4V1RA

Structure of a selenomethionine derivative of the gh76 alpha- mannanase bt2949 bacteroides thetaiotaomicron
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
361
structure length
361
Chain Sequence
b'DPGVEIGNNDYYTWCKETLSVIDKDLKISGTHSYYENQDRSQVSFIWGNIFLLYTYTEGISLSKSEWSDALMNCFLNFDNYWHPNYKGIAGYATLPTSAEKVPDRFYDENGWTAIGLCDAYLATQNNSYLEKAKGALAFSLSGEDNVLGGGIYFQETFVSLPVQKNTICSAVTMLSCMKLYEITQDRQYLDAAIRINDWTVENLLDKSDNLLWDAKMVADGSVNTQKWSYNAGFMIRSWLKMYQATKDEKYLSQAKATLASSEAKWYNSINGALNDPGYFAFSIIDSWFDMYDTDKNTVWLTKAFHAINFIHNKLRDGNGRYPEHWGTPTTSNLEKYDLRFSTVAAYMYMRAANYKRILND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Structure of the Gh76 Alpha-Mannanase Homolog, Bt2949, from the Gut Symbiont Bacteroides Thetaiotaomicron
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 137
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4v1rA00
2H6IB 1H3CA 2SQCA 1N4PB 2WY8A 4GTTB 2A73B 1N4QB 1LD8B 1MZCB 1N4RB 1SA5B 4BOKA 4MU9A 2IEJB 4C1SA 2R2LB 4V1SA 5FO7B 2XQWA 4GTOB 3PZ2B 3SQCA 2V8KA 1FT1B 2WY7A 3PZ4B 1O1SB 2H6GB 3HXFB 4GTVB 4ZRPA 3HXBB 4LNGB 3DSXB 1SQCA 3K7XA 2BB6A 4GTRB 1SA4B 1GXNA 3OXUA 1H3BA 2WINB 3Q78B 4V1RA 1TN6B 3D5SA 5JPNB 4D4AA 1N4SB 2G02A 1O5MB 4KKIA 3RJ3A 1D8EB 3KSLB 4D4DA 1LD7B 2V8IA 4GTSB 3EUVB 2WIIB 4D4CA 1GSZA 3Q79B 3E30B 4ONTA 4YDEB 2XWBB 5AGDA 2H6HB 3DPYB 1HZFA 1JCRB 1NL4B 4GTPB 2B39A 3DSTB 2PMVA 1N9AB 1H39A 5FOBB 1S63B 4LNBB 3OEDA 1KZOB 4MBGB 4KKJA 3D5RA 3Q7AB 2F0YB 2I07B 1H3AA 3EU5B 2H6FB 1W6KA 1FPPB 1TN7B 2NOJA 3E32B 5FO9B 1S64B 1W6JA 1TNUB 5JPMB 1LTXB 3HXEB 3E37B 1UMPA 1O6QA 1TNBB 3PZ1B 1O1TB 1JCSB 4M76A 3E33B 3CU7A 4FXKB 1KZPB 1O1RB 3KLSA 5FO8B 3E34B 1GHQA 4BOJA 2BB5A 4EHMB 1DCEB 2GOXA 3SFXB 1H37A 1X81B 1O6RA 4FXGB 4GTMB 1GXOA 2ZISB 4D94A 3Q7FB 1O79A 1C3DA 1QSJA 4YDOB 2PN5A 4L9PB 1JCQB 4D4BA 1D8DB 3HXCB 2V3PA 3DSWB 3KQ4A 1QBQB 1TN8B 3G6JB 1TNOB 1H36A 2BEDB 3C72B 1R76A 3KSQB 3Q75B 4ZH1A 1GXMA 3Q73B 2G0DA 3DSSB 3DSUB 4LNVA 1NI1B 1TNZB 1N95B 2ZIRB 3DSVB 1N94B 4ZRQA 2BBCA 3HXDB 3DRAB 1O6HA 2V8JA 1QQFA 3PZ3B 1TNYB 2XWJB 4GTQB 2V3NA 3SFYB 1H35A 1FT2B
chains in the Genus database with same CATH superfamily
