4V1SA

Structure of the gh76 alpha-mannanase bt2949 from bacteroides thetaiotaomicron
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
359
structure length
359
Chain Sequence
PGVEIGNNDYYTWCKETLSVIDKDLKISGTHSYYENQDRSQVSFIWGNIFLLYTYTEGISLSKSEWSDALMNCFLNFDNYWHPNYKGIAGYATLPTSAEKVPDRFYDENGWTAIGLCDAYLATQNNSYLEKAKGALAFSLSGEDNVLGGGIYFQETFVSLPVQKNTICSAVTMLSCMKLYEITQDRQYLDAAIRINDWTVENLLDKSDNLLWDAKMVADGSVNTQKWSYNAGFMIRSWLKMYQATKDEKYLSQAKATLASSEAKWYNSINGALNDPGYFAFSIIDSWFDMYDTDKNTVWLTKAFHAINFIHNKLRDGNGRYPEHWGTPTTSNLEKYDLRFSTVAAYMYMRAANYKRILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Structure of the Gh76 Alpha-Mannanase Homolog, Bt2949, from the Gut Symbiont Bacteroides Thetaiotaomicron
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 151
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4v1sA00
5JPNB 1QBQB 1JCQB 3DSTB 4YDOB 4ZH1A 2WINB 3KLSA 4GTSB 3PZ2B 3Q78B 1H39A 3E34B 1N94B 2A73B 2V3PA 5JPMB 1O6HA 4GTMB 2WY7A 3E33B 1N9AB 3OEDA 1H35A 4D4CA 1O1RB 4FXKB 1X81B 1TN8B 1H37A 3HXEB 1C3DA 2PN5A 4D94A 1H3AA 3E37B 2H6GB 3DPYB 1TNBB 4GTVB 3SFXB 3DSXB 2BBCA 3RJ3A 4LNBB 1O6RA 1QQFA 2ZISB 1GSZA 3EUVB 1W6KA 3CU7A 1TNOB 1N4QB 3K7XA 1TNUB 1TNYB 1KZPB 3G6JB 4ONTA 2BB5A 1KZOB 3D5SA 2H6IB 1FPPB 1R76A 1O1SB 1GXMA 1TN6B 1UMPA 1LD7B 3Q7AB 3Q7FB 4KKIA 1MZCB 1JCSB 1D8EB 1TNZB 2IEJB 3KQ4A 1O5MB 2B39A 2G0DA 1S64B 1TN7B 5FO8B 3HXDB 2WY8A 4LNVA 3E32B 1JCRB 2V8JA 4D4BA 1H3CA 1GXNA 2V3NA 1FT1B 4D4DA 1FT2B 1GXOA 3SFYB 5AGDA 3KSLB 4D4AA 2WIIB 3PZ3B 1D8DB 1NL4B 1GHQA 3Q75B 1H3BA 3HXBB 4L9PB 2XWJB 1N4SB 3KSQB 3D5RA 3PZ4B 3HXCB 3EU5B 2V8KA 1O6QA 1LTXB 1W6JA 1QSJA 2PMVA 2BEDB 4GTTB 4M76A 1N4RB 5FOBB 2H6FB 2XQWA 1SA5B 3PZ1B 4YDEB 4BOJA 3DSWB 2ZIRB 3OXUA 3Q79B 1LD8B 4MU9A 1HZFA 4GTPB 2G02A 4FXGB 4GTOB 1SA4B 1DCEB 2BB6A 2H6HB 2I07B 3SQCA 4EHMB 2V8IA 4BOKA 2NOJA 3DRAB 4V1RA 1SQCA 2R2LB 1H36A 1N95B 2XWBB 4V1SA 4C1SA 4ZRPA 4ZRQA 3DSSB 3DSUB 5FO9B 1NI1B 3HXFB 4MBGB 5FO7B 3DSVB 2F0YB 3C72B 3Q73B 4GTRB 1S63B 2GOXA 1N4PB 4KKJA 1O1TB 1O79A 4GTQB 3E30B 4LNGB 2SQCA
