4V1CI

Sirtuin 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
251
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPYPEAIFELPFFFHNPKPFFTLAKELYPAKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 'Erasers' for Lysine Crotonylated Histone Marks Using a Chemical Proteomics Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 75
structure length 251
sequence length 272
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4v1cI02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4v1cI01
4JUBA 4BUZA 1PT9A 1YI0A 2JIBA 5EJ7A 2OD7A 3GLSA 4UU8A 4Q9DA 3RIYA 5BWLA 3HWWA 4BVHA 2H2HA 2OD9A 2H59A 4X3OA 5FYQA 4IG9A 1POWA 3FSJX 5EJ5A 4FVTA 2PGOA 3D4BA 2QQGA 4BVFA 2DJIA 4K9MA 4JUCA 4RJIA 1N0HA 1UPBA 3ZGVA 5EJ6A 4Y6OA 1V5GA 2EZTA 1PTJC 2Q5OA 3EYAA 1V5FA 4UTZA 3CLTD 5K3SA 1SZDA 4UTRA 2VK4A 4V1CI 2H2IA 2FSVC 5DGTA 2X7JA 1OVMA 4BV2A 5MFZA 4COKA 1U28C 5K2OA 1YC2A 1PI3A 2H4FA 2Q29A 5FEMA 4K9LA 2PANA 4ZP1A 1ZPDA 2JLAA 4F56A 3IAFA 2OORC 4L2IA 4K9OA 5MGNA 4TWJA 2A1TR 4GM4A 4QELA 3HWX1 3EA4A 1PO7A 3D81A 2UZ1A 3IAEA 2WVAA 5EJ9A 4UUAA 1S7GA 4R8MA 4JU8A 4QPZA 2BRUC 4TWIA 2JI7A 4JD5A 1EFVA 2FR8C 3CLSD 3F6EX 4RJJA 1M2JA 3CLRD 2NYRA 4D5EA 4GPEA 4FEGA 3F6BX 4GM0A 1YTLA 2Q5JA 4BN5A 2NXWA 4RMIA 4UU7A 2AG1A 3D7KA 1YC5A 1OZGA 3GLTA 2QQFA 1PNQA 1T9BA 2EZ9A 1BFDA 1U2DC 3CF4G 3JWPA 1OZHA 2FN3A 1YI1A 2VBFA 3K35A 4JUFA 1OZFA 1Q17A 4L3OA 1Y9DA 4V1CB 5MF6A 4GP9A 2AG0A 2Q5LA 4GM1A 4JUDX 4O8ZA 2FRDC 5EJ4A 2H4HA 4IF6A 5DGDA 1SZCA 4UTVA 3E9YA 1J8FA 4KXQA 1Z8NA 2Q27A 4GG1A 4BVEA 2Q5QA 3CLUD 1Q1AA 5IMSA 1UPAA 4JSRA 2H2DA 3U3DA 4ZZIA 1HZZC 3LQ1A 3EY9A 4JUAA 4K9KA 5AHKA 4BVGA 5EJAA 4JT8A 1S5PA 1V5EA 1QPBA 2H2FA 1T9AA 4C7BA 2H2GA 4X3PA 3JR3A 2EZ8A 2VK8A 2FWNA 1M2NA 2OD2A 5BWOA 4V1CA 4UTXA 1MCZA 1XLTC 4JT9A 4BN4A 3GLUA 1YHYA 2VBGA 1Q14A 2C31A 3PKIA 3FLMA 2HJHA 1YBHA 2Q28A 4I5IA 1MA3A 1PVDA 2VJYA 3OE1A 5EJMA 3U31A 1UPCA 2IHUA 5EJ8A 1Q6ZA 1M2HA 2UZ1B 3GLRA 1U31A 4FEEA 2JI6A 1YHZA 4MZXA 2PGNA 2V3WA 3ZGOA 1O97D 4RMHA 4K9QA 4RMGA 2JLCA 4QQ8A 1JSCA 1O96B 4HD8A 4G1CA 4MPRA 4D5GA 5K6RA 3PDHA 2OO5C 4IAOA 4J16C 4UUBA 2JI9A 4KGDA 2EZUA 4K9NA 5D7NA 2VK1A 1T9CA 1D4OA 2EZ4A 4RJKA 4HDAA 1T9DA 4K9PA 4MPJA 4JU9A 1PNOA 2WVGA 4RMJA 3FZNA 3PKJA 5DEIA 5MFPA 5K6TA 1NM5C 4BV3A 4FZ3A 2WVHA 4J1TC 4UTNA 4BVBA 4C78A 1EFPA 1U2GC 2JI8A 5BWNA 2B4YA 4Y6LA 2IHTA 4MPPA 3ZG6A 1E3TA 1M2GA 1DJLA 1POXA 4MQ5A 4F4UA 3RIGA 4Y6QA 2W93A 2VBIA 1ICIA 1PYDA 4KPUA 1YNOA 1M2KA 2A1UA 2IHVA 2H4JA
chains in the Genus database with same CATH superfamily
1M6VB 1TCAA 4NZYA 2K7FA 4D6PA 1T4CB 4ACAA 3BD9A 2R85A 5KU7A 1O57A 3GCXA 4JB8A 1SKUA 1XQ9A 1DAMA 2ETVA 3BOSA 3CVWA 2W4MA 3QXHA 1H6DA 4RM3A 4BVAA 2GN9A 2PZAA 5K1ZA 3W3AA 3MINB 4Z4EA 5FV4A 1PF7E 4O4IF 1H66A 2XBMA 4R3UC 4EBBA 3H5RA 4NH4A 1NOJA 2ZGVA 3G13A 1TFUA 3G2IA 4LYJA 3ZUGA 3ROFA 5K3BA 2BKUA 1OH5A 2R65A 4RJLA 2GO1A 5JMTA 1IHXA 2B7CA 4UFOA 1ENZA 1QRDA 2FWPA 4OD0A 3HQ4O 4WI1A 4TTRA 1I4DD 4I46A 4I0WB 2I33A 4L2IA 4NYIR 1U0FA 2AN3A 3CGGA 2POCA 2DWUA 3EOBI 4DT1A 1NW9B 2IPOA 4OXNA 5KQPA 5I9MA 1N8NA 2VJLA 3C8DA 3S0JA 2YDXA 1S8NA 2CV1A 4GMGA 4YJ3A 1W5EA 1E2UA 3OF5A 4CN8A 4BKPA 2NADA 5C53B 3PR3A 4LEIA 4KWEA 2FEKA 1JJIA 4P83A 4WK6A 2VJBA 1HT1E 4QAQA 4NYJR 1XF9A 3AX6A 1EMDA 1XTVA 2BFMA 2R6ZA 4MUBA 4RVUA 4YJ3F 4KIGA 1QX4A 4A26A 4C9BA 1R5BA 1R4NA 4TROA 3U09A 1J49A 1O94A 3LD9A 1ML3A 4IOMA 3Q7RA 2VWHA 3IDFA 2Z9DA 3EPRA 1HE1C 5JXHA 5LOVF 2X0KA 1YRWA 3EVDA 3QQPA 1MO4A 3DCIA 3DBRB 1XXHE 3IJRA 1HWYA 3I6BA 1W9MA 7MDHA 2DPXA 5CDFE 3VR2A 3NVKI 1TKAA 4MROA 5J5AA 3EFBA 3U3DA 1JEYB 3PXBA 4QUIA 3VU1A 2WWXA 3MCAA 4C7OA 1TC2A 1YF3A 2Q41A 3JZMA 3VPDA 8LDHA 1BKYA 3ZLUA 5KDDA 1Y9JA 4MQFA 1RFGE 5AW2A 1NZFA 3ND6A 3WV5A 4ETIA 3NM6B 4QGSA 2IIBA 4L0DA 4KTTE 1VRWA 5IWCA 3TSZA 2ZRDA 3TLGB 1RBQA 2FFRA 4UMDA 4DF3A 2ATIA 2CHUA 3WDSA 1QIDA 3MJVA 3RU2A 4CODB 4R3WA 5A0VA 1E5TA 4JBWA 2JZNA 3X1XA 4HZGA 2PUTA 3T7EA 1BE6A 1T2AA 2UZIR 4JI5B 4DSNA 4LRQA 4IICA 1BWRA 1I0ZA 3S8YA 2HRZA 3ZBUA 1L7NA 3G7UA 4EW1A 2XRZA 3MWKA 4J9VA 4YRGA 1MAUA 1CQPA 1T5DX 3LCJA 1P3Y1 1MEEA 2CMKA 1R18A 3MTIA 4DJDC 3W9BA 3ZLVA 3QVVA 2C42A 3LT1A 4H6WA 5C32A 1GTJ1 1C81A 4QVKA 3RARA 4XJVA 3FVQA 4UE3S 4ZJZA 3NTUA 1EFCA 4AMYA 3QA3E 4B2IA 4XGRA 1LRJA 2V6FA 1RZ3A 2E48A 2V98A 1DHRA 3H18A 4L5YA 5JIBA 2HA2A 1EZZA 3I4LA 4ZYVA 1GPWB 4BMNA 4FMPA 3CUKA 4TQAA 3EQ8A 1EA5A 3N3BC 2ZPUA 2YCLA 4WBSA 1Z5PA 1Y34E 4BMYA 5FTLA 5E2BA 3CNQS 4GYKA 5D51S 2Q6OA 3CJQA 4FS3A 2NU9B 3VYUB 2VJPA 3G6KA 3SE7A 5AKIA 3DMTC 1EWQA 4FR2A 4TSFA 4WKBA 3SXPA 3A9CA 3RK1A 3FOBA 4IXTA 4D4LA 3ROQA 4Y9TA 3VZDA 4D81A 5ALSA 3VU0A 3BDAA 1IPFA 1KQOA 2OCBA 1CP2A 2Q2QA 3IAM1 4P4NA 1G98A 1FUUA 1N0UA 5IZCA 3OQMA 1TVKA 2BFPA 4IYJA 1NY5A 4N9QA 1K8YB 1TXGA 4OU4A 4UUQA 3I61A 1B2LA 4X95A 4Q9HA 3E84A 4J43A 4B76A 1X80A 4FKZA 3E61A 3R7WA 5DHAA 2D2IA 3KKQA 3T54A 3LZCA 4LECA 1C14A 4YECA 5JJLA 3VR5D 4MDEA 1A1SA 4JX9A 4LOJA 1QGED 2R6JA 3O8OB 3GJXC 4RELA 4WW0A 4YI3A 1IBCA 3B8HA 2C5EA 3O90A 4UPDA 1MTZA 4PINA 1FBTA 5KTRA 3G9QA 1YKGA 1OAOA 2CLSA 4F1KA 3S8EA 4GR5A 2CSUA 3A36A 2HZ7A 5L6MB 1NJ5A 4QBIA 1DX9A 1MVNA 