4V1CI

Sirtuin 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
251
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPYPEAIFELPFFFHNPKPFFTLAKELYPAKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 'Erasers' for Lysine Crotonylated Histone Marks Using a Chemical Proteomics Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 75
structure length 251
sequence length 272
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4v1cI02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4v1cI01
1Z8NA 3GLSA 4I5IA 4JU9A 5FEMA 4K9QA 3GLUA 1Q17A 4GPEA 2VBGA 4C78A 5EJ5A 5MF6A 4JUDX 4ZZIA 2H4FA 1M2NA 1PNOA 4RJJA 4JT8A 4R8MA 1POXA 1Y9DA 4FEGA 4JU8A 4UTZA 4ZP1A 1M2JA 3FZNA 2B4YA 2C31A 4G1CA 2H4HA 1PI3A 3CLTD 4J16C 4BV3A 4JD5A 1YBHA 2X7JA 1PYDA 5BWLA 3OE1A 2W93A 3GLTA 2WVGA 2H59A 1HZZC 2JI8A 4MZXA 3GLRA 5K6RA 4KPUA 4X3PA 4F56A 2FWNA 5EJ9A 4FZ3A 1O96B 4UTRA 2NXWA 3IAFA 4GP9A 1SZDA 4K9LA 4KXQA 2Q5LA 2Q5OA 4RMIA 2Q27A 2OD7A 2UZ1B 3F6BX 4FEEA 1MA3A 4RJKA 3PDHA 4UU7A 1PVDA 2EZ9A 1O97D 3CLRD 3ZG6A 1U2GC 2Q5JA 1V5GA 4UTXA 2FRDC 4X3OA 1OZFA 2V3WA 3CLSD 3CLUD 2UZ1A 3F6EX 3IAEA 4JUCA 2JI9A 1D4OA 2VK1A 2WVAA 1OVMA 1E3TA 4JT9A 3RIGA 1NM5C 2EZ4A 3E9YA 5DEIA 2H2FA 2JI7A 4L2IA 5EJMA 4FVTA 1N0HA 1YC2A 2H2DA 5K2OA 2OORC 4UUAA 1BFDA 5FYQA 1YHZA 3FSJX 5IMSA 4J1TC 1PO7A 3JWPA 4BUZA 3JR3A 4GM1A 1Q14A 4HD8A 4HDAA 3CF4G 5EJ6A 5K6TA 2OD9A 4QELA 2EZTA 2H2IA 4BN5A 5EJ7A 4RMJA 3ZGVA 1PNQA 2EZUA 1T9BA 4K9PA 1POWA 1EFPA 2IHTA 4L3OA 1OZGA 4GM4A 5BWOA 4UTVA 1UPBA 4MPRA 2H2HA 4BV2A 1YTLA 2VK8A 2JLAA 4RMHA 2HJHA 4BVBA 1T9AA 4MPPA 4K9OA 1T9CA 3HWX1 1J8FA 2Q28A 3EYAA 1PTJC 4BVFA 1ZPDA 4TWIA 3D7KA 4Y6QA 1Q6ZA 1S5PA 2JLCA 1V5FA 2QQGA 4BN4A 4UTNA 1UPAA 3U3DA 5BWNA 4BVEA 1T9DA 1YHYA 3FLMA 4KGDA 4JUBA 2PGNA 2A1UA 5EJAA 4D5GA 1S7GA 4Y6OA 5EJ4A 4MPJA 4D5EA 4K9KA 3PKIA 1UPCA 2IHVA 4K9MA 2FR8C 2VJYA 1EFVA 5DGTA 2OD2A 3PKJA 5MFZA 4JSRA 1MCZA 4V1CB 2Q29A 4UU8A 2NYRA 2JIBA 4COKA 2VK4A 1M2HA 2A1TR 1YNOA 3D4BA 3ZGOA 4F4UA 1V5EA 2JI6A 1M2GA 2AG0A 3K35A 4V1CA 1U31A 4Q9DA 4RJIA 1QPBA 1U2DC 2Q5QA 4UUBA 3LQ1A 5K3SA 1SZCA 1PT9A 4JUFA 4IAOA 4RMGA 2DJIA 1ICIA 5DGDA 4IF6A 4IG9A 4O8ZA 1U28C 1OZHA 5EJ8A 3RIYA 5MGNA 2PANA 4TWJA 2WVHA 5MFPA 4BVGA 2OO5C 4BVHA 4JUAA 5D7NA 4MQ5A 4K9NA 1YI0A 1XLTC 4QQ8A 3EY9A 3D81A 4C7BA 4V1CI 2H4JA 2BRUC 4GG1A 4Y6LA 1DJLA 1Q1AA 4QPZA 1YI1A 1M2KA 2FN3A 2PGOA 4GM0A 2AG1A 2FSVC 3HWWA 1YC5A 2QQFA 1JSCA 2IHUA 2EZ8A 2VBIA 2VBFA 3U31A 3EA4A 5AHKA 2H2GA
chains in the Genus database with same CATH superfamily
1JG6A 2QYTA 2VPYA 4GIBA 3SIRA 4C5CA 5LQJA 2W2KA 4C78A 2OHXA 4HWPA 4ZZIA 1HYBA 4RHEA 1DOAA 1MABA 1SU7A 2QI9F 4L4ZA 4QUBA 3GW8A 1WHSA 2F62A 2GZRA 3L8YA 3MRXA 4KE7A 5EIWA 5TQ0B 5F2NA 2ACWA 2CLFB 5HG0A 6ADHA 3GP8A 4TS3A 4HCJA 3FTCA 3KXDA 3L7KA 3CH7A 1CQZA 1R0LA 4R51A 4ZN6A 4MA0A 1IVYA 4L2IB 4Q15A 5K2MA 3UV6A 1L5GB 3ETHA 3TTWA 5CX1B 4L6AA 5HKAA 1RCUA 5ALHA 2PKXA 3B6KA 3U4DA 1P9RA 3INTA 3V3TA 1O6ZA 4PO8A 1KJZA 3G8AA 1OWOA 3OFND 1EA5A 1PX0A 4EI9A 1R9MA 2PZLA 5AVJA 3CT6A 1KO5A 3A04A 1GSOA 1O94A 1XTSA 4RPGA 1IULA 1UFRA 3KZXA 4HN2A 4P98A 1X7ZB 5EVCA 3EXHC 1ULBA 3GLHE 3ZKWA 5HXAA 1Z4NA 4IIJA 1R6UA 1TZCA 2Y67A 2PMDA 1OZAA 1N1GA 4CLDA 2P5YA 5AKEA 3BIWA 5CLLA 4PRLA 3EHEA 5FPYA 1G8AA 1NBMA 3GJYA 4GR5A 3IAUA 2QY9A 4ZEXA 4DRXB 1NUQA 4G0QA 2YR0A 1ICEA 1ZEMA 3THSA 1R0RE 2IZ0A 2XA1A 4GFDA 1YBMA 4L4XA 4P80A 5TPZA 2JGMA 3B3JA 1KP2A 1UPBA 4IIXA 5AUOB 3U0VA 1E1MA 4FDAA 3RH0A 3WYGA 4CTNA 4AQ7A 4K3VA 1NVTA 4DB4A 1H8HD 1MEOA 4ENRA 1OUMA 3FOFC 3QPBA 5ALQA 2YZMA 4FGKA 2GTHA 1G17A 4JLBA 1I7SB 5AXBA 1KZ4A 1ANKA 2WUGA 4RPIA 4YRRA 1PTJA 1XZEA 4HFJA 2DWPA 4INZA 3VGPA 1AURA 3P0JA 4DG8A 1J39A 4ZPXA 5KWIA 4PX9A 4EQZA 3OUZA 4GBED 5BY2A 1QQAA 1J5XA 3WGMA 1R18A 2LUOA 3HPQA 3NT5A 3UGQA 2G4CA 2ZIUB 2DMRA 4LS3A 5FR1A 5A2GA 4DANA 2Y1EA 2G9RA 2D54A 1HT0A 2BI4A 3VOSA 1YAJA 3X1JA 4EEKA 1Y4SA 2DHEA 3X1XA 2Z6UA 3M0EA 2DPGA 5KMGB 1BWSA 4YV2A 5BV7A 4JI4B 2DPXA 1GDDA 1AKRA 1N5JA 1U31A 2H5JA 3PDIB 1PR5A 2Y1WA 3N2IA 3U37A 3D4IA 4L8GA 2OGTA 1J4AA 4MCHA 4KLAA 1M7BA 2ZRDA 3BMNA 4JLDA 3DFUA 5K20A 1S2LA 4BYMA 2GVZC 3L77A 1O95A 4B09A 2RARA 3FVTA 4C88A 3C6YA 5MGNA 3QBTA 1OXBB 1NWHA 1IE3A 3PDUA 5BUZA 1XA3A 5IWAB 2XBUA 4ZEWA 2ZYSA 3KKEA 3MBIA 3LFHA 4IKPA 4MLZA 4YRIA 1WUTA 1M0EA 1PYOA 2FG7C 4BFSA 2V97A 3AUYA 3MUOA 1MDFA 4AULA 1VKJA 3NDRA 5L3SA 1T6NA 2JKYA 2IH4A 3C4QA 1EDZA 4IVPA 4M1QA 2POQX 4QFCA 2L17A 3CPJB 4MVJA 4WBXC 3TLEA 3TUJC 1AQYA 4BKPA 2VP0A 3DXXA 5FNVA 1ZYUA 1KJYA 1JPNA 4E31A 3EVEA 3VO2A 1G20B 4MS1A 4ZVQA 4K8RB 1TT5A 2VSOA 3LXUX 1H4VB 1YV9A 4CDMA 2YWHA 3BZBA 4MDEA 4Q9KA 5KTTA 1M8KA 3LUBA 2IXBA 2QF7A 1EX9A 1GU7A 1P91A 1RR6A 2F67A 3DB1A 4L72A 3U13A 3V8RA 4BFZA 1A4RA 2OBXA 2VDRB 4LXXA 2DBQA 3JQAA 5K8JB 2H9IA 4Z8YA 1H6DA 1S6YA 2BP7A 2ZDHA 4NABA 4RK7A 3PHCA 4DCTA 1DEKA 3OTGA 1MORA 2FQQA 2NZUG 2WHPA 3PZBA 1F4PA 2WD9A 3E3LA 1PVDA 3EMKA 2PZ8A 1N6KA 1W5BA 3CLSD 3EQ6A 2HHCA 2JEYA 3R09A 3VBCA 2H9YA 4BASA 2AT1A 1L5VA 1O95D 2VYVD 3GCGA 2XWPA 3OZDA 4FMCB 2GFHA 3E3MA 1CUYA 3U19A 3RS4A 3A2KA 3P94A 4Z8XA 4XTRA 1CLUA 1G2QA 3GD7A 1A4UA 