0L B;  4JLE A;  3AB3 B;  2P9B A;  4H9N C;  1M62 A;  3GMI A;  4HEA A;  4UVC B;  2M6I A;  2YEV C;  3CKD A;  3RH3 A;  2LSG A;  2XUE A;  1U4Q A;  3U3I A;  2NTX A;  3UUL A;  4JBW F;  4UXN B;  4X1K E;  2PFV A;  3FZM B;  1T8B A;  4TN7 B;  5H6Q B;  4CI3 B;  3PUR A;  1E7P A;  4WBO A;  3K3Q C;  1IAP A;  2XQA A;  4I0U A;  4ISS A;  4WZX A;  4XZC A;  4IE6 A;  4X1Y E;  2I6H A;  2Z6E A;  3EAB A;  2XQ8 A;  4YHJ A;  3ZT5 A;  2NW7 A;  3PUW F;  3RHW A;  3RQU A;  2E5L T;  4IE4 A;  2A72 A;  2MYS A;  2K48 A;  4EGW A;  2WWU A;  4H9O C;  3FZK B;  2LHN A;  3C50 A;  2K5B B;  2OLT A;  2C5K T;  4ILU A;  2VUR A;  3Q5W A;  2NOX A;  2YDQ A;  4QHO A;  2L3L A;  4NXN T;  3CX7 B;  1BR1 A;  4I50 E;  1OED B;  2W63 A;  2LSI A;  4ILC A;  5AQR B;  3P8C D;  3ETV A;  4I55 E;  5LG3 A;  1LRZ A;  1V9D A;  2H88 A;  2VKO A;  2W0G A;  1J1J A;  2WP9 A;  3I1A A;  4LFC T;  1IBM T;  4UVA B;  4AI6 A;  3B13 A;  3ZMT B;  4HKA A;  4MFR A;  3AAA B;  5HEH A;  3ZT6 A;  4KMC A;  5LG4 A;  1XMO T;  3RC8 A;  3E08 A;  3EHZ A;  3N2G E;  4PJM A;  3VKH A;  2LEH A;  2LRK A;  5AQQ B;  3ZCJ A;  4PAG A;  3SOL A;  1GQE A;  2VAS A;  4KBM B;  5JDN A;  4HTE A;  4EXT A;  4DR4 T;  3JCF A;  5AQN B;  4HWC A;  1MMN A;  2Q9Q C;  3RYI E;  5LGU B;  3MK7 C;  3QOF A;  3KV4 A;  4QH5 A;  4QXB B;  2CXD A;  4LF5 T;  3LK2 B;  2I0M A;  4YHH T;  3ONJ A;  3C4X A;  5E0O A;  1SHZ C;  2M6B A;  5FY0 A;  2ZM8 A;  2CWY A;  3N2K E;  4OX9 T;  1R8I A;  4L9I A;  2X0H A;  4HE8 A;  1OED A;  1OXZ A;  2ODV A;  4KP3 C;  3AA1 B;  4QX8 B;  4YJ3 E;  3OYX A;  4GIW A;  4LF9 T;  4JEU B;  2DWK A;  3QB5 A;  2KWI B;  4UR9 A;  1CUN A;  3RIF A;  5LJM A;  2IHR 1;  5JDM A;  5AQS B;  3VU7 H;  1BR2 A;  3LFM A;  5EZY E;  5JVD E;  2B76 A;  5CJ5 A;  3UU5 A;  1QUU A;  4PFP A;  4JYA T;  2V6X A;  3AE8 A;  4DR2 T;  2WCA A;  4CQI A;  2CM0 A;  2V1D B;  1I6Z A;  5AQU B;  2A2F X;  2YOE A;  4YXD A;  5FY7 A;  2BS2 A;  4OK0 A;  5AQT B;  2IW5 B;  4AKG A;  1UK5 A;  5L3E B;  4U3C A;  3JAF A;  4O4J E;  5AQV B;  2PBI A;  4CXW A;  3LK3 B;  4JI6 T;  1HG5 A;  2ZM0 A;  1YKE B;  2XTL A;  3SWH A;  2C5I T;  5HCM A;  3VHL A;  4DUZ T;  2LOP A;  2PG8 A;  1N33 T;  4CN6 A;  4PJL A;  3RQW A;  4B3T T;  4DV5 T;  1IJ6 A;  2KLQ A;  3RIA A;  3AE1 A;  3AXJ A;  2FUP A;  4TUY E;  4MHC A;  