5J2TF 1YC5A 1U2SA 4PQYA 1NSYA 2QT0A 2X0NA 3P9PA 3MRSA 4KUGA 4L3OA 2C9DA 3C3YA 2HRQA 4GM1A 5A4AA 2E1PA 1QYWA 1SA0A 3A04A 1IBRA 5BWCA 4BZZA 3AETB 1A8HA 1Q84A 1QCDA 3KT3A 2GAFA 4WBNB 4MGEA 1R4MA 3ECSA 4LGMA 2NSYA 4FXOA 3G1WA 3WZ2A 3CH5A 3OOYA 1FX0B 1UMCA 4XGQA 1QJCA 3A58B 1HO3A 3A1VA 3DTVA 1J7KA 1DRUA 2ZAMA 3UVEA 2EZ8A 4AP5A 2PX5A 1E4YA 4CLDA 3L0IB 1XZIA 4ZC8A 3KR2A 4X44A 4A36A 2J67A 3LUCA 2VHCA 1X15A 1ULSA 5FQNA 2YIDA 5K01A 1VKZA 3LT0A 5CITA 3IUSA 2G4VA 4LF4B 1DPGA 1P7CA 4FBMA 1J0XO 1U8YA 4K6FA 2Q4DA 5DTJA 3V8VA 1SM4A 4MWEA 2XWBF 3KTAA 5TF0A 3EVEA 1VKHA 3F5SA 2C04A 2JFHA 2EYUA 5D3ZA 2F8TA 1JHPA 1OX5A 2JFXA 3IP1A 3K6KA 1EGMB 2FVXA 2G88A 4IOJA 4LPSA 4LTNA 4PZUA 4Q47A 1SXQA 4AN4A 1C29B 1XZHA 3BF7A 4NV0A 1ODTC 1TF2A 3GLGE 1HE2A 2IA5A 1XI2A 2Z4RA 3U1TA 3Q8MA 4S1WA 2GPBA 2FFBA 2FZLA 1B26A 2ZSKA 3P19A 3RKSA 1R9GA 5YASA 4RYLA 3T7CA 1TX4B 3P0IA 4E09A 1PZGA 4D96A 5C8YA 1FDOA 1E1QA 2GXQA 5JEDA 3ND9A 1JHYA 1E2JA 1SUPA 3ENZA 1F2DA 4IL5A 3A4LA 2W93A 3OJFA 4B3BA 4KQJA 2QZPA 2QPAA 2XECA 1K7CA 1SA0B 4ISBA 4YJFA 2Q50A 1N25A 3K9LA 4G0UA 1G6HA 3U19A 3TXXA 1DO2A 5TVGA 2CLLB 2XGJA 1X80B 3KAPA 1SOMA 4D7AA 1LLQA 5FEUA 1JH9A 2JCYA 3ONFA 5EQDA 4EKDA 4ZARA 2P77A 2OD9A 2OR3A 1P3JA 1ODFA 2DPHA 4M0FA 4O5AA 4ER3A 1JB1A 1HC7A 4Z6KA 1KDOA 3O9MA 4F5ZA 4LZAA 5BORA 2YV4A 1Q22A 1Q3TA 1WP4A 3HFSA 4D8UA 3K32A 1XRSB 3P4UA 4GBJA 4JGBA 3ZZMA 4PXAA 2KPOA 4PTYA 3EULA 4DEVA 3ONWA 4MRPA 2RH9B 2G3YA 3FZQA 1ZZEA 3O93A 3NBYC 1FQOA 5B55A 3A26A 4V02A 2B5WA 4URFA 3GGCA 1NRWA 4RVFA 3A3KA 4R0VA 1CIPA 1OPXA 4UBOA 3WLOA 4B7AA 4OI0A 1S7GA 2F1HA 3IBFA 3OMWA 4JLPA 5DHTA 4L1KA 1I1OA 2PT6A 4US0R 2IV3A 4ZDIA 2HPZA 1E2GA 2AE1A 1LBQA 2DF8A 3L4SO 4MPDA 3LVFO 4BQFA 2IYUA 2VDPB 2XEXA 3BIOA 1TPZA 3HB7A 4JB0A 4PYRA 2OG1A 1JHUA 3KKPA 2D2XA 1DC8A 1V3QE 3Q7EA 1NW5A 1EX7A 1HI9A 1TMOA 2NU6B 3K53A 4Q39A 3T3DA 3UCXA 3ZHOA 4AKEA 2YDYA 2P69A 3ICPA 2FY8A 1RZRA 5FD8A 2R4UA 1EHYA 1VL2A 4UUMA 4AL4A 3OPMA 4JQYA 4N01A 1QQ5A 4QATA 4XDHA 4RCVA 3LYLA 5CT9A 4BUJA 1KERA 4GR9A 4CMAA 3TG2A 2BFDA 4DMHA 4X62B 3KEOA 3I5XA 2D0PB 3QFCA 5A3QA 2EIHA 4QARA 4BMXA 4EAAA 5CEFA 3UCEA 3FLEA 3WYNA 4BJHB 4P7JA 5AHWA 4EGAA 4WBNA 3ILVA 3LPAA 1ZRSA 3AF4A 3P5SA 1S2GA 2C2KA 4CIDA 3BCHA 3LRTA 1IM2A 1H0SA 5FWXB 3PT9A 3BL6A 5CEEA 2VK8A 1DXOA 5H81A 1U2QA 1ITZA 4H3VA 1WNFA 2W8BA 3F96A 3A6PC 3NB0A 4E14A 3HDYA 4CG2A 2VQDA 4EB6A 5IJ9B 3ADCA 2ZRCA 4TKZA 3R0JA 5I45A 1U2GA 1JQDA 1BEEA 1I7LA 2HBYA 2YV3A 4O6VA 5JI2E 4CEIB 3MRTA 2NSHA 2PG3A 3IE1A 2IEDA 2CEKA 2EEPA 3OMLA 2CHVA 4WEOA 2ZRKA 1KEEB 3DAYA 3QENA 1V16B 3LRPA 3CR8A 1RABA 1OROA 3PKZA 4LVOA 3T3IA 1VGVA 2VPWA 4J0CA 3GCWA 3OY2A 3I6YA 4JI7B 1AS0A 3UICA 1G3RA 3ND8A 3B36A 3H8JA 4YJGA 3FMOB 1R66A 2I4MA 3KC2A 1NF2A 1R7RA 4IRMA 4FLFA 1L8AA 1EIZA 2XVXA 4W5JA 2G9ZA 2O57A 1OBOA 3FDZA 4N54A 4XGKA 4UU1A 1XT6A 4NMHA 3S5UA 5A5VA 1U2GC 3F8TA 4LJ6A 3KTFA 4AY4A 2H92A 2FZVA 1VG0B 3HA5A 3QPCA 4OXRA 5AXCA 4KW7A 2G7ZA 2J48A 5LIRA 1WX1A 1ZZGA 4M0UA 3QEMA 1HX7A 2I3GA 4ECAA 1NDQA 4WCFA 4NAUA 2OXTA 2ZIAA 1M1XB 3RQSA 3E2IA 4J91A 5FDFA 4G5RA 4OM8A 3AF6A 2PSSA 3G0HA 3N1UA 4MRAA 1CY2A 2IBSA 3V2GA 2EAUA 4FDUA 3EGOA 4NCIA 1Z0IA 1GZSA 1HPLA 4X3OA 1W52X 3KYBA 3O26A 5HQ3B 3I62A 5ITWA 1QLWA 1VLLA 3A4NA 4ZGWA 3LHKA 4EW6A 2E7ZA 2V7WA 4NS1A 2Q5FA 4BNLA 2E85A 1JDPA 2HO5A 5AUQA 1SUIA 2OP0A 2RHCA 2ZVQX 4R1SA 4E13A 4TMKA 2X7HA 3HA2A 1EXDA 4AI6A 3RSZA 1K5HA 1UDRA 4DCSA 2F55A 1V9SA 3DYVA 2CFRA 1Y81A 2H06A 3D6TB 5EE9A 2V3VA 5BUQA 4TMXA 1AGPA 1R8XA 2OL4A 1K98A 2DY1A 3LPNA 3WGZA 4DEYA 2XMDA 1JG4A 3L7KA 3LBAA 4H08A 1B0AA 4Y6SA 3VC7A 1FMLA 4F60A 2GM3A 4RDCA 5K0CA 4OQ4A 1UJ5A 2F43B 3B2EA 1NBIA 2ALJA 4BEVA 2QTZA 3VR4H 5TIIA 4NMXB 2Y67A 3HJCA 4C14A 5HVNA 2B61A 3ZE7A 3K71B 1XLVA 3FROA 4Q6WA 4O3FA 4B6SA 4ZCRA 1B4DA 1CHNA 1NPTO 4ZYWA 2GBLC 1YTLA 4KAAA 1TIKA 1X39A 4NULA 4DAOA 5B5SA 2BBTA 6Q21A 2Q6VA 1CQJA 2J08A 1WQ3A 3L4BC 5BYAA 1OXXK 2Z4SA 4PHFA 1AN0A 3HWRA 4I9FA 5C5CA 1ULTA 1MX5A 2NTJA 4DNPA 1X19A 2P68A 5JS6A 2GZSA 2OZPA 4RANA 4RSMA 4EF5A 3QE9Y 5KVSA 1TM1E 3TLEA 1J5EB 2QJWA 3GVHA 3G2MA 1DBVO 1DWOA 1GG2A 5EWLA 2XSZD 4FYYA 2B34A 1SURA 3CZ9A 1PJ4A 5K0LA 4ZQEA 1I13A 5A9SA 2Y77A 4XCVA 3QUAA 3NT5A 1IQUA 3TLBA 4FQ8A 4BLRA 3FCAA 2HY7A 3U4IA 1T1JA 4FYIA 1HDIA 2Y0CA 3OX3A 4L3WA 1CP3A 5AD1A 1S96A 2ZT7A 3U26A 3ORYA 2F9MA 2V4UA 3F97A 1BE0A 1GFWA 4X94A 4LFAB 4KN9S 1YBAA 4F06A 4MQLA 4HNUA 1K9VF 3R9KA 1ZK4A 4NABA 1JVSA 5IYZB 3AEQA 1CEXA 2EFHB 3QUBA 1E7WA 4EWLA 1N2OA 3RC9A 3K4HA 1W9HA 3LX5A 1R16A 1NRIA 2WUEA 2PUWA 3FHOA 4H4DA 2EZ4A 4L8YA 3V1TC 2W6ZA 3H4TA 2J6HA 2VQ3A 5TQVA 3KE8A 3BJEA 1J2JA 1JYFA 4FW8A 2FDCA 1YQWA 5BWMA 1JR6A 3UH0A 1P62B 3KT6A 5CNMA 521PA 3A6EA 1PFWA 3OLYA 1AGXA 1NG9A 4PIVA 2GO7A 2JCXA 4NTZA 3I04M 5CA1A 4MVJF 1FFBA 4R69A 3C24A 1H6AA 4OTZA 1M75A 5ALVA 3KWLA 2DHQA 2R8XA 2WIGA 3G7SA 3F8WA 2P9FA 1RWKA 1JR3A 1B43A 2OB1A 1V3UA 4JI6B 3MTQA 4YRJA 3SYRA 4F6RB 4ENVA 5F2KA 2A59A 4MYRA 3PNSA 2AI1A 3LVQE 1KK2A 5LP1A 2WKQA 4CMEC 3MBOA 1J0BA 1ZJJA 5DI3B 2BMFA 5TPZA 3RVKA 4P3PA 2BE7A 1ML4A 3FI0A 4GKBA 1TK2A 5B1IA 3RFXA 4JC0A 2ZPAA 2W2LD 1UP4A 1BQ3A 2IXBA 4QOSA 1JIVA 