2NVBA 3NTOA 1QJ4A 1GAQA 1QHGA 4GXTA 5AVQA 5KJFA 4IZOA 5DNVA 5A1JA 3L7YA 5COBA 3KO8A 2GEDA 1F9EA 5DPMA 1UODA 4C4YA 1J2JA 4H77A 2HGZA 1XMVA 4JJEA 5J1TB 1NGSA 3UCXA 1RI3A 2JZOA 3JVUA 3DAOA 4B87A 3LG2A 4C6TB 4NOMA 1ZOSA 4YT2A 3IC5A 3PNSA 5E3HA 3CVYA 1YACA 3ELWA 3EMVA 1V8OA 3JSAA 4L4RA 2UVDA 4ZD6A 5AOVA 4BRUA 4CLXA 5K3EA 2Y2VA 2WILA 1KMMA 3L41A 4ZQCB 1P3JA 3EIHA 3MWKA 1NXXA 1ZC4A 3EZXA 4BB6A 1ISJA 3FYCA 3OJEA 1ZJ5A 3QTLA 4FZ5A 5IARA 1W48A 1V3QE 1U6JA 2VSQA 4HMOA 4K03A 5JJIA 3R41A 3VNUA 4CLRB 2HR1A 4CETA 1R7RA 3WICA 5TQ2A 1N6HA 2GZSA 1YI8A 4K9KA 3TYXA 1HTBA 4FI3C 1QRDA 5DMHA 5CLJA 2C94A 2O1SA 2EHJA 1E3MA 2EOAA 3KOZA 2JGFA 3TLCA 4OK6A 2AW3A 2XOKA 4D45A 4DV0B 2VOEA 4MVWA 4I8IA 3AHEA 1G3UA 3A6GA 5F12A 2JFQA 1GXSB 4LHVA 1CK4A 3FPLA 1FLDA 4M3NA 2J32A 4UHFA 5E9AA 4C29A 2NIPA 1CRLA 5E6SB 5U9CA 1FUUA 1QFMA 3HB5X 1O5OA 1XYVA 1ZIOA 3DTVD 2FF5A 5DCUA 1IVNA 2ZU0C 3WJ7A 3QMPA 1T3LA 2VHUA 3FWZA 3GIWA 4ASUD 1MW8X 3B1YA 4QUIA 1ZWLA 5BNTA 1KVSA 2RC5A 3HHPA 3CT4A 1JG1A 3VNBA 4ZCSA 1GRVA 2ILVA 5T6BA 2ZUTA 1MIOA 1GYQA 1P6UA 1M2OB 1GPLA 1Q0QA 4CM8A 3LQFA 1CNEA 4OGFA 3VU0A 2PGOA 1UXGA 1F2VA 2XDQB 4Q7MB 2YWGA 3EF3A 1X1DA 4NBLA 3E84A 4BY9E 3EA4A 3LUJA 1U81A 3FNIA 4C1BA 3B1VA 1R64A 4ABYA 1E2PA 1XLUA 2J4CA 1J20A 2MJLA 3CLSC 3SEQA 3W6PA 1AGYA 2W6QA 4A6XA 1YXMA 1UINA 4MVJE 5LZ7A 3PUKA 3ZCVA 1L4FA 5I7RA 2QIPA 4QDZA 5ADVA 1REQA 4ND6A 4NNOA 2H0AA 4DM7A 1RVV1 2IW1A 4BL5A 4EHBA 1P9OA 1CZLA 1GA4A 3M6MD 1DC6A 3I6YA 1AHPA 5IS2A 4LECA 4A91A 5AK6A 3EEOA 4QYIA 3DE7X 4TZ0A 2NVOA 1RXIA 5FX2A 1AS3A 4YJ2A 3LQQA 5JAHA 3BOSA 4KN8A 1J8YF 4C2TA 1TUGA 5HK9A 3RSGA 4TYPA 1QFXA 3WTBA 4RF4A 1VSTA 1QF9A 5U4XA 1YVEI 3GK3A 3CLKA 1L7MA 2WKQA 3AEUB 5EP2A 2OFXA 2FZVA 4BO3A 1RU3A 1VE5A 1NG9A 2VJMA 3X43A 2XQIA 2X76A 4OLJA 4WRRA 1KH3A 4QECA 5TQ0A 4KFCA 2CSUA 2Q1UA 3EB9A 3LT1A 1EFUA 3UXYA 5KTYA 4KQ6A 1WUHS 3FE2A 4X54A 4Y2UA 3QU7A 4DLKA 1RAEA 5EHZA 3KD3A 1EMDA 1FDSA 1EPUA 4LJSA 4LZAA 3UJ7A 4F5YA 2O7SA 5IDQA 4X5OA 5BMVB 4WOKA 2CSXA 1E6LA 3CN7A 4L5YA 1GFZA 5NLLA 1XEAA 1PDWA 1K8YB 3H42B 1X80B 3CE9A 3JRXA 4Y67A 3SS8A 2BGIA 4FYWA 4DDHA 4KOEC 4EKIA 1G291 3LPLA 3AKCA 3GWGA 3MMZA 3OQMA 1U2ZA 1UDAA 2Z1DA 3NGMA 2YMLA 4I66A 1ZQ9A 5HKLA 3TZQA 1UPTA 2PKQO 4DADA 2JARA 2FUNB 3I4LA 3CVWA 1SCQA 3T52A 1XZMA 2WF6A 5F2KA 2Z2YA 3O3OB 3JWEA 2E82A 1NTOA 3MCVA 2F9LA 3DPSA 3ZKWB 4IHJF 3MILA 3IQIX 3ACBA 2I6XA 1M6VB 2KS6A 4U0KA 3IUBA 5BRNA 2WC1A 2R2GA 1HC7A 3AHDA 4V39A 2BR5A 2NYRA 3LPNA 4IFTA 4Z4FA 4HNHA 3AJDA 4B3FX 3K73O 2NN3C 2WWTA 3QHQA 5GMOA 1EBFA 2ZJZA 2FFJA 4LJYA 3EZ7A 3A6ZA 4B43A 2IUTA 2Q2OA 4RY0A 3FCXA 3TO5A 3TMKA 1LNQA 3VR0A 5DGHA 1XZJA 4JZKA 1IG3A 4AKEA 1JBKA 2ZU6A 4IHAA 2A9FA 2D3WA 4F5WA 2ANBA 3W3AH 3OZCA 4DF3A 3OC0A 3NV7A 2BRUA 3PQDA 5DEOA 1JT9A 2P2ZA 2PBZA 5LVAA 2FLWA 2X5OA 1J7JA 1XTRA 2XY4A 5DKFA 3BREA 4M0LA 3P9NA 8MHTA 4PIVA 4OXIA 2JANA 4LNUB 4UVDA 1LFDB 4I5DA 3SI7A 2PX4A 5TT1A 1WB5A 3FNQA 3PUJA 4EQ6A 5B36A 2N3ZA 3G6KA 2XNDD 1SUIA 1W581 2WZBA 1P6XA 2C5SA 4RK0A 3PVSA 4ND1A 3IDQA 3TH5A 2XWJI 3LC7O 5ALKA 1GARA 5TMBA 2WM3A 3B6MA 4PU0A 4UNIA 1VECA 1SHJA 4BNLA 4P32A 4EAQA 3NWOA 3VR5H 2A9RA 3C5EA 3CMCO 2NSHA 3DOCA 3IQHX 4EIWA 4QXPA 5AESA 5K0GA 3VPAA 5ELXA 4AQYB 3N2GB 1Z74A 1VE1A 1XL0A 4CKCB 5L3VA 3JAMA 1GPUA 1YMQA 5AUNB 3HNRA 3D6MA 4NJEB 2OLKA 2V4MA 4QARA 4D8XA 1O97D 1NAHA 4HAXA 5IH3A 3GPIA 1K63A 1B1AA 2O0KA 2NXCA 1BRMA 4YHBA 1HEYA 4CMEC 4DGQA 2ZB4A 3FOZA 1VMAA 2GSWA 2Y68A 5DI3B 1IUPA 4IQFA 4CI0B 4TROA 4D4HA 3B3GA 4UEKA 1HG1A 1WX1A 3DCIA 2REQB 4TT3D 3WBKA 3GLFB 2G4VA 4QXQA 3OCJA 4CZ2A 5FNZA 4I6JA 3IT0A 3OCVA 4MZDA 3T34A 4AY3A 1JN0A 4TWBA 2HDNB 1LS1A 3BXEA 1PR0A 3AL3A 3WRXC 3AZPA 4IDQA 3P0HA 2FPGA 4WV3A 5TPWB 3JQPA 2EC5A 5JYDA 3UCFA 3GT4A 3BXPA 4NMMA 3TB6A 2ZWVA 1EFPA 3TEFA 2FP4A 1WR8A 2HJSA 1CHNA 1KKUA 3G2JA 2PNFA 3Q6MA 1CULC 4Y0VA 1PJLA 1YTLA 4P3YA 4U2FA 2PRYA 4DQXA 3G8BA 2XAUA 3VR4H 1RE1A 3VJKA 1OFIA 4EATA 4CWAA 1R8JA 1XDGA 3A11A 3RBVA 5IBCA 2JGAA 2Q28A 4Q9JA 2B0JA 2YY7A 2VHXA 1E8MA 3AEYA 1NJ8A 2OGSA 2VUUA 1XNRB 2B34A 1JYSA 3PC3A 1KSGA 1PDVA 4TYQA 3OIVA 4UEWA 2YIDA 1JQEA 1PK7A 4KQKA 3UA4A 2P62A 1S02A 2HK8A 5A9TA 4XUDA 2G8LA 3REGA 2B92A 1QH1A 4Z7QB 1ZK4A 7GPBA 3LT0A 1XPUA 2QG9A 4NK5A 4OX9Y 2EIHA 2KB0A 3PD7A 1P7YA 2PH5A 1YS1X 3GIDA 3QVGA 1T10A 5GZ6A 4AS1A 1GUZA 1SZPA 4FGSA 4DC0A 4R8RA 2Q99A 4RFVA 3ICQB 1ZG3A 1QUEA 2OZEA 4J1SA 4WHMA 1MC1A 4WZBA 2PZGA 2W37A 1MB3A 2H6EA 4JLKA 3GLQA 1FP1D 1QFYA 3B20A 2WHQA 1XZCA 1SFRA 2BI8A 5DU2A 1E1YA 4RY8A 1TTTA 4UMVA 5EA2A 1C29B 4AWAA 3C5WP 5B4TA 3E23A 2VYND 3GL9A 1VL6A 2PKQP 2GK4A 3SEAA 4GXQA 3T7IA 2G88A 2G4LA 2JH8A 1DE0A 1U9ZA 1W52X 1YSCA 1KBZA 3NNNA 2X1MA 2W5UA 3DKKA 3CSUA 1UXOA 3CWZA 1OH6A 4CEIA 2CUKA 1UWCA 4LOHA 3EARA 4IWXA 4FWIB 4K9NA 4C4SA 4KC0A 2H92A 3KXPA 1VMIA 4J6EA 2IUEA 3STYA 5BV0A 1L8QA 1NM5A 4HHEA 3U3ZA 3DO8A 4AF6A 4BNYA 5IABA 3TD9A 1KY2A 3N8GA 3OPVA 2V5AA 1LBHA 2IHUA 3IRUA 4AJOA 4EKGA 1VXRA 2RHOA 4RORA 4LWOA 3I53A 3PT5A 3K6SB 1Z9BA 5DYNA 4IQ4A 2GCGA 1U8ZA 3KYDB 3PEVA 1NXPA 3JVDA 4DCNA 1P0PA 3IR5A 3FR7A 2R1VA 5DTQA 3QOWA 2IZ7A 4A26A 2BBSA 2ES4A 3I5YA 3FYUC 4LJAA 1BDIA 