4V1CA

Sirtuin 3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
270
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINKDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 'Erasers' for Lysine Crotonylated Histone Marks Using a Chemical Proteomics Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 85
structure length 270
sequence length 274
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4v1cA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4v1cA01
4ZZIA 2DJIA 4MPRA 4RMHA 4IF6A 1HZZC 1YTLA 4GG1A 2AG1A 4JUDX 1JSCA 2Q29A 1Y9DA 1YC5A 2H4HA 4BV3A 2IHVA 4MZXA 3GLUA 2JIBA 2H2FA 5D7NA 2WVGA 1T9BA 3ZGVA 2IHTA 1YHZA 4K9LA 4BUZA 2Q5OA 4QELA 5IMSA 1T9CA 2OD2A 3RIGA 1BFDA 3HWX1 1QPBA 5EJ9A 1POWA 2EZ4A 1U2DC 2FSVC 2V3WA 3K35A 3EA4A 4JUCA 4K9NA 4L2IA 3IAEA 2Q5QA 3PKJA 1ICIA 3FLMA 1EFPA 1XLTC 2AG0A 2VK8A 4V1CA 4K9QA 2FRDC 4UTXA 2VK4A 4JD5A 5K2OA 4RJIA 2H4JA 4TWJA 4FVTA 3GLTA 4X3PA 5BWLA 2WVAA 4JU9A 2JI8A 4JU8A 4RJJA 5EJAA 4BVFA 5FYQA 1MA3A 1Q6ZA 1YNOA 3CLSD 1SZCA 1OZGA 2JLCA 4J16C 4K9KA 2H2IA 4GM0A 4IAOA 1M2JA 4F56A 4GM4A 3D7KA 1PYDA 5EJ5A 1PT9A 2JLAA 4JSRA 1V5EA 1Q1AA 3EY9A 1M2HA 4UUAA 4BN4A 1PO7A 4MQ5A 4BV2A 1M2KA 2H2DA 1V5GA 5K3SA 1M2NA 4Y6LA 5DGDA 2FN3A 2FWNA 4KPUA 3RIYA 2OD7A 3JR3A 1EFVA 2UZ1B 1OZFA 1M2GA 1V5FA 4I5IA 2NYRA 3IAFA 2X7JA 1N0HA 2PANA 4IG9A 5DEIA 4L3OA 1U28C 2VBFA 1PVDA 3U31A 4K9PA 5EJ6A 1UPAA 4RMIA 3CLRD 4G1CA 4BVGA 1Z8NA 2H2HA 4HDAA 4BVEA 2JI9A 3LQ1A 4MPJA 5MFZA 3FZNA 5EJMA 1PNQA 4BN5A 1YBHA 3GLRA 4GM1A 1PTJC 4UTNA 1Q17A 4JT8A 2PGOA 2Q27A 2VBGA 1O96B 3PDHA 2Q5JA 4Q9DA 4C78A 1YI1A 1S7GA 2PGNA 4JT9A 4V1CB 4HD8A 5BWOA 2JI7A 2VJYA 4J1TC 2B4YA 1UPCA 4X3OA 5K6RA 1D4OA 2A1TR 2JI6A 4COKA 1O97D 1U2GC 3PKIA 1UPBA 4UTRA 3JWPA 2H2GA 4UU8A 4Y6QA 2OD9A 3GLSA 1PI3A 1PNOA 2BRUC 2UZ1A 4V1CI 4D5EA 5K6TA 1J8FA 2WVHA 4QPZA 2IHUA 5EJ8A 2OO5C 2H59A 1T9DA 3F6BX 5EJ4A 4QQ8A 2EZ8A 4UU7A 3D81A 2W93A 1DJLA 4K9MA 1YHYA 3U3DA 3HWWA 4RMGA 4FEEA 4UTVA 5AHKA 4KXQA 2H4FA 4BVBA 5FEMA 4D5GA 2A1UA 2HJHA 4TWIA 1YI0A 3CF4G 3E9YA 3EYAA 2EZUA 4GPEA 4UTZA 5EJ7A 5MFPA 4UUBA 4RMJA 5MGNA 4ZP1A 4RJKA 1SZDA 2C31A 5DGTA 4Y6OA 4O8ZA 4F4UA 4K9OA 4BVHA 1ZPDA 1MCZA 1T9AA 2VBIA 3OE1A 5BWNA 3ZGOA 4R8MA 2EZ9A 4KGDA 3CLTD 3D4BA 4JUFA 4FEGA 4JUBA 2OORC 2QQGA 4MPPA 4FZ3A 3F6EX 1NM5C 2FR8C 5MF6A 3ZG6A 1S5PA 2Q5LA 2VK1A 1E3TA 1U31A 2QQFA 3CLUD 4GP9A 1YC2A 1OVMA 1POXA 2NXWA 3FSJX 4JUAA 2EZTA 2Q28A 4C7BA 1OZHA 1Q14A
chains in the Genus database with same CATH superfamily
4NU6A 4CM4B 3LT4A 3OQPA 5IDQA 5AMXA 4BNNA 3DF9A 2YNMD 1YB7A 2NVBA 1AJEA 1R0CA 3UF0A 4QTUB 3K7EA 5JMWA 1IN1A 2HJSA 5GQSA 3H5OA 2XT6A 1P1HA 3QNWA 3I2JA 2VLIA 2IHTA 3AEKA 3C97A 4B3TB 1X3LA 1SHUX 3L8YA 3LT0A 5CJJA 3OJWA 4Z7JA 4JHXA 4LBVA 4EP1A 4D82A 3U44A 5DHQA 5G41A 4NJEB 3B51X 2R11A 4IIBA 1CF4A 3JQQA 3QFRA 1ETUA 4FHFA 4XIGS 3H3FA 4LJ7A 3RTDA 4B3SB 3D1JA 4B35A 1I1NA 4IYRA 5E7MA 2P6OA 3D59A 5DTIA 4A6XA 1N9GB 4UNPA 3I9KA 3NQ41 1VHJA 3L6DA 5ILGA 1E4YA 3LECA 4AYWA 3BWCA 1QIEA 4Q3AA 1FSSA 5C7YA 1YU6A 2ATVA 1XPRA 5H5JA 5AM3A 1ADBA 4YQYA 4X54A 2Q7DA 5KOYA 1AHNA 1Q12A 3O38A 4GMGA 1M2JA 4PS1A 2P6PA 2DFTA 2JAWA 3I2GA 4NBWA 2X22A 1HKHA 2CXHA 3OOJA 4R0VA 2AC4A 5I3CA 1RMQA 3WRYC 4S05A 1QX3A 2YS6A 1WXEA 3W5BA 4EQ6B 3AIOA 3DCIA 4RCVA 1NUPA 1M75A 3GN2A 1N8NA 4MS1B 3V9AA 1QRUA 3W2TA 2FN8A 4OLHA 5KYTA 3UH0A 2VSFA 1KQOA 4R68A 2XUGA 5HQ3A 1IZYA 1H6CA 2VRBA 1EUDA 2ZE8A 2FQXA 3MFYA 4C6TB 2QGNA 4BP1A 1U2QA 4YP9A 4L4ZA 3EG9B 4RWZA 4F3NA 4P53A 1LVUA 2J59A 4UZEA 2NYUA 4B84A 2PLFA 3CH5A 3FE2A 4RKWA 4R1NA 5A71A 3F6RA 5ECGC 2Y92A 3KEGA 4KQGA 1B6TA 3WISA 4HI0E 5HGXA 5G0SA 2EFEB 1F8XA 3QXJA 1I2CA 1YH3A 1GU7A 4JJAA 4LFCB 3DD5A 3DL7A 1G7TA 2OHGA 5KU7A 2JJ1A 2QRNA 1BN7A 3A4TA 2YDYA 1CUYA 1FXUA 1DLJA 1UDRA 1W48A 3CR3C 2UYYA 3QHPA 1WPXA 4OMCA 3DFIA 3M8KA 5TLSA 4FMDB 2OD9A 3GLSA 3UWKA 2IITA 2X4GA 2EL7A 4LJSA 4ZCMA 2GGSA 1CY4A 3LQRA 2Q6OA 4HAVA 2OCXA 4DDMA 3DW3X 1O08A 3PNKA 3F9RA 3GLGA 2W9XA 1EK0A 1TOAA 2NNLD 3KEOA 5D85A 4BV8A 4FEEA 5IXYA 4RK6A 2A1UA 4AZ3A 3K73O 1RT9A 1YZ3A 1VMIA 2LKCA 2JNWA 4O4LA 2R6ZA 2OGWA 4GAEA 4RGVA 4DMRA 1TIPA 2B61A 4DDUA 1AX9A 2PGIA 721PA 4YYZA 3GH1A 3GZJA 3RVQA 2BEUB 1QQ7A 1VYTA 3DLAA 2GZHA 3AF5A 3HEBA 3PFBA 4LFBB 2QJTA 3I72A 3WLAA 4EECA 1U7WA 3EEFA 4UQPA 1ITZA 2QT0A 4MRMA 2Z6UA 1QWSA 1H1LA 3HJUA 1C7IA 1HDEA 5IJ0B 4X64B 2ZBDA 4Q3OA 2RHMA 5AKKA 1UOPA 1JE0A 3CE9A 2BTQB 3DC2A 4Y2JA 1SOVA 4MR9B 5IP5A 4BX8A 1YF3A 3LLCA 3MJFA 2DJIA 4F11A 2WPNA 2P6RA 2G77B 4IHJA 4JQSA 4FN4A 3E23A 5BR7A 2AOTA 2Z1DA 1D5WA 3KSZO 1JSCA 4JFAA 4RCZA 4IFBA 5K3BA 1GAQA 1GLNA 1L5LA 3ADCA 3EZ7A 1WDWB 4J03A 3KXKA 2WPDA 3QKSB 4KYVA 1JDJA 2QX4A 5BYKA 1AKEA 2YBEA 2YV5A 1SCKA 2Q5FA 2QI9C 2RARA 3C1OA 4W8GA 4XXHA 3ZBPA 5J59A 3T5AA 1BE6A 3GI1A 1QC5A 2TMYA 3LPCA 4M9RA 5CFRA 1Z39A 2NSHA 3PKJA 3LP6A 1BGVA 1S2IA 3AZOA 5JXJA 4TN1A 1FFEA 1CEEA 4FBLA 3NU1A 3FNFA 3PI7A 2BGNA 1Q16A 2W22A 2CFRA 4MS3A 3R74A 5EWJB 5GINE 2PU7A 1XCMA 3OT5A 4TVKA 3ZCRA 2I1LA 2QTTA 2ZTHA 2JANA 1A5TA 3N07A 1DMRA 2NTVA 1QP8A 4HEJA 3AXSA 2OCDA 1QMPA 1TQ6A 2EF0A 1IJFA 4LPKA 2J5QA 