1BD4A 2Z2XA 5CDGA 4FFNA 3PEWA 1BN6A 4C03A 1V5GA 4POAA 4JP1A 3TR0A 1UT5A 4Y0VA 1I3KA 3OT5A 3CQ9A 2VQFB 3G0BA 2HV8A 3HEAA 3MJEA 3O0TA 4FOLA 1JEQA 2I3DA 4O1IA 1ZPDA 1NLUA 3ZQKA 3AZPA 4LK2A 2F8SA 2G07A 1RAIA 2ZKLA 1L7RA 4R2JA 3EAQA 5MGBA 2WA1A 5KWSA 3CM0A 4NMWA 1W94A 2IYAA 4N47A 3EAFA 3ICOA 2XDWA 4KXWA 3WVNA 2HJSA 1N75A 5AVKA 1HLFA 3KP1A 1LTKA 4AMVA 1U0OC 1IRXA 3AR7A 3UFXB 3R9XA 4GX1A 4N6GA 4I2NA 4W6QA 5B37A 3RAJA 5BVGA 2TMGA 1UT6A 2IYTA 4UU7A 1FYFA 3ACBA 3OEYA 1ZLYA 3GLTA 2N46A 3L7BA 3QKIA 4G0WA 3CF4G 3JYPA 1JR4A 2I7XA 4M49A 3TWOA 3UUEA 4WXYB 1FP7A 2HA6A 5JTTA 2B37A 5CVTA 8ADHA 4LPKA 1NW7A 2J0UB 1PFUA 2REQA 2F00A 2ZOSA 3BYZA 3DAPA 3PSHA 2R00C 4TWBA 4C0JA 1XVAA 3QV1A 4V0KA 1DC4A 421PA 5LJIA 2PUBA 1GPLA 1UK6A 3M6UA 3DVAB 3SQMA 1UFRA 4BZXA 3RVLA 1WXIA 1OE0A 2YZNA 5ANRB 5IAEA 1KFCB 4CV2A 1CK4A 3EN0A 5BXYA 2HHHB 2IDJA 2IS2A 2ODAA 2P3SA 2VYQA 4UC0A 2MSDB 2NOAA 2GCOA 3G9UA 1W5SA 2PUVA 3VYRB 1W47A 2IXDA 1P73A 2X5KO 3B7WA 3IUEA 3K6RA 3HKBA 3L3BA 3L8GA 1OC4A 3J7TA 5DLEA 2EFCB 5THXA 2CXHA 1G9SA 1M0SA 2A58A 1FXWF 1E5QA 2FMUA 2OFFA 1AUPA 3WRYA 5AT1A 4BFYA 3CT6A 1KR2A 5K4AA 3A3PA 1YMQA 4NZNA 2PH1A 5DNAA 3RS7A 2NXEA 3OIDA 4M3NA 3ZU6A 1G0NA 1G2PA 1SH7A 3E9EA 3K5IA 4NE9A 4DLZA 2CF5A 4FYPA 1DC6A 2FE1A 4MCHA 4IHJB 1W36B 2R79A 1HLPA 1L5YA 1RXYA 3RS5A 2WHPA 3IIEA 1HM5A 2V54A 3B1ZA 3SEFA 2IC5A 3ZLBA 3GFTA 4FHDA 6CHYA 3BH7A 3QPVA 4F2WA 4LXYA 2OV6A 2FWAA 2Q0HA 2P2SA 3HVHA 4IM7A 2FMXA 1QBGA 1QGZA 5ELLA 1CUAA 1N4DA 5KX5A 1T13A 1U2RA 2BM0A 4D99A 4MDFA 1VJCA 2HQRA 3R5TA 2Q2OA 3VO9A 1E3IA 3N70A 5CX1B 1V8BA 3DUFA 5FH9A 4U5QA 1U8FO 2JNWA 4YRIA 1VCOA 3GI1A 2NO5A 5D5HA 3SSNA 4U7FA 4DCJA 1Z15A 2IXEA 2LNDA 3BXFA 3EODA 4JEUA 4KIWA 3WGTA 1U4NA 2ADMA 2ODTX 3L02A 4H4EA 4A03A 2O8DA 4FYJA 4QO7A 4CFYA 3E48A 4DR6B 5SV2A 3KVNA 1A4UA 2GBIA 3EFOB 2NTVA 3WWYA 1ECCA 3Q0EA 5KNLA 1G5RA 3KBBA 4BVFA 1B2RA 2FTKE 1Y42X 3F71A 4CF5A 4FT2A 2ZYAA 1EP3B 3SICE 2Q99A 4LSZA 4UPEA 1V5FA 1UKEA 1PR5A 2GPWA 1JJBA 4HDMB 1ZCAA 4OMCA 3JX9A 3VRHA 1OFGA 4TVBA 5ALFA 1UMDB 1Y6QA 2G1PA 1XK7A 3IRVA 3PE4A 1IOWA 2VPZA 1ADFA 1FNMA 4P2GA 4QDOA 1U6IA 1Z88A 3BTSA 1B6RA 1G9TA 1WG8A 2V96A 3HUTA 3PCXA 3ZV7A 7ADHA 1ZO8A 3FRIA 1N77A 2PKEA 4NLLA 2HGSA 4XIYA 3AVUA 3ROMA 4DB2A 2RK3A 1FFCA 3LLMA 3VYVA 2BGUA 1ZESA 1DBQA 1GAXA 3A1NA 5TGZA 2YV5A 4JYCA 2RHTA 1NVTA 4AJIA 1MHTA 3UG7A 2UXBB 1XZQA 5LP6A 3UMRA 3IMFA 4ALMA 1XUOA 2HWKA 4JGIA 3UMYA 4RKQA 4EB3A 2GRJA 5BNFA 3AZOA 2FOLA 1VLMA 4KQMA 3EQZA 5EPOA 4V0LA 1ZXLA 4FE3A 4B3HA 2P5SA 3WK8A 4LGCA 1GCGA 4IF6A 1HE3A 1MO3A 3MT8A 3H5OA 4QJ4A 4TTIA 2IQIA 3NHZA 4NV3A 5EJFA 3RUAA 3WV4A 1NVGA 4AF6A 4B3SB 3NNDA 4RF5A 2HQSA 4YK7A 3W2IA 4HH0A 2FPGA 2QL6A 2F1OA 5E9WA 4BTVA 4DY4A 4PN3A 3TECE 1TO1E 1JFFA 1XC7A 4IJMA 3WNZA 4D74A 1SKBA 3ICCA 2YIJA 3LT5A 4Q48A 3QI2A 5G1OA 3MB5A 2E4AA 4GP6A 3LE8A 4FGLA 1PEKE 1N3YA 3E5HA 3PPXA 3SYLA 3B3AA 1JJVA 1EJ6A 2ZYIA 4IUDS 3EXFB 4FW9A 2H29A 2QWXA 4CMEA 1SVOA 4CUZA 4N7JA 4K40A 4B71A 3SXUA 2QRUA 1T2NA 4FUTA 4PZPA 5E6RB 3SYKA 4DTCA 2G76A 3R4CA 4O2AB 3VR6D 4OBEA 1ZMBA 2BTEA 1VCHA 1QV7A 1AUXA 3IOBA 4LJ9A 1GV0A 1E58A 1XZBA 4O1HA 4V0RA 4EB6B 2JCSA 3W90A 2O8VA 4TWZA 4U8GA 3RYCA 3HYLA 1IUKA 1FOEB 3JWGA 1QZXA 1F8YA 2JI9A 5I8WA 3RLIA 3E22A 3NDJA 3PYMA 1D5CA 3BM5A 1KH2A 2JEZA 1RRVA 5H16A 3HVRA 2PQMA 4AWBA 1H3NA 1JG2A 2HRCA 1XTUA 3FZNA 1YJ5A 1D4ZA 1Q0PA 1W85B 3RG2A 3SQWA 4EA6A 2AEJA 3EQ6A 4L6IA 5EHQA 5BUZA 4FM9A 1IOZA 1F0NA 1IDOA 2BMVA 2PRSA 3HZZA 3UNXA 5DVZA 4XLZA 3O6VA 1E1DA 1XTIA 3CF4A 1J2RA 3DOHA 4K28A 5D7BA 5I6DA 4ZTUB 1EM8B 2FGKA 1CJCA 1RTTA 3P9QA 1LUAA 1XRJA 2QDKA 4RETA 1HG1A 5F5XA 3RIEA 3VZRA 3ADBA 2D8AA 1P5RA 5KSZA 2X77A 3HLTA 3SDSA 3RIYA 4A9AA 3Q8KA 2QDXA 4ZOLF 1EG2A 1Q77A 1EDDA 2NQ8A 1HH4A 1ULZA 2G9UA 1GTZA 2OHIA 3C6BA 3GAAA 1O3YA 4HAXA 4EYOA 2OO5A 3AERB 4GZ5A 4F86A 3MWJA 4L5IA 3HBLA 2YJ3A 4JJAA 1BX0A 2P6OA 2R9VA 4RPIA 3UMBA 2IZZA 4FP9A 4JZKA 3V2IA 5DP1A 4XVCA 3FRJA 1PW7A 3RWMB 3UW1A 3N8IA 1T36B 1XD2A 3DDNA 2WHQA 3DV2A 3GD7A 3H8WA 4EENA 1VIDA 2H4FA 2Z4TA 3W77A 2FN8A 3LUHA 4FHZA 3FNBA 1L6IA 5EFOA 4AJLA 4DDMA 2FW7A 5A7GA 5HKKA 2AQIA 1Q95A 4N0PA 1FPMA 1ONSA 1QC5A 2JAHA 4BO8A 3ZHXA 3AYXB 4QOGA 5G0WA 3VPXA 2HRRA 3QEKA 4PSDA 4W5TA 3PDWA 4P54A 2JKVA 3T4EA 1C9NA 1V8DA 4M0MA 1J9EA 5FHQA 3DE5X 4BQQA 2CHEA 1IB6A 4AROA 4QGGA 1USWA 1XALA 4XM2A 3RSCA 3VV2A 1N7JA 3PE3A 3NUGA 1SHJA 1TYDE 2ZRLA 2J0EA 4B3IA 4DNQA 1MO6A 1WMEA 3DR5A 4F1WA 1FIUA 3D4NA 1RZRD 2VOJA 5HF8A 4LZOA 5IDWA 5DASA 3B51X 3NJ4A 4HSGA 4E21A 5IX8A 2EATA 2W2KB 2IEAA 3EFEA 1GJRA 1XEWX 3NIGB 4YAEA 5C8YB 5C1OA 4GSLA 3IT2A 4H0NA 1WNTA 1UF9A 1T4BA 3OIWA 3RC1A 3REQB 1PVVA 5HRUA 3B9RA 2H2DA 1I2ZA 1QF9A 4NSNA 1L5GB 3SN6A 1C1YA 2HIAA 4FHCA 4GH5A 3BZUA 3H99A 2O5RA 1U3TA 4OXYA 4CM8B 5AM2A 2R48A 2H31A 1U1IA 4IDHA 4S3MA 5B3AA 5HCUA 1CVRA 1GT6A 1KP9A 3F2IA 3CEPB 4RE6A 3PXCX 1YS6A 4YB8A 1U0JA 3DVSX 5GWXA 3Q7TA 3UJ7A 1E1YA 1P0IA 1GNVA 1PVDA 2UUAB 4E2YA 5AJHA 4LSGA 2XBLA 2YRWA 4W63A 1MIOA 5IP5A 5ESDA 1CR4A 3WADA 4JI0B 4IOKA 5ICMA 3E3LA 2XOXA 3TR5A 3ZCTA 2Z8XA 4G1CA 3PUZA 4QUJA 1XPJA 4PAWA 1CNFA 4H35A 3TUZC 2NYVA 1Q7TA 1U8EA 1XPOA 