5JQG E;  3UFE A;  3KV9 A;  5AQO B;  4EAH A;  3VR9 A;  1WYC A;  3I0Q A;  4U2Z A;  3EDU A;  2D5U A;  3EVY A;  3PJA A;  5DQV A;  5CB4 E;  3RYF E;  1D1B A;  5A1L A;  3CX6 B;  4CI2 B;  2VK9 A;  5JDQ A;  2XPK A;  3FB2 A;  3GA8 A;  1ZP0 A;  2CBJ A;  2CHO A;  2Y48 B;  4WNK A;  5FNV E;  5LMN T;  4YLH A;  3LK4 2;  2R6G F;  4MLK A;  4A97 A;  4X20 E;  4AQF C;  1D0Z A;  2IAK A;  1HF8 A;  1OED C;  4HFB A;  4HFV A;  4H9S E;  2E8I A;  1YW0 A;  2X0Y A;  4X66 T;  4DR7 T;  4AXP A;  4L0R A;  4O8S A;  4GK0 E;  5LA6 E;  1HX1 B;  5JDG A;  3FZL B;  1HNZ T;  3AE3 A;  1KFY A;  3OKQ A;  2YK0 A;  3VRB A;  2BKO A;  3AAE B;  1YKH B;  2IIU A;  4KHP T;  3I9W A;  4WYV A;  2PJQ A;  4MAL A;  1YQ3 A;  1QSD A;  1ZKE A;  4CZZ B;  4PJJ A;  5LHH B;  3PUX F;  3F31 A;  3Q2M A;  4X1I E;  3RIU A;  4AIS A;  4N78 D;  1KNZ A;  2NP9 A;  3OJA A;  2E9X A;  4DR1 T;  2AXD S;  4UVB B;  3R84 B;  3V5S A;  2XAH B;  1XWM A;  2VQE T;  2LRL A;  3ZYK A;  1YQ4 A;  3GN5 A;  5J1G A;  3ONX A;  2CCQ A;  4TWD A;  1WCR A;  1KK7 A;  2UXX B;  2YU2 A;  3IBP A;  1D0Y A;  2IC6 A;  2DI4 A;  3P4Q A;  5AQP B;  3AA0 B;  4TZ4 C;  4BA9 A;  5JR9 A;  4JV5 T;  3RLF F;  5LCY A;  4JI0 T;  2VKD A;  2WDQ A;  3TLU A;  4EED A;  2KMF A;  3O1H A;  5ABH A;  2K3W A;  2BG9 B;  2WWV A;  3UQ4 A;  5IHY A;  2UXC T;  3AEE A;  4U2Y A;  3V5U A;  3DJB A;  4WBN E;  2H7O A;  2HPJ A;  3HKD E;  4EEB A;  3NKZ A;  1VRB A;  5L2L A;  1OED E;  5FKY A;  5LHG B;  5AQJ B;  4GYR A;  4DBQ A;  3PUS A;  3ZSS A;  3PJA J;  4ZEY A;  1W09 A;  5JRE A;  4OYK A;  3FHN A;  3IF8 B;  5HWX A;  4DV3 T;  3LSV A;  2KXP B;  2X51 A;  4Z91 A;  4NIQ A;  4U74 A;  2AE9 A;  2ZMA A;  4IL9 A;  4QXH B;  1HNW T;  2WBL A;  2RPA A;  4ASK A;  2CXL A;  4U33 A;  2YN6 A;  3N9L A;  3RYH E;  4IRE A;  4PK6 A;  3QNU A;  5JR9 C;  3AED A;  3ZJ1 A;  4ZHQ E;  4UF0 A;  3T8O A;  3W15 B;  4G2A A;  3K3O A;  4YSZ A;  4ZI2 D;  3N9M A;  2XQ5 A;  5AQI B;  3OTO T;  4JI1 T;  4JI5 T;  2N1G A;  4A56 A;  5L3G B;  4DV7 T;  4ILA A;  3S4U A;  4DMW A;  3PUA A;  3GN5 B;  3NRX A;  2UU9 T;  4JI4 T;  2ZM2 A;  2XY8 B;  4UV9 B;  4I43 B;  3TLT A;  1IZN B;  5J0Z A;  2UUC T;  2J47 A;  2X9H A;  3T1H T;  1MIY A;  2WS3 A;  4DV4 T;  1X9B A;  2V7M A;  3KVA A;  2N2N A;  3N9P A;  4HFE A;  5HYA A;  1T72 A;  4YTM