4V1RA

Structure of a selenomethionine derivative of the gh76 alpha- mannanase bt2949 bacteroides thetaiotaomicron
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
361
structure length
361
Chain Sequence
DPGVEIGNNDYYTWCKETLSVIDKDLKISGTHSYYENQDRSQVSFIWGNIFLLYTYTEGISLSKSEWSDALMNCFLNFDNYWHPNYKGIAGYATLPTSAEKVPDRFYDENGWTAIGLCDAYLATQNNSYLEKAKGALAFSLSGEDNVLGGGIYFQETFVSLPVQKNTICSAVTMLSCMKLYEITQDRQYLDAAIRINDWTVENLLDKSDNLLWDAKMVADGSVNTQKWSYNAGFMIRSWLKMYQATKDEKYLSQAKATLASSEAKWYNSINGALNDPGYFAFSIIDSWFDMYDTDKNTVWLTKAFHAINFIHNKLRDGNGRYPEHWGTPTTSNLEKYDLRFSTVAAYMYMRAANYKRILND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Structure of the Gh76 Alpha-Mannanase Homolog, Bt2949, from the Gut Symbiont Bacteroides Thetaiotaomicron
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 137
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4v1rA00
5FO7B 2XQWA 1KZPB 3SQCA 2V8JA 1N9AB 1TNUB 4D4DA 3E37B 1LTXB 1TN8B 1TNYB 3K7XA 5FO9B 1H39A 3EU5B 4FXKB 1LD8B 4FXGB 3DSUB 3HXEB 4GTOB 1TN6B 1NI1B 4MU9A 1W6JA 3DSSB 1H3AA 1H35A 1N4SB 3DSWB 4YDOB 1O5MB 1GXNA 4KKJA 3PZ4B 4BOJA 2F0YB 3HXBB 3D5SA 4MBGB 1D8DB 3PZ2B 2WY8A 2BEDB 5AGDA 2A73B 4M76A 3KLSA 2WIIB 1O6RA 3Q79B 5FO8B 3C72B 1N4PB 4GTTB 3DPYB 1GSZA 1KZOB 3HXCB 1LD7B 4ONTA 1S64B 3SFYB 1NL4B 4V1RA 1H36A 2BB5A 3HXDB 2NOJA 3EUVB 1MZCB 4ZH1A 1GXOA 3HXFB 3PZ3B 1TNOB 1D8EB 2ZIRB 3DRAB 4GTPB 1N94B 2H6HB 4GTRB 1S63B 1O6QA 4LNVA 1GHQA 3OXUA 2I07B 4GTVB 1JCSB 2ZISB 1FT2B 4D4CA 1SA4B 2PN5A 3PZ1B 3Q73B 1TN7B 2V3NA 2SQCA 4D4AA 1FT1B 2H6IB 1H3CA 3DSXB 2V8IA 2PMVA 2WY7A 2WINB 3KSQB 4ZRQA 4BOKA 3Q75B 1TNZB 4EHMB 2H6FB 4V1SA 2V8KA 4LNBB 4D94A 1O1RB 1QQFA 1O1TB 2XWJB 3E34B 3E33B 2G02A 3KQ4A 2R2LB 3Q7AB 4GTMB 4LNGB 2G0DA 1UMPA 3Q78B 3E32B 2GOXA 3KSLB 1C3DA 1DCEB 1O1SB 3DSVB 1R76A 1SA5B 4GTSB 3RJ3A 1W6KA 4GTQB 1QSJA 1QBQB 2BB6A 1N4RB 1O6HA 2V3PA 2B39A 2XWBB 2BBCA 3CU7A 3Q7FB 1N95B 4KKIA 4L9PB 3SFXB 4YDEB 3OEDA 5FOBB 1HZFA 1TNBB 4ZRPA 1O79A 1JCQB 3G6JB 4C1SA 1JCRB 3D5RA 1H3BA 1H37A 1FPPB 1SQCA 1GXMA 5JPNB 2IEJB 1N4QB 3DSTB 1X81B 4D4BA 5JPMB 3E30B 2H6GB
chains in the Genus database with same CATH superfamily