2AC2A 4UARA 4MCIA 3GJ6A 1RT9A 2IU6A 1ND5A 3KVRA 3NETA 3OPYB 5IDVA 1T5OA 3DV9A 5EXEA 1MFZA 4OXQA 4MMXB 4CKYA 3FPCA 2I2DA 5LZ5A 2CKDA 2MYNA 4DCCA 5K09A 3TF5A 1ZKDA 5JWHA 4NJOA 1AUVA 1OU0A 1Y9ZA 2CBZA 4C2AA 3EC1A 5P8WA 4ZZ1A 2C07A 3ZG6A 2VSQA 4EH1A 4MVJH 2Q1YA 4YMSA 1JIIA 1O8CA 3RS0A 5DLDA 4F4UA 4Z7OB 2QUZA 3OZWA 2Y6VA 4G5SA 1AIPA 1YDGA 4OXIA 1O6GA 3VHLB 1US8B 3HVIA 3AY7A 4J4HA 2B21A 1LLDA 1CR2A 4QTTB 4YR9A 4PZ9A 4YRPA 4MLZA 1A4XA 2VLIA 1PJ3A 3LDUA 2HU8A 3I6ZA 3L93A 2QJOA 1ZNYA 3OOSA 2ZJ4A 1GGMA 2BT4A 2AN5A 3WMRA 2DP4E 4HRAA 3GA0A 2VYNA 5JFGA 5FNVB 2QX4A 3QG1A 4N8DA 5IKPA 1N9KA 4YEDA 3JVVA 2YWRA 1TZKA 1M66A 2MCFA 3C4JA 4HUJA 1AB5A 3Q5GA 4XVUA 1KBOA 4PY2A 3D7LA 1EE1A 2CXXA 3KB1A 3DZBA 4N76A 1NUTA 5HIMA 3ENQA 2APJA 3BHIA 3SAJA 3EF0A 4G0PA 1BMTA 2P3QA 2RGXA 4J2TA 1AZWA 2FPUA 1I2CA 1JLMA 1LVUA 3F9RA 3R3XA 4BKUA 5JNTA 3T5MA 4L4ZA 4X60A 4GT1A 4ZVVA 1EK0A 1FFAA 2P6NA 4X66B 1TQHA 3EIXA 4TWIA 1BCRB 1GNTA 2BONA 2HRBA 2X8BA 2VO1A 2HA7A 3K0CC 2GKGA 3NEPX 2NPIA 3T34A 4AW9A 3HSYA 5JSUA 2ZJFA 4ER5A 1ZLXA 4U3JA 3WL4A 1P7YA 2CHGA 3F6BX 4ATNA 4YAKA 4C5BA 1JU4A 2Q5JA 2JLBA 3TGPA 1CT9A 5H80A 2NZXA 3V1MA 3WGNA 3V7UA 2AKAB 2PKYX 1S3IA 3G2OA 2YWDA 3E27A 4TYQA 3RVOA 3MTJA 4YH1A 2DM6A 2WR8A 5CA1B 1L5MA 1PGPA 3H9UA 5EIXA 2WM2A 2Z8YA 3E18A 2GLUA 4XDYA 4QYTA 5K0SA 3V3TA 2NO7A 1ZNXA 3OPYI 4DG5A 5EYPA 1R9MA 2FUG6 1HL7A 1NBMA 4RHEA 1ZONA 5AJTA 3DT8A 1DBRA 4D8YA 4TTAA 1IXYA 3LKDA 1AQYA 2P27A 1QP4A 4HN2A 1DINA 2Q7DA 1MH9A 4Z2AA 2YQZA 3CVUA 1E62A 4KQGA 4EF6A 4DSOA 3AY0A 2MDTA 5AICA 2NU6A 4E5DA 2QI9F 1E3MA 4GLJA 1VLHA 5JDCA 2NZVG 3ANNA 4D80A 3B6JA 5KTTA 3I73A 5I7FA 2HTEA 3MFYA 1J9GA 4Z1MA 1A9RA 4QWWA 4LS3A 4IDAA 2SHKA 3ZY2A 3U5TA 4Y3UA 2UZ3A 1JEQB 3RT9A 1XCJA 1ZGJA 3NG1A 3F5DA 4EZBA 1QVVA 2P9EA 4AKGA 4LKOA 3H87A 5FF9A 2EGHA 4MW7A 4NI5A 2H0QA 1XWIA 1SIOA 3KYCA 4Y9DA 3DHWC 3FB4A 1OHHD 1UBKS 1NV9A 2CLKB 4C1NA 5GTDA 1FP4B 1VZ2A 2C4UA 4RE5A 1E3WB 1ZAYA 2I87A 1ISPA 1RYDA 1IZ8A 1RJGA 1K27A 1FYDA 1NR7A 3DFMA 4LV6A 4ODIA 4KNVA 3N3AC 1M54A 1KQPA 1ZAKA 2FPLA 3OAAA 3GH3A 2GLXA 5DNDA 4TUYF 3UEOA 4YAJA 5ALLA 4ES6A 4ERNA 3TQTA 1OTYA 1NNI1 2GPSA 3GRUA 4JJFA 3PUKA 5KNCH 4MQEA 1NXPA 1NVAA 3N5CA 2QTNA 4ZXPA 3W8EA 4EHJA 5CBPB 5GZ6A 3DGEC 3LFTA 3OQPA 1UIRA 4I14A 4ZVOA 4X85A 4I4NA 4XFJA 1L7VC 5A5EA 2D7DA 2A1UA 3NC4A 3OU2A 1YB2A 3X1MA 5JZMA 3PICA 1D04A 3QUTA 5LQCA 1KYTA 4CQNA 5IZ4A 1RBZA 2IDZA 1QHHB 1A7JA 3DP7A 4R9UC 1QTIA 2CGEA 3DUFB 3DT9A 4QOIA 5CLHA 1P0MA 3BB4A 1WXGA 5IAJA 1L9XA 3LRXA 4H7DA 4RLFA 3VZBA 4K6OA 5EG5A 4ABYA 4Z9XA 5KQSA 5JI3E 2Z6VA 3OH8A 1LNQA 1SCNE 2AG8A 4WNCA 1NQXA 3B60A 2PZ8A 2VR1A 1LDYA 2QRHA 3HWSA 4QC2A 4YUZA 4AZWA 3L5KA 4HRYA 4BYGA 3UJNA 5HE9A 4KJXA 4MUKA 3CUUA 4L7VA 4JIGA 1G7CA 2J9FB 4FFBA 4Z4FA 4GGPA 1VKJA 2ABWA 4BC0A 2TECE 3B9BA 1USVA 1OA1A 4RAOA 5EERA 1E6WA 3IBTA 3PDJA 3QITA 4GR4A 5CX1A 4DQXA 1ZK2A 4Y7DA 4ZMBA 3DZGA 4GE3A 4K2HA 5GMOA 4CF7A 4BQEA 2WAMA 4NARA 1E7MA 5COBA 4C4ZA 1HUQA 4GOJA 3N0WA 4IVNA 5SY4A 1X7WB 4ZQCB 3SJZA 2O8EA 3E5MA 1ZJYA 2OCAA 5BN5A 2OGSA 2GYWA 2XVMA 2X19A 3D64A 1RHMA 4MR9A 1I3OA 1Y9DA 5DXAA 1WB9A 2YY5A 4K46A 1UBSB 1VJDA 4FD2A 4OQEA 3B7GA 3AUFA 3GNQA 2XLCA 2IITA 2R6R1 1T4MA 1N7HA 5EIBC 1B7GO 2N47A 2Q4RA 4Q3BA 2I6TA 2IDKA 3LQ1A 4I5DA 1ZGCA 4YRSA 3CX3A 5EIBD 3L7NA 4MVJD 2VHQA 1RQRA 3SSAA 4RA9A 1X1QA 5IH7A 2XMRA 3FNHA 2C4NA 2JIDA 5GVSA 3SJAA 3PC7A 2P9GA 3BE6A 3LL4A 1GLGA 4F5WA 1I3LA 1MC8A 3HCDA 1P7WA 2FI1A 3LG2A 2AI3A 3B1FA 5LA6A 1GQQA 2W6OA 3FAZA 2VIIA 3FLBA 1NMXA 2MU1A 2Q28A 3JU3A 3LOUA 4U9UA 3RANA 1BXRB 3K9WA 4LBYA 2IV7A 3T5BA 3WNBA 4CMKA 1Q57A 3PS9A 3OZXA 2GCOB 3JRXA 3LOPA 2JHAA 4X1OA 4EQZA 2DQYA 3ZGOA 1JT2A 1VSVA 3LSYA 3TKYA 1RIIA 4QG7A 1ZG3A 2X9QA 5C80A 1K0FA 3BT7A 1O77A 1JKJB 4A2WA 4JYPA 4IAOA 4N1AA 1GRQA 2Q1XA 3PA6A 1DFHA 1CDOA 2A3RA 1BE8A 1Y48E 2GF0A 3Q0TA 1UBHS 5HZGA 2NXJA 2D13A 5E1BA 3SSMA 4QVIA 1QYIA 5DIFA 1B14A 4IILA 1P1CA 4RGYA 5FB3A 1DTWB 3T61A 1Y33E 3SDZA 4N3CA 1P1HA 2J59A 1CRLA 2HNKA 2WW8A 1AK9A 3KDPA 4TQGA 5BXQC 3MS7A 1E1KA 2GPTA 2IUEA 4FIDA 3TL6A 5GPBA 5DW0A 5ECWA 4CG0A 5KIAA 3TTSA 2B69A 2YBEA 3ZNOA 4F5EA 5BN5B 5EXTA 4F2DA 3PQFA 2C5HA 2PAFA 2CFTA 3GDGA 5AOAA 4H77A 3T4XA 4HB4A 4ZDWA 5LBTA 2B2XA 1OAKA 1RLUA 5FA8A 4OL9A 2HPHA 1A8PA 1ZI8A 2GM9A 3KT8A 3LZ6A 4QOFA 1Z7WA 4R2HA 3W4IA 4BQOA 3ZHRA 1UJ2A 4BKMA 5AESA 2C5GA 4O2AF 4Q21A 5IM5A 3FA2A 3GQBB 3SHOA 3G79A 1QPGA 2W71A 3STVA 4DWVA 4M1MA 4M6WA 4LA4A 1YE3A 4EG0A 1M2OB 3IULA 4WZAE 1FNCA 1TNDA 1ODCA 3LX6A 4GYYA 4HBGA 4CR7A 1IY2A 3OOEA 3CRMA 3KHSA 4ZV4A 5A4KA 3VH2A 2HMVA 3AP2A 3AR8A 2ORIA 1GGKA 3AKDA 1UK7A 2Q45A 1FC0A 1I01A 4XQ0A 5DHRA 1KGSA 4IMPA 1JB9A 1JIJA 4HJRA 4HH4A 4XB6B 4KPFC 3P2IA 3QU5A 5ELMA 4R8SA 1G6OA 2IEZA 4I55F 1X0XA 2VDMB 1RW4A 4HVTA 4H27A 5FTKA 5IJXA 2UZ4A 2Q5HA 4RQTA 2AA3A 1A5AB 1J8QA 2PA3A 1PR3A 4JD5A 5JWOA 4Q4DA 3V2HA 4E08A 2VEDA 3Q8WA 4ITRC 4RPCA 5BQOA 2F7SA 3QGMA 2BV3A 4TWAA 1GL7A 5ARDA 2PRIA 2XVYA 3VTZA 4QM7A 2HJGA 3MT9A 2EW8A 1IPEA 2ZRAA 1HE4A 1E9DA 1JJ7A 4PW0A 2F64A 3OU7A 1JFFB 2FB9A 4U4AA 3QBVA 1UKBA 2AFRA 1OZHA 2OSBA 3UWKA 3OPVA 4XTRA 2ZCUA 3V97A 4B47A 3NEJA 