1N4PB 2NVPA 1N4QB 1MZCB 2IEJB 5ILZA 1RWFA 2XQWA 5M7YA 2WY7A 3H3KA 5DHKA 2H6GB 5IKHA 4GTVB 4ZRPA 3HXBB 3DSXB 1KWFA 4ZG8A 3M7LA 3OXUA 3SDQA 1G9JA 2QNOA 1TN6B 3W5NA 3WC3A 2G02A 1D8EB 3S4BA 1LXKA 4DODA 2FUQA 2WYNA 1N22A 1CB8A 4WU0A 1GA2A 2WIIB 3M00A 2XWBB 5AGDA 1HZFA 3AFLA 1JCRB 4Z4LA 1OJMA 3DSTB 1XWTA 1FBOA 2ONGA 3G4FA 1H39A 3SDRA 2DRRA 3P5PA 4MMHA 3D5RA 3EU5B 1H13A 1N7PA 2H6FB 1FO3A 1NXCA 1X1IA 2F6DA 2NOJA 4OK2A 5FO9B 1W6JA 1UG9A 1UT9A 3RX7A 1HN0A 3W7WA 3QPFA 1LF9A 3WIQA 3PZ1B 1O1TB 1JCSB 1N7RA 1I8QA 1J0MA 4M76A 5JMFA 3W7XA 1GHQA 3WKIA 1V7XA 2FUTA 2GOXA 2D8LA 3WKFA 2ZISB 4CJ0A 1C3DA 2PN5A 4L9PB 3RSYA 1JCQB 1KFGA 3W7UA 1F9GA 3KQ4A 3G6JB 2XFGA 4AYPA 3C72B 2G0DA 1RWCA 4LNVA 1NC5A 3M77A 1OJOA 3SDVA 3HXDB 4F13A 1N23A 1N1ZA 2V8JA 3PZ3B 1TNYB 2WDAA 2V3NA 3X17A 1KKTA 2WY8A 2SQCA 4GTTB 4OJZA 3NNBA 4NEIA 1N4RB 4BOKA 3WIRA 3ANJA 1EGUA 3QSPA 3SQCA 1FT1B 4YCRA 1V5DA 4WVCA 4LNGB 3K7XA 2BB6A 1HV6A 2ZBLA 3QG0A 3GLYA 1LF6A 2BRPA 1TF4A 2WINB 3QRYA 1X1HA 5JPNB 4D4AA 3QFZA 3N0FA 2GZ6A 4WVBA 4GL3A 5IK6A 3W7SA 1G9GA 2V8IA 1GAHA 3NFVA 3EUVB 4D4CA 2WCOA 3M7BA 1IA6A 2DROA 3A0OA 1AGMA 1KS8A 3AFJA 3M01A 3RX5A 5GZKA 1NL4B 5IL8A 4GTPB 2B39A 5M7IA 3QXFA 2PMVA 3CIHA 4DOEA 3WUXA 1KSDA 3PYBA 1DOGA 4LNBB 4CE7A 1KZOB 1FAEA 4KKJA 4AYQA 3Q7AB 2I07B 1H3AA 1HXGA 5EASA 5IK0A 1N1BA 5JMDA 3E32B 1N20A 5JPMB 1LTXB 3HXEB 4FUSA 3E37B 1UMPA 3W7TA 1O6QA 3M76A 1RWAA 3RRSA 4FXKB 3CU7A 3KLSA 1FMIA 1ULVA 2BB5A 4BOJA 3M75A 4FXGB 1F1SA 1F9OA 4OZWA 4QT9A 4AYRA 1GXOA 4D94A 3ANIA 3ANKA 3E6UA 4YDOB 2AHFA 2V3PA 1DL2A 3M02A 2ONHA 1H36A 2ZZRA 2BEDB 2B4FA 3M74A 1RWHA 2BRWA 3DSUB 2CQTA 1RWGA 1TNZB 2ZIRB 3DSVB 2BBCA 1O6HA 1G87A 3P5RA 3M72A 4GTQB 1FT2B 2E24A 4TF4A 4CJ1A 5CZLA 1H3CA 3WKGA 3TF4A 4L6XA 5ILYA 5KKBA 1HXAA 2JG0A 1N7OA 1FCEA 5C05A 3QWTA 2EADA 2FUZA 2FV0A 3PZ2B 3P2CA 5DHIA 2V8KA 4E1YA 5EATA 3HXFB 5IL3A 1CEMA 3ACTA 1SQCA 3QT3A 1SA4B 1IS9A 1X1JA 3VSMA 2FBAA 2GH4A 4WVAA 3Q78B 2J5CA 1H54A 1O5MB 1L2AA 3KSLB 1H12A 2A8ZA 4D4DA 5EAUA 1XW2A 2JF4A 5MEHA 1HM3A 3Q79B 3E30B 3S4CA 2H6HB 1WU5A 1HCUA 3E73A 3RX8A 3D3IA 1N9AB 5FOBB 1KRFA 4J5TA 4FNVA 2EAEA 3OEDA 2X03A 3E7JA 4EL8A 1FP3A 2F0YB 5IK9A 3LZ9A 1WZZA 4TXTA 1N24A 1TNUB 3GT5A 1FO2A 3SDUA 4LIXA 1LOHA 1TNBB 3S4AA 3QFYA 1X9DA 3E33B 1O1RB 4F10A 4EHMB 2JJBA 1J0NA 5GW7A 1X81B 1O6RA 3Q7FB 2OKXA 4OZVA 1O79A 1RW9A 2P0VA 4D4BA 3VSNA 1D8DB 1KSCA 5E2JA 1H14A 1KREA 2RI8A 1TN8B 4RNQA 1V7VA 2Q1FA 1R76A 3Q75B 4JJJA 4ZH1A 4L0GA 1GXMA 1N7NA 3VXDA 5CD2A 5ILKA 1NI1B 3SDTA 1N95B 1HM2A 4XUVA 4ZRQA 3DRAB 1XWQA 3ON6A 1QAZA 5ILHA 4ZH5A 1W3YA 2EACA 3M73A 3SFYB 3M7EA 1H35A 2VN4A 2DRSA 2H6IB 4OK4A 3A3VA 1RQ5A 1C82A 2A73B 1LD8B 1SA5B 3VW5A 4MU9A 4C1SA 2R2LB 4V1SA 5FO7B 3GZKA 4GTOB 3PZ4B 1O1SB 2E22A 3N0GA 4GTRB 3QT9A 3G4DA 3T33A 1GXNA 1IA7A 3PMMA 4AYOA 1H3BA 3EU8A 3WKHA 