A;  1NEN A;  2VKH A;  1ZOY A;  2LLY A;  3ZMZ B;  4NXM T;  2EHO C;  3TLS A;  1L0V A;  2X9Y A;  3HR0 A;  3VKG A;  4ZS3 A;  2UUB T;  5HEJ A;  1W0B A;  2VL0 A;  2W2U A;  2ZM6 T;  4O2A E;  4DR3 T;  4K0U A;  3RKO A;  4AKR B;  5LGN B;  3RGL A;  3PUG A;  1HG2 A;  4LFB T;  3RX6 A;  1NWM X;  1Y64 B;  4H9R C;  3Q9D A;  4EYY R;  1UGO A;  3QK6 A;  1XNQ T;  2XHE B;  4ILB A;  2WDV A;  4KHZ F;  4P0B A;  3UU4 A;  4K0K T;  4GKK T;  1UUR A;  2WZI A;  5DAB A;  5AQF B;  1MIW A;  2CMR A;  3HKB E;  2W61 A;  2VKJ A;  3D0T A;  3PV0 F;  4QH4 A;  5LBM A;  2DL1 A;  5L3D B;  3ZN1 B;  2IML A;  2BBJ A;  3HL6 A;  1MNE A;  2X9W A;  2XM1 A;  2HN1 A;  2XZE A;  2JMH A;  4COF A;  4DR5 T;  1S94 A;  3OYZ A;  3T1Y T;  4O4L E;  4IE0 A;  4AIU A;  1G8X A;  4U7Y A;  4CN4 A;  4QWN B;  4KUM B;  5HCJ A;  1NEK A;  3CML A;  3FXD B;  3RKG A;  2LKG A;  4TV9 E;  3BQK A;  3UQ7 A;  4X64 T;  3ABV A;  2BVL A;  3AXJ B;  4ZS2 A;  4DO0 A;  1MMA A;  2JJ9 A;  2WMO A;  1X79 A;  2WAU A;  3NWI A;  3J9X 1;  3ZEF B;  4HWD A;  5L4E A;  2XQ3 A;  4JI3 T;  3UTK A;  2BDE A;  2XSB A;  4IDO A;  4X62 T;  2BZB A;  4IDQ A;  1S35 A;  2E9X C;  4E7Z A;  4XAX B;  3G06 A;  3KVB A;  1HNX T;  2V7L A;  3P50 A;  3P7I A;  2RP4 A;  3KBT A;  2C0S A;  3ZMU B;  3O1I A;  3TLW A;  2NR4 A;  3ZKR A;  5LNK A;  4DV6 T;  3P4S A;  4B3R T;  5TAO A;  2E5V A;  4MBQ A;  4P1N A;  4O4H E;  4OHF A;  5LHI B;  5JDL A;  2ACX A;  3I0O A;  4JI7 T;  5LJN A;  5FVK A;  1LVF A;  3ZPO A;  5LMU T;  4LFA T;  2XM2 A;  5LOV E;  3N5L A;  5FL0 A;  4IL4 A;  4QXC B;  2QYW A;  3OVU A;  3RF1 A;  2FJE A;  1FMV A;  2UXN B;  3ZN0 B;  4U7I A;  1US7 B;  2B1E A;  4CXY A;  5BMV E;  2X67 A;  2XQY A;  1H7C A;  2RA1 A;  2W67 A;  3AE2 A;  3NVO A;  3Q5X A;  4IT4 A;  4ZI3 D;  1YD8 G;  3RYC E;  4QH1 A;  2HHH T;  5EK4 A;  1UCU A;  2OA5 A;  2VL8 A;  2H89 A;  2WB5 A;  3CQC B;  1ZEE A;  2K9A A;  3NRY A;  5DJQ C;  1VCT A;  5ABE A;  2CXF A;  2XAG B;  3CPZ A;  3P4W A;  2QGS A;  1OWA A;  2E9X D;  3QUJ A;  5ETW A;  5LP6 E;  5LYJ E;  4V1A v;  4A5X A;  5AQG B;  5C3J A;  2V6Y B;  1KF6 A;  4GKJ T;  3FXE B;  2JQQ A;  2CA5 A;  2WU2 A;  3OBV E;  1IJ5 A;  4O2B E;  5L3C B;  4PFO A;  4F6R C;  3AVR A;  2KIN B;  2VVN A;  3IHR A;  1JNR A;  3KFW X;  2CRB A;  4IDZ A;  2LE8 A;  4YTP A;  