3FKQA 1JR3A 1W88A 2ZRDA 1KDRA 4TWRA 3UC5A 5DW0A 5I7WA 4IKEA 5B3KA 4QUIA 1YRAA 3PZRA 4TLMB 1PO7A 3RYFA 5EJIA 5KNBH 3PUXA 4KXFB 4F3CA 4DR4B 5ALRA 5ALXA 1QHYA 2VJAA 5K0GA 2CEKA 1PQPA 3H6HA 3MGKA 1ZIPA 4YWHA 1DO8A 4URUR 1HYGA 3FTDA 4OG2A 5IKEA 4HG2A 1ECBA 1LTQA 2I6SA 4RE6A 5JC8A 2JIRA 4HWPA 3U31A 3P0RA 1WS6A 4G0ZA 4ZOAA 4YASA 4ZIRA 5TX7A 3DEYX 3QJYA 4FR0A 3OOWA 1FSPA 3PNOA 2VOEA 4KQKA 1M2WA 2QN9A 3K0AB 3MB5A 3U7QA 4LRTB 2FDCA 4BTVA 3GLRA 3OJCA 5IVHA 1E2QA 1QKKA 2BHNA 3AETB 3KOWA 5AKZA 2A84A 4IIDA 4IZ6A 1M5RA 4IRMA 3K8ZA 4A4DA 4K40A 4RKRA 1E79A 1E61A 3PNVA 1TYBE 4R0NA 4XYLA 5C7IO 1EGMB 5CCXA 2OBLA 4PTYA 3TWOA 4MDYA 221PA 3ASZA 1JG4A 2F1IA 4WKBA 4R41A 2AK3A 4IWXA 4QUHA 4F5YA 5TVGA 5DXAA 3AV3A 3ONDA 3WIEA 1TVEA 2HU8A 1SVNA 3IAS1 5AD1A 5HRAA 3HP4A 5IVKA 4BNYA 5B3JA 3V8NA 2BDUA 2CDRA 3N2KB 1B2LA 1CFZA 4QLOA 5EZYA 3SYKA 3SZLA 5BN3B 2FPKA 3GRCA 3M34A 2DFNA 4I14A 2BCJQ 2UZ4A 4NCBA 5AXAA 2J3MA 1UZAA 1KQNA 3COJA 4CQLA 1XZBA 2PRIA 2WDPA 1OFTA 4HNSA 1OTXA 4R8VA 1RQLA 2G5PA 1EIZA 2JS7A 1BKYA 3JAKA 4RK1A 1OX5A 1RE0A 4CFZA 1TRKA 3H11A 2AJDA 3LW8A 4Q3DA 3VA7A 3U4CA 4Z1OA 1B8UA 3EXEA 2VHCA 2GX6A 4TLDA 2ZAOA 4QASA 1YZFA 3TBFA 2EEZA 4PANA 1NKSA 2V5VA 1PGJA 2AXEA 2VUHB 3MF4A 1XSEA 4PM4A 3UT5B 2X5OA 2FN4A 2VHVA 3K5IA 5KQRA 2OWDA 3U9SA 2Z6AA 3GNSA 3R4CA 2G0AA 2PSHA 1XDZA 4MI3A 3A6JA 4GEGA 4KN9S 3REQA 2QRJA 1YTLA 4P3PA 2JD0A 5DHAA 4ECEA 1SG0A 4PN7A 1Q84A 2VNJA 2DFKB 2ODTX 5TQ0A 1EJBA 1LK0A 2V6GA 3CLRC 5DF1A 4CMIB 4F1KA 1S8NA 2E82A 1QXSA 3NOVA 4MYTA 3KSBC 4D96A 3UWSA 1CB7A 2HHCA 4M54A 2OM6A 2IPNA 4GNRA 2ZTMA 3VNSA 1RJ9A 3N0TA 1N2OA 1WMSA 2Z8YA 4GPBA 2BKVA 2FHSA 3GT7A 4IRUB 4UEOA 3VU3A 5JAPA 2HKIA 2XA2A 5K0TA 3PS9A 3BA1A 2F67A 2XT0A 4FYJA 1Q6YA 4JCOA 4P1ZA 1SUEA 2O3QA 4V1CA 3VFDA 3W2GA 2J32A 3BMNB 3V00A 3ZIAD 5K2OA 4BLSA 1B0ZA 4ZC1A 4E2FA 2XGGA 5FTNA 3JU3A 3BJRA 4ZJUA 4PW0A 1HEIA 4IDHA 5KU1A 2R0QC 1YTUA 1Q91A 1FJXA 3BF8A 3QG5A 3S8EA 3NIGB 3RFTA 3KQVA 1Z7GA 4U5QA 1H9BA 1PLKA 1ORVA 2COKA 4Z8XA 1IG3A 5CCDA 1XDUA 2BGLA 1P9WA 3BH7A 2WHRA 4H31A 3T3HA 5BWBA 4B6JA 4DRYA 5F77A 1UDCA 1CT9A 1LXCA 3QNMA 4BN4A 5FOSA 1U1GA 5T67A 1ZK1A 5ERXA 3C87A 1NVUQ 3IAUA 1B3BA 1VP9A 3OU7A 1IC6A 1RYEA 3HE3A 3I04A 5EKXA 5KSPA 4G8BA 4B32A 4B3GA 1M2GA 3PP8A 1SH7A 5H02A 4AQDA 2XVMA 2A0FA 4ZHSA 4U6NA 2JZCA 1E2IA 3RH0A 4D3YA 5IRCD 3H3XA 2VWGA 2PEZA 1LFAA 4NE9A 2FV8A 3WR5A 1NN3A 3TOZA 4HO1X 1G6KA 1U0JA 4DEVA 3HBLA 5CB6A 3T41A 3SR4A 4AF6A 3DTVA 4Y2HA 3ZH9B 3BXEA 4WK0B 3D31A 3ZVNA 1ABFA 5CW1A 4WGFA 4Q00A 5KYWA 4WJLA 2CD7A 2ZPTX 3T5TA 4C78A 1CIPA 1WXWA 5K0JA 3JQAD 2J48A 2PX3A 2ZJOA 3N3BC 4HZIA 5G1PA 4E4YA 2JJMA 2D54A 2PVCA 1N0WA 2QSYA 4PPGA 2IHKA 2J9FA 4WFIA 4DF3A 4MR7B 5BW5A 2AZTA 5FA6A 1QLJA 1W96A 3RTCA 4D4MA 5KB3A 1Q7BA 3RKSA 3N0RA 2EC5A 1A8QA 3P0FA 5ESRA 4L28A 1KAEA 3GVXA 3OT1B 4BBJA 4FWIB 1N33B 4US2R 3FNHA 5LIRA 1NVEA 2E49A 2Z9DA 3LS2A 4WD3A 2VQ3A 1N4DA 3WNQA 4ED9A 3IE0A 3FLBA 1B41A 2EW8A 1DFGA 2IEGA 3A31A 1YMQA 1ZD3A 2AF4C 3BWDD 4JBNA 1U0EA 1M1ZA 1OUMA 1Q0LA 1GGEA 4ND5A 5E8JA 3PPVA 3BFVA 3GROA 5G0WA 3SI7A 5A2QA 2IXDA 3FPJA 2CXTA 4L8WB 4ESVA 3M4NA 2ZR8A 3D54D 1WUKS 4KSYA 1FDOA 1FFXA 1W93A 2FW1A 2VSOA 3AFMA 3QNUA 2EIHA 5DCUA 3TGPA 4V2IA 1HX7A 1IWBB 2NO9A 1JAHA 2HCRA 2B20A 3OQJA 1KVSA 3PNPA 1M3SA 3FCOA 4I1YA 1PG0A 3RSCA 5JC1A 4FHDA 3QMWA 3CJTA 4C87A 1W5SA 4TTAA 4O4HA 4CG3A 1JLKA 2I29A 1A8SA 4MWZA 3B1VA 1ORDA 3KHUA 2M6RA 3LYHA 3H99A 5EFZA 3C5CA 1CUSA 4LUCA 4EGQA 16PKA 2PA3A 5ICGA 1JYEA 1ZR4A 5J40A 3DLPX 1QLHA 3FPSA 2Q9AA 1NVKA 4HNUA 5A3JA 3J7TA 5JT1A 1GG5A 4LF7B 2ZR7A 3RWBA 1PWYE 4G0XA 3P71T 3VKUA 3J7AC 5EHNA 3UVEA 2CFSA 3ONWA 1SCNE 4EELA 3DLTA 3X2EA 3CLVA 1HURA 5L4LA 3M9LA 4OHMA 4C20A 4O59O 1REQB 5I9LA 3KRTA 5JARA 2A9QA 1XLTC 1GQSA 4K9QA 5BR8B 1LLUA 4JGBA 3L04A 2I1QA 1O9GA 4QEDA 3GUCA 4DDWA 2FZEA 2GJ9A 2QW0X 2R1UA 1YFZA 2UUOA 3JAWB 4EVIA 3NKLA 3NOOA 4ZQCB 1GNQA 3DA8A 4NZMA 4V39A 4J9UE 3FTEA 1MJGA 2OCAA 1U0GA 3IERA 4ABYA 2OHFA 4N0PA 1SVIA 1E99A 2D1QA 5A2GA 1FNCA 1YJCA 3EGVA 4LHWA 3RJZA 3WRYA 3ITKA 4E13A 1K89A 3GY0A 2D7JA 1MW9X 1NMSA 4LEIA 4YXWA 2G6TA 3PKZA 3AVYA 3VH2A 1MMFB 2ERXA 4PYRA 4DJTA 4GUAA 2GBGA 2X1VA 3I0ZA 3P1JA 4S1WA 5E6SB 1PX2A 2YY7A 5FAKA 1RAHA 4QICA 3SX4A 4JYZA 3LO5A 4DHWA 5JZSA 5DP1A 1ID8A 4GLBA 1M83A 1GY8A 3DUFA 4WI1A 1JW9B 4RQTA 6YASA 1XZNA 1ZMXA 1AUPA 1QLWA 2VBCA 3QLUA 4MITA 1TO6A 2NO7A 4HHEA 5IC6A 6NULA 3OQ1A 1KY5A 2ZVPX 5EVJA 2WG2A 1USIA 3M0EA 3L6RA 4ME6A 4CCAA 1YD7A 1IBCA 3ZCTA 4RHYA 1RLIA 1T4CB 4EZBA 5AESA 4Z0NA 1T15A 4PX2A 1W2HA 3ND8A 5CGQB 3H4VA 2RGAA 5L3SB 2VQFB 1QF6A 1BG6A 4LYGA 3QOXA 4W6ZA 1TM5E 3ESDA 2O2IA 3HDQA 4MB2A 4R98A 5BW4A 4UU8A 4G5GA 1VA5A 1SG9A 2GN0A 1R10A 1E6MA 3HNPA 4ZEVA 5KYGA 2IHUA 4L9RA 1ZY2A 5DHUA 3W5HA 3TPZA 4G81A 5SZKB 4FC7A 2BZ1A 2NVUA 4LZLA 2JLRA 5DN9A 4DR1B 1CERA 1ZVQA 4BMNA 3PFCA 4KXQA 2GXAA 2XYQA 2CLKB 2C94A 4QREA 1KDPA 4M1QA 4TMZA 2J3JA 2Q5HA 3OSUA 4NFSA 1LWOA 3QELA 4PLZA 2R1VB 4D3ZA 4HV4A 4FYXA 1P9NA 4J29A 3WMWA 3JZIA 1VIYA 3AJAA 2AE1A 3N6VA 1JLMA 3NORA 5T4EA 5EMNA 5ULLA 3A4MA 3G0CA 4RK5A 3L6OO 1IEWA 2IY8A 5I7OA 2X42A 2ZRJA 1I7QB 5IKMA 