4V1RA 3D5SA 5ILDA 1N4SB 3K11A 2BRVX 4KKIA 3RJ3A 1WU4A 3PYAA 5DGRA 1LD7B 4GTSB 1GSZA 3ACSA 4ONTA 4YDEB 3DPYB 1HMUA 4KTRA 2DRQA 5GY3A 2Z07A 2CQSA 4DI5A 1WU6A 1VD5A 1HMWA 1S63B 3M78A 1OJNA 5DGQA 4MBGB 3S4DA 1F9DA 1L1YA 1K72A 3EZ8A 1AYXA 1FPPB 1W6KA 1TN7B 5CA3A 2FV1A 1S64B 4GAXA 3RENA 3QDEA 1G6IA 1GLMA 5ILIA 3S9VA 1N21A 1V7WA 3H2WA 4FJQA 4MMIA 3M71A 1N7QA 5IM1A 1KZPB 5FO8B 1V5CA 3E34B 1DCEB 1LXMA 2RI9A 2AHGA 4Q2BA 3SFXB 1H37A 4GTMB 1GAIA 2RGKA 3H7LA 1QSJA 2EABA 2AFAA 1HX9A 3HXCB 3DSWB 1OJPA 4Z4JA 2D5JA 1QBQB 1TNOB 3EQAA 4Q88A 5ILJA 2YIKA 3QXQA 3WIWA 3KSQB 4KTPA 1HXCA 1JS4A 3Q73B 3DSSB 3W5MA 3SAEA 1N94B 1CLCA 5IKAA 3E80A 2VN7A 1QQFA 3M7CA 2XWJB 1FBWA
chains in the Genus database with same CATH topology
1N4PB 2NVPA 1N4QB 1MZCB 2IEJB 2XQWA 5M7YA 2WY7A 3H3KA 2H6GB 4GTVB 4ZRPA 3HXBB 3DSXB 1KWFA 4ZG8A 3M7LA 3OXUA 3SDQA 1G9JA 2QNOA 1TN6B 3W5NA 3WC3A 2G02A 1D8EB 3S4BA 4DODA 2WYNA 4WU0A 1GA2A 2WIIB 2XWBB 5AGDA 1HZFA 1JCRB 4Z4LA 3DSTB 1XWTA 1FBOA 1H39A 3SDRA 2DRRA 3P5PA 3D5RA 3EU5B 1H13A 2H6FB 1FO3A 1NXCA 2F6DA 2NOJA 5FO9B 1W6JA 1UG9A 1UT9A 3RX7A 3W7WA 3QPFA 1LF9A 3WIQA 3PZ1B 1O1TB 1JCSB 4M76A 3W7XA 1GHQA 3WKIA 1V7XA 2GOXA 2D8LA 3WKFA 2ZISB 4CJ0A 1C3DA 2PN5A 4L9PB 3RSYA 1JCQB 1KFGA 3W7UA 3KQ4A 3G6JB 2XFGA 4AYPA 3C72B 2G0DA 4LNVA 1NC5A 3M77A 3SDVA 3HXDB 2V8JA 3PZ3B 1TNYB 2V3NA 3X17A 1KKTA 2WY8A 2SQCA 4GTTB 1N4RB 4BOKA 3WIRA 3ANJA 3QSPA 3SQCA 1FT1B 4YCRA 1V5DA 4WVCA 4LNGB 3K7XA 2BB6A 2ZBLA 3QG0A 3GLYA 1LF6A 1TF4A 2WINB 3QRYA 5JPNB 4D4AA 3QFZA 2GZ6A 4WVBA 4GL3A 3W7SA 1G9GA 2V8IA 1GAHA 3EUVB 4D4CA 3M7BA 1IA6A 2DROA 1AGMA 1KS8A 3AFJA 3RX5A 5GZKA 1NL4B 4GTPB 2B39A 5M7IA 3QXFA 2PMVA 3CIHA 4DOEA 3WUXA 1KSDA 3PYBA 1DOGA 4LNBB 4CE7A 1KZOB 1FAEA 4KKJA 4AYQA 3Q7AB 2I07B 1H3AA 3E32B 5JPMB 1LTXB 3HXEB 4FUSA 3E37B 1UMPA 3W7TA 1O6QA 3M76A 3RRSA 4FXKB 3CU7A 3KLSA 1FMIA 1ULVA 2BB5A 4BOJA 3M75A 4FXGB 1F9OA 4QT9A 4AYRA 1GXOA 4D94A 3ANIA 3ANKA 3E6UA 4YDOB 2AHFA 2V3PA 1DL2A 1H36A 2ZZRA 2BEDB 2B4FA 3M74A 3DSUB 2CQTA 1TNZB 2ZIRB 3DSVB 2BBCA 1O6HA 1G87A 3P5RA 3M72A 4GTQB 1FT2B 4TF4A 4CJ1A 5CZLA 1H3CA 3WKGA 3TF4A 4L6XA 5KKBA 2JG0A 1FCEA 3QWTA 2EADA 2FUZA 2FV0A 3PZ2B 3P2CA 2V8KA 3HXFB 1CEMA 3ACTA 1SQCA 3QT3A 1SA4B 1IS9A 2FBAA 2GH4A 4WVAA 3Q78B 1H54A 1O5MB 1L2AA 3KSLB 1H12A 2A8ZA 4D4DA 1XW2A 2JF4A 5MEHA 3Q79B 3E30B 3S4CA 2H6HB 1WU5A 1HCUA 3E73A 3RX8A 3D3IA 1N9AB 5FOBB 1KRFA 4J5TA 2EAEA 3OEDA 4EL8A 1FP3A 2F0YB 1WZZA 4TXTA 1TNUB 3GT5A 1FO2A 3SDUA 4LIXA 1TNBB 3S4AA 