5BT9A 4JUDX 1GD1O 2NZWA 2C3PA 4BOYA 4UTPA 1H9BA 4MV6A 3RASA 4DYHA 3QBEA 4NBTA 4PPYA 4HX9A 3B5JA 3RVMA 5LQRA 2D5BA 2CEAA 2RDMA 2CJWB 3EXG1 3JYNA 1WTCA 2AMFA 3NBQA 3O8QB 3T9AA 2D0DA 3ZVLA 1K6MA 1F4PA 2C97A 5L3ZA 2ZBFA 3THRA 5CVUA 4GKKB 4BU0A 4V03A 4DA4A 2B4TO 1X77A 2IY9A 1EINA 3JYQA 2GN6A 1HDYA 3QVKA 3SFTA 3W3AH 2AS0A 1F06A 2L69A 1SPBS 4RA9B 3WJ7A 3SJUA 3VR5H 2VAXA 2P2DA 5D8DA 1E9CA 1DKOA 3VH1A 1RWQA 2HIGA 3QWBA 2O6LA 2FXIA 1NFFA 4NX2A 2BKEA 1OXUA 3PXGA 2QAGC 2QUKA 2I2AA 1XDGA 4QFCA 1Q1QA 2Z56A 4PLTA 5ILOA 3I2YX 3K1YA 1SKAA 3HL4A 4ZOCA 4FFVA 5DWDA 4B3CA 1Z0UA 3B70A 4KRXA 3LFHA 2EWVA 3LX4A 4BAUA 1NV8A 1FTSA 4LF7B 4OYRA 1VJGA 1U0GA 4J3FA 1Y4SA 2JFGA 2KYRA 1VI2A 1MBZA 3QLVC 4B80A 2QE7D 5K4HA 4B9AA 1N2JA 1MRSA 2WYUA 2JIOA 2N3ZA 5B3KA 2XA9A 2ZT6A 3WO1A 4DXHA 1YKFA 3ZWAA 1DWUA 4DJAA 2I6FA 1DRWA 1FFEA 2EP8A 5LIPA 3GGGA 2YYYA 4Z0TA 1U5BA 4JQZA 1MO2A 1YV9A 3OSZA 4QDZA 4UM5A 4EI8A 4GOOD 4UTNA 4L72A 4C78A 2JI8A 4YS6A 3CBGA 2FUCA 3DDSA 3JCZA 1YULA 2DG2A 2ONYA 4P3XA 1CFZA 4QX6A 4UCFA 2I3BA 2RAFA 3VHRA 3GOHA 1EVLA 4RA6B 1GUAA 1EFDN 1Z6AA 2CCKA 1Q0ZA 3PD0A 4RNCA 4ZT2A 4BJ1A 3GWGA 1J21A 4UUOA 1XCMA 1PYDA 2OGWA 1CWUA 2YHUA 3HCBA 3KL4A 4RMNA 5EWMB 2HMUA 2JLYA 5AVXA 5ICGA 3UT5B 1THMA 3NKLA 4MUHA 4PO8A 4QHTA 4R2LA 3R0IA 4X6XA 1NP7A 4MTLA 1O89A 2O2CA 4WNAB 1C0PA 3U3MA 3ZQ6A 4C4TA 3AEYA 3FB1A 4NL4H 1EAYA 2OFWA 2X5NA 5FYQA 2W98A 2Z09A 3WHPA 3WRYC 2YFKA 1GKKA 2PU7A 3AWIA 3FCSB 3THYB 3MJTA 4L22A 3M89A 2BBSA 3Q4GA 3H0KA 4EQ6A 2NVUB 3S1SA 3Q7PA 1NX9A 1BH2A 2G7MC 1AK2A 2XZDA 2P0EA 3CH6A 3FIUA 3G1UA 2CXNA 3KYCB 4YRAA 5ADHA 2OHGA 2A7XA 5PGMA 2ZJ6A 3BGOS 5K2OA 3UJHA 1GTRA 1KDYA 4ZN6A 2ERYA 3NH6A 3BTOA 2P6MA 1QM5A 3P26A 2GN2A 1UPUA 1XU4A 2GSWA 3ER6A 2IUTA 3IP3A 3K16A 3MRXA 4S2EA 2R00A 3U7QB 2C95A 2L2QA 1PFYA 1Q3HA 2TMYA 4X20B 5EXXA 2PRZA 4A27A 1FMTA 2A2ZA 2G8NA 4FILA 3TLAA 5ALHA 2IS6A 2QRJA 4DGSA 4ME6A 3S3TA 5CUQA 3FF4A 4CM3A 4L6CA 3FETA 4EOGA 1D1PA 5L51A 2R8OA 3LQ2A 4FEGA 3QM1A 5ILQA 5H3CA 3T0IA 1O5OA 3K9QO 1IUNA 2CXRA 3T5CA 2FSVA 2X2EA 3AI2A 3FDZB 1U3VA 3HDVA 1T3SA 1DV2A 2C88A 2P9TA 2R1VA 3MERA 4CQJA 3O8RA 2C8VA 2BM8A 3PE6A 3O3NB 3KCNA 4CQMD 1N7GA 1KQ3A 1CD5A 3LC2O 1YS1X 1SZCA 1YU9A 4PHTA 4JQCA 4WA7A 1N6KA 1TQ6A 1CY0A 1TDJA 5KSYA 4HDNA 5L40A 4TZTA 4JUAA 1PR6A 4DM4A 4BRUA 3FDFA 4IQ4A 1G21A 4PRYA 1X7DA 3JR7A 4WOBA 1RI3A 1EWTA 1D9ZA 1OZAA 3MCZA 4UOQA 4B4WA 1XG5A 4H1HA 4LHZA 1R6TA 1T4GA 3IUQA 3DYBA 2XT0A 5G2OA 3TTXA 4EUEA 1ECBA 4W5NA 3W6UA 3WYAA 2AB0A 4NCKA 2C58A 3WRWA 2PGDA 4JC5A 1A2QA 3NM5A 4DKXA 2NZ8A 1K3UB 2RH8A 4LQDA 5DBFA 4K2AA 1AZTA 2EOAA 3WMXA 2ZE8A 3HEBA 3RRMA 2QMHA 1F2UA 3ID6C 1FFXA 3OO1A 3N2ZB 3SGLA 1JNYA 1OXTA 5CB4A 1DGQA 3V4RA 4HOYA 3K9BA 4BQPA 3FUVA 2DWQA 3HY3A 4BYMA 4CWAA 4OLBA 1L4EA 4JLVA 1RR6A 3AESA 1MC1A 5F7JA 4M8IA 4YRTA 4ZANA 3IQFA 4GO1A 3K72B 3L4EA 3A4IA 1RQ2A 3MG9A 4P3KA 4D4IA 4JLNA 5ALJA 5C7YA 2XADA 2H1SA 1A77A 1F5NA 2A57A 3DHEA 3WB9A 4LKRA 1WSBA 4DLBA 2VDUE 4CXMA 3V5NA 4G1VA 4C21A 2F3RA 2P40A 4F7DA 1PV1A 1PJZA 3BX1A 2IGTA 2PZKA 4WDQA 4A0RA 1C7QA 4PNHA 3KL2A 4DDKA 4ESVA 1JKIA 2E9SA 5E9JA 3HN6A 1QH0A 2YJNA 2PYZA 3MGBA 5EIAA 4E4YA 5JZBA 2Z8ZA 1RJFA 4I4CA 4Q1EA 2EJVA 4PPFA 3I5YA 2HA4A 4K81B 1PFGA 3TLMA 1M0TA 4WADA 1JWLA 2QSUA 4GWLA 4Y2QA 1DXHA 2O1EA 3G5TA 1V7CA 4IG9A 3EGDA 5FUBA 4QQRA 1GQSA 2QT1A 3MILA 4K9MA 2OESA 2WNHA 5T4HA 4OHZA 1DJNA 4JYMA 1L8OA 3ZKWA 2BLLA 2XEDA 3H0EA 2RHWA 1PTJC 3SIRA 5JT1A 3P0RA 1P80A 2AR9A 3F7OA 1S2NA 2G04A 3GY0A 1GQ2A 1HDGO 4G37A 3SZLA 3LHIA 1U28C 4PZCA 3KR0A 5BUSA 4JYZA 1RS0A 1QZZA 1E2DA 2ZYTX 3C6KA 4IUBS 3P9YA 1I5OA 2BH2A 2PPLA 2VNIA 3L82B 1XTKA 2RGNC 1YJ8A 3JD2A 3PBKA 3CTMA 1T6XA 4NP6A 3PTAA 2FLVA 5BSTA 5CBPA 1KHTA 1JILA 1TAHA 2FZ4A 2GKOA 2YYZA 4PIPA 4XVHA 5EP3A 3MWDB 4LF5B 3V8MA 4PFSA 1DOAA 1BRTA 1QE0A 2PMDA 3BWEA 1XJQA 5T41A 4EFDA 1BFKA 2LDXA 1IE3A 3DP9A 4KSCA 3ZPXA 5T67A 3UMFA 4QDJA 4PZLA 5CT8A 1E5VA 3IHTA 2XT6A 1LBTA 1Z5NA 1Y63A 4HAWA 4PYLA 5EHIA 1OZFA 2IZ1A 3NO4A 2HCRA 1DJQA 1OGYA 1Y1RA 5HW0A 3AJAA 1C9DB 1K86A 1QBKC 4M2LA 3DMPA 1QV9A 2J1LA 1CQXA 3L0YA 4OH1A 4HX2A 5DEOA 3R3YA 3DEHA 1GZ5A 4QLOA 1YZUA 3TNLA 1EUDA 2A1TS 5ESWA 4C0QC 4C2TA 1QX3A 3QUSA 1DKPA 2J5RA 1CQJB 1JGTA 1GZ4A 1JQ5A 1CKEA 3D3WA 3OZDA 5F1OA 3RHTA 5KNDH 4KE7A 2O8NA 2HUNA 4Z49A 4HVCA 3EIEA 5EKUA 2DQZA 1VPVA 2BF7A 4GUDA 4AYWA 1GRNA 3TM4A 4RENA 2B8JA 1RWWA 1NR1A 5KREA 4ARUA 1IBLB 3ZWYA 5G1NA 5JPDA 3L04A 3S2IA 1BDBA 3OEHD 4GL4A 4EP1A 1KZ7B 2HCFA 4L2IB 3IODA 3ZDFA 3UKOA 4K5QA 4JK3A 5JW6A 4EKIA 1XKLA 3FNQA 4P0TA 4R83A 1T36A 3L0PA 3LP8A 1T0PA 2J9RA 5A04A 4IFBA 4F3TA 5HKBA 4TZ0A 3K96A 1VG9B 1Z2CA 4V3BA 1UM9A 2YKGA 5CW1A 1MQ9A 2I8CA 2HB6A 4PBRA 4UW9A 1FXSA 1UMBB 1YASA 2QRZA 4ZCIA 5I7OA 2CVQA 3TAUA 5CLGA 1W34A 1TVKB 3PQ8A 4NCJA 1RPTA 2Z9BA 4MS3B 3UQZA 2GEVA 3I0NA 3KKOA 3TEFA 4BX8A 5FPQA 3FSEA 1PT8A 4IIUA 4L5BA 3AF3A 2P65A 3H3FA 4RPJA 5ALWA 1V1RB 3DBRA 3OFJA 4B31A 3NHBA 4MA4A 1WLSA 4EPWA 4X1IB 3BMXA 3SBOA 3NIBA 4RDHA 4H4CA 4YWHA 2ACKA 5GONB 2FHPA 5E7MA 1H23A 5FPSA 3IP7A 3VOAA 2CZQA 2GEJA 4HDSB 4KQXA 1YS7A 1FXUA 2YH2A 3PJGA 1DG9A 5DYTA 3RJTA 3VR0A 1KYVA 1RXUA 