1ULVA 2EABA 4QT9A 5CA3A 1AGMA 3M00A 1TNUB 3K7XA 2QNOA 5CD2A 1TN6B 1NI1B 4MU9A 3E6UA 3DSSB 4YDOB 1N7PA 4KKJA 1F9GA 1HXAA 3PZ2B 4TXTA 5IK9A 5MEHA 3W5NA 5JMDA 3KLSA 5IKHA 4GTTB 4FNVA 4AYQA 1KZOB 3HXCB 1LD7B 1N1BA 3QT3A 2WCOA 4V1RA 2CQSA 1L2AA 2X03A 5IL3A 1RWAA 5GY3A 3PZ3B 1WZZA 5M7IA 1KFGA 1D8EB 1KWFA 4DI5A 1XWTA 3DRAB 3QRYA 1N94B 2H6HB 4GTRB 5EAUA 1FBWA 1O6QA 4OZWA 1J0MA 1IA7A 2JJBA 3M74A 1FT2B 3X17A 2PN5A 3S4DA 3SDTA 2YIKA 1TN7B 2SQCA 3PYBA 3A3VA 4XUVA 2DROA 1H3CA 3DSXB 2WY7A 3PMMA 5E2JA 1N7QA 3RX8A 1TNZB 4MMIA 2V8KA 4LNBB 1V5CA 2Q1FA 5ILKA 3QFYA 1FCEA 3E34B 1KKTA 3Q7AB 2FV1A 1HN0A 1X1IA 3Q78B 2FUQA 1N23A 2JG0A 1DCEB 1O1SB 1F1SA 1N24A 1R76A 3CIHA 3RJ3A 3E7JA 1N4RB 1UG9A 3EQAA 1XW2A 2GZ6A 4L9PB 2EAEA 1HZFA 3N0FA 4F10A 2CQTA 3QXFA 1H3BA 1H37A 4AYOA 1GXMA 2RGKA 3DSTB 4KTRA 2H6GB 3NNBA 1HM3A 4TF4A 5FO7B 1NC5A 1EGUA 5IKAA 5DHKA 1G9JA 2V8JA 1N9AB 3LZ9A 4D4DA 1HXGA 1TNYB 2J5CA 1NXCA 3M78A 3M71A 4FXGB 1CLCA 3DSUB 3HXEB 4GTOB 1QAZA 5EATA 4JJJA 3WKHA 1H35A 3DSWB 3EU8A 2DRSA 3HXBB 3D5SA 1D8DB 4J5TA 4M76A 1WU6A 1O6RA 3Q79B 2ZZRA 3C72B 2WYNA 3E80A 3DPYB 1V7VA 2GH4A 4NEIA 2XFGA 5GW7A 3M77A 3W7TA 3M7CA 1H36A 2NOJA 3EUVB 5CZLA 4CJ0A 3M01A 3QSPA 3HXFB 1RW9A 1TNOB 1V7WA 1J0NA 1LF6A 2ZIRB 1GA2A 3WKGA 3M7BA 3RENA 3WIWA 2I07B 3VSNA 1H14A 1SA4B 4RNQA 3RX5A 4F13A 3VSMA 3Q73B 2V3NA 1OJNA 1UT9A 4D4AA 2H6IB 4KTPA 3W7UA 2V8IA 3N0GA 3GLYA 1I8QA 2NVPA 1FP3A 1HXCA 2JF4A 1O1RB 2ONHA 1O1TB 5KKBA 3WC3A 2B4FA 1IS9A 4GTMB 1X9DA 3QG0A 2D8LA 1KREA 4OK4A 1UMPA 4OJZA 4Z4JA 3ANIA 3E32B 1C3DA 3DSVB 4LIXA 4GTSB 4Q2BA 3W5MA 1HM2A 2B39A 1FO3A 2E24A 2XWBB 4KKIA 5DGQA 3SFXB 1H12A 3OEDA 3QXQA 2BRVX 3WIRA 1KSCA 3ACSA 5IL8A 3E73A 3VXDA 4DODA 3TF4A 1N21A 2Z07A 4WVAA 1JCRB 3D5RA 1FPPB 1XWQA 1W3YA 5JPNB 3QT9A 2IEJB 4ZH5A 3M76A 2XQWA 1KZPB 3AFJA 3QWTA 1FO2A 5ILHA 3SQCA 1N7OA 1OJOA 4DOEA 1LTXB 1TN8B 3EU5B 4FXKB 1FBOA 4YCRA 5GZKA 1V7XA 4E1YA 1HX9A 2VN7A 3QDEA 5IM1A 3S4CA 2EACA 1W6JA 1LF9A 3D3IA 4L0GA 1N4SB 4CJ1A 1N7RA 1O5MB 1GXNA 1RQ5A 4BOJA 5M7YA 2A8ZA 1RWGA 2WY8A 5AGDA 2A73B 4OZVA 1HMWA 5EASA 3GT5A 1N4PB 2EADA 3WIQA 2WDAA 1GLMA 1RWFA 2FUZA 1KSDA 4ONTA 1S64B 3SDQA 1WU4A 1CB8A 5ILYA 3WKIA 1N7NA 3G4DA 4ZG8A 1K72A 3AFLA 4LNVA 3OXUA 2FV0A 4GTVB 1L1YA 5IK0A 3ACTA 3M73A 3P2CA 1FT1B 1GAHA 1LXKA 3PYAA 5C05A 4MMHA 3S9VA 3KSQB 3A0OA 5JMFA 2F6DA 2FBAA 4EHMB 2H6FB 5IK6A 1HV6A 4V1SA 3EZ8A 4D94A 4Q88A 3G4FA 3QFZA 3M75A 3WUXA 3E33B 2G02A 3KQ4A 2R2LB 3H3KA 4AYRA 5ILZA 4LNGB 2FUTA 1OJMA 1OJPA 2P0VA 4OK2A 1VD5A 1N1ZA 1QBQB 2BB6A 4WU0A 1O6HA 2V3PA 1LOHA 3ANKA 3W7XA 3Q7FB 1N95B 3NFVA 4YDEB 2RI9A 5FOBB 3W7SA 3QPFA 3SAEA 1TF4A 1TNBB 2OKXA 3M7LA 3M72A 3RRSA 4WVCA 1JCQB 3G6JB 2BRWA 3M7EA 1N4QB 1H54A 3SDUA 3SDRA 4GAXA 3K11A 3E37B 4AYPA 3P5RA 5FO9B 1H39A 1LD8B 1X1HA 1AYXA 2RI8A 3SDVA 1G87A 1H3AA 3PZ4B 3T33A 