4KDCA 4NLLA 2CYAA 5DT9A 3WLRA 3ODGA 5E1OA 5DN9A 5I9LA 5HRAA 1RI4A 4XUGB 2C04A 3PQ6A 3NBKA 1HG0A 3AERA 1NOKA 4UTRA 3F0TA 1R0XA 4KWTA 3LYLA 4NI5A 1PEYA 4URFA 4ALJA 1CRPA 3VOBA 1IXYA 4EUSA 2A0FA 5GWXA 5IVPA 4O5OA 4JQCA 2YOGA 1S1MA 3PFWO 1YZ3A 2DTDA 5TPZD 3VHLB 4ZCRA 3CUTA 3L04A 3VC7A 1Z35A 4PYNA 2I3BA 3AHFA 4RSMA 2Y1CA 1PHPA 2BF4A 3T7JA 3VPGA 4ASUA 3KQKA 3NIDB 4B3GA 1QTNA 2OQ2A 5JCOC 5DGIA 5J40A 3MYYA 1AB6A 3WGZA 1THTA 2G5CA 3L6UA 3EUFA 3EUWA 1ZNXA 3HFRA 2EJUA 4NBKA 4WXRA 4EY3A 4IJKA 1AS2A 1KTVA 1EFTA 3N07A 3TOSA 2YJNA 3BD6A 3OQOA 2B1QA 1E0JA 3W4JA 5BW5A 2I3ZA 4G01B 2JGLA 1PNQA 1R15A 4N7RA 1XRLA 3PNVA 3ML1A 4KAXA 1PG2A 3DP7A 4H4EA 2RC6A 5EGSA 1CC1S 2O2EA 3LF1A 1P4HA 1HKHA 4JN6B 2YZ7A 1H2YA 4LRXA 4RVDA 3FNFA 4L9RA 2D4AA 1JH8A 3AEZA 1Y9EA 3FR8A 4YCAA 3T99A 3HWX1 4JJAA 3KKKA 4BVJA 3D4LA 1JW9B 1NVBA 1W0CA 2DFDA 1BKSB 5EUMA 3WADA 2WU0A 3NTQA 4N9QA 1R5BA 3STUA 3T95A 5AW2A 4MGYR 3OESA 4UNPA 4Y1GA 5EE0A 3NAQA 1JFFA 4ESVA 2FZWA 2JLVA 1ZC3A 2K6GA 2BSQA 4DG5A 1BJRE 2A92A 3IJPA 1HEUA 1S7GA 1CXZA 1YKGA 1N2BA 1DJNA 2NUBA 3HDQA 2Y0PA 3BXOA 3K0BA 1JKFA 1KHHA 1R12A 4DHWA 4XB6B 5D5HA 3I05A 4D3FA 2I8LA 3LRXA 3A58B 4OXRA 1G9XA 1Q3KA 4NRDA 2PYIA 1ZP6A 3DKPA 4ZA2A 2VHVA 3UMBA 4PTZA 5KJ1A 3LFTA 5LBUA 5IUJC 4FOLA 4YJ3F 4YAGA 1TLTA 3L7OA 3QYPA 2ZXFA 4NCIA 1EXDA 3QUBA 4JYAB 1NF9A 2R85A 1JJ7A 1LK0A 5BMVA 1EB8A 4JAVC 4S0XA 3VVCA 1PSZA 1ZJYA 1D5WA 3CRQA 5CBKA 3EGOA 5HNKA 2BP7B 5TXGA 4LDRA 4HPJB 3OF5A 5I7VA 1Q44A 3DAGA 4TQAA 2AA3A 2Y71A 4X6XA 2WVHA 5DLEA 1A77A 1MQ9A 5CA1F 1T1GA 1V48A 1P4RA 1F5SA 2XCLA 2YWEA 3G7UA 3ZWVA 2VDPB 4BO2A 4CM3A 5HJ2A 3GF4A 4QTYA 1JLLB 1JWBB 4YVFA 4D6XA 3ER8A 1WY5A 3COSA 4JLUA 4AZ3A 2C00A 3NFYA 5AVYA 2HT1A 2HA5A 3MWJA 1GGKA 1FMLA 2DFVA 1VFNA 4K2AA 1FU8A 2A9PA 2O7VA 1L7BA 2X9VA 3ZD8A 2B37A 4GPAA 1FTQA 1XCBA 3ADBA 4EHDA 2X0EA 2VHWA 4OLAA 2RHMA 3WKCA 3RC9A 2H18A 4G9EA 3CNEA 2GXQA 5FIUA 1B3BA 1GV0A 1Q74A 3CBQA 3O8NA 4RIHA 5AXDA 3VOAA 2SICE 4QVKA 3QEBZ 3BL8A 1LBEA 4IDBA 3BCUA 2AFIA 1UBFA 1T5TA 2QM8A 3GUVA 3ZPXA 3GJ4A 4HQNA 4XIJA 4FCWA 1Y1KE 3MJVA 2H54A 1X3LA 4HDOB 5G0WA 1N92A 2HPVA 4ODIA 3CLTC 4C4TA 3ISVA 2ZTLA 3ND7A 5DBHX 4ZQFA 4W9MC 2EZ9A 1W47A 4V0QA 5KJCA 4B6QA 4EELA 5JASA 3I8SA 2HKIA 4N6OA 3LC0A 3T1NA 1E3TA 1XMOB 1U2DA 2BMVA 3JWGA 3LA8A 4IIDA 3SOPA 3RIGA 1OY1A 2GAFA 1FDUA 4HF7A 4R7ZA 2RAFA 4L8YA 1EGAA 3RFTA 4BV8A 5FDFA 2RKWA 2VXCA 1W5SA 4J1TA 3SLGA 4LZWA 3HU3A 4BNDA 5FLXA 4RVNA 4J1TC 3NYIA 5FOUA 4G4SP 5DV9A 1UQTA 3F46A 3KYDA 1UJ5A 2IIQA 3UBTA 3AY0A 1W73A 4OAPA 3SFVA 1CJMA 2CXRA 1WW3A 1QQ7A 3B2EA 3G5MA 4YIKA 4Z9FA 1H23A 5BSKA 4KQMA 4KDEA 2XI4A 3L0ZA 4J4TA 2ZT6A 5C4GB 5EMMA 3SE0A 1MB0A 5JW6A 1VLQA 2ODQA 3WX0A 1EQ2A 2VPTA 1KEUA 2NACA 3IR6A 4G81A 1TZBA 4P9NA 3T38A 2W4IA 2C83A 4N5HX 5FLKA 4OEHA 2M6LA 5FBZA 4CLOB 4FFBB 2O8NA 1B2LA 1IY8A 1RXCA 3PHIA 2O2DA 1N2GA 4N5MA 3ZLTA 2JLCA 3N8IA 5PNTA 2RE8A 4JIGA 1UK6A 3PYMA 1D1QA 3RIEA 3FLMA 2ECFA 1SUCA 4GGOA 5FFNA 1QHFA 4IWYA 4JYPA 5EMHA 4RKEA 1T4BA 3OMLA 2K2WA 2EQAA 3TZCA 5EJ4A 5A0VA 1ZN7A 4WBNF 3R20A 1OI3A 2L19A 3C3KA 1G9SA 3L4SO 3PQ2A 3QX9A 4QHSA 4W4TA 5AW5A 1D1SA 4GUDA 4EPXA 4EZBA 1P0MA 3FB4A 2GMWA 1TMKA 2XYRA 3RC8A 2FQYA 2IUSA 1CRZA 4EUEA 2OORA 4Y7DA 4XVCA 1MO3A 4AQDA 5CFPA 4S1VA 4K1XA 4G8JA 5DZSA 5G2OA 2O3JA 3RKSA 2F55A 4IFBA 3THWA 2DB3A 2I4OA 3GGJA 4L50A 2P9GA 5ALXA 3SJBA 3TBFA 4EWLA 1W9HA 4BPBA 1VL8A 3GELA 5GONF 3WWEA 3GRUA 4GNKA 1KWKA 3C6ZA 4OXXA 4X0EA 4OSPA 5L45A 2CL7X 1W5EA 3OH8A 4AMZA 5IN5A 2OCPA 1QAQA 1XRSB 5L9AA 2GPNA 3F9CA 2ZAIA 3E70C 2F1JA 4YJHA 1T5OA 4GZ5A 4E5NA 5LLTA 2PDAA 1QM5A 1VL5A 2C5HA 2XE6A 2XQVA 2JCSA 3PUWA 1JVNA 3URKA 4CMGA 4F4DA 1I32A 1RPTA 1ZHFA 3JCZA 2JLBA 5LXTF 2ZE5A 1S3SA 2YIMA 1NKTA 3SZRA 3ZHRA 3FKSA 2FW0A 1EP3B 2P9YA 3IOEA 1GO2A 1NYLA 1CBUA 2DAPA 2WFLB 3C7KA 3PIIA 4WESB 3UWPA 4BUJA 3H1PA 3QU9A 1BWRA 4GPEA 4WOPA 3JZFA 5CLIA 5I51A 5FTJA 3NTLA 2CNKA 1VKZA 2BFFB 3EFOB 3I9KA 4U2CA 3LCCA 3V8BA 4I4TF 1LF0A 4HLUA 2QM7A 2YVKA 1OLUA 4YXFA 2C31A 1CLEA 4LYDA 2GWHA 3O95A 4BV3A 3IO3A 5CXXA 4AIIA 3BE6A 4JKIA 2ZT7A 3D64A 4EGAA 5JI2E 2JKVA 4B3MB 1L7VC 4KITB 2WG1A 3JQBA 4U5XA 4TXHA 4YMWA 4EPRA 4P4GA 1GY8A 1JR3E 1QE5A 1CJCA 1U02A 2GLXA 4BO9A 2PGAA 2ZULA 4REQB 3RVKA 1JP7A 4KX5A 4YP6A 2PX6A 2X1HA 1KH1A 1U2GC 1E4VA 1XN1A 3H1TA 4TWAA 1JSZA 4M0MA 4Q37A 4REQA 3FUXA 1TUEA 2KMLA 1XZBA 5DXFA 3L92A 3TTSA 1FJGB 4ZZ1A 4B48A 3E9EA 1NKVA 2J3HA 2WTAA 3DE5X 3P20A 2VSYA 5H1YA 1PHRA 3ZV5A 1T8UA 2V55B 3K4QA 1VPTA 2HJ9A 4DR3B 4MYTA 3ROXA 1N36B 3WDKA 4X63A 1T35A 1MAAA 1TVKA 1XVAA 3AR8A 4HMQA 2DQYA 4K9DA 1EZZA 4XVUA 3ZCQA 1DPGA 4D4JA 3BXGA 3SSOA 4JP1A 4EP1A 4EVSA 3QEAZ 1U3GA 5BMOA 1JDVA 3TFOA 1CDZA 2EFEB 2FWIA 1ZXBA 1XALA 2HQ1A 3P52A 4GX5A 5AVSA 3V4VB 1GFIA 1J9GA 1W2HA 5B4UA 5KC9A 5COQA 3QF7A 3O8QB 1WM1A 2X2PA 2ZVPX 3B9QA 3RYIA 4GI2A 2Q45A 3HS3A 1A82A 1IWBB 3R1IA 1JAIA 3FCEA 3T4UA 2JI4A 1XKLA 2QZ4A 4XSHA 5JE8A 3VO1A 3WNVA 4BNJA 2EQBA 1PTKA 2W00A 1ISSA 4JYBA 3Q87B 2WFMA 1HYGA 2YFQA 2GILA 2OWEA 3ESCA 1XHEA 4AWBA 4KHZA 4DS3A 4EMTA 2ZYDA 3PIDA 4N0QA 2JJ2D 3EODA 2QYOA 3M1AA 3EGXA 2WM9B 1USVA 2X0KA 4JJ7A 5JJBA 2I8CA 