5JS7A 4ANFA 2IPNA 2I67A 4O0LA 3S28A 4YAGA 2QMYA 3OCYA 3U7EB 2QTVB 4ZYUA 2IEIA 4HEJA 3AUAA 4FUQA 2YWBA 1GCIA 2OAEA 3VOBA 2CUTA 5BRJA 4Q5IA 4DIFA 1VMDA 4B4DA 5BOVA 5DDIP 1ULUA 3ULKA 4AZ0A 5JZ9A 2O3TA 2XNDA 3B1WA 4AY6A 4IDFA 2PH5A 5DP2A 3T7KA 5JAOA 1KYXA 1L1RA 5IN4A 4FYXA 3NHSA 3RV3A 4BLTA 1L4YA 3LWZA 4RWEA 2VOEA 4II2A 1IWPB 4QTYA 2FMHA 3GMDA 3KT0A 2GXAA 1CY7A 2PNFA 3CRQA 1C3XA 1QZUA 1E9FA 1GIAA 3FYUA 1KFJB 1NQ5A 4KVAA 1C2TA 3CZ4A 3T1TA 3K9FC 1SUAA 1R0KA 1Y7PA 2HSWA 1V11B 2XXBA 3MT0A 2G8LA 4W9NC 4Z3OA 1HFKA 3KQTA 5ITZA 1B8OA 3HDTA 1QRRA 3TNDA 4F85A 1ZCJA 4E5NA 5GINE 2OBLA 4OBXA 2W6JA 4HGOA 1M72A 2MTBA 2QGFA 3IV7A 4DQ0A 4PGFA 2QD5A 2I4IA 3GEEA 1H93A 4F93B 4X65B 2PMCA 4L27A 1GUZA 3PFWO 4Y0AA 4YP0A 4ZTBA 5TXGA 5J2UA 1M2WA 1KZHA 1WOYA 4MA5A 4HC4A 1E2PA 1ZGGA 1KI9A 4NZZA 2PLRA 1Y4ZA 3I9JA 3TOZA 4ARVA 2UDPA 3V4LA 4DR4B 1RJ9A 3GXBA 1H2EA 3RVPA 1U7OA 2CXPA 1WDLA 2X42A 4FGSA 3W5IA 2NP6A 5IK2D 3S5JA 2NO0A 1P4SA 5DXFA 4DSAA 3RUIA 4PVDA 1XNRB 4LRWA 3NVDA 2C29D 3AZQA 3GRVA 1WY7A 3DBLA 2WAXA 1SCQA 4JMLA 3NWEA 1Z8HA 1JW9B 1TCVA 3GRYA 3TAHA 1MA3A 1DG3A 4QU5A 3JQGB 1AH2A 3MWEB 2FDXA 3EOAI 4DCUA 5A4MS 4LFBB 4LQ4A 1U31A 3A0RB 2FAXA 4B3JA 1O96B 3R0XA 5C46F 5JUWA 3AIMA 3LNCA 4V38A 1JJAA 2XD9A 3F2VA 3HKBB 2JK1A 4PYOA 2ZIXB 4QL3A 4NU5A 1PN3A 3NATA 1A88A 3O1JC 4EJFA 2CY0A 2YOHA 4LXHA 4EX6A 3U4QB 1ZVQA 3E81A 3PK0A 3ZE2B 2Q3JA 4ZVRA 5B3JA 4OMFG 2M32A 4TLMB 3L4JA 3SIPA 2P1DA 4RVDA 3AI7A 4MB6A 3EPHA 2F48A 2YZGA 1OB2A 1J07A 3DLTA 1OYWA 4B6FA 1ZIPA 4L57A 4Z1MD 1RPZA 1Y5MA 2C5FA 4D25A 2WIFA 4YO7A 5BSWA 1SEVA 4DY6A 2XV1A 4RHXA 2XCIA 4D8VA 3SHFA 5BVHA 4F2GA 2WTAA 3C7CB 2A0YA 4Y0NA 3H75A 3HVJA 3TTWA 4UPVA 1NW6A 1GVHA 1VIAA 3BFKA 4J0DA 2G36A 2H4ZA 4E5VA 1D2RA 5BVGB 4AZSA 2YW9A 3PT5A 4BJ3A 2YXPX 2PX4A 1SKYE 3CUEF 3H05A 3GVPA 5CM8B 5J4LA 1H2WA 1SWWA 1SG9A 1IOVA 4AYTA 4HDRA 3NKVA 4R98A 1UT8A 4M7RA 1A0OA 3GB9A 3KVOA 4MLDA 4CHGA 4EF4A 1Z4KA 2QJFA 4Q9LA 5EINA 5KNBH 1WP9A 2NO1A 3N76A 2RB4A 1U8CB 2FN7A 2P7HA 1CS0B 1II8B 3TLCA 1ZN9A 2CWDA 1PDWA 5I4KA 5FEMA 1P72A 1XN1A 2JAXA 1HYHA 2YQ5A 3IEKA 4F38A 1AJEA 4INOA 4DW8A 5J43A 1N3BA 3AM1A 4OREX 1T6ZA 2X9VA 1PO7A 4JOQA 3H5TA 3EIUA 4U7GA 1C4WA 3ZBTA 5AVQA 2YBDA 2ZVDA 2IYQA 4H6XA 1FFWA 4D42A 3N8DA 3ND7A 1CVLA 3U4DA 5CB0A 2HMWA 2BHLA 4REQB 3ITKA 2G5CA 2QROA 4C3UA 3LM8A 1JAZA 4U7DA 3C0KA 4XR4A 4F6RA 4D9KA 5F98A 1GDHA 3A6GA 3KIPA 3PXAA 4F3YA 3R7NA 3RSQA 3WSVA 1I6WA 1PZMA 1I30A 2NYAA 4TYPA 2DCMA 4GMKA 3REFA 5CNIA 2I3AA 5CDYA 4IHAA 4ZCSA 5EZSA 3K9CA 2PEYA 4GX5A 1ZGZA 5J63A 1N6NA 2ZK7A 3OJXA 4ZZIA 1R4AA 3WWDA 4KOAA 3ABSB 4DRZA 3GV0A 3O1HB 4RFLA 1ATZA 4EHKA 1HT3A 2BJHA 4B4OA 2O3QA 2WYHA 2ZIZA 4NOJA 1I36A 4XI9A 4ZVUA 3K0EA 2XMGA 3L0DA 2H2FA 3CSSA 1M8KA 4ZEXA 3RVBA 1WEKA 4I9UA 1G5HA 1YL6A 4Q1VA 4BN4A 1NSFA 2DVMA 4MQMA 1MOSA 1L7OA 3IJ5A 5EVJA 4L78A 2A9VA 3DE3X 1EDEA 3MYYA 1MXFA 4MS4A 4FEEA 1ADBA 2JFBA 1NNEA 2V5UA 4ZZ3A 4ZVTA 3EVNA 4BFVA 3ZVNA 1PR9A 1EFVB 3ADPA 3HXPA 3D6JA 4O4HA 4HQOA 2ONJA 3VPAA 1YZYA 5J2UB 1OFIA 1U02A 1Z0FA 3O8DA 3HDHA 5FAKA 1NVXQ 4LY3A 1C7FA 3LUGA 4S24A 2NU8A 5IDQA 1BVHA 5KAMA 3MZ0A 4CEJA 4W5WA 5LQDA 3AT1A 4C7OB 3D9QX 2GJSA 4YA6A 1ECJA 5CLQA 1QB8A 3WOVA 2OP1A 3SBEA 3IALA 1XCPA 2JASA 1JLKA 2X1VA 3G2KA 4IDBA 4U7WA 4B17A 2NUAB 2NU9A 4AJ4A 4YX9A 4HXEB 3IOMA 3H17A 3R6TA 4GX0A 3P9RA 5FOWA 2YJZA 1G1MA 3BCSA 2YZKA 1JAHA 3RVSA 1U3UA 5TEWA 1GFZA 721PA 3V9AA 3KR1A 1JFRA 1K63A 3DQPA 2GVDC 2QE7A 1TJ4A 3GLKA 3GT4A 4PZYA 1CUVA 2H54A 1E9BA 2QNBA 5JHGB 4QQKA 2EARA 4N5IX 3SZ3A 1JA9A 1QQTA 1T6BY 1Q1NA 3PFFA 4K3UA 5IBPA 3DEKA 3I1YA 3MWLA 1BGWA 4G5QA 3RS9A 3D1JA 2G06A 1GAQA 1Q50A 1Q2UA 5IM4F 4FOPA 5K0TA 3H2KA 1GV1A 3HMQA 4KE8A 4D98A 1XIVA 1FUEA 1VG8A 1Y5RA 3TL3A 1FQKA 5CAEA 2YXDA 4A8JB 4NPHA 3JD0A 3UZUA 3QLJA 3ZY4A 1DCFA 1SOVA 4FJ0A 4ZO6A 3WLAA 3SIXA 5DHPA 2HHJA 1NSTA 3IHKA 4RA6A 4EG7A 2Z6UA 1KZ9A 1V7PC 4MW4A 1L5HB 5EE5B 5TJHA 5K4GA 4WOPA 1GZ7A 3RRXA 3U7RA 2CE2X 4ZVMA 3ZNNA 1T5HX 2ZJYA 4QJBA 4UEJA 1DAHA 5E1MA 3HLKA 4BVLA 2UUCB 3KB8A 5KYYA 2RCYA 4TTSA 4BP8A 4EHFA 3ZNPA 3H2JA 5FTMA 4PCVA 1ZX1A 4A6EA 4D5EA 5FR2A 2J3EA 1LB1B 4ALJA 5I5GA 3HZOA 4UEQA 4LF9B 2VN8A 3GGOA 4QEKA 4BN5A 1MP0A 5K20A 3NAMA 4DC9A 1DIGA 5ECYA 1OI2A 4TM8A 2AZDA 3ZWPA 5JDIC 3NHMA 3GAFA 1T1RA 3W7AA 1BXGB 4B3DA 1PJ8A 2AZMA 5EIFA 5EHGA 2UYCA 5HFJA 1CUYA 1UMKA 2ZB4A 4OA8A 4QYIB 3M9LA 1A76A 4L95C 1P4HA 4HMQA 5I8PA 1N5OX 1TYZA 1KEKA 1XU7A 2P2NA 4JWTA 5DTMA 3SM9A 1RWPA 3JR3A 2IYXA 3BD6A 4RO0A 4YJHA 4CKBA 2V9CA 1O54A 3C6YA 4QUEA 1J9ZA 4JT9A 2M2IA 3PXUA 5FFFA 3RTCA 3TBFA 1KEEA 4YMTA 4G8JA 4JXJA 2ZYGA 2YV1A 2FZWA 3OKFA 2ZQZA 5EWLB 1L0BA 2BEVB 1MV5A 4MH0R 3OM1A 3PITA 4LY6A 3VR1A 3AHHA 3QLUA 1VMAA 4B4UA 2ST1A 4LHEA 3KB2A 4MZDA 2QYTA 4PBSA 1NQUA 3M5DA 4JDUA 3HRKA 3BIXA 3MSXA 1WEHA 2PMEA 4ZYTA 3EF3A 2DHDA 3MMXA 5INTA 1FUYB 1M7GA 4WK4B 5C81A 1P1FA 1DEXA 4LFCB 2YVQA 1YZVA 1YS2X 3AFGA 3STXA 1NGSA 2FG5A 4OLJA 3U17A 5E0OA 2F8LA 1F0KA 3AKCA 2BEJA 2SKCA 3JQCA 4BVBA 3K05A 4KIJA 1T3ZA 3ND5A 4X7PA 3CLTC 5TS2A 4E4TA 1QC5B 3WLEA 2WK1A 4JDPA 1Y3IA 3PUYA 2RBKA 3QU2A 1YDHA 5AI9A 3CO5A 2ZG6A 3V4SA 3EA0A 2ZWIA 