2F0YB 4MBGB 4L6XA 2VN4A 2BEDB 2WIIB 5ILIA 4FJQA 1FAEA 4FUSA 5FO8B 2ZBLA 3WKFA 1GSZA 2AHFA 1G9GA 2ONGA 3SFYB 1NL4B 1WU5A 2BB5A 3HXDB 1KRFA 4ZH1A 1MZCB 3W7WA 1GXOA 3M02A 5DHIA 4GTPB 2DRRA 1S63B 1GHQA 1H13A 3RSYA 2AFAA 1JCSB 2ZISB 3S4BA 4D4CA 1C82A 2E22A 3PZ1B 1RWCA 1FMIA 1GAIA 3VW5A 1CEMA 2PMVA 2WINB 4ZRQA 4BOKA 3Q75B 2AHGA 2D5JA 4EL8A 2BRPA 1F9OA 1QQFA 2XWJB 1N22A 4CE7A 1HMUA 1KS8A 3P5PA 1IA6A 2G0DA 5DGRA 3ON6A 2DRQA 4WVBA 1RWHA 2GOXA 1LXMA 3KSLB 1DOGA 1V5DA 1SA5B 4GL3A 1W6KA 4GTQB 1QSJA 3H2WA 1X1JA 1G6IA 2BBCA 3ANJA 3CU7A 3S4AA 4ZRPA 1O79A 4Z4LA 5ILJA 4C1SA 1JS4A 5ILDA 1SQCA 3RX7A 3GZKA 1DL2A 1F9DA 1HCUA 3H7LA 1X81B 4D4BA 5JPMB 3E30B 1N20A
chains in the Genus database with same CATH topology
1ULVA 2EABA 4QT9A 5CA3A 1AGMA 1TNUB 3K7XA 2QNOA 5CD2A 1TN6B 1NI1B 4MU9A 3E6UA 3DSSB 4YDOB 4KKJA 3PZ2B 4TXTA 5MEHA 3W5NA 3KLSA 4GTTB 4AYQA 1KZOB 3HXCB 1LD7B 3QT3A 4V1RA 2CQSA 1L2AA 5GY3A 3PZ3B 1WZZA 5M7IA 1KFGA 1D8EB 1KWFA 1XWTA 3DRAB 3QRYA 1N94B 2H6HB 4GTRB 1FBWA 1O6QA 1IA7A 2JJBA 3M74A 1FT2B 3X17A 2PN5A 3S4DA 3SDTA 2YIKA 1TN7B 2SQCA 3PYBA 3A3VA 4XUVA 2DROA 1H3CA 3DSXB 2WY7A 3PMMA 5E2JA 3RX8A 1TNZB 2V8KA 4LNBB 1V5CA 3QFYA 1FCEA 3E34B 1KKTA 3Q7AB 2FV1A 3Q78B 2JG0A 1DCEB 1O1SB 1R76A 3CIHA 3RJ3A 1N4RB 1UG9A 3EQAA 1XW2A 2GZ6A 4L9PB 2EAEA 1HZFA 2CQTA 3QXFA 1H3BA 1H37A 4AYOA 1GXMA 2RGKA 3DSTB 4KTRA 2H6GB 4TF4A 5FO7B 1NC5A 1G9JA 2V8JA 1N9AB 4D4DA 1TNYB 1NXCA 3M78A 3M71A 4FXGB 1CLCA 3DSUB 3HXEB 4GTOB 4JJJA 3WKHA 1H35A 3DSWB 3EU8A 2DRSA 3HXBB 3D5SA 1D8DB 4J5TA 4M76A 1WU6A 1O6RA 3Q79B 2ZZRA 3C72B 2WYNA 3DPYB 1V7VA 2GH4A 2XFGA 5GW7A 3M77A 3W7TA 3M7CA 1H36A 2NOJA 3EUVB 5CZLA 4CJ0A 3QSPA 3HXFB 1TNOB 1V7WA 1LF6A 2ZIRB 1GA2A 3WKGA 3M7BA 3RENA 3WIWA 2I07B 1H14A 1SA4B 3RX5A 3Q73B 2V3NA 1UT9A 4D4AA 2H6IB 4KTPA 3W7UA 2V8IA 3GLYA 2NVPA 1FP3A 2JF4A 1O1RB 1O1TB 5KKBA 3WC3A 2B4FA 1IS9A 4GTMB 1X9DA 3QG0A 2D8LA 1KREA 1UMPA 4Z4JA 3ANIA 3E32B 1C3DA 3DSVB 4LIXA 4GTSB 4Q2BA 3W5MA 2B39A 1FO3A 2XWBB 4KKIA 5DGQA 3SFXB 1H12A 3OEDA 3QXQA 4DODA 3WIRA 1KSCA 3ACSA 3VXDA 3E73A 3TF4A 2Z07A 4WVAA 1JCRB 3D5RA 1FPPB 1XWQA 5JPNB 3QT9A 2IEJB 4ZH5A 3M76A 2XQWA 1KZPB 3AFJA 3QWTA 1FO2A 3SQCA 4DOEA 1LTXB 1TN8B 3EU5B 4FXKB 1FBOA 4YCRA 5GZKA 1V7XA 2VN7A 3QDEA 3S4CA 2EACA 1W6JA 1LF9A 3D3IA 4L0GA 1N4SB 4CJ1A 1O5MB 1GXNA 1RQ5A 4BOJA 5M7YA 2A8ZA 2WY8A 5AGDA 2A73B 3GT5A 1N4PB 2EADA 3WIQA 1GLMA 2FUZA 1KSDA 4ONTA 1S64B 3SDQA 1WU4A 3WKIA 4ZG8A 1K72A 4LNVA 3OXUA 2FV0A 4GTVB 1L1YA 3ACTA 3M73A 