4A23A 3IAM6 1WP9A 3MMNA 2X5NA 1SOAA 4BMOB 5KNCH 4L57A 1ECFA 1RJFA 2CWWA 3MWEA 2HFJA 4UVHA 1DV1A 1Q50A 1NBME 1RAFA 3F5MA 3A6EA 2GCOB 2O19A 3PFGA 1BX0A 4HK4A 4XSGA 5FL3A 3JU3A 4F4UA 3AVQA 1TADA 3GNTA 1W44A 1A4XA 2RAUA 4TXLA 3NNSA 1VSUA 4GO1A 4B85A 3A1UA 3PU6A 1Y3HA 2OO5A 2Q3DA 3DKIA 2UYCA 1E94E 1F1BA 3EC1A 3SR3A 1K3FA 3C1OA 4PE5B 3E5NA 1LPNA 4WJLA 3X2FA 1QJCA 1W94A 3ZIAA 4YTEA 4CDNA 5EZYF 1XZAA 2CGEA 2Y77A 4WZAA 3HABA 3W5CA 2XUIA 2JBAA 1CS4C 1F20A 2TSYB 4MWTA 4EA8A 2P4HX 1DJOA 2ZI6A 1WRBA 4BAUA 4DKXA 4BJ5A 1ZSVA 4OHWA 1YI0A 2F3UA 2CNWA 1Z0UA 3CR8A 4C76A 1EGVB 1JA0A 4EO4A 2VCHA 1PIWA 4YI5A 3V8PA 2VZEA 1T1JA 2G7ZA 1VCHA 4NAHA 1Q7CA 4UZFA 5ES4B 1A98A 4QULA 1BD4A 2JFXA 2XTJA 1A5TA 3KQQA 1KEEA 3ENZA 3ONNA 3BRWD 2GRAA 4JGIA 4WKOA 4ZGBA 5B1EA 3PC8A 4D25A 4JU9A 5K45A 1Y4UA 1LX6A 3Q5DA 4ZO4A 5F1OA 1KC1A 4E2YA 5LNK6 3VVLA 3ZHSA 2VPQA 2WBLC 4JI1B 5JROA 1VHLA 4KTVE 3RAGA 4BX2A 1KFJB 2G17A 1WCIB 4FGZA 1FS5A 5I3CA 5KQSA 1XVVA 1WCXA 1WXWA 1Y0BA 1Z2OX 4OFBA 2Q0QA 5E3IA 2GRUA 4OX9B 2J31A 3RS2A 1FMCA 1CQIB 3HYLA 3H2BA 4P0TA 5T3UA 1W0KD 4KBGA 1PFVA 5JLJA 2I2WA 3CVOA 2J9ZB 3IPCA 4JR1A 5I9SA 3FIUA 3RW9A 3VZSA 2XD4A 1YK0A 2RJOA 3N7TA 4OOFA 4PGHA 4CCYA 2HV8A 1QIKA 2PY6A 4F21A 5HKBA 2PH7A 4KX3A 2A0KA 4QUDA 4BP8A 4CIXA 8AT1A 4DYDA 5I4IA 2P9CA 1SUSA 3EVFA 4CCYB 4LBVA 1G3IA 3W7AA 4YRKA 3WJAA 3ZS8A 1NVKA 2A9JA 1FUYB 4BJ3A 1RQRA 1DV2A 3DZFA 1QHYA 1GL9B 2BIFA 1P7WA 4YREA 4FNGA 4DCMA 1U0OC 2JBHA 1QVVA 2WJAA 1QSGA 3KFVA 4ZCPA 2PWYA 1UXHA 2AMFA 2ROQA 1QHNA 3K72B 4N54A 5EKXA 5FL7D 4URZR 3WLLA 4EK9A 1FYWA 4NJMA 4FHDA 3K9QO 3PPIA 1I2ZA 1KK0A 2YWDA 4W5WA 2AOVA 4FLEA 4GM1A 1IH8A 1JXMA 1I7NA 1JJBA 2GGSA 2RCNA 3DG9A 3BTUA 5AKJA 3UB3A 3SJ7A 4ZREA 2P6MA 3ZNNA 4ZU1X 2XSZA 3IKTA 3PE3A 3QI7A 4GBGA 2PYDA 3QOXA 5TGTA 1K86A 4L9SA 4YCBA 5EYPB 1C81A 1ISHA 1PR2A 2IXGA 4FEAA 4ZCQA 2J6BA 3TLGB 3HB4X 2JLAA 4IRMA 1E2IA 1Q20A 2RHHA 2IS4A 2JGRA 1KQFA 1QWOA 5BNIA 3QEKA 3TINA 4KWHA 3HKDB 2X6QA 4QQRA 2Q3HA 2F43A 2VUTA 5GV8A 4DSZA 5JFTA 1I7PA 4E4YA 1I7QB 1K06A 4KMOA 1N4AA 1DEAA 5EG5A 5C5CA 4NYMR 4OIMA 3WY9A 1LPPA 4D56A 3OPQA 5HIKA 2W6JD 2J46A 1RMQA 3EGDA 4HRAA 1LSUA 1ZITA 4HEA1 4YONB 3LDGA 3B7PA 1WWKA 1OFTA 1LEHA 2I2DA 3AVOA 3OPYA 3RBXA 3S5UA 1ZRSA 5E8JA 3WYDA 3MERA 1BHO1 4ID3A 4XCXA 2IHNA 2IA5A 4MHTA 1NNSA 1P61B 4O2BF 2VF8A 1XMJA 4G0MA 2Y2UA 3FPHA 2FUG1 5KOJA 1YFJA 1C41A 2DULA 3ITDA 4LOKA 1VBKA 1I2BA 1VSVA 1BJTA 2V0NA 2VRBA 1BDJA 4UEJA 4O2AF 1JFLA 1QTIA 4WD3A 4IX9A 5EIFA 2A14A 3VHRA 1KBQA 3GRCA 4YJ3A 5LQNA 1YR9A 3WB9A 2ZAMA 3DTYA 4E46A 2W6ZA 1XQ1A 4E4TA 4RSGA 2ETVA 1PD1A 4OA8A 4BCDA 3UMVA 3FBGA 2H4JA 1KEZA 5LZ8A 1IXSB 1E18A 2BOVA 3T8YA 1CUZA 4GICA 4GWLA 5BSFA 5GP1A 3FFAA 4D8TA 1Y4DE 1QYXA 1BVHA 2YOHA 4DJTA 1PK8A 2ZTMA 4YBRA 2CB0A 4F6RB 1E60A 2ONCA 3FMVA 4IDPA 1A8QA 1II9A 1O3YA 3DAFA 3QEMB 1NU8A 5BW4A 5HE8A 1QCYA 3CUEF 1E9CA 1Z5UA 5ER6A 4B2YA 2VH5R 5I01A 1LJ8A 5CXUA 5AI8A 3GUUA 3QEMA 3IERA 3JQFA 4I9UA 2Z9DA 1Y4AE 4R1NA 3H1BA 4YO8A 4BJ1A 3PA8A 3GQVA 3HA3A 5I48A 4R2LA 3M8KA 2XUJA 4YRNA 2NSJA 2PS1A 2KM1A 3AUTA 4J0CA 2UZIR 2JCXA 3LUDA 4HGPA 5FBKA 1CETA 2A0XA 1ZESA 1T5BA 4AKTA 2VLIA 1FC0A 3FGZA 1F48A 2GFIA 5HTKA 1R6TA 3BL6A 3EIQA 4BOYA 3VI4B 4YAKA 1SUFA 3GJ8A 4EPTA 4IHJA 1SCIA 2OCBA 4Z2AA 1WEKA 2FWBA 4J03A 1HMYA 1MIHA 2AEFA 1YR8A 2FFBA 2O3TA 3M3PA 2OCYC 3OVMA 4C2UA 2PT7A 2C8VA 1N0HA 1YC2A 1EVJA 2XR1A 2JHCA 3M6IA 4R5HA 5JZVA 1SU8A 2I7XA 1T2EA 1U5AA 4Y1RA 1Z5WA 5FI5A 5BNFA 5F1YA 1G5IA 4KLZA 2FW7A 4H16A 3V4LA 5HMMA 4PY2A 4N41A 2V7QD 3FZGA 4MV3A 5JNUA 3UFXA 1GTMA 3VDNB 3NC1C 4PFKA 2QM3A 3D8NA 4PZCA 4IH9A 1WD7A 1XQ9A 1Q11A 2VWQA 3JW8A 4LNHA 4TQGA 4BQNA 1OXSC 2PUVA 4CIBA 3DHWC 2PT9A 5D51S 2YN4A 2OMKA 1TIPA 2P3LA 3MBKA 5EZSA 2Q6LA 4EA9A 2B25A 2VJDA 5AW6A 2IH5A 2CLOB 3DPUA 1FVHA 2HPHA 2V7WA 1ADBA 1MN6A 3K1YA 1K9SA 1TZMA 4OFZA 5AM5A 5BYAA 5BR8B 2J48A 3K31A 3AVPA 2I7DA 1H65A 2IK8A 2OEPA 3AHCA 5C5EA 5F21A 3LY7A 1G6Q1 2H08A 3TR6A 5LMUB 1SXJC 1GSAA 1R1DA 1XC7A 3DO5A 4HAOA 1G38A 1QO0D 4NBTA 5FJJA 2DLNA 3CCCA 2G0TA 1UBSB 3K5IA 4LPKA 5IVKA 2DY0A 2WSSD 1EXVA 1T0BA 2B4KA 3REOA 1OA0A 3G2OA 1G55A 3G2IA 3WDSA 5CDTA 3FBWA 3K9LA 2FP3A 2RK3A 4RL4A 1YWGO 2PUWA 1T9GS 2D5IA 2B3TA 2JIZD 4ZRMA 1KR5A 4IJ6A 5GQSA 4BCCA 3PNPA 3GEDA 2ZZKA 1CJSA 3EISA 4W5NA 2XF8A 3BB1A 4B35A 1WUJS 5A62A 2BMWA 3U3RA 2O59A 5FWDA 4U6SA 3L0OA 3MJSA 3QBVA 3A3OA 4Y9TA 1U90A 2WU3A 3R5TA 1FSZA 2BHTA 5HZMA 2HNKA 1QPZA 2EWMA 4FU0A 2G09A 2QJTA 3WLNA 1I30A 3TD6A 1AKNA 3E8XA 2BRUC 3RSLA 4BFVA 3PPYA 1DJLA 1JMKC 1NVVQ 2W4MA 3BIJA 3EBOA 2SNIE 4FOPA 2Q4RA 3OJLA 1JSCA 3QPCA 3BD8A 4FUTA 4PAMA 5CAEB 3UFBA 2VT7A 1XZNA 1GV1A 4LZLA 3H97A 4DN6A 2NOAA 1IQUA 2BZ0A 4OI0A 3PQ3A 2HQBA 3LUHA 1W59A 3NHJA 2ODTX 2PZEA 2ARKA 5F77A 4BNDB 2XT6A 4BZZA 4ZMBA 5DCLA 2P41A 1QZXA 3IDAA 1L0BA 1G60A 1W5TA 4LVCA 4HAZA 1BXKA 1UCFA 2C2HA 2CZGA 3FHLA 5KNDH 3F4LA 3W9BA 2H52A 1DT3A 2AMYA 4ENVA 8ATCA 1YCFA 1A9TA 1Z13A 1TO2E 3PC4A 5C4IA 4FT2A 4L22A 4QG7A 4FD2A 1UDCA 1ZN2A 2F1HA 2FN4A 3BULA 5JRZA 2ILTA 5TSDA 1FFSA 2VH1A 2Q3BA 1WSWA 2B99A 2VTVA 2XCIA 3KQYA 2NZXA 1JHMA 2WTMA 2GJSA 4Q16A 4OATA 