1FDSA 1P62B 2KB0A 1J2JA 4MQMA 2ZRPA 3NOQA 2C4TA 1GGNA 3S5UA 2JLYA 4DR6B 3AY7A 4BDTA 1YDGA 2YZ2A 1VA4A 3AP2A 3KHKA 1KIAA 3PX3A 3BSWA 5IC5A 3ZDEA 3D6VA 4B80A 4C7OB 2JGDA 7REQB 3O8LA 3INYA 3KCQA 2RHDA 1G18A 3N8KA 4P80A 3S55A 1A88A 4OKSA 4NK5A 1WUHS 2XEDA 4YALA 2YVUA 2DUUA 3M3PA 3TDNA 1WVIA 3NVDA 4RQBA 1USVA 1BFDA 2UZ0A 421PA 5K8UA 4DLNA 3OF2A 3M5PA 4I50F 4J4BA 4X97A 5EXPA 1DTEA 3TS1A 4POAA 5HCIA 3IAEA 4W1RA 1SXJC 2F59A 2AB0A 5ICMA 2CMDA 3HM9A 1QPZA 3AEUA 3GRUA 4HXEB 3A1CA 1HFEL 2P65A 3QBJA 3CHYA 4BVFA 2FZWA 5AOCA 1WAMA 1W5TA 4M1TA 4OKNA 3WMXA 4J07A 4LOIA 1YZUA 4QSMA 2PZ8A 3QTTA 1UT6A 2EBHX 1HE8B 4L07A 3KQSA 5K8TA 3NGXA 1T1JA 4MHOA 1OFVA 4KVGA 2WG1A 5TY0A 4RVFA 1NBHA 1FBTA 4F72A 1EFCA 1P7ZA 5CDYA 4YQFA 4M1WA 4M7RA 3C3YA 3F5MA 2BVNA 2QENA 3OKCA 1KI7A 2I4OA 5DXFA 2BW0A 4XYEA 3NP9A 5DLQC 3WE7A 2OO7A 3X43A 1Z5OA 3MWGA 3PITA 5DSTA 4G0MA 1EHCA 4AT1A 2Z6QA 1KY3A 3TR0A 4G85A 5DM60 4TYMA 2E3JA 5IN5A 3AW9A 3OZAA 1VB3A 1XHEA 4CDRA 4MGZR 4CZ2A 1W0JA 4EYKA 4W1QA 3PGLA 1E0DA 2IYWA 1JNYA 3BB4A 3IRVA 3B85A 5H1YA 4DLKA 4A2CA 4MLZA 2FJPA 1Y5NA 4JB2A 2ZRMA 3ZXIA 1P1RA 5EVCA 4C6HA 1N7GA 3IO5A 3K2EA 3OSZA 4IUCS 2C2ZA 2PDAA 4QODA 1UPTA 2Y71A 4TSKA 2O59A 2DBVO 3AVTA 2G71A 1HZZA 1O5TA 1VQ1A 1WO8A 2A1TR 3BGWA 2AQIA 1JA1A 3O4HA 1SCAA 3DMNA 3PVSA 3C98A 4IJQA 4HEA1 3ZIAA 3ZWQA 3K71B 4Y6QA 4LHZA 1O03A 5JI3E 3CQ9A 4P4UA 2Q3EA 2ZUFA 5JNTA 5FTWA 1TUBB 1C41A 3KXIA 3QRWA 4WXHA 3RKRA 4DSNA 3B3QA 3HVHA 1JX6A 2K7FA 3AUAA 4TUYB 4O4JF 1UKEA 1UXIA 1SKMA 3HFRA 2Y0CA 2WJHA 2O2CA 4L0QA 4JYMA 1JHXA 2J3HA 2OKCA 2H0RA 2FSUA 1XMVA 5F1PA 4AX4A 2ZJ2A 5IJ9A 4WZAA 1YBVA 5JH7F 2YWXA 3E81A 1MP0A 1TYAE 2CLFB 1PEYA 1U3FA 3F90A 1BHO1 1MZVA 1RP7A 4KOAA 3D3KA 3U3XA 2XGMA 4AJNA 1CNFA 3QY0A 4GVPA 4BQIA 1I33A 1YQDA 4UOEA 2OP0A 1IXYA 1YAHA 1FFAA 1K08A 4HDSB 1NYTA 3AH8A 2PSFA 3FMOB 2FDRA 1G17A 3DP9A 2W4QA 3ZJYA 5K20A 4DUZB 1G8FA 4Z9YA 4DADA 4DQLA 4GSKA 4JEHA 4KZKA 3WRXA 1D2MA 3WBBA 1FDUA 2LRHA 1T1SA 4QDZA 1LF5A 2HQSA 4ALJA 2YV2A 1ACMA 3NTOA 3T52A 1E5XA 4JBGA 4DRZA 4OHBA 4ENVA 4R1SA 4Z2AA 4RMHA 1K75A 4JJ8A 1KPIA 3PNQA 4GG1A 5FV4A 1J42A 1TVCA 3M6AA 4MYDA 3NAMA 4QUJA 1SCDA 3MLEA 3S2FA 4D44A 3ERCA 1TZJA 4DQKA 1EVLA 4BMDA 1OAKA 1Z28A 3WYCA 3IXQA 1JFSA 2X13A 2DWPA 1T9CA 3HHPA 2ID9A 4XVCA 1BROA 2XY4A 1P0FA 3U09A 3ZJVA 2EWMA 2IXGA 4U2GA 4BN0A 3FMVA 1RRPA 5INTA 3H9GA 1UMCB 2VK8A 3B12A 1RQNA 3WGHA 2COEA 2RMKA 2ZRKA 2D8AA 5CB0A 4D26A 3VJRA 4B4DA 4ID3A 2ZREA 3TUIC 2R00C 3JQRA 2YMPA 3I39X 3HB7A 3NDPA 2NUPB 2FTKE 3HA3A 1K8YB 2I7TA 1A50B 3N2ZB 3FWPA 3PHJA 3I6ZA 4FHCA 1YACA 3GBVA 1W2GA 3L8ZA 2H2IA 4F9GA 3KL2A 3R3XA 2QUIA 2BUBA 3CJQA 2R6JA 5BSUA 1SVLA 1ZVMA 5LYJB 3PTLA 5KQSA 3UMGA 5GONA 3DCJA 3RAJA 1N32B 1C4KA 1TQ8A 1TZBA 3C3PA 3CRMA 1M2KA 3GLHA 1M6HA 4HH0A 4HTFA 4MV7A 4D9HA 3KU1A 2NUBA 3WHKA 3W8RA 2P30A 4RK4A 1SA0B 3UJ9A 3RWMB 2JGRA 3LAWA 3LNCA 1WY5A 4FX5A 2W8BB 4P6VF 2JH3A 3NBXX 2DF8A 4RXMA 2YYAA 4E46A 3R3ZA 1KJ9A 2VAXA 2MT9A 3OWHA 4MTLA 1Z4QA 3BK7A 3NDJA 3PXDA 3SVTA 3OZSA 4X8HA 2PRZA 5CDGA 3R3UA 3L93A 3RQSA 2YN0A 4PFSA 3RE1A 2X9NA 1K8QA 5DBGA 3DAOA 2W2KB 3E7WA 4R51A 4E2WA 2ZZKA 1THMA 3DS8A 1QK4A 4TQAA 3UTCA 2PX4A 1U8FO 3SS8A 3EAGA 4WEOA 1E92A 2B1RA 2JI6A 1JDUA 1M72A 1WDMA 3D6MA 4PQGA 3O47A 2JEZA 3DMPA 1TVKB 1F2VA 2O6LA 3KQQA 2WTEA 2PXHA 4RORA 1CS4C 2BSAA 1Z26A 4WLOA 1I7LA 2DWUA 3GA0A 4A15A 3DE5X 2ZJZA 1IOVA 3E3NA 3FHOA 2BCEA 4XCXA 5EIOA 3D7RA 5FPSA 5FHQA 1GKLA 4EEXA 4C4RA 2ZR0A 3UQZA 3G23A 3JALA 2QX8A 3EODA 4BEVA 4CEIA 1Y0BA 2I6QA 2WKRA 3WNVA 2EZUA 1HO3A 3PC2A 1JJBA 4XWKA 1PL8A 4PX5A 5KNCH 3BRCA 1KMNA 1YASA 4OLJA 1E7QA 1VJ0A 4JL6A 4YAEA 2GT1A 1OLUA 3A1SA 2R00A 1WKVA 4RWEA 1XZKA 3WWEA 2Z1NA 1GAJA 3AF3A 1WXXA 3PL1A 4Y2XA 4FIDA 1JQBA 1HKUA 3G9UA 1YJXA 4CT4B 1AGNA 1MC8A 4AUNA 2HSEA 4CBVA 1AGXA 2A5LA 4ZAVA 1C0IA 2OORC 2AZDA 2BTOA 3D1LA 4R3UC 4A6PA 4OMFG 1DBPA 1WW2A 4ENQA 3C48A 3EIEA 1RP1A 4RDHA 3WFJA 1H93A 2ZVJA 5BV1A 4IGEA 5DMHA 1Y7TA 1Q2UA 1E9CA 3FHTA 5ICCA 3QMPA 4RLQA 4RIIA 2ZZMA 3PUYA 3GGDA 4OIMA 3BGVA 2H1SA 2GFQA 4CN9A 5JBIA 3PUVA 3IP5A 4YJ2F 3LHKA 1GZ6A 1XRPA 2P67A 1JHUA 2XNKA 2KHZA 4LYDA 4NYMQ 1XOIA 3EUWA 5J4KA 2GZ2A 1XZLA 4HFRA 4ZAZA 1HDRA 3WK7A 4L16A 2B4QA 3PHIA 3RU2A 1PBTA 4I08A 4O2AA 1RZRD 3FYTA 3UENA 1XLTA 3HKCB 2Q3JA 4ZT2A 2CCGA 2R85A 1XTZA 5LFAA 1GZ3A 1RZVA 2PAFA 2PUTA 2R4QA 4FCTA 2CBXA 4BKQA 4EPTA 1USGA 1PR4A 4KQJA 3TLMA 2CLDX 4G1BA 2VS1A 2ZITA 4F8YA 4Z4CA 2XBLA 1K06A 1FMLA 1JXMA 2V7EA 2ZM6B 1CU1A 1TZ2A 3FAZA 2RK4A 3U44B 4NI5A 3WVNA 4IMIB 1E2EA 1E1YA 4K6GA 4YTEA 2ZUEA 3HNOA 1OWMA 4RIGA 1XAGA 3ACBA 3QMMA 2HJWA 3QWHA 5EA2A 5K1ZA 4N76A 2X8JA 1HM5A 3UPDA 1MIHA 2DUMA 4OHVA 1EZ4A 4JI4B 4KCGA 1E59A 3DBLB 4IIXA 4ZVMA 5B64A 3F2VA 1LCIA 3RROA 2NTEA 4IXMA 2PT6A 3HBFA 1X1RA 1WUTA 4UHCA 2VXOA 4LOAA 5DBOA 4C2AA 2AD1A 1TF5A 3AUJB 4OUDA 5SY9A 1ABEA 1RQXA 5JO0A 3CKMA 3PEFA 2PVPA 1MJNA 1TDJA 2BGGA 5E1MA 4AY2A 2Q99A 5FR1A 3W3AH 3OM0A 4M83A 4RY2A 5JPDA 1USUA 2B98A 4C9BA 1O6ZA 1UBJS 4H3HB 2IW3A 3P9XA 4MWCA 4TVOA 1Z0ZA 2XQKA 3M6FA 2O48X 4DJEC 4E08A 4YMTA 1FPMA 4HN4B 3ORYA 5JS2A 4CMGA 1RQGA 3PE3A 4FI3C 4CG1A 3VAZA 