3P2CA 1FT1B 1GAHA 3PYAA 3S9VA 3KSQB 2F6DA 2FBAA 4EHMB 2H6FB 4V1SA 3EZ8A 4D94A 4Q88A 3QFZA 3M75A 3WUXA 3E33B 2G02A 3KQ4A 2R2LB 3H3KA 4AYRA 4LNGB 2P0VA 1VD5A 1QBQB 2BB6A 4WU0A 1O6HA 2V3PA 3ANKA 3W7XA 3Q7FB 1N95B 4YDEB 2RI9A 5FOBB 3W7SA 3QPFA 3SAEA 1TF4A 1TNBB 2OKXA 3M7LA 3M72A 3RRSA 4WVCA 1JCQB 3G6JB 3M7EA 1N4QB 1H54A 3SDUA 3SDRA 3K11A 3E37B 4AYPA 3P5RA 5FO9B 1H39A 1LD8B 1AYXA 2RI8A 3SDVA 1G87A 1H3AA 3PZ4B 3T33A 2F0YB 4MBGB 4L6XA 2VN4A 2BEDB 2WIIB 1FAEA 4FUSA 5FO8B 2ZBLA 3WKFA 1GSZA 2AHFA 1G9GA 3SFYB 1NL4B 1WU5A 2BB5A 3HXDB 1KRFA 4ZH1A 1MZCB 3W7WA 1GXOA 4GTPB 2DRRA 1S63B 1GHQA 1H13A 3RSYA 2AFAA 1JCSB 2ZISB 3S4BA 4D4CA 3PZ1B 1FMIA 1GAIA 3VW5A 1CEMA 2PMVA 2WINB 4ZRQA 4BOKA 3Q75B 2AHGA 2D5JA 4EL8A 1F9OA 1QQFA 2XWJB 4CE7A 1KS8A 3P5PA 1IA6A 2G0DA 5DGRA 3ON6A 2DRQA 4WVBA 2GOXA 3KSLB 1DOGA 1V5DA 1SA5B 4GL3A 1W6KA 4GTQB 1QSJA 3H2WA 1G6IA 2BBCA 3ANJA 3CU7A 3S4AA 4ZRPA 1O79A 4Z4LA 4C1SA 1JS4A 1SQCA 3RX7A 3GZKA 1DL2A 1F9DA 1HCUA 3H7LA 1X81B 4D4BA 5JPMB 3E30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO7 B;  2XQW A;  1KZP B;  3SQC A;  2V8J A;  1N9A B;  1TNU B;  4D4D A;  3E37 B;  1LTX B;  1TN8 B;  1TNY B;  3K7X A;  5FO9 B;  1H39 A;  3EU5 B;  4FXK B;  1LD8 B;  4FXG B;  3DSU B;  3HXE B;  4GTO B;  1TN6 B;  1NI1 B;  4MU9 A;  1W6J A;  3DSS B;  1H3A A;  1H35 A;  1N4S B;  3DSW B;  4YDO B;  1O5M B;  1GXN A;  4KKJ A;  3PZ4 B;  4BOJ A;  2F0Y B;  3HXB B;  3D5S A;  4MBG B;  1D8D B;  3PZ2 B;  2WY8 A;  2BED B;  5AGD A;  2A73 B;  4M76 A;  3KLS A;  2WII B;  1O6R A;  3Q79 B;  5FO8 B;  3C72 B;  1N4P B;  4GTT B;  3DPY B;  1GSZ A;  1KZO B;  3HXC B;  1LD7 B;  4ONT A;  1S64 B;  3SFY B;  1NL4 B;  4V1R A;  1H36 A;  2BB5 A;  3HXD B;  2NOJ A;  3EUV B;  1MZC B;  4ZH1 A;  1GXO A;  3HXF B;  3PZ3 B;  1TNO B;  1D8E B;  2ZIR B;  3DRA B;  4GTP B;  1N94 B;  2H6H B;  4GTR B;  1S63 B;  1O6Q A;  4LNV A;  1GHQ A;  3OXU A;  2I07 B;  4GTV B;  1JCS B;  2ZIS B;  1FT2 B;  4D4C A;  1SA4 B;  2PN5 A;  3PZ1 B;  3Q73 B;  1TN7 B;  2V3N A;  2SQC A;  4D4A A;  1FT1 B;  2H6I B;  1H3C A;  3DSX B;  2V8I A;  2PMV A;  2WY7 A;  2WIN B;  3KSQ B;  4ZRQ A;  4BOK A;  3Q75 B;  1TNZ B;  4EHM B;  2H6F B;  4V1S A;  2V8K A;  4LNB B;  4D94 A;  1O1R B;  1QQF A;  1O1T B;  2XWJ B;  3E34 B;  3E33 B;  2G02 A;  3KQ4 A;  2R2L B;  3Q7A B;  4GTM B;  4LNG B;  2G0D A;  1UMP A;  3Q78 B;  3E32 B;  2GOX A;  3KSL B;  1C3D A;  1DCE B;  1O1S B;  3DSV B;  1R76 A;  1SA5 B;  4GTS B;  3RJ3 A;  1W6K A;  4GTQ B;  