3QFYA 1X9DA 3E33B 1O1RB 4EHMB 2JJBA 5GW7A 1X81B 1O6RA 3Q7FB 2OKXA 1O79A 2P0VA 4D4BA 1D8DB 1KSCA 5E2JA 1H14A 1KREA 2RI8A 1TN8B 1V7VA 3Q75B 1R76A 4JJJA 4ZH1A 4L0GA 1GXMA 3VXDA 5CD2A 1NI1B 3SDTA 1N95B 4XUVA 4ZRQA 3DRAB 1XWQA 3ON6A 4ZH5A 2EACA 3M73A 3SFYB 3M7EA 1H35A 2VN4A 2DRSA 2H6IB 3A3VA 1RQ5A 2A73B 1LD8B 1SA5B 3VW5A 4MU9A 4C1SA 2R2LB 4V1SA 5FO7B 3GZKA 4GTOB 3PZ4B 1O1SB 4GTRB 3QT9A 3T33A 1GXNA 1IA7A 3PMMA 4AYOA 1H3BA 3EU8A 3WKHA 4V1RA 3D5SA 1N4SB 3K11A 4KKIA 3RJ3A 1WU4A 3PYAA 5DGRA 1LD7B 4GTSB 1GSZA 3ACSA 4ONTA 4YDEB 3DPYB 4KTRA 2DRQA 5GY3A 2Z07A 2CQSA 1WU6A 1VD5A 1S63B 3M78A 5DGQA 4MBGB 3S4DA 1F9DA 1L1YA 1K72A 3EZ8A 1AYXA 1FPPB 1W6KA 1TN7B 5CA3A 2FV1A 1S64B 3RENA 3QDEA 1G6IA 1GLMA 3S9VA 1V7WA 3H2WA 3M71A 1KZPB 5FO8B 1V5CA 3E34B 1DCEB 2RI9A 4Q2BA 2AHGA 3SFXB 1H37A 4GTMB 1GAIA 2RGKA 3H7LA 1QSJA 2EABA 2AFAA 3HXCB 3DSWB 4Z4JA 2D5JA 1QBQB 1TNOB 3EQAA 4Q88A 2YIKA 3QXQA 3WIWA 3KSQB 4KTPA 1JS4A 3Q73B 3DSSB 3W5MA 3SAEA 1N94B 1CLCA 2VN7A 1QQFA 3M7CA 2XWJB 1FBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6I B;  1H3C A;  2SQC A;  1N4P B;  2WY8 A;  4GTT B;  2A73 B;  1N4Q B;  1LD8 B;  1MZC B;  1N4R B;  1SA5 B;  4BOK A;  4MU9 A;  2IEJ B;  4C1S A;  2R2L B;  4V1S A;  5FO7 B;  2XQW A;  4GTO B;  3PZ2 B;  3SQC A;  2V8K A;  1FT1 B;  2WY7 A;  3PZ4 B;  1O1S B;  2H6G B;  3HXF B;  4GTV B;  4ZRP A;  3HXB B;  4LNG B;  3DSX B;  1SQC A;  3K7X A;  2BB6 A;  4GTR B;  1SA4 B;  1GXN A;  3OXU A;  1H3B A;  2WIN B;  3Q78 B;  4V1R A;  1TN6 B;  3D5S A;  5JPN B;  4D4A A;  1N4S B;  2G02 A;  1O5M B;  4KKI A;  3RJ3 A;  1D8E B;  3KSL B;  4D4D A;  1LD7 B;  2V8I A;  4GTS B;  3EUV B;  2WII B;  4D4C A;  1GSZ A;  3Q79 B;  3E30 B;  4ONT A;  4YDE B;  2XWB B;  5AGD A;  2H6H B;  3DPY B;  1HZF A;  1JCR B;  1NL4 B;  4GTP B;  2B39 A;  3DST B;  2PMV A;  1N9A B;  1H39 A;  5FOB B;  1S63 B;  4LNB B;  3OED A;  1KZO B;  4MBG B;  4KKJ A;  3D5R A;  3Q7A B;  2F0Y B;  2I07 B;  1H3A A;  3EU5 B;  2H6F B;  1W6K A;  1FPP B;  1TN7 B;  2NOJ A;  3E32 B;  5FO9 B;  1S64 B;  1W6J A;  1TNU B;  5JPM B;  1LTX B;  3HXE B;  3E37 B;  1UMP A;  1O6Q A;  1TNB B;  3PZ1 B;  1O1T B;  1JCS B;  4M76 A;  3E33 B;  3CU7 A;  4FXK B;  1KZP B;  1O1R B;  3KLS A;  5FO8 B;  3E34 B;  1GHQ A;  4BOJ A;  2BB5 A;  4EHM B;  1DCE B;  2GOX A;  3SFX B;  1H37 A;  1X81 B;  1O6R A;  4FXG B;  4GTM B;  1GXO A;  2ZIS B;  4D94 A;  3Q7F B;  1O79 A;  1C3D A;  1QSJ A;  4YDO B;  2PN5 A;  4L9P B;  1JCQ B;  4D4B A;  1D8D B;  3HXC B;  