2Q9Q D;  4HWF A;  2WSS V;  2K24 A;  2KWH A;  3AE5 A;  3JC6 C;  5IUX A;  3RI5 A;  5JRC B;  1SE7 A;  4H9Q C;  4B3S T;  3ZCI A;  4YFS A;  2FBW A;  4E7S A;  3ANW B;  3E22 E;  3EUH A;  4HN9 A;  1FEW A;  3A8Y C;  3SS1 A;  4ZI3 C;  5J2T E;  2UXB T;  2X66 A;  4H63 H;  4BJN A;  1D0X A;  2XQ9 A;  3SRZ A;  3Q5D A;  2H7V C;  5L47 A;  4IIJ E;  3AEB A;  5FY1 A;  1UX5 A;  5JTG A;  5C8Y E;  5KXJ A;  1J5E T;  4AKH A;  2LM2 A;  2UXD T;  3UUM A;  3N9N A;  3KDS E;  4P09 A;  2EHO A;  1B7T A;  5FP3 A;  4LML A;  1Z0P A;  3KV5 A;  4FJO A;  4AKI A;  4PK5 A;  2F4V T;  2YKS A;  1LKX A;  3LBX B;  5KDM C;  3KBU A;  2DCF A;  3K8P C;  2V7K A;  3PUY F;  5JDH A;  1G73 A;  2J62 A;  2W4X A;  2JQK A;  3EAM A;  3AE4 A;  1D1A A;  5HEU A;  2QA7 A;  5HEO A;  2G0U A;  3ZLI A;  3TLV A;  5ADX L;  2MPK A;  2MAW A;  2A3D A;  2JQ9 A;  4IDP A;  4UEL A;  4ZOL E;  2MOZ A;  2WU5 A;  3M3Z B;  3N9Q A;  4LMJ A;  2QVA A;  4TV8 E;  5AFU L;  1E2A A;  4UIG A;  2WM9 A;  4NUV A;  3CIR A;  3PDY A;  4H9P C;  3UT5 E;  1MMD A;  3DP7 A;  3UU3 A;  3WI3 A;  3C4W A;  3X1D A;  3ZMS B;  4X5T A;  3ZYL A;  2DLR A;  2V6Y A;  2VWA A;  2XAF B;  3C4Z A;  3CVR A;  1W0A A;  2CEA A;  3AEF A;  3N2O A;  3ZC1 A;  4ERR A;  2BG9 C;  2Q9Q B;  5LGT B;  4XBF B;  2ACZ A;  3PUQ A;  3AE7 A;  4TWH A;  5L3B B;  1KEY A;  2BS4 A;  1HFA A;  2MBG A;  2L9Q A;  2C5J A;  4EYU A;  4I4T E;  2VQF T;  4DUY T;  5AQL B;  3RC3 A;  4NPP A;  4PK4 A;  4QKN A;  1IBL T;  5IYZ E;  3RRC A;  3UU6 A;  4CI1 B;  2YDR A;  4J2C A;  2Q9Q A;  5FMN A;  2DNX A;  2NW9 A;  4HFI A;  4ZZC A;  4LF6 T;  5C2T A;  5LXT E;  2XAJ B;  2D0U A;  3H3M A;  2XAS B;  4YSX A;  2L8K A;  2N9D A;  4BJM A;  3MJX A;  4X65 T;  5BR8 T;  5EK3 A;  2YIN A;  3RRW A;  4M1P A;  2NW8 A;  3ZST A;  5KMG P;  2DWG A;  4IGU A;  3MAC A;  2WY2 A;  1N36 T;  3LG7 A;  3EI0 A;  1MIV A;  5H6R B;  3BK9 A;  3FZH B;  3SFD A;  1FMW A;  5F8P A;  4CXX A;  4DV1 T;  3PE0 A;  4B3M T;  3R6N A;  1WFD A;  4IDN A;  2M67 A;  4OFZ A;  3F2E A;  1T98 A;  1Z8U A;  4EOZ B;  2XJ7 A;  3AVS A;  3U78 A;  1SUM B;  1AJ3 A;  3AEC A;  3C51 A;  3E0Z A;  4LF7 T;  4JI2 T;  1XNR T;  4PNI A;  5ABF B;  1WR0 A;  1LVK A;  4KI0 F;  3RIU C;  3VRA A;  4EZH A;  5HWY A;  1N32 T;  2J4G A;  4GOU A;  3EDV A;  2CHN A;  3AEA A;  4WW0 A;  