1QSJ A;  1QBQ B;  2BB6 A;  1N4R B;  1O6H A;  2V3P A;  2B39 A;  2XWB B;  2BBC A;  3CU7 A;  3Q7F B;  1N95 B;  4KKI A;  4L9P B;  3SFX B;  4YDE B;  3OED A;  5FOB B;  1HZF A;  1TNB B;  4ZRP A;  1O79 A;  1JCQ B;  3G6J B;  4C1S A;  1JCR B;  3D5R A;  1H3B A;  1H37 A;  1FPP B;  1SQC A;  1GXM A;  5JPN B;  2IEJ B;  1N4Q B;  3DST B;  1X81 B;  4D4B A;  5JPM B;  3E30 B;  2H6G B; 
#chains in the Genus database with same CATH topology
 1ULV A;  2EAB A;  4QT9 A;  5CA3 A;  1AGM A;  3M00 A;  1TNU B;  3K7X A;  2QNO A;  5CD2 A;  1TN6 B;  1NI1 B;  4MU9 A;  3E6U A;  3DSS B;  4YDO B;  1N7P A;  4KKJ A;  1F9G A;  1HXA A;  3PZ2 B;  4TXT A;  5IK9 A;  5MEH A;  3W5N A;  5JMD A;  3KLS A;  5IKH A;  4GTT B;  4FNV A;  4AYQ A;  1KZO B;  3HXC B;  1LD7 B;  1N1B A;  3QT3 A;  2WCO A;  4V1R A;  2CQS A;  1L2A A;  2X03 A;  5IL3 A;  1RWA A;  5GY3 A;  3PZ3 B;  1WZZ A;  5M7I A;  1KFG A;  1D8E B;  1KWF A;  4DI5 A;  1XWT A;  3DRA B;  3QRY A;  1N94 B;  2H6H B;  4GTR B;  5EAU A;  1FBW A;  1O6Q A;  4OZW A;  1J0M A;  1IA7 A;  2JJB A;  3M74 A;  1FT2 B;  3X17 A;  2PN5 A;  3S4D A;  3SDT A;  2YIK A;  1TN7 B;  2SQC A;  3PYB A;  3A3V A;  4XUV A;  2DRO A;  1H3C A;  3DSX B;  2WY7 A;  3PMM A;  5E2J A;  1N7Q A;  3RX8 A;  1TNZ B;  4MMI A;  2V8K A;  4LNB B;  1V5C A;  2Q1F A;  5ILK A;  3QFY A;  1FCE A;  3E34 B;  1KKT A;  3Q7A B;  2FV1 A;  1HN0 A;  1X1I A;  3Q78 B;  2FUQ A;  1N23 A;  2JG0 A;  1DCE B;  1O1S B;  1F1S A;  1N24 A;  1R76 A;  3CIH A;  3RJ3 A;  3E7J A;  1N4R B;  1UG9 A;  3EQA A;  1XW2 A;  2GZ6 A;  4L9P B;  2EAE A;  1HZF A;  3N0F A;  4F10 A;  2CQT A;  3QXF A;  1H3B A;  1H37 A;  4AYO A;  1GXM A;  2RGK A;  3DST B;  4KTR A;  2H6G B;  3NNB A;  1HM3 A;  4TF4 A;  5FO7 B;  1NC5 A;  1EGU A;  5IKA A;  5DHK A;  1G9J A;  2V8J A;  1N9A B;  3LZ9 A;  4D4D A;  1HXG A;  1TNY B;  2J5C A;  1NXC A;  3M78 A;  3M71 A;  4FXG B;  1CLC A;  3DSU B;  3HXE B;  4GTO B;  1QAZ A;  5EAT A;  4JJJ A;  3WKH A;  1H35 A;  3DSW B;  3EU8 A;  2DRS A;  3HXB B;  3D5S A;  1D8D B;  4J5T A;  4M76 A;  1WU6 A;  1O6R A;  3Q79 B;  2ZZR A;  3C72 B;  2WYN A;  3E80 A;  3DPY B;  1V7V A;  2GH4 A;  4NEI A;  2XFG A;  5GW7 A;  3M77 A;  3W7T A;  3M7C A;  1H36 A;  2NOJ A;  3EUV B;  5CZL A;  4CJ0 A;  3M01 A;  3QSP A;  3HXF B;  1RW9 A;  1TNO B;  1V7W A;  1J0N A;  1LF6 A;  2ZIR B;  1GA2 A;  3WKG A;  3M7B A;  3REN A;  3WIW A;  2I07 B;  3VSN A;  1H14 A;  1SA4 B;  4RNQ A;  3RX5 A;  4F13 A;  3VSM A;  3Q73 B;  2V3N A;  1OJN A;  1UT9 A;  4D4A