2V3P A;  3DSW B;  3KQ4 A;  1QBQ B;  1TN8 B;  3G6J B;  1TNO B;  1H36 A;  2BED B;  3C72 B;  1R76 A;  3KSQ B;  3Q75 B;  4ZH1 A;  1GXM A;  3Q73 B;  2G0D A;  3DSS B;  3DSU B;  4LNV A;  1NI1 B;  1TNZ B;  1N95 B;  2ZIR B;  3DSV B;  1N94 B;  4ZRQ A;  2BBC A;  3HXD B;  3DRA B;  1O6H A;  2V8J A;  1QQF A;  3PZ3 B;  1TNY B;  2XWJ B;  4GTQ B;  2V3N A;  3SFY B;  1H35 A;  1FT2 B; 
#chains in the Genus database with same CATH topology
 1N4P B;  2NVP A;  1N4Q B;  1MZC B;  2IEJ B;  5ILZ A;  1RWF A;  2XQW A;  5M7Y A;  2WY7 A;  3H3K A;  5DHK A;  2H6G B;  5IKH A;  4GTV B;  4ZRP A;  3HXB B;  3DSX B;  1KWF A;  4ZG8 A;  3M7L A;  3OXU A;  3SDQ A;  1G9J A;  2QNO A;  1TN6 B;  3W5N A;  3WC3 A;  2G02 A;  1D8E B;  3S4B A;  1LXK A;  4DOD A;  2FUQ A;  2WYN A;  1N22 A;  1CB8 A;  4WU0 A;  1GA2 A;  2WII B;  3M00 A;  2XWB B;  5AGD A;  1HZF A;  3AFL A;  1JCR B;  4Z4L A;  1OJM A;  3DST B;  1XWT A;  1FBO A;  2ONG A;  3G4F A;  1H39 A;  3SDR A;  2DRR A;  3P5P A;  4MMH A;  3D5R A;  3EU5 B;  1H13 A;  1N7P A;  2H6F B;  1FO3 A;  1NXC A;  1X1I A;  2F6D A;  2NOJ A;  4OK2 A;  5FO9 B;  1W6J A;  1UG9 A;  1UT9 A;  3RX7 A;  1HN0 A;  3W7W A;  3QPF A;  1LF9 A;  3WIQ A;  3PZ1 B;  1O1T B;  1JCS B;  1N7R A;  1I8Q A;  1J0M A;  4M76 A;  5JMF A;  3W7X A;  1GHQ A;  3WKI A;  1V7X A;  2FUT A;  2GOX A;  2D8L A;  3WKF A;  2ZIS B;  4CJ0 A;  1C3D A;  2PN5 A;  4L9P B;  3RSY A;  1JCQ B;  1KFG A;  3W7U A;  1F9G A;  3KQ4 A;  3G6J B;  2XFG A;  4AYP A;  3C72 B;  2G0D A;  1RWC A;  4LNV A;  1NC5 A;  3M77 A;  1OJO A;  3SDV A;  3HXD B;  4F13 A;  1N23 A;  1N1Z A;  2V8J A;  3PZ3 B;  1TNY B;  2WDA A;  2V3N A;  3X17 A;  1KKT A;  2WY8 A;  2SQC A;  4GTT B;  4OJZ A;  3NNB A;  4NEI A;  1N4R B;  4BOK A;  3WIR A;  3ANJ A;  1EGU A;  3QSP A;  3SQC A;  1FT1 B;  4YCR A;  1V5D A;  4WVC A;  4LNG B;  3K7X A;  2BB6 A;  1HV6 A;  2ZBL A;  3QG0 A;  3GLY A;  1LF6 A;  2BRP A;  1TF4 A;  2WIN B;  3QRY A;  1X1H A;  5JPN B;  4D4A A;  3QFZ A;  3N0F A;  2GZ6 A;  4WVB A;  4GL3 A;  5IK6 A;  3W7S A;  1G9G A;  2V8I A;  1GAH A;  3NFV A;  3EUV B;  4D4C A;  2WCO A;  3M7B A;  1IA6 A;  2DRO A;  3A0O A;  1AGM A;  1KS8 A;  3AFJ A;  3M01 A;  3RX5 A;  5GZK A;  1NL4 B;  5IL8 A;  4GTP B;  2B39 A;  5M7I A;  3QXF A;  2PMV A;  3CIH A;  4DOE A;  3WUX A;  1KSD A;  3PYB A;  1DOG A;  4LNB B;  4CE7 A;  1KZO B;  1FAE A;  4KKJ A;  4AYQ A;  3Q7A B;  2I07 B;  1H3A A;  1HXG A;  5EAS A;  5IK0 A;  1N1B A;  5JMD A;  3E32 B;  1N20 A;  5JPM B;  1LTX B;  3HXE