3C2QA 4V39A 4Y2JA 4P5EA 4PLCA 3S1LA 4NDNE 3OLWA 5IJWA 4MUIA 3A9UA 3KE9A 3O2NA 3U7GA 1RQNA 3HYCA 3C3PA 3O7MA 4E5UA 2VDNB 2ZDHA 3QBDA 1YI0A 1TK3A 3GIWA 2YXNA 1C3EA 5CVCA 1DZ3A 5CURA 2YCBA 1FFYA 2DPMA 5C3MA 1CVIA 1JR2A 3N2LA 3DWEX 5H59A 3JVEA 5SZJA 3A3NA 4OPMA 3GLHA 3FJYA 3JALB 2Y2UA 5ALRA 1UZUA 3A7DA 1H22A 1GKUB 1PGJA 4UTRA 3LPLA 5DOZA 2ZM5A 5EMNA 1Y3AA 1E1CA 5ECDA 4EG4A 4JI1B 4Z9YA 2Q62A 1A8SA 2QSJA 3ONNA 2B1QA 1XTTA 4OGWA 4ZP1A 3I76A 5ALUA 4EUHA 5HKOA 4CUJA 3BSWA 3OE7D 4R71A 1QVWA 2DQKA 1XJ0A 2FRVA 2SECE 5AI6A 4ZXFA 1C3OA 4KQFA 5M7EA 1RRMA 1EQUA 5HILA 3B48A 4CM9D 3W2EA 3WL6A 3E6AA 4C7MA 5JD5A 1WETA 3KZ1E 1FZQA 2VSFA 2J5XA 4WMLA 3HGQA 1S2MA 2Q3HA 1SHTX 2MR5A 1QONA 3W8RA 4ALLA 3EMVA 4QDXA 1U3GA 4BNGA 4HBZA 2NU7A 4ARIA 4RDXA 2IOQA 1SO8A 1EWKA 3JAWA 4Y1EA 3F49S 3RYIA 4ZHQB 2OGZA 5BV2P 4NNPA 2W43A 4R8LA 5JBNA 4GU5A 5BPHA 2Y05A 4G9BA 5EMMA 1VL8A 3AR9A 1WUTA 1NT2A 3OPYA 1WPXA 1Y7LA 1ZNQO 2ZAYA 4ZKDA 1H4SA 2AUNA 2UVDA 1MT0A 2UU9B 3L1IA 1FDSA 3QTLA 4AYXA 4EGJA 4OCZA 4FWTA 2VHXA 4TXMA 1NXOA 3JZIA 3V9PA 4AG6A 3EXIA 3WGQA 5AMXA 2IWHA 4BLQA 1K7SN 2P7IA 1LPBB 4LXXA 1YRBA 4X54A 2V4MA 1QRAA 2X0JA 3D6NB 1HBJA 2ZU6A 3GRAA 4J7AA 4DA6A 2E4VA 1TB4A 5B57C 4C7BA 3T1HB 1CC1S 2GA8A 4BQSA 2GXSA 4TL6A 4CQLB 3GQVA 4ENQA 1YI8A 4QBKA 2WWGA 4F0JA 3R8XA 3CYFA 3EJWA 4UQLA 2VAWA 1BHSA 1Q7BA 4MW5A 4XVQA 4C7JA 2D5IA 3NORA 5BR8B 2GDZA 1KE1A 1G8MA 1MB3A 2JPDA 2XOEA 3OM8A 4Q02A 2I7DA 4TS1A 4M9UA 5PNTA 3VAZA 2ORWA 4Y98A 1B23P 2TMDA 5IC6A 3NHYA 3PIDA 3O21A 3KCQA 5FI1B 1G7TA 3NUZA 2BHRA 3TTYA 5BQFA 5HZHA 4P92A 4IIVA 2AEMA 1M34A 2CNNA 4TV8F 4YFVA 2Z5FA 1EXNA 2VA8A 3ANLA 1MGPA 2RMKA 1AT1A 4TPKA 4COOA 1SR8A 2EJCA 1A9XB 3I39X 4P4TA 1YIDA 3KZVA 5F4BA 7GPBA 5KWEA 5D6OA 5J4YA 3ITDA 5IEJA 1MG5A 2ROQA 3BREA 3GNSA 4G0OA 5HK8A 2XNKA 1C50A 1RSZA 3C1UA 4DV0B 3HUEA 2I0FA 2ON6A 4QT0A 4OFXA 2AZTA 3SEAA 3LCUA 3HVKA 4Y7CA 3UWOA 2J9FA 4EFLA 3KJIA 3A1TA 2REXB 2G9QA 3BGDA 4L5JA 5FTWA 4Y6QA 4A4DA 1PU2A 4LY0A 1M0EA 1W6RA 4KV7A 2LKCA 2IVFA 3T0GA 4KNWA 5C5IA 4RJ2A 2RHOA 1JAXA 3H5AA 3G5UA 1EFRD 1M1YA 2I80A 1P0QA 2WAYA 3N8GA 1V7ZA 3WGVA 3KQLA 3VZPA 3STTA 3ICVA 2WUFA 3SMVA 2YRXA 4XYLA 1FU8A 4AY2A 4ZT7A 2DKFA 4ZGBA 2PGOA 1ZSNA 2IYWA 3I42A 4B8ZA 3F6SA 1ZOSA 4TV9B 2BH9A 5DLPA 1LX7A 1MN6A 3IVGA 1XF1A 4HQ0A 2BSAA 5HIAA 3ZE1B 4G4SP 2WJYA 4GYJA 5B58T 5T5QA 1J2TA 1Y7HA 3EDOA 4F46A 1EIWA 3OCCA 2VLBA 3GRRA 4QPDA 1K6XA 3MFQA 3R75A 3S2FA 1L5ZA 4EI7A 4DC0A 1P4AA 3P97A 4DCTA 1PFKA 1VDMA 4N40A 3LQFA 3PV0A 5DLQC 2OKCA 1YL7A 3OX2A 3NH9A 3TCNA 3AVTA 3B12A 4M55A 1R5OA 2PZLA 2CCGA 2XHEA 3DWFA 3V46A 5BVHB 5IDXA 4KO1S 2E82A 3A1DA 4MI9A 1G38A 1MQ8B 4RPHA 1RQPA 1PAUA 3ANMA 3OLQA 4JLDA 5ESXA 2XT9A 5I9TA 3ZS8A 1PUXA 4CV0A 1M5UA 2GMWA 1E6MA 2EG9A 3GLGA 2YICA 4HS9A 1G2IA 3ZC3A 1TO2E 1N1GA 3T1QA 1IVYA 4BBJA 4FE7A 1KPGA 2OCKA 2V6GA 2YNMA 3DMHA 4YI5A 3ED1A 3PWZA 5LQUA 1LW6E 3X1WA 2QQ5A 3CXUA 4JHXA 4E3ZA 9ABPA 3HFJA 3TI7A 1IHYA 4NATA 2NIPA 1YXMA 1J8FA 5HSGA 3GLIB 3QBJA 1VE3A 2INGX 1RWXA 2JBAB 2WIBA 3HCWA 3KFXA 2JLXA 1M33A 4MAFA 1A7AA 1SC9A 3RVJA 4GQAA 4RU1A 1NURA 3A2KA 5B4TA 4A2CA 3GLHE 2H52A 2XA1A 2FWNA 1IG3A 1SG0A 4U0JA 1WPGA 3HKDA 4DARA 3LY8A 4O08A 5IJ9A 1TM7E 4FCTA 2PUGA 3TDKA 4A0GA 3GLRA 3TLKA 1VHWA 3TK1A 3NVAA 4RMHA 1N8KA 2VF5X 3C3EA 3AR2A 1A1VA 1CR0A 4PGHA 5E38A 4B6EA 4MB0A 3EVGA 4NHOA 5CTJA 3PWTA 5DM0A 1QPZA 3OURA 3UUGA 1TCCA 2X2OA 2CW5A 4KGDA 3LAWA 3FI9A 4NFYA 1FFDA 4E7OA 4MGYR 3IR6A 1DEOA 3AVWA 1P8AA 4UOZA 4E32A 4P4LA 3LY7A 5EHZA 4G5OA 2L0XA 2BW0A 5A4JA 2OPBA 5KDOA 3EDQA 3Q5EA 2F3QA 2PRJA 3TINA 5HRAA 3GMTA 4BE4A 5JFOA 3RNOA 4MHSA 5JQWA 2MYPA 1BWSA 1SBNE 2NMVA 1I4EB 3WL3A 3V4VB 4Q3EA 4ZEVA 4BEBA 2PBZA 1HYEA 4AKSA 4ER7A 2VJQA 2QLBA 4IW3B 4I81A 5AVSA 3MD9A 5KEIA 1AXGA 1M2VB 2AW3A 3DT6A 1NBEA 3TLXA 4DXDA 2PUHA 3ESRA 4HLQB 4XB2A 1D07A 4GEKA 1G5QA 3AVOA 1E5LA 2R2GA 3COPA 3MIIA 2R0QC 3IKJA 2QUHA 2RHGB 3KPJA 3T8YA 4O2BA 5FNVA 4IFIA 3DOJA 2J3JA 3JATA 5F1YA 3I92A 3P4YA 3MGCA 1VLVA 2HSGA 3KXIA 4EPXA 4Z9FA 1PL6A 3AGPA 1SHKA 3TQSA 2A9OA 2GGSA 4TXNA 1YZNA 2GHQA 1NIJA 1WZIA 2AMVA 2WKSA 3CZAA 5U4XA 3G2HA 2I4NA 3UWSA 3EFOA 4KEAA 1ZH8A 1H5NA 2NZJA 2R4TA 2QN8A 3GJTA 3ISTA 4N5DA 5JR3A 4OBBA 5K0FA 2RC6A 3U44A 1P5ZB 4HGZA 5I7UA 3HCRA 4DZTA 4P0QB 1UEJA 2A5GA 3UJ6A 2XGOA 2HLNA 4UZSA 1W1WA 3IAHA 3N05A 3WGOA 3LK6A 4J9UE 3HB0A 5BSUA 2XZPA 3M1AA 3PHBE 1E4VA 1SZJG 3DB1A 3DVRX 2YUIA 5F64A 9LDBA 4CCSA 3CUTA 5CXSA 2P9JA 2WFLA 2AZXA 4TRMA 4QWMA 1E3LA 2TRSB 3V8BA 1N57A 2FX3A 4FMDF 1VYUA 1CJMA 1PLKA 4OHBA 2AG1A 1J1IA 1EJBA 1S1MA 2D0IA 2PDAA 4K6GA 3T52A 4A8PA 4Z7QB 2PMBA 2PO5A 4Q37A 3IVRA 4HCJA 4CUKA 2O2GA 4RPLA 2RK4A 1CUFA 4GP9A 1XEXB 4DMRA 2XTNA 1UXIA 3F1KA 3HJAA 1QORA 5EQTA 3ROTA 3R41A 2JJ1D 3GLQA 3L6EA 1ONOA 4DUGD 3WQHA 1SELA 2JFOA 1J5PA 3ZU5A 1G5TA 4C6TA 4HNHA 4X41A 1E89A 1YB4A 4IIXA 2B25A 3F78A 3RIMA 1RM0A 2WDPA 2ODWA 2ZYSA 2QNIA 1T15A 1OT3A 1O6ZA 2CDCA 1FLDA 4IHQA 4OP1A 4D0GA 5KWVA 2XCSB 4J1NA 4IGFA 3ZEAA 2VG8A 2EJTA 3MQ4A 3N2YA 4FDAA 4HQRA 4CMIA 4XUGB 2JARA 4CR6A 2O14A 1CQIA 5EJMA 3VPFA 4MKXA 1J56A 2D4AA 5LLTA 3V1KA 1H8ED 3IC5A 3ZDAA 3I3SR 1EZ4A 