chains in the Genus database with same CATH superfamily
1QBQB 2BRPA 3S4AA 2FV1A 2WINB 2J5CA 4GTSB 3Q78B 2D5JA 3E34B 1OJPA 1F9OA 3ACSA 2AHGA 3P5PA 3M71A 4D4CA 3P2CA 1HX9A 1I8QA 1X81B 3HXEB 4MMIA 1N24A 1F9DA 4D94A 2H6GB 1TNBB 4GTVB 3DSXB 2BBCA 3M01A 3W7TA 1HXGA 3TF4A 1GSZA 1W6KA 1N4QB 4Q2BA 5ILZA 5EASA 1TNUB 3E80A 4DODA 4ONTA 1X1IA 1KZOB 1WU6A 1DOGA 1GXMA 3Q7AB 1X9DA 1D8EB 4XUVA 1TN7B 1IA6A 1KSDA 3HXDB 3N0FA 1JCRB 4GAXA 1H14A 2ONHA 1NL4B 1OJMA 3AFLA 1N23A 4OJZA 1V7WA 2CQTA 3HXCB 1TF4A 1FBOA 1O6QA 1KWFA 1W6JA 1QSJA 2XFGA 2PMVA 2XQWA 1SA5B 1CLCA 3ACTA 4BOJA 2RI8A 1DL2A 1LD8B 3M7LA 2Q1FA 5IK0A 5DHKA 3CIHA 4DOEA 3G4FA 1F1SA 3QG0A 1ULVA 1V7XA 3QT3A 2RGKA 1N95B 5EAUA 4ZRPA 4ZRQA 1GA2A 5FO7B 4GL3A 3EZ8A 2NVPA 2F0YB 3C72B 3Q73B 5DGQA 2E22A 1O1TB 2ZBLA 3SDRA 1LOHA 1JCQB 4YDOB 1QAZA 3S4BA 1N1ZA 2BRVX 1HXCA 1KSCA 2GH4A 4FNVA 3QXFA 1H39A 4ZG8A 2FV0A 3H3KA 1N94B 2A73B 2V3PA 5JPMB 1FO2A 1N9AB 3OEDA 1H35A 4NEIA 3WKGA 3RX8A 2JG0A 1EGUA 4WVBA 4DI5A 3GZKA 2B4FA 5KKBA 3WUXA 5ILDA 3VW5A 2JF4A 3RJ3A 1HMWA 5IK9A 2OKXA 3A3VA 1O6RA 2ZISB 1KRFA 2P0VA 5M7YA 1GAHA 1KZPB 3G6JB 1RWAA 2BB5A 1FPPB 4L6XA 1TN6B 1NXCA 3Q7FB 4KKIA 2ZZRA 1V7VA 1JCSB 1G87A 5CZLA 1O5MB 2G0DA 5M7IA 1RW9A 1J0NA 2FUQA 4LNVA 1FP3A 1UT9A 2V8JA 1AGMA 4D4BA 1GXNA 2V3NA 1FT1B 1GXOA 4AYPA 5AGDA 1IS9A 1HXAA 1OJNA 3SDUA 1H13A 3PZ3B 1W3YA 3WIQA 1GHQA 2EABA 3Q75B 4OZVA 3SDVA 4L9PB 3KSQB 1N4SB 3D5RA 3M72A 4AYOA 5ILIA 1LTXB 3PMMA 4GTTB 4M76A 1N4RB 5CA3A 4YDEB 1JS4A 3E7JA 3OXUA 4MU9A 4GTPB 2JJBA 3M76A 5DHIA 3P5RA 1G9GA 4CE7A 1K72A 3SQCA 1KFGA 2I07B 1LXKA 2V8IA 