B;  4FUS A;  3E37 B;  1UMP A;  3W7T A;  1O6Q A;  3M76 A;  1RWA A;  3RRS A;  4FXK B;  3CU7 A;  3KLS A;  1FMI A;  1ULV A;  2BB5 A;  4BOJ A;  3M75 A;  4FXG B;  1F1S A;  1F9O A;  4OZW A;  4QT9 A;  4AYR A;  1GXO A;  4D94 A;  3ANI A;  3ANK A;  3E6U A;  4YDO B;  2AHF A;  2V3P A;  1DL2 A;  3M02 A;  2ONH A;  1H36 A;  2ZZR A;  2BED B;  2B4F A;  3M74 A;  1RWH A;  2BRW A;  3DSU B;  2CQT A;  1RWG A;  1TNZ B;  2ZIR B;  3DSV B;  2BBC A;  1O6H A;  1G87 A;  3P5R A;  3M72 A;  4GTQ B;  1FT2 B;  2E24 A;  4TF4 A;  4CJ1 A;  5CZL A;  1H3C A;  3WKG A;  3TF4 A;  4L6X A;  5ILY A;  5KKB A;  1HXA A;  2JG0 A;  1N7O A;  1FCE A;  5C05 A;  3QWT A;  2EAD A;  2FUZ A;  2FV0 A;  3PZ2 B;  3P2C A;  5DHI A;  2V8K A;  4E1Y A;  5EAT A;  3HXF B;  5IL3 A;  1CEM A;  3ACT A;  1SQC A;  3QT3 A;  1SA4 B;  1IS9 A;  1X1J A;  3VSM A;  2FBA A;  2GH4 A;  4WVA A;  3Q78 B;  2J5C A;  1H54 A;  1O5M B;  1L2A A;  3KSL B;  1H12 A;  2A8Z A;  4D4D A;  5EAU A;  1XW2 A;  2JF4 A;  5MEH A;  1HM3 A;  3Q79 B;  3E30 B;  3S4C A;  2H6H B;  1WU5 A;  1HCU A;  3E73 A;  3RX8 A;  3D3I A;  1N9A B;  5FOB B;  1KRF A;  4J5T A;  4FNV A;  2EAE A;  3OED A;  2X03 A;  3E7J A;  4EL8 A;  1FP3 A;  2F0Y B;  5IK9 A;  3LZ9 A;  1WZZ A;  4TXT A;  1N24 A;  1TNU B;  3GT5 A;  1FO2 A;  3SDU A;  4LIX A;  1LOH A;  1TNB B;  3S4A A;  3QFY A;  1X9D A;  3E33 B;  1O1R B;  4F10 A;  4EHM B;  2JJB A;  1J0N A;  5GW7 A;  1X81 B;  1O6R A;  3Q7F B;  2OKX A;  4OZV A;  1O79 A;  1RW9 A;  2P0V A;  4D4B A;  3VSN A;  1D8D B;  1KSC A;  5E2J A;  1H14 A;  1KRE A;  2RI8 A;  1TN8 B;  4RNQ A;  1V7V A;  2Q1F A;  1R76 A;  3Q75 B;  4JJJ A;  4ZH1 A;  4L0G A;  1GXM A;  1N7N A;  3VXD A;  5CD2 A;  5ILK A;  1NI1 B;  3SDT A;  1N95 B;  1HM2 A;  4XUV A;  4ZRQ A;  3DRA B;  1XWQ A;  3ON6 A;  1QAZ A;  5ILH A;  4ZH5 A;  1W3Y A;  2EAC A;  3M73 A;  3SFY B;  3M7E A;  1H35 A;  2VN4 A;  2DRS A;  2H6I B;  4OK4 A;  3A3V A;  1RQ5 A;  1C82 A;  2A73 B;  1LD8 B;  1SA5 B;  3VW5 A;  4MU9 A;  4C1S A;  2R2L B;  4V1S A;  5FO7 B;  3GZK A;  4GTO B;  3PZ4 B;  1O1S B;  2E22 A;  3N0G A;  4GTR B;  3QT9 A;  3G4D A;  3T33 A;  1GXN A;  1IA7 A;  3PMM A;  4AYO A;  1H3B A;  3EU8 A;  3WKH A;  4V1R A;  3D5S A;  5ILD A;  1N4S B;  3K11 A;  2BRV X;  4KKI A;  3RJ3 A;  1WU4 A;  3PYA A;  5DGR A;  1LD7 B;  4GTS B;  1GSZ A;  3ACS A;  4ONT A;  4YDE B;  3DPY B;  1HMU A;  4KTR A;  2DRQ A;  5GY3 A;  2Z07 A;  2CQS A;  4DI5 A;  1WU6 A;  1VD5 A;  1HMW A;  1S63 B;  3M78 A;  1OJN A;  5DGQ A;  4MBG