5JCXA 1SUPA 3QVKA 2P9TA 2YWHA 4GS5A 1KK0A 2F1OA 2C98A 3FF1A 4MVCA 2DRIA 1Q7RA 1SHLA 2EQ5A 2IJGX 2QD2A 2YWEA 1CLEA 3K1JA 5F35A 2R66A 5LYJF 4AICA 4U6QA 3KXPA 1TEZA 5F7OA 4Z1MD 2XUHA 1Z22A 3RQIA 3PJRA 2Z8XA 4EUKA 1CD5A 1QH1B 2E4VA 2WNHA 3VHRA 4B09A 3N1UA 3SFZA 3JQPA 5IJ9B 1FP2A 4QQ8A 4MVJI 3PXBA 1G8KA 1CP2A 2BDEA 2ISSD 5AKHA 3FMGA 2GS9A 1DO0A 1H8ED 3A25A 1CIJA 3H0CA 3JSAA 4GGOA 3N2YA 4JYCA 4TLBA 3TH5A 1II8A 4FCCA 2QG9A 1CQZA 1QZXA 3P4YA 4PLWA 2QRGA 3BOSA 4QVKA 4LN1A 3U62A 4YUZA 4TZKA 2UXCB 3BSYA 5FL3A 2QBYB 4PBTA 2ZAYA 4NZ9A 1VXOA 1L8AA 3MGBA 1NBME 3B3GA 3LBFA 5F73A 3IAHA 2QRQA 4MYHA 1L1FA 1DKRA 2FPIA 4ZMSA 1WDTA 1WZIA 1K0UA 2G1AA 3Q7PA 3T6KA 1G9TA 3DFKA 3WK6A 1ZVKA 5LQSA 4CV3A 1GUBA 3HU2A 3LDUA 1AZWA 3E8XA 4RH3A 4AUMA 1U2RA 3HL0A 3KKPA 2VF4X 1PGNA 4NCIA 3T4XA 1GTSA 3NBKA 1B43A 1X7HA 3AEUB 3BG5A 2VO1A 1KZ4A 1XEXB 4FFVA 1N5KA 3EGXB 5CRIA 2Z9BA 3UW1A 4QU9A 3A4LA 4MWDA 3AUTA 3ZWYA 4IDFA 3TZKA 3A9WA 5K0BA 2XOXA 3H1GA 4II7A 1H2RS 2A35A 3WTCA 2A59A 4RFSA 4ZHQA 3EVNA 3CB2A 3WXMA 2DTDA 2FY8A 4MB0A 3ROGA 3QEJA 1JEEA 5DWVA 3PSAA 3W6ZA 2B94A 1KDZA 4C3UA 3RUPA 4QARA 4JASB 1G20B 4XYGA 3UWMA 2GNOA 1X77A 2WJYA 1VE5A 3AVVA 1B2RA 1J2YA 2Q3HA 1P45A 4LKOA 4ISBA 5C1IA 4D98A 5EP1A 5LP6F 4GXQA 4NPCA 4ZOLB 1T34A 3UJDA 4QT0A 5F5NA 2YHIB 1JSXA 1CRLA 4FPXA 1MB3A 2W2OA 1YB2A 1GKUB 1QGUB 2J45A 2GRAA 2H0AA 2X23A 1C30A 4LBZA 3EEQA 4NZZA 4EUSA 2DCUA 2HRQA 2JJ2A 1NIJA 3O2NA 1H2BA 2V7QA 2HWYA 3WIVA 4GZLA 2LNDA 3DT9A 5KYUB 1EDDA 1KDOA 2PYIA 5EEHA 5HEKA 2QUHA 1QS0A 2V65A 1GUYA 1ZUHA 2FPMA 3VTKA 2QIOA 3FKSA 1QFXA 3A9CA 4GEKA 4R4JA 3RS8A 3F6YA 1HGXA 1UDWA 2JH9A 3KBOA 3ME5A 1DINA 1WOYA 2RHTA 3A3OA 4KDCA 4KWTA 3T1HB 1J4AA 1AV6A 3AUXA 4X1YA 5JYEA 4FUTA 1LK5A 2QI9F 1NXOA 1TPYA 1Z8NA 3BVPA 1M7HA 3T06B 2P4EA 2DB3A 2MYPA 2GM9A 5EMJA 2BLNA 5JYCA 1GTL1 3ORQA 4DDHA 2YJNA 4F5EA 3AP1A 4WCFA 4MK4A 1V1RB 1O4VA 4N3AA 1CEYA 4BGIA 3LVBA 2SCUB 4QWWA 5L6MB 2FPPA 1QH9A 2C9BA 1HSZA 1V11A 3ABRB 4M0DA 1I8TA 3N0VA 3BXZA 4EX7A 3DE7X 5REQA 5BYAA 1DHRA 4CDMA 1W46A 1ORWA 3FSEA 1S7CA 4GUDA 4MVJM 5A0VA 1K6JA 3ZDCA 2HSZA 3K1TA 4KK3A 5EJ4A 2VKQA 1VDZA 1YVRA 1SBIA 1XCGB 4P2BA 3TQOA 4PR0A 3V8BA 1YBMA 3H75A 3SSNA 1YI0A 2N1MA 3O4VA 3ZR4B 5CTAA 5D5QA 2XB8A 2I1WA 1SBQA 4CPDA 3IJEB 2MDTA 1EM8B 4UDYX 3HY6A 3CONA 2CLOB 1A2KC 1YRBA 4PU0A 3MMNA 3DHWC 2O07A 2OG1A 3ULKA 3P2OA 4UNSA 4TV8A 3LOQA 5BSFA 1TJ4A 4YCLA 5T4BA 2RGUA 1PGOA 3DPUA 2RI6A 1ZH4A 3RT7A 3MTAA 3QVGB 5KREA 2BCGY 2P9EA 4U2DA 4BWFB 1N2XA 4JI0B 2OLEA 3DNPA 3F3MA 5IYZA 5KPJA 1ODTC 2FQYA 1MAVA 1T0PA 1K2VN 4MWGA 3F47A 3TX2A 1CUGA 3SY8A 1S3SA 3DWFA 4JR0A 5I6DA 1UP4A 4XDGA 2HBYA 1IEXA 5ER6A 3EIUA 5THKA 3GRFA 3O1IC 3M6XA 3A58B 3EDRA 1UBOS 2IHVA 5IAKA 2XSZD 3GEPA 4J0HA 5H8WA 3F0TA 1T9ZA 4U2EA 1RIFA 3U26A 1F60A 5KMGB 1XAIA 4KH1A 5L45A 3BXPA 2RGCA 1W35A 1XCJA 1N2CA 4V38A 1SXJB 3F1LA 3PQ8A 1W87A 1E63A 2C2WA 2P78A 2B1GA 2OT3B 1P5FA 3QYAA 4QAJA 4B6QA 4U7WA 3AKDA 4HQNA 2APJA 3B36A 2WHPA 3U48A 3UBTA 4DB4A 1RXCA 3LO8A 5IT4A 1QGAA 3E5RA 1FB5A 4WK4B 3DDZX 4AS2A 4RA6A 4US0R 3V8MA 3E3AA 2CDBA 2NP7A 4L9SA 4PAMA 5TXGA 1PP4A 4QKQA 5KYXA 3A27A 3VC7A 1QE5A 3GGGA 1IY0A 3IBGA 2RGNC 1MZPA 2IHNA 1DTWA 2HIHA 2NXJA 3F5FA 2XAUA 3JZMA 3G8CA 4MIEA 5F1KA 4JLBA 4OQDA 1AF7A 1WTCA 3RTBA 3S2UA 2JFUA 4KC0A 4EMSA 3VC1A 3N28A 5LQUA 4KH0A 3UW3A 5KTYA 1W19A 4LE2A 4MQ4A 5FB3A 2Q3BA 4WFKA 4AJ2A 4PX3A 3DMRA 3FOAA 4FT4A 3DLCA 1YMVA 3TQIA 3VHQA 5BNZA 5IG2A 4OH7A 4N39A 4C3OB 1TK9A 2VBFA 5IBRA 3ZCPA 5G53C 1C8KA 3W4IA 5IFKA 3RUIA 2AWOA 3INTA 2DHCA 2C3UA 1QFJA 2ZJFA 3HU5A 3M6UA 3M6VA 4M0MA 1WETA 1FDWA 5CJ2A 1UZMA 2AW3A 2XB6A 3KOZA 1CF2O 2DBYA 1IZ0A 4E5VA 4QUDA 4Q19A 4GF5A 1Z38A 5CXXA 3A04A 1P0QA 1VLQA 1AA9A 1CNMA 2YJTD 5H3LA 2XUFA 5ELXA 1YB4A 1GPH1 2JI7A 4OP1A 3I76A 2F4VB 1KYXA 1UPCA 3PQ6A 4FDTA 4FILA 3DHEA 4C0KA 2BPOA 2JGAA 1GU0A 2IYLD 4EAQA 1J23A 3IUPA 4PGMA 2NU9B 4PG7A 3IXLA 4K6MA 3VO1A 3TEJA 3WP0A 1HNZB 3UKOA 3WZ2A 5C53B 5TDHA 2YJ6A 3VZCA 4UAJA 4BNLA 4KXMA 4CV1A 3G2KA 3MS2A 3DBIA 5J9FA 4W8OA 4E6EA 1I6WA 4JNKA 2BBOA 3ZE6A 5C51B 4FFWA 1EA5A 1D2RA 4LF8B 3JQ9A 3KWJA 4FK8A 1JDNA 3OX3A 1ZP6A 4F7DA 5IPFA 4C4OA 1EB8A 4UCFA 3EZ6A 3JQAA 3MAJA 4IVQA 3N0WA 1GPLA 1SVWA 4P93A 4F2HA 3K0CC 2JLVA 1OJLA 5A6SA 2BZGA 3RIHA 2RAPA 4ZOBA 3PXXA 5B2ZA 2FN7A 1T9GR 3T1QA 3DZGA 1M1NA 3FVQA 4O2LA 2YMQA 3ESQA 4KX5A 1QIJA 3CIFA 4KYUA 3SKXA 1Q92A 3ZYCA 1N3BA 2WRZA 1VFPA 2QX7A 3R3SA 4MH0R 4PHCA 5CK4A 1JMYA 4Q12A 4CMJA 2IYUA 2QTFA 3EMBA 3VPCA 5A5DA 1ZKMA 3IE2A 4LSZA 2P27A 2D0PB 4C3ZA 3W2HA 1C2TA 1NBOA 2OHVA 2QVGA 3C3DA 1FS6A 5DLEA 2GN6A 3H7AA 1NUTA 3T7IA 2CYBA 3A1VA 4PIMA 2ECQA 3QUTA 4DV6B 4JJ6A 3ESXA 5H83A 3PEVA 2VUTA 2PZLA 1N2IA 2ECFA 3WLPA 4GRIA 3ZQJA 5FTMA 5LOVB 3NATA 1NJGA 2O3JA 5AP9A 2GZRA 1G42A 2OFPA 2R2GA 2O2SA 3CZMA 3FLMA 1EXDA 2O1SA 2VRCD 4RETA 4R6XA 3ROFA 2QL9A 4NFLA 2JFNA 5JASA 2A1TS 3HN2A 1NJ2A 4F84A 3UWPA 3IOYA 1XMXA 3E48A 5B1DA 1WBJB 2HOQA 4KFSA 4RHFA 5LJIA 3PC8C 1FX0B 1AC5A 1BCSB 4M87A 5KJCA 5COBA 4GP7A 1ZR2A 2HJRA 2PFSA 4P5DA 3L4BA 4INJA 4IAOA 3FFAA 3H9JA 1R8XA 4UEKA 4JP8A 1MH1A 2JLUA 4Z3DA 3GJSA 4UM5A 5BVGB 