4S1OA 5ARCA 4HAIA 4BMNA 3F47A 4Y2TA 4DEVA 5IKEA 3Q3EA 2CLSA 3KUCA 2FV8A 1IZ8A 5C1IA 5LZ9A 1HE4A 2UUCB 1NXTA 3LRTA 2WHXA 1V4VA 4PN7A 1WLYA 1X7YB 4NV3A 4HB0A 4PYRA 1Z82A 3FKQA 2OWDA 2XGOA 3V2HA 3EZ2A 3RT1A 5J58A 1H2XA 3DAYA 3SF8B 3IMFA 4R68A 3CUYA 4GKJB 4OGKA 3AILA 2HO4A 3W79A 2OUIA 3EOAI 3AI2A 4G89A 4UPDA 2QRNA 4PC3A 3TNDA 5KTNA 3I9MA 2Z8YA 3ZDYB 4HKTA 3QNUA 2ZTVA 1SVIA 1PR6A 2IZOA 2PZKA 1AM4D 2AKYA 4WXMA 4TLDA 3IJ5A 3ZZNA 5ETJA 3AFMA 1VTKA 3BIXA 2IXAA 1T9BA 2QW0X 1POWA 5TGZA 1H42A 4R8KA 2J5KA 3ICPA 1RPZA 2H17A 4GSLA 4M7OA 2AN5A 2BGUA 2QEQA 3ESDA 5G1OA 4XD7D 4M37A 1F0NA 3O1JC 1DG9A 2GBPA 3L7AA 3AVUA 2EYUA 4M9CA 5AJXA 4DLRA 4YYZA 5K8IA 2IDKA 3NVAA 3E1GA 3U09A 3BTSA 1EDOA 3JSXA 3FPBA 2Z6AA 2Z2IA 2ID7A 2ZB7A 4HSGA 4UKDA 1JLMA 3VR6H 3ZJUA 1YOVB 3EEQA 3N0WA 2H63A 4YJ2F 1U8UA 3UEOA 4DA9A 4OMFG 2PLNA 3LDAA 2XQJA 2PR7A 4KQGA 1N5DA 1EQAA 4ZYTA 4ZYUA 5KINB 4DBLE 4L27A 4B3CA 4RV4A 3LLSA 3F7TA 4EF4A 2HU5A 4XZ3A 4HV4A 1CHDA 4YCSA 3T9BA 2C9ZA 4F4CA 3EVDA 2WW8A 3DF7A 3F6PA 3JS5A 5JS6A 4JDPA 1UPFA 1KZ1A 2A6PA 1YZVA 2Q8NA 2HO5A 5C3UA 1PEDA 1XFDA 2XMBA 4TGLA 4OUKX 4MJ3A 2H85A 1RRMA 1ZZGA 4BAZA 2D6FA 1L5YA 5C18A 1ZH0A 3PX3A 1NVEA 4ZAFA 1MKYA 2VHCA 3CTPA 1SBYA 3SD7A 3SHVA 2IX9A 4PLYA 3D8UA 1B6RA 5D3ZA 3N70A 5AH0A 3LY5A 3OJOA 5A03A 3K2BA 2OV8A 3JQ8B 3VPXA 5CFRA 2Z6VA 1VJDA 3TQHA 2GPAA 5HX7A 3L5OA 3IQEA 3TQOA 1KI6A 4TKLA 1GSIA 1UDXA 4RZIA 2TMKA 1C7ZA 2F17A 3QG5A 1KZHA 1J23A 4BMCA 5ITZA 1X7WB 1KJQA 1YS7A 2JF0A 4EB8A 3BRQA 3JQCA 3SYLA 4YRMA 4Z53A 3CISA 2C61A 4FIZA 2G1UA 1A5AB 3M4YA 2HRRA 4DAOA 1GXSA 2QJWA 3LVFO 1PI3A 3JWHA 2C9CA 2EBUA 2IYFA 3DZIA 1QX4A 4ZQIA 3TKYA 4C5AA 3U44A 1ABFA 1I6MA 1YDHA 1ZH6A 4HB2A 3KWJA 4R69A 4XEHA 1VA5A 2DECA 4A9AA 3ICEA 3EIOA 1QVWA 1XZHA 3H4IA 2PAFA 1IG0A 3AF4A 2EFHB 4LK3A 5H80A 1D03A 4M1OA 1JSXA 4PONA 2E85A 5HRUA 3HKBB 1C0PA 1Q21A 5K3BA 5JSYA 2HSEA 2NU7B 3LNTA 3KVOA 4UHBA 4LYFA 3DEAA 3IV7A 1QNFA 2WVAA 1CYDA 2IEYA 2WF9A 3JAKA 4JVNA 3DC7A 4M89A 2AH5A 3JAWA 3K0AB 4ITUA 5EJ2A 3I3SR 1ZVVA 1RZVA 4I6EA 3JYQA 4B76A 4RYDA 1V7QA 1QGDA 5DOZA 4EB0A 1QCZA 4YP0A 4BXOA 4KBYA 3IVRA 3RBZA 8LDHA 1RXEA 1XEFA 5AM0A 3TQTA 2TYSB 4E11A 2ZSEA 5LN1A 1BN7A 1RHMA 2FWMX 4LZPA 4N0PA 4OU4A 3UHJA 1UFQA 1VI6A 2YUIA 3P4UA 4I3HA 4EKEA 1QPGA 1Y3BE 4J0JA 2FWJA 2FX5A 2WJPA 2IODA 3O9ZA 4PFQA 5IC6A 3RSQA 1ZM4A 4R41A 5KCZA 1FSSA 1MXFA 4R6WA 2VN8A 1O1YA 2FEAA 3K71B 3FYHA 4J0FA 2PWZA 1K8RA 1S4QA 2O52A 2HM7A 4GYKA 1AQNA 1FP2A 1VCIA 3H2YA 1G5HA 1U98A 3A28A 3IELA 1SBHA 2G63A 1G42A 1J97A 2FPIA 2XMGA 1IHUA 4AP6A 2XKKA 1M34E 3AF0A 3BJIC 3GT0A 3QGMA 4JLSA 3NQ41 3GYGA 4EY7A 5F3DA 2Y66A 2WYWA 4WNCA 3FMPB 4HB3A 2QRHA 3ZV7A 4PLTA 4GMGA 3OFNA 1CUEA 4OHUA 3CM0A 3S8MA 4O4JA 3OQJA 1ZVQA 3DOOA 1NG1A 3O4RA 1SVOA 1M6EX 4ZAGA 4C04A 1I0LA 2BD0A 3U48A 4GAEA 4RFSA 3WL7A 1P2SA 3HVHA 3OOWA 1GLGA 5GM2A 5ELMA 3OKAA 4D8VA 3G0BA 3QX7A 4NCNA 5AQ1A 1UDRA 4XIYA 1WF6A 2O2GA 1CZRA 3OT5A 1P8JA 2IYRA 1I51A 2ZT5A 3PDJA 2LCQA 1FTNA 3GRFA 1JQAA 3VYTB 1OH5A 1Q1NA 1ICIA 2ETXA 2RD2A 3E9MA 4TMFA 1RHRA 4TTSA 5K0BA 2YMQA 4CCSA 2O8BA 1G1MA 5E1BA 2PS3A 4B33A 4QKQA 4YUAA 2XUGA 4RTMA 1ND6A 4G8BA 5D87A 3V2GA 1O08A 4DIUA 1H9BA 2YDYA 3GQBB 4C7JA 1IN1A 3QBJA 4XVQA 3CRNA 4GOND 2XB8A 3NUGA 3LY8A 2ZEJA 4EHFA 1PP4A 4QLBA 1B43A 2DXIA 3TUIC 3CX8A 5L3QB 1NZJA 2ZW9A 5I7EA 4TTPA 3UK6A 1ZNYA 3QV1A 4YCJA 3VU9B 1NNEA 2M2IA 3W5BA 4MRAA 5BN1A 3R7LA 1GZ5A 4C0BA 5C32A 1UJ6A 2FPPB 4OHXA 2VT2A 4JELA 5T7BA 4HNAA 3TMYA 5EY5B 4B6SA 1LU9A 2VWHA 4HG2A 1TVKB 4HDNA 1NXQA 1AOXA 1X9IA 4XDYA 3S40A 3W2HA 2P3SA 2RAVA 5EHNA 5TF4A 4I1PA 5HGJA 3WYNA 4XX0B 1ODJA 2O0MA 1PJZA 2XT0A 3WKDA 4YV0A 5L40A 1KZ6A 2RGXA 1A2KC 5CDHA 4MVXA 2PD3A 5BWLA 3O3NB 4IUBS 5U1PA 4Q3EA 2XV1A 3O03A 4TMWA 3BXHA 5WRFA 1E79D 4GSKA 2W2TA 2FPXA 4RV5A 3NPMA 1K8ZB 5H5JA 2X42A 3DBHB 1EEHA 1HDCA 3UOGA 4Z6KA 5A5DA 1WB9A 1EI9A 1KZ9A 1QGUA 1TJPB 2RB4A 4PLGA 5IDVA 2WK1A 3HA2A 4O1HA 1RWOA 4QOFA 1NJSA 2A67A 3SYMA 3PD1A 4ZO7A 3PDWA 3H5RA 4OI4A 1OLOA 3BDVA 4MW1A 3WGIA 1N3BA 1LBSA 1U3CA 4U4AA 1XF9A 2I22A 3LKBA 3W2GA 1WPRA 2GERA 5DEIA 3L4EA 4TTIA 3UTCA 3HR4A 3DZGA 2YV4A 4HI0E 3T3OA 3RYTC 3NETA 1EVKA 2GF0A 3NM6B 4L16A 5I7WA 3UKOA 1AQIA 2JD2A 2R96A 3PSAA 3O84A 2WIKA 4FOTA 1KWGA 2QHXA 3VUEA 3ZBTA 3FGOA 4MPRA 3A6HA 2O6HA 4JJIA 4XRGA 4G65A 1F6DA 4MVCA 3N0RA 4NJEA 1V8FA 1N7GA 4TWRA 3ZGYA 1VPLA 1Z2NX 2D0OB 3Q7PA 2P75A 3ZDZB 4J0HA 5C8YA 2J9YB 3DMPA 5MN4A 5KO2A 2YTZA 3B9RA 5G1NA 2R3SA 2UUPA 3AW9A 4KYUA 3BWBA 5C1DA 3EGCA 3LP5A 4A3SA 5A71A 4ZI2A 3BH6A 5KSWB 3SDZA 3KLNA 2C2OA 3OIDA 3PNOA 5E7QA 4IP0A 3ELDA 2C5AA 1ISIA 4RHFA 1UZNA 3DFKA 1OVGA 4GSYA 1BYUA 2ZSDA 3C7TA 1M34A 4Z7NB 1LZLA 3KOYA 1KRWA 3EUAA 4HNTA 1X7GA 3M83A 4L9AA 1IQPA 2EFCB 3GMDA 4FFDA 3AG6A 2FSVA 3K35A 4UUMA 2J7PA 3HFSA 1AKYA 4NOKA 2FP4B 2FU5C 2XIQA 3PPWA 4F38A 4X00A 3AEQA 1B2RA 2PGJA 2DT5A 1FJHA 3FKSD 3QW2A 4YFVA 3TIXB 3UATA 2B8WA 5ICEA 4M98A 1APBA 4NAVA 2PZAA 3D7MA 1FVXA 3VM6A 4RANA 4NZMA 3U3JA 4DIEA 4BE4A 1OLSA 1Z56C 4GQAA 3ROMA 1QQ6A 3ZCSA 3KXKA 5AD1A 4G1MB 2ONYA 3OUTA 1VL2A 1P39A 1XVIA 2XA9A 4X62B 3H11A 1U2SA 3A0UA 2RGCA 1M0SA 5D3KA 1R5JA 