B;  3S4D A;  1F9D A;  1L1Y A;  1K72 A;  3EZ8 A;  1AYX A;  1FPP B;  1W6K A;  1TN7 B;  5CA3 A;  2FV1 A;  1S64 B;  4GAX A;  3REN A;  3QDE A;  1G6I A;  1GLM A;  5ILI A;  3S9V A;  1N21 A;  1V7W A;  3H2W A;  4FJQ A;  4MMI A;  3M71 A;  1N7Q A;  5IM1 A;  1KZP B;  5FO8 B;  1V5C A;  3E34 B;  1DCE B;  1LXM A;  2RI9 A;  2AHG A;  4Q2B A;  3SFX B;  1H37 A;  4GTM B;  1GAI A;  2RGK A;  3H7L A;  1QSJ A;  2EAB A;  2AFA A;  1HX9 A;  3HXC B;  3DSW B;  1OJP A;  4Z4J A;  2D5J A;  1QBQ B;  1TNO B;  3EQA A;  4Q88 A;  5ILJ A;  2YIK A;  3QXQ A;  3WIW A;  3KSQ B;  4KTP A;  1HXC A;  1JS4 A;  3Q73 B;  3DSS B;  3W5M A;  3SAE A;  1N94 B;  1CLC A;  5IKA A;  3E80 A;  2VN7 A;  1QQF A;  3M7C A;  2XWJ B;  1FBW A; 
#chains in the Genus database with same CATH homology
 1N4P B;  2NVP A;  1N4Q B;  1MZC B;  2IEJ B;  2XQW A;  5M7Y A;  2WY7 A;  3H3K A;  2H6G B;  4GTV B;  4ZRP A;  3HXB B;  3DSX B;  1KWF A;  4ZG8 A;  3M7L A;  3OXU A;  3SDQ A;  1G9J A;  2QNO A;  1TN6 B;  3W5N A;  3WC3 A;  2G02 A;  1D8E B;  3S4B A;  4DOD A;  2WYN A;  4WU0 A;  1GA2 A;  2WII B;  2XWB B;  5AGD A;  1HZF A;  1JCR B;  4Z4L A;  3DST B;  1XWT A;  1FBO A;  1H39 A;  3SDR A;  2DRR A;  3P5P A;  3D5R A;  3EU5 B;  1H13 A;  2H6F B;  1FO3 A;  1NXC A;  2F6D A;  2NOJ A;  5FO9 B;  1W6J A;  1UG9 A;  1UT9 A;  3RX7 A;  3W7W A;  3QPF A;  1LF9 A;  3WIQ A;  3PZ1 B;  1O1T B;  1JCS B;  4M76 A;  3W7X A;  1GHQ A;  3WKI A;  1V7X A;  2GOX A;  2D8L A;  3WKF A;  2ZIS B;  4CJ0 A;  1C3D A;  2PN5 A;  4L9P B;  3RSY A;  1JCQ B;  1KFG A;  3W7U A;  3KQ4 A;  3G6J B;  2XFG A;  4AYP A;  3C72 B;  2G0D A;  4LNV A;  1NC5 A;  3M77 A;  3SDV A;  3HXD B;  2V8J A;  3PZ3 B;  1TNY B;  2V3N A;  3X17 A;  1KKT A;  2WY8 A;  2SQC A;  4GTT B;  1N4R B;  4BOK A;  3WIR A;  3ANJ A;  3QSP A;  3SQC A;  1FT1 B;  4YCR A;  1V5D A;  4WVC A;  4LNG B;  3K7X A;  2BB6 A;  2ZBL A;  3QG0 A;  3GLY A;  1LF6 A;  1TF4 A;  2WIN B;  3QRY A;  5JPN B;  4D4A A;  3QFZ A;  2GZ6 A;  4WVB A;  4GL3 A;  3W7S A;  1G9G A;  2V8I A;  1GAH A;  3EUV B;  4D4C A;  3M7B A;  1IA6 A;  2DRO A;  1AGM A;  1KS8 A;  3AFJ A;  3RX5 A;  5GZK A;  1NL4 B;  4GTP B;  2B39 A;  5M7I A;  3QXF A;  2PMV A;  3CIH A;  4DOE A;  3WUX A;  1KSD A;  3PYB A;  1DOG A;  4LNB B;  4CE7 A;  1KZO B;  1FAE A;  4KKJ A;  4AYQ A;  3Q7A B;  2I07 B;  1H3A A;  3E32 B;  5JPM B;  1LTX B;  3HXE B;  4FUS A;  3E37 B;  1UMP A;  3W7T A;  1O6Q A;  3M76 A;  3RRS A;  4FXK B;  3CU7 A;  3KLS A;  1FMI A;  1ULV A;  2BB5 A;  4BOJ A;  