1W5BA 4K46A 2YWJA 3RUHA 5AI9A 2X4IA 4MUMA 1T8SA 1DS6A 3JR3A 2VPYA 2VYNA 1ISJA 1NOJA 2WB2A 1XPOA 3T3IA 2VPIA 4UD2A 1DAHA 1U9IA 4LXYA 2P7IA 3KUDA 1GQQA 1K92A 2VAVA 4FLEA 3AB7A 1DUIA 3H3JA 1QVZA 2LW7A 3CEAA 2ZQYA 1F2UB 2LVBA 5A4AA 1U65A 2VYVA 2O8BA 4YREA 1Y9JA 3N7AA 4RHXA 1FVOA 1H6DA 4MYUA 4YMSA 1UBLS 5C9ZA 5HUQA 1P2UA 2A6PA 1F20A 4E88A 2R8XA 3P97A 1IY8A 1PCXA 5EQFA 2X40A 2ZWMA 5FWXA 4B3BA 5ALZA 3NRBA 4YXFA 2EIXA 4CIBA 1ABBA 3IEPA 1K7XB 4J7AA 2F3TA 1ECFA 2WTUA 3RTEA 1XEWX 1JECA 2J5KA 4R54A 3CWCA 3R3VA 4WK6A 1T36B 1LJLA 4EJSB 4ETIA 1HE1C 2VDMB 4WLUA 3LHDA 3EG9A 4TL6A 2XA9A 5FAXA 3WKEA 2ZBFA 3BMXA 3LW7A 3LMKA 5LDDC 1KO7A 3DF7A 4UU7A 5F9FA 1P81A 4A0SA 2VH5R 3SWWA 2EERA 2GPJA 4RZ2A 3PR1A 1Z17A 3AL3A 1MX9A 1R18A 3ANXA 3ZI0A 4UUBA 2FHPA 3V3TA 2ISQA 1V6AA 4LCBA 1VDMA 5JFGA 4HLNA 4KXXA 4PGFA 4WBNA 2WILA 3S2GA 3ZVMA 4ZQIA 2OZLA 1UC4B 2OOKA 2V7VA 3GQBA 3S1AA 3U7RA 2Q4EA 2PU5A 3RM3A 3SHOA 4G1EB 3NBMA 5FEMA 2BGJA 1DV2A 2XJ9A 1XVIA 4DXAA 2Z4TA 2HRBA 1KO1A 1WPGA 3IIEA 3L4BC 4J0QA 4Y1RA 4LF9B 2LCFA 1SBHA 2GLUA 5DTJA 3LP5A 1CNEA 3DHYA 3RFFA 5HM6A 2X41A 3CG4A 1GIAA 3NWOA 4Y2SA 2H9YA 4KSBA 4LDPA 4DC1A 1EDBA 4RYLA 1KSHA 1SURA 3AY3A 3GA5A 1U04A 3KP1A 1KF0A 2VWPA 1KZGB 3GN1A 2X0EA 1L5RA 1TPZA 4UHFA 1R50A 1T6ZA 1J0XO 3P2KA 5EKDA 4AY4A 7MDHA 2JFBA 2Q5OA 4CLRB 3NC1C 1E20A 3ZKAA 3FPGA 2FZGA 5A5EA 3WYDA 4FMBB 1POWA 2KI5A 1MOSA 3CW8X 3EA4A 4KR0A 3E7FA 1I1OA 1IQPA 3ECCA 3RC9A 5JDIA 4UBKA 3EXFB 2HF2A 4OA8A 1UBKS 3T99A 1M73E 1G8PA 3MYRA 3S0JA 2NACA 5DHSA 3CRZA 3D7LA 4NJMB 1E8DA 3WFZA 3V1UA 4BFXA 1I7SB 2RC5A 2Z08A 2PJDA 1T36A 5J3JA 3VSBA 1FNSA 3NI2A 2ZIUB 3D2CA 3IFSA 5L9AA 2HMAA 1RCTE 3G7UA 2WUGA 5KOHB 3WGVA 9LDBA 5KTRA 1T91A 1QCCA 2A9FA 1U9ZA 1C9KA 3OE7A 3TBKA 1LV8A 2BFDA 1TZKA 4QTZA 1YZYA 4BXOB 2FMHA 4ZEOA 1DXHA 1GDDA 2WMOB 1ODLA 4NBLA 5I4CA 2C4WA 1S8AA 5EZYF 4DKXA 1P9LA 1OZFA 1C4OA 5H0IA 5HBGA 3C6MA 2NO1A 3MJDA 3HP1A 3USES 3W8DA 4CNQA 1G98A 1DKOA 2PANA 3NHMA 4OQMA 3RV4A 1OXMA 1LGYA 1A76A 2RB4A 4M89A 3K92A 3GP3A 3QWIA 3QLTA 4IV5A 1NIPA 3SQMA 4TTJA 1S8OA 2QAGB 2JAHA 1ZMOA 4Y1FA 1PEAA 3SG0A 2Y99A 4DPLA 1PG2A 4B6EA 4XGIA 4JXXA 3GMDA 1HT0A 1O96B 5A0FA 1DZIA 3LQ2A 5LD2C 2PLRA 2PGNA 1NHGA 1Y3IA 2GZ3A 4RV4A 4LYHA 2JDID 3KPJA 3QVXA 1LY1A 2H9IA 1NP3A 3IC5A 4I1SA 4C7VA 3WA6A 4DLVA 1J90A 4X3OA 1U2SA 1ZNWA 1LI4A 5J4YA 2EHJA 2PMFA 1XA0A 5JQGB 1P74A 1V9LA 3L0OA 3I5AA 2WDZA 2OFXA 5E8RA 2FWIA 3C6YA 1P31A 5DT2A 3NHKA 4HPWA 5T5QA 4ZCSA 2R25B 2G9NA 1JDBB 5I47A 1K98A 3D81A 4RJ2A 3NVMB 1W1IA 3U7QB 1CE8A 1NDUA 4BGUA 1KFCB 4AP5A 1MORA 2PK3A 1NQVA 3ILXA 4FN5A 4MRAA 3FNBA 4A92A 4G0WA 3A1TA 4OX9Y 2GEKA 1Y7HA 2AI3A 3GVIA 4BZQA 1QK5A 2MSCB 1G8YA 2ZWAA 1ZVVA 4X1OA 2EGUA 4HLDA 5C46F 2CEAA 2FCAA 1WHTA 4NMMA 1U63A 1TKRA 2ZB3A 1QU2A 3CE6A 2WT9A 5ALSA 1B8NA 1TKAA 3FGZA 3KC2A 4HGPA 1ODIA 4DV7B 3LF1A 2C9OA 3DBHA 3DKIA 1YVDA 4PLHA 1Z25A 3S29A 2E89A 1JIIA 4GBJA 4KXNA 3ZY2A 2ZUWA 3N2KA 1O8CA 3ESAA 3C45A 1E2JA 1NV9A 1OVMA 1X0XA 2GYUA 4N4AA 5GM1A 3ST7A 4ZT3A 1KZYC 2O14A 1OXVA 2XA1A 3H2YA 5EY5B 5LC1A 1WSBA 2H31A 3NJ4A 4GX0A 4BC1A 4D43A 1RMYA 5C5CA 1SEVA 2CW5A 3DGEC 4I5GA 5IK2A 3JAKB 3Q12A 4FJ2A 1ZIYA 4CFYA 1AMUA 7REQA 4DJFC 3R7DA 1RHMA 3RIXA 4U7JA 3RF7A 3G5LA 4R7ZA 3F7NA 4NENA 1EDEA 4MVJH 1T8PA 1VB5A 2IXTA 3GUUA 1AKWA 3UG6A 1YOVA 2G36A 3DEJA 5DXJA 4I4LA 2KYRA 2JKZA 5JIBA 4JP5A 3O9ZA 4X6UA 2XDQA 1EFPA 1GHTA 4KACA 2H1LA 5FEUA 1UFRA 2GUGA 2CJFA 3G8BA 5HOEA 3I6IA 3QP9A 2LDBA 5ESXA 3EMDA 4B4UA 3CIOA 1VJCA 2G7ZA 2YDXA 4O08A 4R40A 5DTMA 5CFNA 1JJ7A 4L85A 4EA7A 2IQIA 1RC1A 2Y77A 1CVIA 4NAVA 1HE4A 5DNWA 1X7DA 4DV5B 2WJPA 2WFLB 3FB4A 3VBEA 4PLGA 4MV5A 4Y98A 4YDRA 1IJBA 2PSSA 1AKMA 3I9FA 4AF7A 2AMYA 4QBGB 3W8EA 2GHIA 5HVNA 4B48A 3UANA 4GU5A 4QG7A 3O6VA 3QFTA 1E2HA 4CKXA 4OJMX 4DDVA 1RI2A 4LGCA 5TPWB 3M6WA 2K2QB 4DDKA 1JR6A 2IUSA 2I6XA 4X45A 1TD9A 2LXNA 2I2FA 1MC4A 1U28C 3GRRA 4DMUB 1RHUA 1N2ZA 5JVDA 1V7CA 5I9TA 2JAOA 3OCWA 4DTIA 2V3VA 5CA1B 1PQWA 1JG7A 2BFMA 3ANTA 4G1CA 4C08A 1YUMA 3FPBA 3CRVA 1SNYA 2Y2VA 3WQSB 1E9DA 3VR5H 1ZXLA 1G5QA 2HIAA 2AJCA 4AM8A 4L08A 4YHHB 3D4OA 3MD9A 1C14A 1ZH6A 2JGNA 5BT8A 1OOEA 1IBMB 2JLWA 5AK3A 2JFWA 1JBQA 1D9ZA 4MLPA 4EY8A 4XEHA 2D2EA 5K0NA 3UBMA 3V8EA 1E3EA 5LLSA 3KQUA 4IY1A 2O7RA 5LJLA 1F8FA 1PJ8A 1W85B 1PHPA 2CB0A 3QKRA 2EFGA 2QWXA 1U8AA 3DR3A 4CIXA 4YP0A 5EQDA 2QMOA 3HZHA 2J67A 3EAFA 3UJNA 4CCYB 4NXMB 3I2HA 3ED5A 1SJ9A 2Q3FA 2CVOA 4PYQA 4ZHQF 4MQLA 1E9FA 3HUEA 4QOGA 4ZV9A 3BH6A 3GFOA 3ICEA 3PR3A 3U60B 1TAUA 4QDJA 1UADA 3EE6A 3TXAA 3AF1A 3NJRA 5KHAA 4UVEA 6AT1A 4PFQA 4RHCA 2CXQA 3PCXA 3VR0A 5IXSA 4MVJE 1DAIA 2JBAA 3WQBA 4NICA 4CR6A 3H4TA 2C9YA 4BX9A 1AXEA 1BDHA 4EY5A 1FFBA 1UDBA 4PHTA 2W2TA 1OFIA 4YJ3B 2YIVX 1LEHA 3HMQA 4RZHA 2QYTA 4Y1EA 5DW3A 3TE7A 5JFTA 6ADHA 1NJSA 2IF2A 3KCNA 2IYPA 4HDSA 4UULA 3R7NA 1Z8HA 4EFNA 5ABPA 3L1JA 3N2GB 4C7KA 4KHPB 4DSOA 4BMCA 4MPRA 4PG4A 1SN7A 4ZU1X 2XMSA 3JY6A 4QVGA 4WNAB 4BBZA 2XTJA 3SZ3A 5H80A 4TTPA 1MHPA 2E1RA 2QW8A 4KO8A 1ZMRA 4PPFA 1NLMA 4QDOA 4XIYA 1D6NA 2C5BA 3RC3A 3ZXXA 1A4RA 1SXHA 4M1OA 3UPUA 4Q3EA 2ZJ6A 1I4LD 4D74A 4PTZA 4M86A 3LX5A 3PGJA 