A;  2H6I B;  4KTP A;  3W7U A;  2V8I A;  3N0G A;  3GLY A;  1I8Q A;  2NVP A;  1FP3 A;  1HXC A;  2JF4 A;  1O1R B;  2ONH A;  1O1T B;  5KKB A;  3WC3 A;  2B4F A;  1IS9 A;  4GTM B;  1X9D A;  3QG0 A;  2D8L A;  1KRE A;  4OK4 A;  1UMP A;  4OJZ A;  4Z4J A;  3ANI A;  3E32 B;  1C3D A;  3DSV B;  4LIX A;  4GTS B;  4Q2B A;  3W5M A;  1HM2 A;  2B39 A;  1FO3 A;  2E24 A;  2XWB B;  4KKI A;  5DGQ A;  3SFX B;  1H12 A;  3OED A;  3QXQ A;  2BRV X;  3WIR A;  1KSC A;  3ACS A;  5IL8 A;  3E73 A;  3VXD A;  4DOD A;  3TF4 A;  1N21 A;  2Z07 A;  4WVA A;  1JCR B;  3D5R A;  1FPP B;  1XWQ A;  1W3Y A;  5JPN B;  3QT9 A;  2IEJ B;  4ZH5 A;  3M76 A;  2XQW A;  1KZP B;  3AFJ A;  3QWT A;  1FO2 A;  5ILH A;  3SQC A;  1N7O A;  1OJO A;  4DOE A;  1LTX B;  1TN8 B;  3EU5 B;  4FXK B;  1FBO A;  4YCR A;  5GZK A;  1V7X A;  4E1Y A;  1HX9 A;  2VN7 A;  3QDE A;  5IM1 A;  3S4C A;  2EAC A;  1W6J A;  1LF9 A;  3D3I A;  4L0G A;  1N4S B;  4CJ1 A;  1N7R A;  1O5M B;  1GXN A;  1RQ5 A;  4BOJ A;  5M7Y A;  2A8Z A;  1RWG A;  2WY8 A;  5AGD A;  2A73 B;  4OZV A;  1HMW A;  5EAS A;  3GT5 A;  1N4P B;  2EAD A;  3WIQ A;  2WDA A;  1GLM A;  1RWF A;  2FUZ A;  1KSD A;  4ONT A;  1S64 B;  3SDQ A;  1WU4 A;  1CB8 A;  5ILY A;  3WKI A;  1N7N A;  3G4D A;  4ZG8 A;  1K72 A;  3AFL A;  4LNV A;  3OXU A;  2FV0 A;  4GTV B;  1L1Y A;  5IK0 A;  3ACT A;  3M73 A;  3P2C A;  1FT1 B;  1GAH A;  1LXK A;  3PYA A;  5C05 A;  4MMH A;  3S9V A;  3KSQ B;  3A0O A;  5JMF A;  2F6D A;  2FBA A;  4EHM B;  2H6F B;  5IK6 A;  1HV6 A;  4V1S A;  3EZ8 A;  4D94 A;  4Q88 A;  3G4F A;  3QFZ A;  3M75 A;  3WUX A;  3E33 B;  2G02 A;  3KQ4 A;  2R2L B;  3H3K A;  4AYR A;  5ILZ A;  4LNG B;  2FUT A;  1OJM A;  1OJP A;  2P0V A;  4OK2 A;  1VD5 A;  1N1Z A;  1QBQ B;  2BB6 A;  4WU0 A;  1O6H A;  2V3P A;  1LOH A;  3ANK A;  3W7X A;  3Q7F B;  1N95 B;  3NFV A;  4YDE B;  2RI9 A;  5FOB B;  3W7S A;  3QPF A;  3SAE A;  1TF4 A;  1TNB B;  2OKX A;  3M7L A;  3M72 A;  3RRS A;  4WVC A;  1JCQ B;  3G6J B;  2BRW A;  3M7E A;  1N4Q B;  1H54 A;  3SDU A;  3SDR A;  4GAX A;  3K11 A;  3E37 B;  4AYP A;  3P5R A;  5FO9 B;  1H39 A;  1LD8 B;  1X1H A;  1AYX A;  2RI8 A;  3SDV A;  1G87 A;  1H3A A;  3PZ4 B;  3T33 A;  2F0Y B;  4MBG B;  4L6X A;  2VN4 A;  2BED B;  2WII B;  5ILI A;  4FJQ A;  1FAE A;  4FUS A;  5FO8 B;  2ZBL A;  3WKF A;  1GSZ A;  2AHF A;  1G9G A;  2ONG A;  3SFY B;  1NL4 B;  1WU5 A;  2BB5 A;  3HXD B;  1KRF A;  4ZH1 A;  1MZC B;  3W7W A;  1GXO A;  3M02 A;  5DHI A;  4GTP B;  2DRR A;  1S63 B;  