3FI9A 5DN6A 1AQUA 4GG1A 3MHPA 1TX4B 3DPIA 4Y2SA 4E2XA 1Z26A 1I4LD 3H11B 4OFXA 5GZ3A 5KNBH 3WGLA 1SXQA 2WWWA 3BK7A 4OYYA 3TX6A 1TZKA 3H0EA 2KBFA 2R8PA 5AHKA 3Q5GA 1Z8NA 1PG5A 3ISJA 4MLCA 4C14A 2F4VB 1X1AA 4HLQB 4JJKA 4OXQA 3UICA 5JCJD 4CW7A 5HUQA 2QLJA 3PHLA 3PQFA 2PRIA 4Q48A 5DF1A 5CFZA 2BY4A 1M2JA 4X92A 3KQMA 1QO7A 1NMXA 4L5AA 1YQUA 4DTCA 2FMUA 4FCTA 1T4MA 1TFUA 3AGQA 4KO3S 3FAZA 1MO2A 5E9QA 4KEAA 3T9EA 4BZPA 4W5OA 2AN1A 3USZA 4YP7A 3PD0A 1NNI1 2WIDA 3JVIA 1WMBA 2QLNA 1UBMS 3W2FA 3G0GA 4JFRA 3NB0A 5AHXA 3TIGA 4RQUA 3CZQA 3E8MA 2CB9A 1EWRA 2NZ2A 1XWWA 4QT0A 4XYEA 5AVOA 4EGQA 1CT9A 1U0TA 2OKCA 1C9DB 1EHCA 3DHEA 1K3TA 3CUVA 2KLBA 5EQDA 1G59A 4AZ0B 3DVLA 5JNSA 3K9CA 1XG5A 4H1WA 4JT9A 3B8HA 2CD9A 4Q1CA 3DT6A 3MB8A 3PFHA 3QZUA 1PD0A 4ML3A 2HV9A 1ESNA 1F0KA 4OM7A 1YCHA 2HQOA 4L5JA 3RC1A 2IY7A 5LDGA 4A2WA 1AKEA 3ERCA 3HYNA 4Z9XA 4KQ9A 1R8YA 1SK9A 4UDNA 3TB4A 4E6EA 2D2FA 2NVUA 2P4QA 3I09A 3A9SA 1S3FA 3IAAA 3OKPA 3PCRB 8GPBA 3HWRA 3R0IA 3S2GA 2X58A 4R9SA 3GNQA 1ZIXA 4BWGA 4ETMA 1J1IA 5HJ5A 4MH0R 5ERGB 3ILHA 3CS3A 1L1FA 4AUMA 3EULA 2FG5A 1HQDA 3L7BA 1E6MA 2R8RA 4QUHA 4CM6A 1M6WA 3P9QA 4DIOA 3S2ZA 4EB3A 2QAGB 4IOKA 1GNTA 4M49A 2YOFA 1N9KA 1W25A 5ER9A 2FPOA 1HI9A 2FW6A 4M76B 5FTMA 4L76A 1CERA 1E7SA 1M1NA 1OREA 5FAKA 3R7NA 4EECA 5CT5A 2O9JA 3DDCA 3DE4X 5B37A 3A7DA 4TUYF 2J6IA 2QD2A 3I04A 3TW8A 4F5DA 1NJ2A 2Q6IA 1MA0A 1RWMA 2BEWA 2GJAA 2JFOA 3CX3A 3IVXA 3QLEA 2M6KA 3T1HB 1M0WA 1MH1A 3VZBA 2ZSJA 1W30A 2VFAA 3Q0EA 1UKYA 1XMQB 4UNNA 2HLDA 4QYMA 4YRDA 2HCJB 1KDRA 1U5BB 3FCSB 2CJYA 4MVJM 5K01A 1RS0A 3TG8A 1HNZB 2TMGA 1N78A 5AVKA 2QOEA 4KMRA 2CMGA 1I4OA 4V2UA 1V41E 1JIUA 2JA1A 2JBAB 1K8XB 4IIUA 4WSOA 2XCUA 3CNNA 4HYYA 3VU3A 4BIMA 2AOTA 4F9FA 2BMDA 3P2YA 3GY0A 2ATEA 1SHUX 3BM5A 3K1AB 3OU7A 2WV7A 4V0SA 4KHPB 2JD0A 1E9SA 5J1SB 2GN0A 3LIPA 2EL9A 3H75A 3FD8A 5CG2A 4YUWA 3CZ5A 3AW8A 3GAFA 3KEGA 4QDOA 3GLHB 4P6VF 4R7GA 4EA7A 1R9NA 2OCKA 3G9QA 2CXOA 3EUEA 3SDSA 3PXGA 2P0YA 1CUWA 1JJVA 1N1DA 3AM5A 1Z7BA 5JVDA 1F8UA 4UHKA 1BX3A 1WEHA 4PAQA 3SM9A 4IVQA 3TIFA 3EDOA 4GH5A 4S2EA 3UZUA 3OCCA 2VCYA 4X1IB 1E64A 2G1KA 4QJBA 1KYVA 4DDWA 1KDYA 2UXCB 2OSVA 1SBCA 3Q12A 4UNQA 1K97A 4LDNA 3MQ4A 4GW3A 2BI7A 3UGTA 4RKFA 4MUGA 1VJCA 2P4EA 3SQWA 1XD8A 1UT6A 1IM2A 5EIEA 4MUMA 2A86A 1XZLA 3TKLA 5BN4A 3DOEA 3HGMA 3TIVA 4N8EA 1XNHA 5IJAA 4GLFA 3MRSA 2IBMA 1H3FA 4YUZA 3LDFA 5M7EA 1FUEA 3F4KA 3HKCB 4MMYB 4RLFA 4J0KA 4QOHA 4D46A 5EJFA 1QDEA 5I9BA 3ADDA 3JPYA 1WNTA 3NTVA 4O1IA 3GLGE 5T4HA 5I9MA 1PWZA 4YQFA 4K28A 4Y2XA 3K32A 4BEWA 1IY0A 4UM9B 4NOLA 2WFZA 3GROA 3ECCA 4WLNA 5K2OA 5BQ3A 5H3LA 5KVQA 3FYDA 4G86A 5T4FA 4A0HA 4CMBA 1VHJA 5IPFA 1M67A 3ROEA 1XIVA 1D0VA 4HQ6A 1J2RA 1AGPA 4YR9A 4HD8A 1K6XA 2FCAA 1FCJA 5FTLA 1C3JA 2PUFA 1VDMA 2GR9A 4P3OA 3HA5A 1SQ6A 4XYLA 1ZGAA 1H2RS 1FMFA 2WD7B 2DLDA 3CN9A 1J09A 1DWQA 1RXYA 3MJ4A 3N5KA 1YZFA 2H2HA 1NFRA 3FFXA 3NBFA 1V47A 4HDCA 1M76A 1SVNA 2YCLA 3E6AA 3MTDA 2NYVA 4MPPA 3FHTA 5EXDA 3ET4A 2ZJBA 1HQKA 3R3UA 1W46A 3RFUA 4IKEA 5A9RA 3AF1A 1U4NA 3W77A 4W5QA 4E21A 3NKLA 4PG6A 4P3PA 4RHCA 5J4HA 3BSSA 4WERA 2QR3A 1XTTA 2H11A 3VZRA 3HKEB 4X1KA 1JT2A 1N2SA 2FLKA 1VBFA 4FGLA 4AJHA 4KAAA 2GOYA 2RGNA 2P7HA 3QJYA 4KQ2A 1JBQA 1S7CA 1CJTC 3RJTA 4D92A 5JPCA 4GDMA 1ZVJA 2A3NA 1E3WB 2R47A 1RMTA 3JQBC 5LMNB 1U2EA 1NLYA 2D06A 2H5EA 1YRYE 5JG7A 3JATB 1I0ZA 3MPOA 4LUCA 1C80A 3IAM1 1VJ0A 4EPWA 4Q1DA 2Z08A 4OA5A 3CH5A 4PLPA 5AKHA 2FK7A 1U3DA 1W0JA 1W4BA 4C3OB 4GBMA 4KGZA 4ZZ2A 3V8MA 2V65A 3ZV3A 2J4DA 2XWBF 2AEJA 3QLTA 2RGEA 2M6RA 1XKXA 3DBLA 3F3YA 3TGLA 2FOXA 4GLBA 4X20B 2ZJ5A 2VP9A 3IP8A 3H65A 1UFVA 4IDDA 5DBOA 4G1EB 5GZ1A 1SCBA 1FRVA 3EN0A 2QZJA 3ZVMA 5F52A 1IXKA 4H7EA 5EXEA 3BHMA 1D2HA 4X8OA 7REQA 1IB0A 4A7PA 2BHNA 4A15A 4JYZA 5JATA 3E82A 2Q3MA 3NALA 3HPRA 1Z6PA 2R8BA 2Z2KA 1F8XA 1CE8B 2XKAA 1RQ7A 4OXYA 4XVRA 4Z3DA 1X2EA 5EUQB 4R1PA 3JAKB 5EKSA 4BNFA 3PYXA 1LUAA 4BLWA 3NAMA 3T7RA 5K0FA 1W1WA 3ETCA 3OZGA 1GNQA 1C7RA 1VHQA 2BFOA 4P7GA 1UDBA 2FQXA 3H99A 4ZOLB 2QM0A 4AG6A 2H4YA 3REQA 2R97A 3I9LA 3MGCA 1J90A 1UC9A 4IUDS 4JX8A 1OPRA 4J3FA 4O4LF 4P1ZA 4WKGA 2WYIA 3WYEA 3OHPA 4KO2S 2XBLA 3EX7C 3KYIB 3B1JA 1SG0A 4G0PA 5SYNA 3TQIA 1RCFA 2H4WA 1LNSA 3TOXA 3PDCA 3F8TA 2PFKA 1QV9A 2IYEA 2QGZA 4IG4A 4OHFA 3KS9A 3RG2A 1B0UA 4J7AA 2H57A 3WL5A 4HTAA 1VIMA 3CF6R 1I33A 1F6WA 4CMIA 4IEFB 4QTXA 4EJSC 4FB5A 1EFAA 4K9LA 5CXSA 2PV0A 2IUYA 2Z57A 1QG4A 1VCOA 2IU4A 1QGAA 2GNOA 2VDQB 2CMKA 1NPDA 1XK7A 3GEIA 3EEBA 3VYUB 3A6FA 3MRTA 2VP4A 5EMJA 4YDSA 3JVVA 4GKKB 1MPXA 2XMZA 2NADA 2XDAA 4ITVA 5G4KA 1SC3A 1I4TD 3L8ZA 4LJKA 2E5WA 3WIDA 3Q8LA 5IMSA 1G8GA 1E77A 2ZK7A 1I3NA 3PV0A 4BUZA 4QEDA 4RK4A 2G07A 1UOPA 2OILA 1TM3E 3HB7A 2EZTA 1Z62A 1P0FA 1LI4A 3ZWBA 1AIPA 2IU0A 2AE2A 3OCWA 1TU0A 1TVCA 4LWPA 1C7JA 1CEEA 2I71A 5YASA 4QLAA 1AN0A 1J2EA 1G0OA 4JCCA 4RPCA 1K7FB 2YX1A 3IH5A 4TPKA 1Z25A 4U7PB 5AK5A 5FD8A 2GETA 3A2MA 5FNVB 1UZAA 3FJ1A 2Q8PA 1UK8A 4C0XA 3WK5A 5EP3A 1UMBA 2CJFA 2DWOA 4X24A 1N2HA 3H9GA 1ZD2P 5SZJA 3K8ZA 1IATA 3T5TA 1KL7A 2P2SA 1DKQA 4GE3A 4UULA 5DSZA 1D2GA 2NPOA 3K5PA 4P5DA 5SICE 4C6RA 3ZLJA 