5ABG A;  2WMN A;  3HKE E;  2J1D G;  2V8S V;  3I9Y A;  2EHO B;  3ESL A;  3P4R A;  1I94 T;  4LF8 T;  1JNZ A;  1M7K A;  2W66 A;  1D1C A;  5HXS A;  3O9X A;  3HA4 A;  5HXR A;  2KND A;  2V7J A;  5ABF A;  4EV6 A;  4OYJ A;  2HH7 A;  3A7M A;  3ONL C;  5FXZ A;  3PU8 A;  4YY3 T;  2D0T A;  1HX8 A;  5F5W A;  1KNP A;  3IA3 A;  4HGA A;  5EK2 A;  3PUZ F;  3DTO A;  2LJL A;  5HXE A;  4AQY T;  1Y01 A;  2PTF A;  1ZHC A;  1NAF A;  2JRK A;  3ANW A;  3KV6 A;  4U31 A;  4NUU A;  4BAY B;  1HS7 A;  2XQ4 A;  4U72 A;  5JRC A;  2LM9 A;  2V5C A;  3FZF B;  4YT0 A;  2CLY B;  3CQX C;  4Q25 A;  4DV2 T;  3MXZ A;  4UEM A;  3BQL A;  5L4H A;  4ZI2 C;  5J2U E;  4AQF A;  2BKP A;  3L3P A;  2WDR A;  4JUY A;  4DMV A;  2D9D A;  2LHR A;  3ZYM A;  5LBQ B;  5IWA T;  1VCS A;  4ADZ A;  4EZ4 A;  3LJC A;  3HI2 A;  2LKH A;  2MTQ A;  2NTY A;  2YU1 A;  3UUB A;  2LSJ A;  2NWB A;  2WZH A;  2I59 A;  3BQI A;  2W62 A;  1BR4 A;  3K1S A;  2FJA A;  3VR8 A;  4G63 A;  2D2S A;  2YDS A;  4KX6 A;  3JAD A;  1UX4 A;  1ZV4 X;  2IC9 A;  3QC9 A;  4UF0 B;  2CE7 A;  1XZY A;  2H3R A;  2ODU A;  2BVM A;  3FBL A;  3NZQ A;  4IE7 A;  1VOM A;  4JEH B;  4TX5 A;  4Z8X A;  4DVD A;  4LMK A;  2V7I A;  4L5G A;  2UUA T;  3CQG B;  2BBH A;  4DID B;  1QLB A;  4QX7 B;  3MA9 A;  3AAI A;  3LDQ B;  5FXW A;  2JPF A;  1WR6 A;  3L8R A;  3TKL B;  5JH7 E;  1HR0 T;  1FJG T;  1E1H B;  3UUX B;  4LF4 T;  5M4Y A;  3O4X E;  3SFE A;  2OV9 A;  3F57 A;  5GON E;  4JI8 T;  4ANJ A;  1XDP A;  2HPL A;  3CX8 B;  2JMK A;  2FJD A; 
#chains in the Genus database with same CATH homology
 5DQW A;  2GK9 A;  4IE5 A;  3ZMV B;  4UV8 B;  1MMG A;  2ZLY A;  2CWO A;  3WAJ A;  2Y6X A;  2LT3 A;  5CA0 E;  3LBX A;  1HTJ F;  1EZ3 A;  4GK5 E;  4PW8 A;  4PJN A;  5F3J A;  5KX5 E;  1WLX A;  4YJ2 E;  5JR9 B;  3AA7 B;  3KIN B;  3HKC E;  3C98 B;  3PTR B;  5FXX A;  3B57 A;  2E9X B;  3WAK A;  5FXV A;  5JDF A;  3NZP A;  5HAX A;  3M65 A;  2KZ7 B;  2LSY A;  3PU3 A;  3UUN A;  5HXH A;  1HCI A;  4GYS A;  4DND A;  2W00 A;  3CWZ B;  3FBZ A;  1WYB A;  2DHR A;  4H63 V;  3O1J A;  3ZC0 A;  2SPC A;  3H3A A;  2EHO D;  2VB6 A;  4EIW A;  3C64 A;  3MZK B;  4O4I E;  4C90 A;  2CLY C;  3AA6 B;  4B6X A;  5L3F B;  2KT9 A;  3GWH A;  4ZI7 E;  4AQG A;  4EB6 E;  1MND A;  2X9X A;  3MKD A;  4DBR