3R76A 4MYDA 2A4MA 1Z28A 4D9FA 16PKA 4MPRA 4M46A 1XXHB 3K2BA 1EZ1A 4WCDA 3B2NA 1K8XB 2BFNA 1MQSA 3K31A 1TTHA 3AETA 5HIJA 2RHMA 4BNDA 3L0OA 2VDOB 1RJWA 1UK8A 2OBFA 5FUWA 5K8UA 3FUCA 1JIUA 2ZJZA 3AVVA 3QLEA 4YT5A 4UDOA 4CV1A 1ZCFA 4XPIB 1PJBA 4RYDA 5E3JA 1I2DA 1F0PA 1PL0A 2OCYC 2QL9A 2R8BA 3PNLA 2H8KA 4J16A 4CTKA 3RVQA 2XE7A 2RC5A 2PUCA 3NHAA 4KGZA 1PEAA 4I9GA 1I3MA 3WE7A 3DULA 5EIOA 2Y8EA 3HVUA 4XEHA 3BFVA 3GG9A 3PDCA 5MHTA 4FX2A 1DKLA 5K51A 1Q7EA 1P18A 2VBIA 2X86A 4P5DA 1WF6A 1SFRA 2I8LA 2W7TA 2ZVJA 4OHXA 5DULA 3D7NA 1EXVA 3U62A 1ZY2A 4WJLA 2XVZA 4FONA 1HE5A 2HJ9A 3F6PA 4FZ5A 1S3FA 2OQVA 2HMSA 2ZR8A 1HURA 4ZODA 4TXJA 3FGNA 5KOIA 3FZEA 3WIEA 1ZXBA 2H17A 3CZCA 5B4UA 4CETA 3D6FA 2C96A 1FTNA 2EX1A 3F98A 3DE7X 3JS5A 3MPUA 3HP7A 2ZE6A 3OQ1A 1F9AA 1M74A 1VSQA 3W5SA 2FQYA 2MHCA 2ZIWB 1W44A 3AW8A 3R24A 5C51B 2ZCJA 1E4OA 1OGJA 2C2MA 4MA0A 3CU5A 3AQIA 3PQ6A 1QFXA 4W9NA 1ZD1A 1CY8A 1QF7A 3JZAA 3W5UA 5BOSA 1W36D 4M89A 3UXMA 1PR1A 4G5XA 1FFGA 3Q7SA 4LYFA 1WHSA 5JD3A 3LQYA 1AKTA 3H5WA 3FZGA 3L05A 4N0QA 4LF6B 2AQ8A 2AN1A 1A8QA 3RTDA 2I2CA 1JQLB 4CMCA 3GFGA 4Z99A 1O95A 4W82A 2WNSA 5DBEX 2JD2A 2ZQ5A 2XQIA 2EERA 4FD3A 3C5CA 3FYDA 1FZTA 1UJCA 5ALGA 1TTQB 1OGIA 1ZW6A 1WUYA 3LDFA 3RS4A 1AS2A 4RJJA 1Y3BE 4NYIQ 5LKAA 4PTZA 4Q4AB 4QLBA 2GEDA 2Z30A 1A96A 3QY0A 1A27A 1LDGA 4GM0A 2BOVA 5FORA 1X8KA 3I28A 1P2BA 5COQA 1JMKC 4P1ZA 5HQJA 3RUDA 3RYCB 4C89A 3TGLA 1X1CA 1G19A 3LT4A 3R0VA 1KNXA 3TW4A 3REGA 1Q17A 2XQVA 1YQ9A 4RHUA 4ERXA 4KK4A 2JGRA 4OLAA 3H1BA 3CLRC 3TJMA 4MWOA 4D43A 1W46A 3O5AA 3VFDA 3QVJA 1CW2B 1BDJA 2V7TA 3QPAA 4EEXA 5FLXA 4YAOA 1MD9A 2FPIB 3SZRA 4DV4B 1KARA 1VIVA 5FPTA 1G2OA 2B5OA 3EW7A 4GPIB 3D3KA 4CLRA 3IMKA 3T3NA 1PTKA 5CA0F 2BFFA 2FLWA 3O84A 1QHEA 1L5WA 3AY6A 3H1FA 5AKYA 3A70A 3RF6A 1WBBA 5JC1A 2HW8A 5B6PA 3D2AA 2QLNA 1DMRA 2XRFA 4GF5A 4ZO8A 2HH9A 5CPBA 3KQVA 5EYPB 4M21A 4ZCQA 2ZAGA 3HI6A 1Q21A 3KPYA 3SSOA 2YFYA 1RXCA 1DQRA 3RYIB 3BSFA 4ZHQA 4PAOA 3SC6A 3QV2A 1V11A 2K2WA 4HEQA 1RM4A 5TF4A 2H5JA 3ZI7A 4J8PA 3N8NA 4H7HA 4RV9A 4RJKA 5EJGA 1O0CA 4JODA 2WF5A 3VNSA 4LOAA 3ICEA 1T3TA 3A4TA 4EUSA 4OHPA 1B42A 1GAWA 2OAGA 3W5JA 4FMBB 2QUAA 4TX1A 5DRYA 3A7EA 5BQXA 4MR7A 3DLAA 5DMXA 1PJTA 1Y8RA 1I9GA 4HWOA 3UWPA 5J4KA 5JQGB 2BFEA 1Q0TA 3UJ3X 3U3ZA 1TEVA 1Y3CE 2OYRA 1WY5A 1UPTA 1SC4A 4LSMA 4KHZA 4QUKA 1J6UA 3BRCA 3TZLA 1NXQA 5GQSA 1E1CB 3ZEIA 3SP1A 3WFJA 2DLDA 1UKVY 3UK1A 2VC2B 1TPYA 2J32A 2ZRNA 3P20A 1W19A 3DSRA 4ISCA 4BUZA 4KMOA 4CT4B 4CM6A 2WBLC 3C3KA 3JQ7B 1Y1LA 1P9RA 2JVIA 2Z43A 4DQDA 2WOJA 3O8LA 4DN6A 3D2CA 4OQLA 4YAUA 2BGMA 2HREA 4EJMA 3L2OB 3A2MA 3DZHA 2WILA 2A6PA 4M8SA 3E2PA 4AO6A 1IJBA 2EJBA 4KO2S 2OM6A 2PZFA 1DKUA 4MWGA 4WOCA 1H85A 4B6RA 4DMGA 1DDOA 2PS9A 3OFNA 1ECFA 3MGKA 1AE1A 5FPKA 5FUMA 3EPLA 2J45A 4ABTA 4LBWA 1OQAA 2P6UA 5BRNA 1M6YA 3LXMA 3W04A 4WE3A 1BSVA 1C7RA 2IEYA 2ZRJA 2GAJA 4H3HB 2W11A 3QVUA 1KBQA 4RM2A 4B44A 1L5QA 4BWFB 4C4XA 3AYZB 2RHLA 4KXYA 1P0PA 4JI3B 3NM4A 4MYSA 4TMYA 1KK1A 2Q3BA 1CUDA 2PNJA 4BNZA 3TFWA 5EAIA 1DPFA 4PGAA 4B84A 1KAMA 1G8JA 1UM9B 1GA6A 5JZOA 3STUA 2QGZA 5IBRA 3X1ZA 1RACA 2GEFA 3HNPA 5DNWA 5DK6A 4GPEA 2GZ1A 1K4YA 3A06A 3PC3A 4EDFA 3PXXA 4WVLA 5AVOA 2CKMA 1YBFA 2EZ9A 3H4IA 2CFIA 2FCAA 1PTJA 4ML3A 1QFSA 2QKYA 4X7BA 1QWOA 4CM5A 4YLEA 3B82A 4PO1A 4YMLA 3V4FA 1B6TA 2EVWX 4OMUA 5HE8A 2G0NA 1DRJA 2AK2A 2VJKA 2Q5QA 3L7YA 4I6EA 1COWD 3RYFB 4Q3KA 5C5EA 3LPMA 1G3MA 4RORA 2GCNA 3IILA 3S68A 3Q9SA 1TOAA 3DBOB 2BFEB 2V7EA 1PUIA 4KSBA 4E7PA 2JGAA 2YWCA 4MYHA 1HDXA 2ES4A 3EVAA 4LC1A 4ER0A 2WVAA 3B6IA 3L7MA 4I9NA 4UD6A 2H9YA 3RRJA 4DZZA 1BHO1 1SU6A 2E4ZA 3AJ8A 3A1SA 3TDMA 2VJYA 2F67A 2WT4A 3I9MA 4EK9A 1WB4A 4W7IA 3L40A 5JH7A 1T8SA 3I12A 3NR2A 2J6IA 3KQPA 4KQ2A 3IP9A 2CJYA 4E33A 4S35A 2ZAIA 3A9WA 3AJDA 2OZLB 2CJWA 3LDAA 1KMHA 1ADGA 1P2DA 1D8TA 1CRPA 1JVNA 1I5EA 4BBAA 2XB8A 4PE5B 5BYBA 3HR7A 3D0RA 3ESZA 4V2IA 5BWBA 2AD5A 1F48A 2WWVD 2JAUA 4QUGA 2GN8A 1ZGHA 1Q1GA 4RD1A 2ZRGA 2PKWA 3Q7IA 3HCAA 3U81A 1S7CA 2GK7A 5LXTA 3FHLA 1RHKA 4PS0A 3ECAA 2IBTA 2H7XA 5BURA 4IO1A 1ISHA 1GUFA 3C7DB 5DHQA 5GAJA 2IBMA 3H2YA 4IDNA 4HXFB 3PFBA 1MG0A 2ECOA 3THXA 2RI0A 2PL9A 3TOSA 1A9ZA 3AIIA 1U90A 4FLMA 3EH1A 4BASA 2IKQA 5CJJA 4ALNA 2I1LA 3BIJA 4BFWA 3HSKA 2AXNA 4BVKA 5AW3A 5C4MA 4Q3AA 3B6EA 1N1EA 2G82A 1YIOA 1VOTA 3LHDA 5JPIA 4NU8X 5JSZB 2B98A 3ZBQA 4LXTA 4ZU6X 4NIMA 4YTEA 1TTTA 4V0MA 2JCVA 4WUVA 2V6IA 2ZSEA 1KIFA 3SY8A 1JIXA 1G3QA 3EARA 3MJDA 5JNRA 1EBFA 2V5VA 1CE8B 2I99A 3C3DA 3OZCA 3R6WA 1UR5A 2F3TA 1QFZA 1PDOA 1YK1A 3C6QA 3OSUA 4K3VA 3EMBA 4UNPA 3NBZC 2EZTA 2OHOA 1W0KD 1Y8RB 2J30A 5AK4A 3ANSA 2QV7A 4IDPA 5JADA 5CXXA 4JROA 4UQOA 5DGTA 1NMSA 3PTLA 2B6HA 3TN7A 1I1HA 5JPCA 1SOWA 3TPFA 1C1DA 3DUWA 3GRCA 4LZJA 4YONB 2F4VB 2BY4A 3BEOA 4BFUA 4U2KA 3FPLA 1YGYA 1EBUA 1M34B 4FJ1A 4EYEA 2WINI 5HOEA 2MOKA 2O2EA 3H0CA 2BBWA 1WSDA 3IAS1 2DFKB 3AHCA 5IKXA 1DKMA 3H5IA 4WIAA 5KMGB 2BUCA 3AONB 2CNWA 2B36A 2AEFA 4UXIA 2BYTA 3AI3A 1KDZA 4WINA 2DLCX 1KY4A 3RREA 3G8YA 3OIYA 1TM5E 3VMMA 4JC4A 1T24A 4QYXA 6YASA 3W4KA 2FMIA 1V1MA 1U1FA 1A82A 4QBHA 5D84A 1CLUA 3I3OA 3I1FA </