1GHQ A;  1H13 A;  3RSY A;  2AFA A;  1JCS B;  2ZIS B;  3S4B A;  4D4C A;  1C82 A;  2E22 A;  3PZ1 B;  1RWC A;  1FMI A;  1GAI A;  3VW5 A;  1CEM A;  2PMV A;  2WIN B;  4ZRQ A;  4BOK A;  3Q75 B;  2AHG A;  2D5J A;  4EL8 A;  2BRP A;  1F9O A;  1QQF A;  2XWJ B;  1N22 A;  4CE7 A;  1HMU A;  1KS8 A;  3P5P A;  1IA6 A;  2G0D A;  5DGR A;  3ON6 A;  2DRQ A;  4WVB A;  1RWH A;  2GOX A;  1LXM A;  3KSL B;  1DOG A;  1V5D A;  1SA5 B;  4GL3 A;  1W6K A;  4GTQ B;  1QSJ A;  3H2W A;  1X1J A;  1G6I A;  2BBC A;  3ANJ A;  3CU7 A;  3S4A A;  4ZRP A;  1O79 A;  4Z4L A;  5ILJ A;  4C1S A;  1JS4 A;  5ILD A;  1SQC A;  3RX7 A;  3GZK A;  1DL2 A;  1F9D A;  1HCU A;  3H7L A;  1X81 B;  4D4B A;  5JPM B;  3E30 B;  1N20 A; 
#chains in the Genus database with same CATH homology
 1ULV A;  2EAB A;  4QT9 A;  5CA3 A;  1AGM A;  1TNU B;  3K7X A;  2QNO A;  5CD2 A;  1TN6 B;  1NI1 B;  4MU9 A;  3E6U A;  3DSS B;  4YDO B;  4KKJ A;  3PZ2 B;  4TXT A;  5MEH A;  3W5N A;  3KLS A;  4GTT B;  4AYQ A;  1KZO B;  3HXC B;  1LD7 B;  3QT3 A;  4V1R A;  2CQS A;  1L2A A;  5GY3 A;  3PZ3 B;  1WZZ A;  5M7I A;  1KFG A;  1D8E B;  1KWF A;  1XWT A;  3DRA B;  3QRY A;  1N94 B;  2H6H B;  4GTR B;  1FBW A;  1O6Q A;  1IA7 A;  2JJB A;  3M74 A;  1FT2 B;  3X17 A;  2PN5 A;  3S4D A;  3SDT A;  2YIK A;  1TN7 B;  2SQC A;  3PYB A;  3A3V A;  4XUV A;  2DRO A;  1H3C A;  3DSX B;  2WY7 A;  3PMM A;  5E2J A;  3RX8 A;  1TNZ B;  2V8K A;  4LNB B;  1V5C A;  3QFY A;  1FCE A;  3E34 B;  1KKT A;  3Q7A B;  2FV1 A;  3Q78 B;  2JG0 A;  1DCE B;  1O1S B;  1R76 A;  3CIH A;  3RJ3 A;  1N4R B;  1UG9 A;  3EQA A;  1XW2 A;  2GZ6 A;  4L9P B;  2EAE A;  1HZF A;  2CQT A;  3QXF A;  1H3B A;  1H37 A;  4AYO A;  1GXM A;  2RGK A;  3DST B;  4KTR A;  2H6G B;  4TF4 A;  5FO7 B;  1NC5 A;  1G9J A;  2V8J A;  1N9A B;  4D4D A;  1TNY B;  1NXC A;  3M78 A;  3M71 A;  4FXG B;  1CLC A;  3DSU B;  3HXE B;  4GTO B;  4JJJ A;  3WKH A;  1H35 A;  3DSW B;  3EU8 A;  2DRS A;  3HXB B;  3D5S A;  1D8D B;  4J5T A;  4M76 A;  1WU6 A;  1O6R A;  3Q79 B;  2ZZR A;  3C72 B;  2WYN A;  3DPY B;  1V7V A;  2GH4 A;  2XFG A;  5GW7 A;  3M77 A;  3W7T A;  3M7C A;  1H36 A;  2NOJ A;  3EUV B;  5CZL A;  4CJ0 A;  3QSP A;  3HXF B;  1TNO B;  1V7W A;  1LF6 A;  2ZIR B;  1GA2 A;  3WKG A;  3M7B A;  3REN A;  3WIW A;  2I07 B;  1H14 A;  1SA4 B;  3RX5 A;  3Q73 B;  2V3N A;  1UT9 A;  4D4A A;  2H6I B;  4KTP A;  3W7U A;  2V8I A;  3GLY A;  2NVP A;  1FP3 A;  2JF4 A;  1O1R B;  1O1T B;  5KKB A;  3WC3 A;  2B4F A;  1IS9 A;  