A;  1O3X A;  3ETU A;  4IHJ E;  4C91 A;  5CA1 E;  1FIO A;  3L09 A;  3ZJ2 A;  1WRD A;  3A5X A;  4IST A;  2V26 A;  5HXC A;  4AKL A;  3IEE A;  4FI5 A;  2LSK A;  2X68 A;  2LOS A;  3N9O A;  3NBX X;  3K3N A;  1SA0 E;  3RPU A;  5FYM A;  3J7Y q;  3H37 A;  3JC6 D;  1BR0 A;  2Y8D A;  2ES0 A;  2XAQ B;  1U5P A;  4P0A A;  2X0L B;  4JLE A;  3AB3 B;  2P9B A;  4H9N C;  4HEA A;  3GMI A;  4UVC B;  4DO0 A;  2YEV C;  3CKD A;  3RH3 A;  2LSG A;  2XUE A;  1U4Q A;  3U3I A;  2NTX A;  3UUL A;  4UXN B;  4X1K E;  2PFV A;  4TN7 B;  5H6Q B;  4CI3 B;  3PUR A;  4WBO A;  3K3Q C;  1IAP A;  4ISS A;  4IE6 A;  4X1Y E;  2Z6E A;  4YHJ A;  2NW7 A;  4IE4 A;  2A72 A;  2MYS A;  2K48 A;  2WWU A;  4H9O C;  2LHN A;  3C50 A;  2K5B B;  2C5K T;  4ILU A;  3Q5W A;  2NOX A;  4QHO A;  2L3L A;  3CX7 B;  1BR1 A;  4I50 E;  2W63 A;  2LSI A;  3P8C D;  3ETV A;  4I55 E;  1LRZ A;  1V9D A;  2VKO A;  2W0G A;  3I1A A;  4UVA B;  4AI6 A;  3B13 A;  3ZMT B;  4HKA A;  4MFR A;  3AAA B;  4KMC A;  5LG4 A;  3RC8 A;  3E08 A;  3N2G E;  4PJM A;  3VKH A;  2LEH A;  3ZCJ A;  4PAG A;  3SOL A;  4KBM B;  2VAS A;  5JDN A;  4HTE A;  4EXT A;  1MMN A;  2Q9Q C;  3RYI E;  5LGU B;  3MK7 C;  4QXB B;  3KV4 A;  2CXD A;  3LK2 B;  5FY0 A;  3C4X A;  5E0O A;  1SHZ C;  2ZM8 A;  2CWY A;  3N2K E;  4L9I A;  4HE8 A;  1OXZ A;  2ODV A;  4QX8 B;  4KP3 C;  3AA1 B;  4YJ3 E;  3OYX A;  4GIW A;  4JEU B;  2DWK A;  2KWI B;  1CUN A;  5LJM A;  5JDM A;  3VU7 H;  1BR2 A;  3LFM A;  5EZY E;  5JVD E;  1QUU A;  4PFP A;  4CQI A;  2CM0 A;  2V1D B;  2A2F X;  5FY7 A;  4OK0 A;  2IW5 B;  4AKG A;  5L3E B;  4O4J E;  4CXW A;  2PBI A;  3LK3 B;  1HG5 A;  2ZM0 A;  1YKE B;  2XTL A;  3SWH A;  2C5I T;  3VHL A;  2LOP A;  2PG8 A;  4PJL A;  1IJ6 A;  2KLQ A;  4TUY E;  4MHC A;  5JQG E;  3UFE A;  3KV9 A;  4EAH A;  1WYC A;  3I0Q A;  3EDU A;  2D5U A;  3EVY A;  5DQV A;  5CB4 E;  3RYF E;  1D1B A;  5A1L A;  3CX6 B;  4CI2 B;  2VK9 A;  5JDQ A;  3GA8 A;  3FB2 A;  4WNK A;  5FNV E;  2Y48 B;  4YLH A;  3LK4 2;  4MLK A;  4X20 E;  4AQF C;  1D0Z A;  2IAK A;  1HF8 A;  4HFV A;  4H9S E;  2E8I A;  1YW0 A;  4AXP A;  4L0R A;  4O8S A;  4GK0 E;  5LA6 E;  5JDG A;  3OKQ A;  2YK0 A;  3AAE B;  1YKH B;  3I9W A;  2PJQ A;  4MAL A;  1QSD A;  1ZKE A;  4CZZ B;  4PJJ A;  5LHH B;  3F31 A;  3Q2M A;  