5EIOA 1LDGA 3ZDAA 4PBSA 4BO1A 5FH9A 2VQFB 1LI5A 2ZIGA 2W8BB 3AKEA 2I6UA 3WRYC 4IWNA 4AKHA 3TJRA 4MRMB 2I2BA 2GZHA 3ICOA 1GNSA 3JD1A 4RHXA 3JPWA 2X7HA 1KQGA 5IYZF 3WDLA 3PKZA 3NHUA 3ICWA 4MDHA 5LJLA 4W7SA 1SXJA 4G1VA 3O38A 4X1YB 1J42A 1Z36A 2AOXA 2CYCA 3R6DA 4QAJA 1OMOA 2ZBUA 3MWYW 4QBIA 3CCBA 4H17A 2X9NA 4KXXA 2IHBA 1FRFS 2QNRA 3ROGA 1CR1A 1NP6A 4TWJA 1R3DA 1IAQA 2AKAB 1YJAA 4G0NA 3TFWA 3DEHA 4DXHA 4UOEA 3K9GA 5DNDA 1NUSA 1QGUB 3QLJA 2Q1TA 6YASA 1YJCA 4FW9A 1VQ1A 5ARDA 5LPNA 2WB2A 1E7RA 2LV8A 4PCAA 1BWPA 1I3KA 3B1XA 4B47A 3PNMA 4BLPA 3W34A 1JHPA 4MVJD 1NQ5A 4G3XA 4WACA 1EXNA 3HZOA 5LOVB 2JJYA 2H2GA 3CJQA 3MTEA 3QVGB 5EKTA 2PL1A 3F3SA 3I37X 3OSZA 5JFOA 3TS1A 4NFSA 3T0FA 2MSLA 5JXJA 3PR1A 2WWGA 1FL9A 1JMVA 3DLPX 3W3AD 4D3XA 1BC5A 2CJWA 3I30X 3KEQA 1N5LA 1U65A 3EF1A 1JHZA 2QN7A 2FMKA 3UUFA 1ZUD1 2BDTA 3UUEA 5H70A 4PPFA 4RVGA 3U7FB 4HBZA 1G8HA 4C2AA 4R1LA 4PCLA 2GNPA 1LBIA 4RPJA 1L5WA 1UM9B 2QZ9A 2OK8A 5KOJB 2RHTA 3QELA 4Y0NA 5BSEA 1PCXA 4RH1A 1N6PA 4WI1A 3N8HA 3GT7A 2IFTA 1ZD4A 2QT1A 3C45A 4MUYA 2P5TB 4M6WA 2ZBFA 4P38A 4D81A 3GFTA 1K5HA 2J3EA 4Y2PA 2XYHA 2Z1NA 4U2EA 3TGPA 4RF2A 4O4JB 4NK4A 4CTJA 3LLVA 4KVZA 1ENOA 4R16A 5TV2A 4AX4A 2XHZA 3GCXA 4YEDA 1OASA 3S4YA 1AMNA 4FDTA 2C92A 1CQWA 4KXYA 1W4ZA 4LK2A 1JEAA 5ALRA 1T2UA 3IQWA 3SM3A 4CKBB 3P9PA 3BFJA 1FS4A 2G6BA 4LRTB 4N5DA 4G0UA 1L5KA 3FOCA 4HUQA 2WA1A 1TK9A 3IJRA 3MELA 3MMPA 2XYPA 4N8SA 2X41A 1IONA 1TD9A 1T2AA 1ZRHA 2GN2A 2I29A 4ONEA 3WO1A 4BLUA 5KYKA 3AERB 3CUSA 3FNRA 5ILGA 3YASA 4N5NA 1H8ED 2O07A 4MKHA 2YFKA 3IUJA 5DYGA 5BOSB 4REMA 1C9JA 4IDFA 4C0QC 3WGYA 3D7SA 1BXRA 3SK0A 3OCZA 3EWIA 4NG5A 3O2QB 1Y3CE 2OCXA 4P93A 2ISQA 3R7WB 2C7RA 2WD8A 1KRXA 2JCYA 2ZWIA 1RNLA 2YS6A 3NM4A 3PJFA 4OB8A 5THKA 1SWVA 4K9MA 4CPDA 2D5AA 4IVNA 3VSEA 3J7AC 2CLLB 5ALDA 4JSRA 1LDYA 3NKVA 1TEHA 4NESA 1P1BA 3REFA 3A9CA 2Q29A 3KT0A 3KZCA 3VR3D 1R4MA 3K53A 2AXNA 2EG9A 4P3XA 1GLNA 3SYRA 5LYJA 6NULA 2PA3A 2Q07A 4RHTA 4H0CA 3GARA 2VHZA 2R44A 2RHJA 1KS9A 3U0BA 4JXKA 5JY1A 3NHBA 3ZWWA 4IF6A 4DABA 4CL0A 1ECCA 4AX8A 1KJWA 2JLXA 3SHTA 5JTUA 3THYA 1OIVA 3SHFA 1YR1A 2V7VA 3CINA 1RLTA 2AF4C 3T3PB 1H5NA 2A5DA 3OT1A 2LZ0A 2DPYA 3G9UA 1FDOA 3A3KA 4C7BA 4IV0A 1Z0AA 1CJVC 2X8JA 4TKMA 2Q50A 3MCZA 3MM4A 3OZBA 2V7EA 1Q1AA 3ZG6A 4U7TB 4B4VA 5DWDA 3W8RA 3EGDB 1RQ2A 2ZIWB 3IXLA 4LDJA 2X8JB 1LRJA 3EXFB 4PHFA 4EB6B 3EWNA 1JIIA 3JATA 2JGKA 1TC1A 1L6RA 5EJ5A 3GAAA 5FWNA 1M10A 3ND9A 5TQVA 2PVCA 1KI3A 3WGKA 5JYCA 1JRLA 2GH1A 5K3AA 1GDTA 3EPJA 4WX2B 1RCTE 3L1IA 3P32A 4K2HA 3FHOA 4EJ6A 5KBYA 2I66A 1N0WA 4ZALA 5JH7F 1FNDA 1Q1GA 3LI2A 1H5UA 1OX4B 1RWQA 1PAUA 2JAXA 2GCPA 5EHQA 2W93A 2B1RA 3GJ0A 2OC9A 5JSUA 3D7RA 3GGGA 3SX2A 5IM5A 1YZUA 3BXZA 1C1DA 1IXZA 1HFKA 3ZWQA 2YHAA 4P0QB 2WM8A 1H2EA 2A7XA 1YGYA 1OWMA 2YXDA 1N5RA 3AOEA 4LGCA 2Q5JA 3GLGA 4D0NA 2WWIA 4QGAA 2JI9A 3TTYA 4E2ZA 3BF8A 3DYIA 1G4UR 1AV7A 4GHWA 3S28A 3PTAA 2A3RA 2QUAA 2J67A 4ZDIA 1QRTA 3ONVA 3DOFA 2RHWA 3WFIA 5L7WA 3HJTA 3U9TA 5E38A 4LC1A 4K6GA 3AESA 5DP1A 1TRKA 5AT1A 1H0KA 3ZK9A 1Y89A 4EMBA 2B8EA 2OAQ1 4R31A 3I5AA 3IODA 4TLMB 3WSTA 1M66A 2XWQA 3BGSA 1TTPB 2HUPA 2JIOA 2ODWA 1F2DA 4ZI7B 3ZX5A 4WA7A 1RHKA 1Z2DA 2YV5A 2ICAA 2VRCA 2Q6KA 2HPAA 1W4LA 1Z0FA 4BV2A 3P0RA 5JPIA 4EAAA 5HP4A 4RE5A 3FMOB 4CMIB 1IWOA 3C3BA 3L7DA 4OBWA 4Z4QA 2FR0A 3WAJA 3KEFA 4H3VA 4UUQA 3FX2A 5BOVA 1JDTA 2YHIB 4K81B 1G7SA 4BVFA 2QZPA 3I23A 3QLVC 2QX8A 1QR6A 2P27A 3D7KA 3HYRA 4CMCA 5H4GA 4B5LA 1SK8A 1OOEA 3A4YA 4RH0A 2XKJE 3WGVA 3JQDA 4D5GA 1RI5A 2IPAB 4BMYA 1S3GA 4MYHA 5I7UA 5BN3A 3PA6A 1YVPA 4LJ5A 4M21A 5A1TA 1J8MF 1PEKE 1TECE 1YBVA 3ST7A 3C3AA 3Q9LA 4R8VA 2CLCX 4ND3A 1CG6A 1N2IA 3C1TA 2JI6A 2COUA 3AINA 5L4SA 4JODA 1GLVA 3CVUA 1W87A 3A32A 4QFDA 2QSUA 3L1HA 3RUPA 1YAHA 4E12A 1P60A 2G1JA 3CF4A 2Z3VA 4G5XA 4TM7A 5DX0A 4DDKA 3BT7A 4QQFA 4IG9A 1N1MA 1WKBA 3NGLA 4GGMX 4MX8A 3STWA 1OI4A 1Q0TA 1M1UA 4U0JA 2WAOA 4X7MA 1XZDA 4Y1FA 4IJ5A 2AJLI 4LTNA 2OXEA 4YK7A 2ZJ8A 4XJSA 5KDOA 1JDBC 3C3PA 2JFVA 1DL5A 1Z7EA 1JYEA 1TA9A 3COWA 3Q7TA 2Z8ZA 3MQFA 4J4BA 1R10A 4KXMA 2GD0A 1KFBB 2XNKA 4R8LA 4IDCA 5DHAA 2PKEA 1HLDA 4IEIA 2G5TA 2G70A 4J16A 1EUCA 5JS8A 1QCCA 2UZAA 2CDCA 4UM7A 4BQQA 2C3PA 2HRZA 4UFNA 3E1KA 3GJRA 3ETEA 4HQRA 4E22A 1U8TA 2BKUA 8ABPA 2ZSBA 1BRTA 1KU0A 3L4JA 1S8NA 1WTCA 5CK4A 3V7NA 3VH4A 4IJWA 2PZMA 4Q3OA 4HNSA 4L8FA 3PWTA 1U3WA 2QRVB 5K3DA 3B7WA 4Q9IA 4JKYA 3TQSA 4RIFA 4IINA 2O50A 3ZDCA 1E9RA 2ZUBA 3OY2A 3M34A 1Z8FA 2V7XA 1KDPA 1E2HA 2WUFA 4Q93A 4Q47A 4H1UA 1SXJD 3EF0A 1D07A 1W96A 3PIRA 3GGPA 2JZCA 1ENZA 5IASA 1QX3A 3D6VA 4CL2A 4JJGA 3Q2OA 2IUFA 1OVMA 3F5SA 2XE7A 2AFRA 4UVEA 4YUYA 5C1BA 1NRXA 2F59A 4MV4A 3F7NA 4F72A 3MWLA 4OU5A 1E63A 1G1AA 2DHRA 1Q5PA 2BEJA 4RPHA 2R5FA 4X60A 1HYQA 3FSGA 2ID9A 2ORIA 3RS8A 3T6KA 1JNXX 3MOSA 2VEOA 1DEOA 3OU2A 4IS3A 4PRKA 2P9QA 4Q3BA 4TWZA 2HSDA 4MW2A 1TRHA 1OFUA 1V7ZA 2R84A 3QXJA 2P5UA 4RKYA 4WZBB 2OFFA 3AVYA 1CUVA 2K87A 1ISFA 4GMFA 4YQYA 3ZWAA 4W8GA 3JTMA 1OAKA 4ZARA 1FU4A 1QB7A 3AEKA 1WOYA 4G8CA 1R37A 3OP4A 4NU0A 1G3MA 1LW7A 5AM3A 4FC7A 3E9NA 2ZWOA 4Y0AA 3BWVA 3KLBA 5I9NA 1OBVA 3PEFA 