4DV1B 3QJ5A 1V37A 4FYIA 4Z7OB 4O0LA 4HDNA 4EDHA 3IJRA 2FUEA 1KFBB 1U6JA 4N5DA 1SCQA 3C2QA 3C5VA 3GVHA 3BXHA 4G5QA 4B46A 5JXHA 4JXZA 4HJRA 5DNUA 4D3FA 3D3NA 1YL6A 1FCJA 1O95C 1Q83A 3H86A 1BYIA 2H5IA 2JLXA 1G7SA 3IVRA 4Z4GA 2ZRAA 3JALB 2YVLA 3N6XA 1MT3A 4P3OA 5SYAA 4BFCA 5DT9A 4C2TA 1JMVA 3QVLA 3I9JA 5JG7A 2YW2A 1SZCA 3E53A 3R2JA 5EIBD 3QVMA 2GPNA 4OGKA 2DLCX 5T6BA 4W5WA 1JTFA 4OSOA 3IEVA 3G0HA 3VR6A 5HRCA 2ISCA 4KO1S 1PR2A 3EN0A 1GM5A 2V0GA 3E70C 3ELBA 2JFOA 3EDCA 3GQVA 3RD5A 4GYWA 2F6RA 5EIFA 5EZSA 5ALJA 4L8VA 5K3SA 4DIFA 5AW2A 2A92A 1IOZA 3W9SA 4L5BA 3ENNA 1OASA 3OJOA 2GFHA 1IHYA 1ZD5A 4OU5A 4B76A 2PEYA 4MTCA 5BSTA 2RH8A 4PBSA 1XCBA 4ZJZA 2GEDA 4TL7A 4Q6WA 1P0IA 2PL3A 2XOKA 3CMCO 1S2LA 4MAMA 2ZQZA 2N46A 3TCNA 4B79A 3PI6A 4IPTA 2F1KA 3PDIA 3SU8A 1XZQA 3FCSB 4F91B 1WCV1 5JO9A 1S2NA 3N2GA 4IYJA 2QU7A 5ECYA 3TIGA 1M0EA 2V0CA 1HDOA 4ZAGA 5GADl 1ST2A 1B6GA 1R27A 3V4OA 2FI1A 3LY5A 5EIXA 3CNEA 3QI2A 2HAEA 4QNMA 4FYPA 4U39A 4AG5A 2IP4A 4NU8X 1XWIA 1NUHA 3I2YX 4MEBA 3WO1A 4BCBA 4YX9A 1RM0A 3MC1A 2HK8A 2GBPA 3K0AA 4YMWA 4RD3A 3KG2A 1EUYA 2GTHA 2YXDA 4KR3A 4A91A 1X15A 3B7PA 1ACLA 5L3VA 4PAQA 1PJ2A 4R8RA 2H1CA 2C8LA 1LNSA 1E8MA 4M0KA 2QROA 2Q4RA 4TTIA 4ZCTA 4HSEA 2X14A 3DKKA 5JSQA 1CJMA 1OXTA 1ZBQA 4FQ7A 2V3CC 1C2YA 4GT1A 2G1KA 2C7RA 4Z0TA 1R0KA 2R62A 1U7ZA 1WXFA 3EYAA 4JELA 1JHZA 4ZEXA 3ZDYB 4DG5A 3THWA 4OBWA 2OGTA 3AHCA 3E3MA 1GA1A 3NT2A 1O89A 3GB9A 2QN3A 2P9JA 2NZXA 2ZLBA 3HLYA 2WWYA 4MKIA 5A4MS 4L75A 1ZK0A 2C2XA 2RHJA 3DEHA 4MUYA 1LPOA 3UT6A 4AN1A 2WNIA 4FEGA 2QQGA 4K8OA 3DHNA 2VR1A 1ZD9A 4WLEA 1E2BA 2CFTA 1ZL2A 4V0NA 5KSOA 1WV0A 2QQFA 1T13A 3ZNNA 1E7MA 4KUGA 4E1VA 4M7WA 4EW3A 3K0HA 4NCKA 4HAOA 3SEAA 2QN7A 4BMYA 2VYVD 2JIZD 4FHEA 1KMHB 3KLBA 4LX0A 1C7FA 1CR0A 1UANA 3QELB 4WKGA 2VHQA 3OZEA 3UT0A 2PH1A 4MUGA 1QGED 3CUYA 2R751 3P45A 5EXSA 2JCGA 1DBIA 4MW9A 2RSLA 1QU3A 3PDIB 3JRXA 3FSGD 4BXOA 4TTRA 1WTAA 4UOZA 2JAPA 1LFDB 1F2TA 1LV7A 1ZNQO 4G63A 4LMBA 1BX0A 1CVRA 2M2IA 1LRKA 2IV2X 1JQ3A 4HVLA 4XLLA 3ADDA 1U2DA 3OBBA 3RKUA 5FOQA 1WVGA 4QLAA 1MB9A 2X8AA 2RGNA 2XVZA 2IPAB 3MMPA 2PX8A 4LJAA 4D8TA 4PO8A 1LRLA 5CYFA 2X3FA 3E7PA 4KGVA 2IEAA 1ADGA 3V6MA 2OZPA 1J22A 3HU1A 4IR7A 4OQFA 3E7XA 5E2IA 2WUWE 4UTPA 4XRGA 2QVYX 1TQ4A 3QVUA 5AM5A 3GCWA 5BR1A 2AR0A 2JGJA 3H5IA 3TD2A 1NQAO 1FYEA 1ZRNA 5HZHA 3H04A 1XEAA 4YAJA 2GI4A 2GK3A 4CKEA 3LTNC 3V1TC 3OP1A 4TTTS 1FTYA 4C6SA 2YY5A 3S8MA 4AKSA 4CWAA 1LDNA 1TT5B 2PH3A 4GBMA 3M83A 5CW2A 4GOOD 2C8VA 1XK6A 4Z86A 3IESA 1DO2A 2FMFA 3OP4A 1TGYA 3MJCA 5AHOA 4ZVLA 3V4LA 4D9JA 1V71A 3E3OA 3NKFA 4HB3A 4OQXA 2JI9A 3SYRA 3GJTA 1VE7A 1Q1ZA 3OOHA 4IDCA 5IWCA 1G3QA 1ZK4A 2AC2A 1DKLA 1KJZA 4P8RA 5AQ1A 1IQ0A 4HNQA 4LGVA 1R8JA 1L7XA 5D2CA 2Q9BA 3CZRA 4V1CB 2GBLA 2JGFA 1E1DA 5D3KA 2GCEA 1PFYA 4CTMA 1L7AA 2XYHA 2YV4A 3DMFA 2CHQA 1ST3A 3SBXA 3HVJA 3F96A 3UT5A 1XMQB 1KH2A 1Z9BA 1Z68A 3COVA 4QHYA 1RYDA 3D64A 1HEYA 2WWVD 4NZNA 6Q21A 4D6YA 3B5IA 1G7RA 4E09A 4JUIA 1QFYA 1BDMA 1DRWA 3GZNA 1PNRA 2XTNA 1O6BA 4GYJA 1AKQA 1TU0A 1HFWA 1T9KA 4EB6B 1N2BA 2F43A 1VFNA 2AQ8A 2OV2A 2YYSA 6ABPA 3PWSA 4DAEA 1HTWA 4IICA 5TPZD 3SBEA 2BL4A 2OORA 3HEAA 2NT3A 4GX1A 3SR3A 3V6LA 1KZ9A 3RI3A 3ZHSA 1L9KA 5K45A 4XGRA 4R1LA 2OVFA 4LQCA 1C3XA 1XDDA 1PK8A 5EHGA 2P9QA 2I3GA 5J5AA 4B3HA 4NDZA 2RIRA 3IHKA 1WL8A 3KWMA 3FVTA 3FYCA 1OVGA 1T4BA 1UZNA 2VBIA 3P96A 4U0JA 5FL7A 2F3QA 3SS9X 1MEEA 4B7UA 4ZTZB 4R8MA 3IQEA 1JDTA 1B3RA 1JU9A 4IDBA 1KRXA 2HFKA 1CQJB 1G38A 3DBVO 2PM8A 4JN6B 2VJQA 4KX3A 3Q8LA 1VJ5A 2XWJI 1XQ1A 3DZCA 4JLMA 4UCWA 1YRWA 3RFUA 2DBQA 4QFBA 3AW8A 3LBHA 3THXA 2O8EB 4G09A 4BFYA 2WTXA 4I6JA 4LW8A 4ZGBA 1ZM2A 3TRIA 4DNQA 1CIVA 4U7HA 2R1TA 2B37A 2FEAA 2Y9MB 3VVBA 5JXIA 4I55F 5KS2A 2YBDA 1YQWA 5E9WA 4RH0A 5EZ6B 4AUEA 3WAGA 1KNXA 5LMCA 3BERA 3GARA 3D4PA 2YZKA 4C4PA 2VQSA 3OMXA 5FFMA 4DQXA 2GZDA 3ANLA 1J1ZA 2OBFA 3CXRA 3FHCB 4RF2A 3G9QA 4OB7A 1QR2A 1ISGA 4LRQA 2XITA 1Z6TA 4DEYA 4JEUA 2BP7B 1U7DA 3PICA 5REQB 1EVKA 5LXTA 4NOKA 1NQ5A 1T29A 3DNMA 3T3PB 3K30A 3RF6A 2HF9A 1CY8A 3VI3B 5AW4A 2EG9A 3RGWS 3O95A 3E61A 5G40A 4ZVTA 4W9MC 4D0SA 2UXDB 4TLAA 3VNQA 3IUJA 3DFZA 3LQYA 5U4QA 4EPVA 3DAFA 2EBFX 2X7HA 1Q20A 4YJGA 2PZBA 1G5TA 4AO7A 1LBQA 4N3BA 5DYGA 3WYAA 1IAVA 1BTOA 2GCOA 2V58A 3STHA 4BO3A 5H68A 4ETMA 3FWYA 4TL9A 2HCTA 4P5PA 1CZLA 4R7GA 2CE7A 1PYDA 2FQQA 3O90A 1COWD 2JLAA 1ORHA 1P3DA 3F3KA 3H7IA 1C9NA 1NU8A 4TMVA 3THOA 2JLBA 1XPUA 1RJDA 3EVZA 4LJ6A 2WM2A 4GKBA 3IPLA 3WK5A 4GC9A 1GN9A 1N6RA 2X2EA 1O0BA 5JWHA 3WWYA 1DKQA 5GMOA 3PU6A 1GEGA 4FNGA 4ENWA 1I80A 2PGDA 3EHDA 4MAFA 2P2GA 2Q1TA 3LYUA 1KYZA 1O3YA 2WOOA 5CVEA 3E8SA 5K01A 3EBLA 1M6VA 2QDKA 3EZNA 5DASA 2L69A 2JFVA 5A6VA 5ICSA 3F8TA 1F1BA 3W7AA 1WZEA 3JTEA 3HSKA 3P9PA 4DTCA 5IHPA 3MELA 2ZJ4A 4X00A 4BMXA 2Y76A 5KX5A 3BS4A 3R7LA 5K3FB 1KAOA 1RLMA 2WMDA 4I3FA 4MRPA 4Q4AB 3HZZA 1OH8A 5DB4A 2A58A 4WNYA 1Z4OA 2PUVA 3GR6A 4UMEA 3FYHA 1E1KA 2P6NA 1OC4A 2PPVA 4L4UA 3NS7A 5HDBB 4YP7A 2GO7A 2EKLA 4CU5A 4F9FA 5M2QA 3B13B 1PNOA 2D6FA 1V11B 2C83A 4RA6B 2VTKA 1Y3DE 2BP7A 4AW9A 1NBMA 2GZMA 3T5CA 3X1JA 3ZE9A 1BAPA 4Q7LA 4GBED 