4X1I E;  4N78 D;  1KNZ A;  2NP9 A;  3OJA A;  2E9X A;  4UVB B;  3R84 B;  3V5S A;  2XAH B;  3ZYK A;  3GN5 A;  5J1G A;  3ONX A;  2CCQ A;  1KK7 A;  2UXX B;  2YU2 A;  3IBP A;  1D0Y A;  2IC6 A;  2DI4 A;  3AA0 B;  4TZ4 C;  4BA9 A;  5JR9 A;  5LCY A;  2VKD A;  2KMF A;  3O1H A;  5IHY A;  3V5U A;  3DJB A;  4WBN E;  2H7O A;  2HPJ A;  3HKD E;  5L2L A;  1VRB A;  5LHG B;  4GYR A;  4DBQ A;  3PUS A;  5JRE A;  4OYK A;  3FHN A;  3IF8 B;  5HWX A;  2KXP B;  2X51 A;  4U74 A;  2ZMA A;  4QXH B;  2WBL A;  4ASK A;  2CXL A;  3N9L A;  3RYH E;  5JR9 C;  4PK6 A;  3ZJ1 A;  4ZHQ E;  4UF0 A;  3T8O A;  3W15 B;  4G2A A;  3K3O A;  4ZI2 D;  3N9M A;  4A56 A;  2N1G A;  5L3G B;  3S4U A;  4DMW A;  3PUA A;  3GN5 B;  3NRX A;  2ZM2 A;  4UV9 B;  4I43 B;  1IZN B;  2X9H A;  1MIY A;  2V7M A;  3KVA A;  2N2N A;  3N9P A;  5HYA A;  2VKH A;  3ZMZ B;  2EHO C;  2X9Y A;  3HR0 A;  4ZS3 A;  4O2A E;  4K0U A;  3RKO A;  4AKR B;  5LGN B;  3PUG A;  1HG2 A;  3RX6 A;  1NWM X;  1Y64 B;  4H9R C;  3Q9D A;  4EYY R;  3QK6 A;  2XHE B;  4P0B A;  5DAB A;  1MIW A;  2CMR A;  3HKB E;  2W61 A;  2VKJ A;  3D0T A;  5LBM A;  5L3D B;  3ZN1 B;  3HL6 A;  1MNE A;  2X9W A;  2JMH A;  1S94 A;  3OYZ A;  4O4L E;  4IE0 A;  1G8X A;  4QWN B;  4KUM B;  3VKG A;  3CML A;  3FXD B;  4TV9 E;  3BQK A;  2BVL A;  4ZS2 A;  1MMA A;  2JJ9 A;  2WMO A;  1X79 A;  2WAU A;  3J9X 1;  3ZEF B;  3UTK A;  2BDE A;  2BZB A;  1S35 A;  2E9X C;  4E7Z A;  4XAX B;  3KVB A;  2V7L A;  3P7I A;  2RP4 A;  3KBT A;  2C0S A;  3ZMU B;  3O1I A;  5LNK A;  5TAO A;  4MBQ A;  4O4H E;  4OHF A;  5LHI B;  5JDL A;  2ACX A;  3I0O A;  5LJN A;  1LVF A;  3ZPO A;  5LOV E;  3N5L A;  4QXC B;  1FMV A;  2UXN B;  3ZN0 B;  4CXY A;  1US7 B;  2B1E A;  5BMV E;  2X67 A;  2XQY A;  1H7C A;  2RA1 A;  3Q5X A;  4ZI3 D;  4XBF B;  1YD8 G;  3RYC E;  5EK4 A;  1UCU A;  2OA5 A;  2VL8 A;  3CQC B;  3NRY A;  5DJQ C;  1ZEE A;  2K9A A;  1HS7 A;  2CXF A;  2XAG B;  3CPZ A;  2QGS A;  1OWA A;  2E9X D;  3QUJ A;  5ETW A;  5LP6 E;  5LYJ E;  4V1A v;  3FXE B;  2JQQ A;  2CA5 A;  3OBV E;  1IJ5 A;  4O2B E;  5L3C B;  4PFO A;  4F6R C;  3AVR A;  2KIN B;  3IHR A;  4IDZ A;  3KFW X;  2LE8 A;  2Q9Q D;  2WSS V;  2K24 A;  2KWH A;  3JC6 C;  5JRC B;  4H9Q C;  3ZCI A;  4YFS A;  4E7S A;  3ANW B;  3E22 E;  3EUH A;  4HN9 A;  