3OZRA 1FNSA 4G24A 5DLDA 4UD6A 3RYFA 4PIPA 2CNLA 1Z2CA 4RVCA 3RM3A 1FXUA 2KQUA 3KSMA 4L7QA 3OHMA 1DC4A 1UPUA 1XXLA 3K7EA 2GO1A 1Y1TA 2VP2A 5IAGA 3RUIA 5LZ2A 2QBYB 5E6UB 2B4RO 3OZIA 3RAEC 1AQLA 4O4HF 2PL9A 2P2YA 5C9ZA 4EVRA 3ORRA 1UMDA 2N46A 2IHVA 3P96A 4FXPA 4K6FA 4WK6A 2Q0SA 3IIJA 1K6JA 1T5IA 3B51X 1GZ4A 3D8BA 5GGYA 4K88A 4HUTA 9ABPA 5H59A 4X71A 3UO8B 4YRCA 3S1AB 1JYFA 5BN5B 3AEQB 3D6HA 4ON9A 3WGGA 1P0CA 1I9CA 1P7CA 2IIPA 1R0ZA 3DHNA 1RZUA 5C37A 1ZK3A 4F96A 1IB6A 1UKEA 1WZIA 2ODAA 1RM5A 2OENG 4WDQA 1J25A 1MZPA 1Z2EA 4HPXB 5CVEA 1XQWA 5DM1A 1ZH2A 1WY7A 3AY3A 1ISPA 4W1PA 1F1JA 1VJGA 3RHFA 3HI4A 3NWEA 3G23A 1NLUA 1CIVA 4PSKA 2YHIA 5D8DA 4OQNA 3ZWKA 1QBKC 3V5NA 3HDHA 2EIXA 4AP5A 3I2GA 4ZDJA 4QPDA 1SY7A 3I42A 2Y6VA 3KFLA 3EMBA 3WKEA 1C0LA 4BQEA 1MJ5A 1SURA 2WJHA 1ZN9A 4HLDA 2JBWA 1C9EA 1C3EA 1CP2A 1U8AA 3A3YA 4BKOA 2V4ZA 3ENVA 4A4DA 1QBGA 1GG9A 1KY5A 1JECA 1COZA 3N75A 1SCDA 4B34A 3GFOA 1OU0A 3QYJA 5HS4A 3THXA 1MJGM 4NEQA 1RRCA 4ZQHA 3FDIA 4DA0A 4DSOA 3HUUA 3KR1A 1DX4A 3NANA 4HNRA 1YR3A 3QLVA 3SR4A 1ZHHA 2H7XA 3S81A 2HNBA 3O31A 3ABIA 4RD1A 5IJ9A 1D9ZA 1V1MB 3B5IA 3CA8A 4S05A 3BMNB 2NU6A 2DHCA 1ORIA 2WJ3A 1INLA 1ZR4A 5AJWA 1T0UA 4J2HA 4LQDA 2YIJA 4XUCA 4X3PA 3HCBA 1E96A 1RM4A 4OB7A 521PA 4A92A 3BBLA 2AXQA 3HDJA 4QFMA 5T5QA 3LS2A 2EBWA 2ZCJA 1W88B 2EF0A 1BZYA 1EFKA 4ZKDA 3QFRA 2PD6A 3F6EX 1PSWA 4I4TB 2BCJQ 1VCNA 4BZXA 5BR1A 1DXOA 2BMEA 3AONB 2GKOA 1XNQB 2GT1A 3HVIA 3UN1A 1M74A 1L2TA 1SXJE 3K2QA 1QONA 3CC8A 3OETA 5FUXA 1U2QA 1WPXA 3WA6A 5IJ0A 1VLHA 2JEZA 4Q02A 5BSRA 3EK2A 1KPGA 3M1IA 2W8ZA 3ZW8A 2IQIA 1XV5A 2OCAA 4RGQA 4JA0A 5G4LA 1Y6JA 1SKYE 3UB4A 3QKIA 4RXTA 1PZGA 2VATA 2X2OA 2J30A 4KWCA 2V8BA 1JQBA 3KWMA 4FE7A 2EYQA 2HTFA 3DQQA 3F1LA 4MW4A 2B5OA 2EX4A 4NTZA 3SOZA 4LF6B 1QG6A 4RCZA 1U0JA 5D85A 4Z49A 1ZW6A 6Q21A 3C16C 2QTTA 3V7YA 3HO6A 4B81A 4MV9A 1SELA 4BNMA 1UM8A 3U2QA 3L84A 1FNCA 1PR4A 1JLRA 2JCBA 3WRYA 4IW3B 1KP9A 1XA4A 5AKYA 3HJAA 4YYEA 1GTJ1 1S2IA 3AXSA 2PK3A 3C97A 3PP8A 2E4YA 2QRUA 4QVIA 2PUGA 3AK4A 4J8PA 3IBSA 3RK4A 5E6RB 5LQRA 3KQLA 1MENA 1THZA 4PSVA 3RYHB 3V97A 1ODTC 1K6IA 3BGDA 9LDTA 1XHLA 3VBEA 3IEUA 1IM5A 3DHYA 4JVMA 3PXUA 5EZ6B 1EJ0A 5EEGA 5JNTA 4ZGWA 2A1TR 2DFTA 3BMQB 1JHQA 4WJZA 4B2LA 1IY9A 2REBA 5C51B 4KACA 3CG4A 4JVSB 3DB2A 1Y9ZA 4U7JA 4MRRA 3IKLA 1BYIA 4PYKA 5HYVA 2VUSA 3H5IA 3OZFA 4QFBA 4U7WA 4CEIB 1MEJA 2WF8A 2HYIC 1VFPA 2A9QA 4MITA 3E61A 4KR0A 2ZE7A 3FNGA 2ZI9A 3W5UA 1CW2B 4X8HA 1KYZA 1QOQB 1GKIA 4GT1A 4GMDA 2DEUA 3HCAA 1F2UB 1NOJA 1TW2A 1ZJZA 2DFNA 4YWHA 5JVDB 1A9RA 2AVNA 4KIGA 2R00C 1HDZA 2X0FA 1NR1A 3SR0A 1TF7A 1PZEA 5BN3B 1GR0A 2QQFA 4NYMQ 2XCOA 3ZWYA 4D3ZA 1V5WA 2W98A 3SMQA 2JHPA 4I2VA 2V9CA 3GX1A 5G0TA 1DKRA 4JBXA 5EZYB 3OPYB 1SEPA 3VJRA 3HU5A 1AXEA 4RJJA 2NSYA 3ROZA 1J1ZA 1QS0B 3HDYA 4AURA 1SVMA 2UUBB 2IX3A 5ALOA 5A4IS 3U9SA 1RWBA 3QF4B 3QVLA 4G5SA 4JLOA 2NT3A 4MRSA 4HGRA 1YH3A 4EFMA 4GC9A 4QWWA 3CH6A 3KBBA 1Q92A 3HCDA 3AC0A 2Q27A 1Q0SA 4WUVA 4MR8B 1V6SA 1MA3A 1V2GA 3PDHA 2YHSA 4X8MA 5EHGA 5T6MA 3NORA 4UNRA 4H6WA 3CEHA 1A3CA 4P53A 1GKUB 3SZGA 1AGNA 1EWYA 3NCHA 4WK0B 3AR5A 2YRWA 1JVBA 1EWKA 3LECA 3TRDA 3A6JA 1ZZEA 2BM1A 1RYYA 3VNVA 4BECA 1MFZA 3BGWA 5C1OA 3TDNA 4TTTS 1FYVA 1WHTA 2P1RA 2QQEA 1UIMA 2RH5A 4KXVA 2LXNA 4P22A 5AHRA 4MS3B 2H7CA 3VR5D 3THXB 1DOHA 5DM70 1H6BA 5ALTA 3WGTA 1YULA 2FUCA 3C3WA 3MLAA 5CVVA 3GVXA 4K1LA 3N0TA 3QOFA 1K7CA 4GOMD 3CNHA 4DVJA 3GMSA 1WXXA 1O95C 2OFOA 4FFMA 2WY2D 1M33A 3UAGA 1KXZA 4WXEA 3T7EA 4ZVOA 4PYOA 2Q62A 1G98A 3DBHA 4FD3A 5IUNC 3OA2A 4CKWA 3AIKA 3BEOA 1OXTA 4WKBA 3EAGA 5IAOA 3M3DA 1ZD8A 1VBMA 2R4QA 2V6IA 1KY4A 1E3QA 1Z75A 3HKEA 4X1KB 4YRJA 4UQLA 2XCTB 1CQPA 5GIPE 1SGWA 2GARA 3QOYA 2PO7A 3NHRA 1T5HX 1Z6YA 2PG3A 4YPOA 1JF8A 5AK3A 1XRPA 1O2DA 4GD3Q 4UHJA 5H3HA 1VMDA 8OHMA 5I45A 1GPJA 1LC0A 3R5SA 2GN1A 1TYZA 3PC6A 3RTCA 4XPIB 2WFLA 4KN6A 1I0IA 3DBVO 3KVYA 3PKJA 1RKUA 2ZJOA 4WESA 3VV2A 5CIWA 1IVSA 1IL0A 1R66A 3F6CA 2BAGA 4JNKA 3U17A 4OBBA 5JJ5A 3WTCA 3AF6A 1CVRA 2REOA 2VQ3A 5L3QA 3KB6A 2UXDB 4L6CA 4MUIA 3OEED 3AOGA 4E4RA 4ZTUB 1D2CA 2D7JA 4U63A 4HDMB 3W8EA 2PJZA 1KHTA 2Y76A 3NUQA 2J45A 2WSLA 3RK0A 3KL4A 1I01A 4M1ZA 1GAWA 3EQ7A 3UXMA 4AY5A 4C5BA 4PG8A 1Z17A 2E4WA 1RFGE 3B48A 2BW0A 1ZM9A 1BD3A 1NYRA 1AK2A 1M73E 1N8TA 3LYHA 1DC5A 5D7NA 2BELA 3NU1A 1X9GA 3SEFA 3DZKA 4ETWA 2Q0HA 4HS4A 4F2WA 4JY7A 5AJVB 5KTRA 1G20E 4GEGA 4EABA 2QAGA 2YXLA 3DP9A 3MJHA 3LLUA 2W90A 3I6IA 4UFPA 2WTUA 2F9FA 3A1TA 2NMVA 4LJLA 2FPWA 2YNMA 5E4FA 1L4BA 2WKRA 3UT5A 1Z4JA 3Q88A 2WU4A 2QRPA 3ABRB 4GP7A 3S8YA 3RARA 1D8AA 2AZTA 3GH3A 5ERYA 3G0OA 1E2DA 1KF0A 2EGUA 4TL9A 1OHHA 5FI3A 1JWLA 1Z5ZA 1RKQA 2DZDA 2WSYB 5CYGA 4GQIA 4NONA 3T54A 2B78A 2OHIA 3L8FA 1XTIA 3DH0A 1RZRD 1RRFA 1U7OA 3U3KA 2D59A 4BWYA 4DUGA 2IYSA 4QSHA 1Z7YA 5E1MA 1RADA 1BCRB 2CUZA 2IY8A 3OZEA 4NC9A 3W06A 3O82A 4BWVA 4R2HA 4YDQA 1E5QA 3DL4A 5ALMA 3PRHA 1GPDG 3L82B 3UB2A 1T3GA 4EH1A 1YVDA 3X2SA 2FRDC 4RQBA 5JD3A 4JCOA 4U7FA 1Y34E 5J2UA 1NBIA 3J81k 2C4TA 1HSZA 2ZJ2A 3PTZA 2Z4TA 4CKEA 3AJ9A 5C5DA 1Y6FA 4KW7A 1IEXA 3KYCB 4UZEA 4QT4A 1J0XO 4AI6A 4TL6A </