3M75 A;  4FXG B;  1F9O A;  4QT9 A;  4AYR A;  1GXO A;  4D94 A;  3ANI A;  3ANK A;  3E6U A;  4YDO B;  2AHF A;  2V3P A;  1DL2 A;  1H36 A;  2ZZR A;  2BED B;  2B4F A;  3M74 A;  3DSU B;  2CQT A;  1TNZ B;  2ZIR B;  3DSV B;  2BBC A;  1O6H A;  1G87 A;  3P5R A;  3M72 A;  4GTQ B;  1FT2 B;  4TF4 A;  4CJ1 A;  5CZL A;  1H3C A;  3WKG A;  3TF4 A;  4L6X A;  5KKB A;  2JG0 A;  1FCE A;  3QWT A;  2EAD A;  2FUZ A;  2FV0 A;  3PZ2 B;  3P2C A;  2V8K A;  3HXF B;  1CEM A;  3ACT A;  1SQC A;  3QT3 A;  1SA4 B;  1IS9 A;  2FBA A;  2GH4 A;  4WVA A;  3Q78 B;  1H54 A;  1O5M B;  1L2A A;  3KSL B;  1H12 A;  2A8Z A;  4D4D A;  1XW2 A;  2JF4 A;  5MEH A;  3Q79 B;  3E30 B;  3S4C A;  2H6H B;  1WU5 A;  1HCU A;  3E73 A;  3RX8 A;  3D3I A;  1N9A B;  5FOB B;  1KRF A;  4J5T A;  2EAE A;  3OED A;  4EL8 A;  1FP3 A;  2F0Y B;  1WZZ A;  4TXT A;  1TNU B;  3GT5 A;  1FO2 A;  3SDU A;  4LIX A;  1TNB B;  3S4A A;  3QFY A;  1X9D A;  3E33 B;  1O1R B;  4EHM B;  2JJB A;  5GW7 A;  1X81 B;  1O6R A;  3Q7F B;  2OKX A;  1O79 A;  2P0V A;  4D4B A;  1D8D B;  1KSC A;  5E2J A;  1H14 A;  1KRE A;  2RI8 A;  1TN8 B;  1V7V A;  3Q75 B;  1R76 A;  4JJJ A;  4ZH1 A;  4L0G A;  1GXM A;  3VXD A;  5CD2 A;  1NI1 B;  3SDT A;  1N95 B;  4XUV A;  4ZRQ A;  3DRA B;  1XWQ A;  3ON6 A;  4ZH5 A;  2EAC A;  3M73 A;  3SFY B;  3M7E A;  1H35 A;  2VN4 A;  2DRS A;  2H6I B;  3A3V A;  1RQ5 A;  2A73 B;  1LD8 B;  1SA5 B;  3VW5 A;  4MU9 A;  4C1S A;  2R2L B;  4V1S A;  5FO7 B;  3GZK A;  4GTO B;  3PZ4 B;  1O1S B;  4GTR B;  3QT9 A;  3T33 A;  1GXN A;  1IA7 A;  3PMM A;  4AYO A;  1H3B A;  3EU8 A;  3WKH A;  4V1R A;  3D5S A;  1N4S B;  3K11 A;  4KKI A;  3RJ3 A;  1WU4 A;  3PYA A;  5DGR A;  1LD7 B;  4GTS B;  1GSZ A;  3ACS A;  4ONT A;  4YDE B;  3DPY B;  4KTR A;  2DRQ A;  5GY3 A;  2Z07 A;  2CQS A;  1WU6 A;  1VD5 A;  1S63 B;  3M78 A;  5DGQ A;  4MBG B;  3S4D A;  1F9D A;  1L1Y A;  1K72 A;  3EZ8 A;  1AYX A;  1FPP B;  1W6K A;  1TN7 B;  5CA3 A;  2FV1 A;  1S64 B;  3REN A;  3QDE A;  1G6I A;  1GLM A;  3S9V A;  1V7W A;  3H2W A;  3M71 A;  1KZP B;  5FO8 B;  1V5C A;  3E34 B;  1DCE B;  2RI9 A;  4Q2B A;  2AHG A;  3SFX B;  1H37 A;  4GTM B;  1GAI A;  2RGK A;  3H7L A;  1QSJ A;  2EAB A;  2AFA A;  3HXC B;  3DSW B;  4Z4J A;  2D5J A;  1QBQ B;  1TNO B;  3EQA A;  4Q88 A;  2YIK A;  3QXQ A;  3WIW A;  3KSQ B;  4KTP A;  1JS4 A;  3Q73 B;  3DSS B;  3W5M A;  3SAE A;  1N94 B;  1CLC A;  2VN7 A;  1QQF A;  3M7C A;  2XWJ B;  1FBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...