1L5GB 1SCUA 1DJLA 2C8KA 3G2HA 3WO0A 1BN6A 1EJ2A 5G1NA 2A1IA 4OFXA 1UP6A 2I8LA 2ZKLA 4XD7A 2CKDA 1KJNA 3STVA 1J6UA 3K72B 1UKBA 1UBTS 1PJLA 1HOXA 3EDMA 2ST1A 2GK4A 4MA4A 5IDWA 4DA6A 3S81A 3BB3A 4IV8A 2H4YA 4F4UA 5IJ0A 1E9SA 1IUPA 2RJOA 2MR6A 2FW0A 4XWAA 3OCYA 3RJTA 4EGJA 4MIKA 4RH1A 3FAKA 3OZTA 2CXUA 4L3VA 3HY3A 2Y1XA 3SDBA 1OB2A 1FLNA 4CL2A 3Q1KA 1TYZA 2W0SA 5JY6A 5I5EA 4FFRA 1AHPA 2NUTB 4QZVA 4G9EA 1GA6A 4AD8A 3CNNA 3LUGA 4CM7A 4DMHA 2ADOA 1ULBA 1F48A 3HFGA 3FNIA 4MCIA 5ARDA 5I7SA 4ZCPA 4TROA 4UE2A 3IX7A 1ZIDA 3M1IA 3DEIA 2BI8A 3PZBA 3PC4A 4QPDA 3TR6A 4EYSA 1H3NA 2ZUSA 3RYTC 2GJSA 2BM1A 3I30X 1RI1A 3KOMA 4KZPA 4WN3A 4ZDIA 4I9FA 4MS3B 4Q9KA 3W5IA 1BEUB 4RZSA 1WOMA 5F33A 4QPNA 2ID7A 1V3QE 2QXUA 4B44A 3GCZA 3JASB 3LVFO 2W4IA 2WU1A 1FDTA 3EZFA 5E95A 3VR2A 3BFKA 1JIQA 1FC0A 3OQBA 4RV9A 4F06A 4DNPA 4LWZA 4KMOA 4RPCA 3T7KA 1NG1A 3R3JA 2F55A 1I7DA 4X3PA 1IVYA 1P5HA 4EHLA 1XAHA 4R8SA 1BQEA 3G02A 4B5LA 5KQGA 1NPDA 3M4JA 3TLCA 1TIBA 5FIUA 4MWBA 2QG6A 5AUPB 2ZPAA 2NYVA 4D4JA 3OIDA 2NAPA 3O21A 4H6XA 5EERA 3T34A 2XYRA 3ES9A 2EJVA 1I2BA 1M1YB 1WB5A 4FYHA 4Q47A 4C6RA 4CGYA 2UKDA 2M6LA 4QPJC 2HA5A 1YZNA 4QGAA 1I6MA 3GF4A 5FXMA 1JJIA 1FRFS 1FA9A 1GQYA 1NR1A 1ODFA 1SU8A 4FT2A 1IMJA 1R9NA 2ALJA 1QHIA 1Z18A 2O1EA 2O2EA 2VAWA 2QRKA 3IPRA 3Q5DA 4O2RA 4RVCA 3PHCA 1E3SA 4OJNA 5EPUA 1ACJA 1A9ZA 3OLVA 2IE8A 1V43A 5KTSA 4CEHB 3K4HA 2VXYA 1V6CA 1ZJJA 3I45A 1X8JA 3OA0A 3B6EA 1VL8A 5ECDA 3UFBA 3V9PA 5BWMA 1VMAA 2RH9B 2BM0A 1CF9A 1I4WA 2C78A 4F4HA 3DVLA 1SUIA 1R4AA 1OIXA 3G8AA 4K6HA 2AN1A 4XJTA 4A16A 1MQ9A 3C5HA 4KVFA 4HAIA 1Z0SA 1UEIA 1Y37A 2IYYA 2Q5JA 1AN0A 3PX7A 3OQIA 4XWOA 1ZMBA 3TE6A 2PV0A 2ZJ0A 2ZULA 2CT8A 4CIYA 1D4OA 4JODA 4HF7A 4WWHA 1FP7A 1ZD2P 4D46A 1GR1A 3OPNA 3LT1A 4IH1A 4C88A 1YL5A 4LBWA 4OOEA 1GUFA 4RTRA 4RMNA 1FMTA 2WMNB 1C1HA 2JARA 5F3DA 4BQRA 1AQ6A 2PKCA 3B53X 3QPCA 3JQ7A 1O95D 3VR3D 2J7PD 4IZOA 3M2PA 1QBGA 5J43A 2Q1XA 5BR4A 5A9TA 2DERA 4CTNA 3P32A 3GFQA 3PCRB 4JSTA 4ZP1A 4Z7QB 3OIGA 1K4MA 2ZDQA 1GG8A 4IOKA 4OK5A 4BZPA 4II3A 5BNIA 2NV0A 1EVEA 4DYDA 3D3JA 2AKEA 3LXMA 2FZVA 1FLVA 5JECA 2N0SA 2ZFUA 2EGHA 4IDGA 3V55A 1QBKC 1DOAA 2J46A 1AH2A 1TJYA 4MJ7A 4A27A 2Z04A 4TLLB 1K66A 1SZJG 1OTYA 4BNTA 2R5WA 1W2WB 4Q4JB 3E7DA 5IKXA 5F78A 2O7SA 5CX4A 4JI8B 4D0GA 5A5VA 5DNEA 5GIPE 1NUSA 3IAM6 5ALUA 5AVTA 2BKLA 3QA3E 4GMKA 4JXJA 3UWOA 4RDIA 1Y9DA 3I5MA 3GEEA 1MO4A 3TLJA 4ZRMA 5DN6D 3GWZA 3NVKI 4MUHA 3NEAA 1GPJA 2VTBA 1L4EA 2RH4A 1NQTA 3GJ3A 3OZIA 2J0UB 4JBXA 4AULA 4EY6A 4MDEA 4OM8A 2HGSA 1E64A 2QR2A 3X1ZA 3CVYA 3D6NB 4PCUA 4YA6A 4LMRA 2V5AA 2QT1A 3NHYA 4KB5A 4UC0A 5JAQA 1J09A 1IBSA 2Z0MA 4UFOA 3VDNB 2NZUG 1INLA 2WEKA 2AVDA 1H4QA 5JCZA 2IK8A 2QEQA 1FZQA 4YY3B 3JX9A 4Q1EA 1X19A 2VDJA 3G2NA 4M1YA 3JARA 4GKAA 1F8UA 4H08A 4IMPA 4MUKA 5A3RA 1GGHA 3L7IA 4KPUB 1V6SA 1A8IA 4FBGA 4ENUA 4MVXA 5GZ3A 4M38A 2B4KA 1G4AE 1ULHA 2OR3A 4NV0A 5F23A 4UHKA 2BMDA 3UC9A 5HS4A 5H3HA 4N49A 3UJCA 1RXSA 4M37A 4MMYB 2R7KA 1CRQA 4O3FA 3I58A 1LPBB 4INZA 1ZI6A 2AC7A 2JZOA 4BKUA 1E4EB 3L1IA 2OO3A 3X1KA 1SU6A 2AEMA 2AYXA 1CDZA 2GA9A 2LKDA 3BMCB 4RTKA 3IA2A 3W1VA 4C4XA 2P6MA 3BM5A 4H3KB 5CURA 4GMHA 1JPJA 1PVDA 1TW3A 2ZU6A 4IJWA 2CLIB 4LBYA 2WD7A 5E7QA 5KX5B 3TZ6A 3PQ4A 4WXEA 2CHUA 5FPYA 1RRVA 1ZGGA 4IIGA 3I3SR 5BQ3A 2QUJA 5CXQA 3WLKX 1TA4A 1PR0A 3LX4A 3QU2A 4AWBA 4FQ5A 3LPMA 3F98A 3AJEA 4J76A 1QP0A 1XU7A 1TL7C 1ZN8A 4MLCA 1CR4A 1WZNA 4MW1A 4RANA 5FUWA 4F86A 1VYHA 1CBUA 1YVUA 2HCJB 4G41A 2PR7A 3UG7A 3ZWMA 4JAVC 1H0SA 3X1DA 5FUQA 2EKZA 3A0RB 1Z06A 3C6XA 4OQQA 3OI7A 2ZIAA 3RBZA 5FA8A 4AIIA 1VHQA 2QX6A 4GR9A 2DECA 2WKWA 4ENPA 3W6OA 1ZX1A 2YOHA 5D3MA 2CZCA 5TGDA 2EAUA 1EUDB 1JT9A 4C6TA 5KWIA 1LI5A 2FWBA 2PA0A 1YS6A 4PSUA 2OYRA 4YLEA 3TSZA 1N1GA 1H42A 1SQGA 2FPXA 1GNPA 4RTMA 3N7UA 1QH8A 5JVDF 5AHKA 4NZYA 1YB5A 4ZOQI 4LGMA 3TGWA 3NEJA 3WL4A 1FUKA 1T3TA 1AS2A 4FGLA 2O3TA 3X1WA 3ETGA 3PG5A 4OA5A 2A8YA 4YROA 1OHHD 3MPUA 5AW5A 4KOEC 2PQ2A 2VA8A 1VCIA 3BWXA 2JIOA 3EFOB 3HUUA 4GZ6A 4NEGA 3A1EA 1NOIA 4HNAB 4G0OA 4RSMA 2ZAGA 3SXUB 1GG2A 3TG2A 3ZE1B 1DTWB 4XM0A 1R0LA 2HMSA 3Q5GA 4Y6PA 5LQJA 3T3EA 4WSOA 3RB8A 1QO0A 2R97A 2ODEA 1DX4A 3W1EA 4DNXA 4EG4A 4BIIA 2C9DA 4QDTA 5IDYA 1UT8A 3TKLA 2A5JA 1FVHA 2XDWA 3IULA 4YDSA 3C3JA 5DDIP 5BQ5A 4FSHA 4CM9D 1JHRA 3IKLA 2VT6A 3FYUA 3LHFA 4R9UC 4FLMA 2PUHA 3PHLA 4BMSA 1DQZA 2HB6A 2ZBQA 4CL8A 1LDBA 5LN1A 2O5VA 1T6XA 3COSA 3V33A 3VU9B 1ECGA 2FF5A 1H2ZA 3ZWXA 4YRAA 3O92A 1HOTA 3GGOA 1DFIA 4B9EA 1Z75A 1QTIA 1AS3A 4XI9A 3GEIA 1RWPA 2P9CA 1G3IA 2L18A 3RIMA 4R3NA 1BKDR 1EUCA 5D1HA 4Q24A 4HUQB 3REGA 3EIOA 1MA3A 3L0ZA 4BX2A 4GLLA 1RXUA 3FTPA 2VNSA 4K9KA 1AUXA 4KQ2A 3ZDBA 5HQ3B 2QU8A 5IZ4A 1R6AA 1Z6AA 4ZT6A 3OC0A 1XK7A 1F7VA 4U7PB 3T5MA 3IBFA 4QQRA 5K0LA 2GYVA 4C7JA 3BRSA 4KXUA 2XQVA 1KWKA 4TXMA 4YDQA 1EFVA 2Z2KA 1GCGA 4MYSA 3PBKA 4J1TA 4B6FA 4ZYXA 4M9XA 5IW8A 3C43A 1J8DA 1M6EX 4FOSA 3OF3A 4WZBB 3V1YA 4XB2A 1HE2A 2FFAA 3Q7IA 4IVPA 4F3TA 4B6GA 2GVZC 2FX2A 2WWHA 3FWNA 1YBHA 1LW7A 1DXOA 1SOMA 3LSTA 3UMRA 3QPBA 1GFIA 2QN6A 1U0RA 1HA3A 3WGGA 4OJKA 3A2KA 1C1DB 4H0NA 2EOAA 4NMLA 4M8NE 