4GTM B;  1X9D A;  3QG0 A;  2D8L A;  1KRE A;  1UMP A;  4Z4J A;  3ANI A;  3E32 B;  1C3D A;  3DSV B;  4LIX A;  4GTS B;  4Q2B A;  3W5M A;  2B39 A;  1FO3 A;  2XWB B;  4KKI A;  5DGQ A;  3SFX B;  1H12 A;  3OED A;  3QXQ A;  4DOD A;  3WIR A;  1KSC A;  3ACS A;  3VXD A;  3E73 A;  3TF4 A;  2Z07 A;  4WVA A;  1JCR B;  3D5R A;  1FPP B;  1XWQ A;  5JPN B;  3QT9 A;  2IEJ B;  4ZH5 A;  3M76 A;  2XQW A;  1KZP B;  3AFJ A;  3QWT A;  1FO2 A;  3SQC A;  4DOE A;  1LTX B;  1TN8 B;  3EU5 B;  4FXK B;  1FBO A;  4YCR A;  5GZK A;  1V7X A;  2VN7 A;  3QDE A;  3S4C A;  2EAC A;  1W6J A;  1LF9 A;  3D3I A;  4L0G A;  1N4S B;  4CJ1 A;  1O5M B;  1GXN A;  1RQ5 A;  4BOJ A;  5M7Y A;  2A8Z A;  2WY8 A;  5AGD A;  2A73 B;  3GT5 A;  1N4P B;  2EAD A;  3WIQ A;  1GLM A;  2FUZ A;  1KSD A;  4ONT A;  1S64 B;  3SDQ A;  1WU4 A;  3WKI A;  4ZG8 A;  1K72 A;  4LNV A;  3OXU A;  2FV0 A;  4GTV B;  1L1Y A;  3ACT A;  3M73 A;  3P2C A;  1FT1 B;  1GAH A;  3PYA A;  3S9V A;  3KSQ B;  2F6D A;  2FBA A;  4EHM B;  2H6F B;  4V1S A;  3EZ8 A;  4D94 A;  4Q88 A;  3QFZ A;  3M75 A;  3WUX A;  3E33 B;  2G02 A;  3KQ4 A;  2R2L B;  3H3K A;  4AYR A;  4LNG B;  2P0V A;  1VD5 A;  1QBQ B;  2BB6 A;  4WU0 A;  1O6H A;  2V3P A;  3ANK A;  3W7X A;  3Q7F B;  1N95 B;  4YDE B;  2RI9 A;  5FOB B;  3W7S A;  3QPF A;  3SAE A;  1TF4 A;  1TNB B;  2OKX A;  3M7L A;  3M72 A;  3RRS A;  4WVC A;  1JCQ B;  3G6J B;  3M7E A;  1N4Q B;  1H54 A;  3SDU A;  3SDR A;  3K11 A;  3E37 B;  4AYP A;  3P5R A;  5FO9 B;  1H39 A;  1LD8 B;  1AYX A;  2RI8 A;  3SDV A;  1G87 A;  1H3A A;  3PZ4 B;  3T33 A;  2F0Y B;  4MBG B;  4L6X A;  2VN4 A;  2BED B;  2WII B;  1FAE A;  4FUS A;  5FO8 B;  2ZBL A;  3WKF A;  1GSZ A;  2AHF A;  1G9G A;  3SFY B;  1NL4 B;  1WU5 A;  2BB5 A;  3HXD B;  1KRF A;  4ZH1 A;  1MZC B;  3W7W A;  1GXO A;  4GTP B;  2DRR A;  1S63 B;  1GHQ A;  1H13 A;  3RSY A;  2AFA A;  1JCS B;  2ZIS B;  3S4B A;  4D4C A;  3PZ1 B;  1FMI A;  1GAI A;  3VW5 A;  1CEM A;  2PMV A;  2WIN B;  4ZRQ A;  4BOK A;  3Q75 B;  2AHG A;  2D5J A;  4EL8 A;  1F9O A;  1QQF A;  2XWJ B;  4CE7 A;  1KS8 A;  3P5P A;  1IA6 A;  2G0D A;  5DGR A;  3ON6 A;  2DRQ A;  4WVB A;  2GOX A;  3KSL B;  1DOG A;  1V5D A;  1SA5 B;  4GL3 A;  1W6K A;  4GTQ B;  1QSJ A;  3H2W A;  1G6I A;  2BBC A;  3ANJ A;  3CU7 A;  3S4A A;  4ZRP A;  1O79 A;  4Z4L A;  4C1S A;  1JS4 A;  1SQC A;  3RX7 A;  3GZK A;  1DL2 A;  1F9D A;  1HCU A;  3H7L A;  1X81 B;  4D4B A;  5JPM B;  3E30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...