1FEW A;  3SS1 A;  4ZI3 C;  5J2T E;  2X66 A;  4H63 H;  4BJN A;  1D0X A;  3SRZ A;  2H7V C;  4IIJ E;  5FY1 A;  1UX5 A;  4AKH A;  5C8Y E;  3UUM A;  3N9N A;  3KDS E;  4P09 A;  2EHO A;  1B7T A;  5FP3 A;  1Z0P A;  3KV5 A;  4FJO A;  4AKI A;  4PK5 A;  1LKX A;  3LBX B;  5KDM C;  3KBU A;  2DCF A;  3K8P C;  2V7K A;  5JDH A;  1G73 A;  1D1A A;  2QA7 A;  3ZLI A;  2G0U A;  5ADX L;  2A3D A;  4UEL A;  4ZOL E;  2MOZ A;  3N9Q A;  4TV8 E;  5AFU L;  4UIG A;  2WM9 A;  4NUV A;  3PDY A;  3UT5 E;  4H9P C;  1MMD A;  3DP7 A;  3WI3 A;  3ZYL A;  3C4W A;  3ZMS B;  5LGT B;  2DLR A;  2XAF B;  2VWA A;  4ERR A;  3C4Z A;  3CVR A;  2CEA A;  3N2O A;  3ZC1 A;  2Q9Q B;  3PUQ A;  5L3B B;  1HFA A;  2MBG A;  2L9Q A;  2C5J A;  4EYU A;  4I4T E;  3RC3 A;  4PK4 A;  4QKN A;  5IYZ E;  3RRC A;  4CI1 B;  4J2C A;  2Q9Q A;  5FMN A;  2DNX A;  2NW9 A;  5LXT E;  2XAJ B;  2D0U A;  2XAS B;  2L8K A;  2N9D A;  4BJM A;  3MJX A;  5EK3 A;  2YIN A;  3RRW A;  4M1P A;  2NW8 A;  5KMG P;  2DWG A;  4IGU A;  3MAC A;  3LG7 A;  4CXX A;  1MIV A;  5H6R B;  3BK9 A;  1FMW A;  5F8P A;  3PE0 A;  3R6N A;  2M67 A;  4OFZ A;  3F2E A;  1T98 A;  4EOZ B;  3U78 A;  3AVS A;  1AJ3 A;  3C51 A;  3E0Z A;  4PNI A;  1LVK A;  4EZH A;  5HWY A;  4GOU A;  3EDV A;  4WW0 A;  2WMN A;  3HKE E;  2J1D G;  3I9Y A;  2EHO B;  3ESL A;  5HXS A;  3O9X A;  1D1C A;  3HA4 A;  5HXR A;  2KND A;  2V7J A;  4OYJ A;  2HH7 A;  5FXZ A;  3PU8 A;  2D0T A;  1HX8 A;  4HGA A;  5EK2 A;  3DTO A;  2LJL A;  5HXE A;  3KV6 A;  1ZHC A;  1NAF A;  2JRK A;  3ANW A;  4BAY B;  4NUU A;  4U72 A;  5JRC A;  2LM9 A;  2CLY B;  3CQX C;  3MXZ A;  4UEM A;  3BQL A;  4ZI2 C;  5J2U E;  4AQF A;  3L3P A;  4JUY A;  4DMV A;  2LHR A;  3ZYM A;  5LBQ B;  4ADZ A;  4EZ4 A;  3LJC A;  3HI2 A;  2MTQ A;  2NTY A;  2YU1 A;  2LSJ A;  2NWB A;  2I59 A;  3BQI A;  2W62 A;  1BR4 A;  4G63 A;  2D2S A;  1UX4 A;  1ZV4 X;  2IC9 A;  3QC9 A;  4UF0 B;  2CE7 A;  2H3R A;  2ODU A;  3FBL A;  2BVM A;  3NZQ A;  4IE7 A;  4JEH B;  1VOM A;  4TX5 A;  4Z8X A;  4DVD A;  2V7I A;  4L5G A;  3CQG B;  4QX7 B;  3MA9 A;  3AAI A;  5FXW A;  2JPF A;  1WR6 A;  3TKL B;  5JH7 E;  1E1H B;  3UUX B;  5M4Y A;  3O4X E;  5GON E;  3F57 A;  4ANJ A;  2HPL A;  3CX8 B;  2JMK A;  4XZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...