3Q3GE 5FL7D 1U98A 4NMXB 1OYVA 1HL3A 1JKJB 3KLMX 4WA7A 4MPDA 2O0LA 1JEYA 3EK2A 1YMUA 2P4QA 1QRRA 1HL7A 1N7JA 2W98A 3EXHA 4L22A 5K3DA 1C0PA 3CH4B 4GO1A 1ZCBA 3JQ7B 3I42A 3RUDA 4CGZA 9ATCA 1U0HC 1ZU4A 2HU2A 4TT8A 1SB8A 2CFIA 2DSTA 1IPFA 1K7SN 1E2UA 1KNQA 1NX9A 5EL0A 3ZCXA 1LSOA 5K3EA 1EGHA 4EVQA 4ZCIA 3PWZA 3JYPA 8GPBA 2GM4A 2VJCA 1F4PA 2O8NA 2QLLA 4KFTA 1I5RA 4LYAA 3FUVA 4TN5A 5JJLA 1CE8B 3V8PA 4G8DA 3R09A 2PD3A 3EDYA 4FHGA 3KPWA 3TIVA 2E0IA 2WYOA 1L4UA 2C59A 4HDRA 4KTTE 4N7JA 1P1IA 4CKBB 2BH2A 3EWAA 3AHDA 3HKCA 4XH9B 4AMVA 4D97A 2XUDA 4IDAA 5CVTA 3F5DA 4RK0A 4FGJA 1Q11A 3BWMA 1KIMA 1T4MA 4WVFA 3R6WA 4GZMA 3MHPA 4I5DA 4Y6GB 1C7QA 1C7JA 3B6MA 4JIGA 2DULA 3S40A 5DSXA 3JRWA 1XRNA 2UVQA 4K1LA 4AJKA 1X39A 3MSXA 1CR1A 2EARA 1GDHA 2NVOA 4MDHA 4URVR 1Z63A 4UM9B 1CETA 4J9VA 4OB8A 4FJ0A 4BL5A 2V9CA 3K9WA 4R2WA 3KZ1E 4TS1A 5IVPA 2H7XA 4Y8VA 2GAJA 2NU7A 2VF7A 4D81A 5E9JA 2YRXA 4O25A 3UZUA 2IEBA 3BL6A 3CRNA 3HADA 4IFEA 4A5OA 3DBRB 4XJSA 4ZAFA 5K8JB 3T9EA 1O0SA 2VHTA 2ZSDA 4LC0A 4BPRA 3SSOA 4NARA 1ZD1A 3NP7A 2XBMA 6CHYA 1XJ5A 3F9CA 2PHZA 2C9MA 1Z45A 2MTBA 3BPSA 4TS3A 4CM5A 1K3UB 3HJAA 4WEQA 2Y3IA 5GJWC 1TQDA 2IVFA 1AKTA 1JIJA 3GFFA 4EUFA 1RADA 3GG9A 4PZYA 1XP5A 4YCMA 2AJBA 1A7UA 1R74A 4MLDA 3SYTA 1Z2CA 4LXUA 3TI9A 2HLHA 4G9BA 4ZPXA 5F5XA 1Y98A 1T5DX 3EQ2A 3GJQA 2GEBA 1ZGAA 4XYMA 4AS1A 1IUOA 3GLIE 1JP7A 5E9QA 4KQFA 1KC1A 1BXRA 3KR1A 3R0QA 1GV0A 5E1DA 2Q4OA 3EXG2 3QTLA 1Y8ZA 1W36C 1IL0A 1GL9B 3RIYA 1JQDA 3HYSA 4JKIA 4AMBA 3ICOA 1KEKA 1K68A 1ELOA 2I54A 2HDWA 3JWIA 4Q9JA 5EMLA 2R7MA 4DBLE 1CZOA 1C3JA 1DAGA 5BXQC 5ADHA 2PS1A 2Z3WA 5AW1A 1QO9A 3TUZC 3GMTA 4ZVRA 1CJKC 1NC3A 2H1RA 3GFGA 3NPMA 5AM1A 5FO1A 4U2FA 1ZEMA 3W6UA 1AB6A 1C50A 1H65A 5HQJA 2PL1A 2QLTA 1EEHA 1K0FA 2V6MA 3ZE7A 3PEUA 3O83A 3Q87B 1G291 1F14A 1Q17A 1Z7BA 2AEFA 2IEDA 3BGIA 3KQKA 1A9YA 4KW7A 4BE7B 1AQJA 3CV3A 4G1FA 1E0KA 1ZEJA 1KETA 4X20B 3I05A 3UUWA 5D3MB 3NBZC 1SB9A 4URYR 4CR8A 5I8PA 4JVNA 2O8CA 2X0JA 3O8OB 1NDHA 4BP3A 2Z2IA 3RFCA 1RCFA 1ZD8A 3AB8A 3OHMA 4KQHA 3SBDA 4HT3B 3FM9A 1Y7PA 3GNQA 2VP4A 4F3RA 2G4LA 5E6UA 3MRTA 2BFCB 2YINC 1VLZA 1BA2A 2WI8A 1RHKA 4PNEA 5CXUA 3SSAA 4H3SA 4LHXA 3NWJA 2AH5A 3GRAA 1OGIA 3ZQUA 5EYPA 1EZ1A 1UBGA 1P2BA 1YB1A 3MGAA 3OUZA 4ND8B 2FJ0A 4JI6B 5EJ7A 3REFA 2PYDA 3IJ5A 3DD1A 1T1EA 1WA5A 1V2GA 3LDAA 2ZIFA 1MFZA 2IS1A 2ZIWB 3IB6A 3KDPA 3G9XA 5BWNA 3EIQA 4OAPA 2RJNA 1ZUIA 2LE0A 4FDLA 1CUBA 3KQPA 4B8YA 1U7TA 4NFYA 1W8IA 1VPVA 1QVWA 3F6EX 3VXKA 1KI6A 1LNZA 4M76B 4U7GA 3UO8B 5FWAA 3UMFA 4UHDA 5EXEA 1NMXA 2WIGA 2REQB 4I19A 2EWWA 4WE3A 5IM4F 1HH4A 1QGYA 3RS7A 2AV6A 4HWTA 4J1QA 1BWRA 3MUEA 3OPYB 5HGJA 4IF6A 3WGOA 1ISSA 1ZRHA 3R44A 5DM70 4G2TA 4PVCA 2AI1A 5KOJA 1Y8RB 2WSSA 3W5UA 2V8OA 3EOZA 4DZZA 5IM4A 1FFHA 2IOFA 4HATA 4DKJA 2YCBA 3B1KA 2W6JD 4H27A 3ZTTA 5AUQA 1HSOA 2ZJAA 2P2YA 5E7JA 3QPAA 3KLNA 3CC8A 2ZUUA 4G0QA 1J49A 5E3HA 5BXYA 1KI1A 1DNPA 1NN1A 2VQ6A 2Z1MA 4E1AA 3PEWA 1SC1A 1NF8A 4NQRA 3G2OA 3HI4A 2KPOA 4P2GA 4G5YA 1M0SA 4RS3A 3GDOA 2C4NA 3FRJA 1Q74A 2VPXA 3T0IA 1TC1A 3KAJA 5AHRA 4YMLA 1UC8A 5A4IS 5IBPA 5E3IA 3HO1A 5JD5A 2P3SA 2XVAA 1E9AA 1KU6A 4RLFA 4ZZ1A 5JS7A 1EWQA 3PYLA 4JZKA 2G5TA 2JLCA 4H0CA 1PD1A 4H6VA 5EHQA 3OZCA 3RVJA 1JLLB 4MVWA 5C4IA 4J16A 1T9HA 1M34B 2GHRA 2TSYB 2Z4SA 1M7GA 2HEGA 4O5AA 4RESA 4WJKB 4JSRA 4ESHA 3ABIA 4PYNA 4BVJA 3H2SA 4IDPA 3WLIA 5ALOA 1VPLA 2A4MA 3KAPA 3P2EA 4RV5A 4EI9A 1D5CA 3CZQA 5CLFA 1XALA 3ZGLA 2ZWOA 3IQZA 5DGDA 3FCAA 1B0PA 3CLHA 1OV6A 1XD2B 4C0HA 4E4TA 3GRVA 2C3YA 2F00A 4YT8A 1GQRA 2Q4TA 2QUBA 2ZU0C 3E9DA 1VL1A 2V6JA 4N8DA 4P4NA 4LF4B 3KB8A 4FDVA 1QM5A 4AJIA 8AT1A 5AVUA 1YR6A 3E18A 4OPMA 4R2XA 4WRRA 3CUVA 1D6MA 1E9EA 1OH5A 2BF4A 1OWLA 2J7KA 3OU6A 1Z7YA 4KWHA 1EX6A 4ETWA 2VDQB 1XTPA 4EB3A 1H8HD 1F6BA 3SZUA 3PXEA 2OFFA 3VH1A 2I2CA 1Z5GA 3ED1A 1KJYA 2ZRNA 4GR4A 1Q1GA 1ZJ4A 3UCEA 5A5FA 1BQ3A 3DZ8A 4NYIQ 2DR2A 1TUEA 4NCAA 3K20A 4JY7A 1SXJD 1Q22A 3B3JA 3WDKA 2CCJA 2EKBA 5JTUA 3EPHA 1OSNA 1T6BY 2OLKA 1OH7A 3LBAA 5IAJA 3SN6A 2D06A 1BW9A 3N3AC 1XZCA 1RBQA 4CQMB 2BFEA 2ZTUA 1L5HB 2X0RA 3A6LA 4YFYA 3PWKA 1WCIA 2HMYB 3MT9A 3H2JA 1FSGA 1THTA 5DLDA 1EFUA 1S4QA 1H4SA 3QE2A 3GNLA 2D3TA 3ROKA 5DNYB 2R7AA 2YNMA 3N2EA 4G0VA 3TOCA 2H4FA 2P68A 1UAAA 5CDHA 3NX4A 2GVDC 2C3MA 4G4JA 2FPGB 1E6LA 5MFPA 1EP2B 3VPFA 4OJQA 3UK2A 4CU2A 4E7PA 4G65A 5K8CA 4KAJA 1ZL0A 1A7AA 2V9PA 4DFDA 1FEZA 4JLJA 1NT2A 1VXRA 2G17A 1TCBA 3EIWA 3QX8A 2JFFA 1B15A 1XQYA 3QWAA 4CT5A 2G1PA 1R37A 1E0AA 1ZITA 2FCRA 2I4LA 1NXVA 4V0LA 4BB9A 1RC8A 1FYVA 3QWFA 2VZ8A 1DARA 1KFEB 3BWVA 1JUDA 4PNHA 3TG8A 5AKJA 2XADA 3RCBA 3FVRA 2V98A 1WNTA 3HRHA 1Y80A 3OAAD 1DIOB 1P77A 3V8QA 5GZ1A 3DVSX 5AW0A 2UZAA 5KYXB 4MINA 4H6PA 3QYPA 2BMJA 1ENOA 2Q3CA 1FDVA 3CBGA 4DWOA 5BSRA 7AT1A 4P0PB 1NJ1A 2EP5A 3RRZA 2ZJBA 2OV8A 3ZTWA 1XNRB 1U11A 1P4SA 2H18A 4X1YB 3FYUC 3EPLA 1WHSA 5JAMA 1FXWF 1XROA 2QR5A 4PLCA 3NIFB 4HVCA 5A02A 1RFGE 1RSZA 2TMGA 3H13A 3IOEA 2FSVC 4A5SA 3L01A 2A0KA 2C5HA 2H3EA 5CBPB 1A5BB 3O8NA 4F6RA 4W6QA 4GKKB 1EFVB 1I1HA 3MZ0A 2BBTA 1GGVA 2J4FA 4LE1A 5B6PA 1RWQA 2GSWA 4R1MA 3MK31 1ZHFA 3CUEF