4BOKA 2FBAA 2NOJA 3DRAB 3W7XA 1HM3A 4V1RA 3E6UA 2E24A 5IL3A 4KTPA 3DSSB 3HXFB 4MBGB 3DSVB 4QT9A 2FUTA 3WIWA 2GOXA 2D8LA 1F9GA 1N4PB 4E1YA 1FAEA 4LNGB 2ONGA 3EU8A 1FMIA 5JPNB 3ANJA 1RWCA 4CJ1A 5IKAA 1V5DA 1GLMA 3GT5A 1RWGA 2DRRA 4LIXA 5MEHA 3E33B 2VN7A 3EQAA 1X1HA 4F10A 1O1RB 1TN8B 4F13A 4TXTA 3W5MA 1L2AA 3E37B 1XWTA 2VN4A 4YCRA 1HV6A 1L1YA 4LNBB 3RSYA 1HM2A 3SDQA 3WC3A 3EUVB 1TNOB 3K7XA 1WU4A 4JJJA 4OK2A 1TNYB 1AYXA 3QRYA 1H54A 3S4DA 3WKHA 3ON6A 1N7NA 3K11A 1O1SB 1UMPA 2F6DA 3GLYA 3VXDA 5IKHA 1TNZB 2AHFA 2B39A 3M7EA 4EL8A 3NFVA 1S64B 5FO8B 2WY8A 5DGRA 3PYBA 3E32B 3ANIA 1H3CA 1FO3A 1KS8A 4D4DA 1FT2B 5JMFA 2DRSA 2WCOA 1C82A 4D4AA 2WIIB 3E73A 3H2WA 1IA7A 3M7CA 5ILKA 1WZZA 3HXBB 4Q88A 2DRQA 3W7WA 5GW7A 3EU5B 2BRWA 5ILYA 3PYAA 1N1BA 1FBWA 3WIRA 4AYQA 3DSWB 3RENA 2G02A 4FXGB 3NNBA 3G4DA 3S4CA 1OJOA 1KKTA 1SA4B 1KREA 2H6HB 1HCUA 4EHMB 4WVCA 2EADA 4KTRA 3H7LA 2XWBB 4V1SA 4C1SA 1N7RA 3W7SA 5IL8A 3DSUB 4WU0A 1NI1B 4TF4A 1NC5A 1GAIA 4OK4A 3M00A 2CQSA 3D3IA 4OZWA 5ILHA 1HMUA 4GTQB 1LF6A 3M78A 1LXMA 3DSTB 5E2JA 4ZH1A 3AFJA 3KLSA 3PZ2B 4RNQA 1O6HA 2GZ6A 5C05A 4GTMB 5CD2A 1G6IA 2DROA 2WY7A 3T33A 3RX7A 1N7PA 4FXKB 1H37A 3VSMA 1C3DA 1G9JA 2PN5A 1N20A 1H3AA 3M77A 3DPYB 3SFXB 3M73A 3QT9A 3WKFA 3M74A 4Z4LA 2EACA 2FUZA 1QQFA 5GZKA 2EAEA 3CU7A 2Z07A 3SAEA 3D5SA 2H6IB 2AFAA 1R76A 4FJQA 4L0GA 2QNOA 4ZH5A 1LD7B 1MZCB 1LF9A 2IEJB 3KQ4A 1J0MA 1RWHA 3QFZA 1CB8A 3QPFA 3WKIA 4Z4JA 1X1JA 3M75A 3SFYB 3RRSA 3VSNA 1RQ5A 3KSLB 3QSPA 3X17A 1D8DB 1WU5A 1VD5A 1H3BA 3M7BA 1CEMA 2XWJB 3PZ4B 1N7OA 2V8KA 2BEDB 5FOBB 2H6FB 3PZ1B 4CJ0A 5EATA 2ZIRB 1N22A 3Q79B 1HZFA 2WDAA 3N0GA 4WVAA 3LZ9A 3RX5A 4GTOB 3ANKA 2BB6A 1DCEB 5IK6A 1RWFA 4MMHA 1HN0A 2RI9A 2A8ZA 1XW2A 3SDTA 1H12A 1N21A 1V5CA 2X03A 1SQCA 3W7UA 4AYRA 3S9VA 2R2LB 1H36A 4FUSA 5GY3A 4J5TA 1N7QA 3W5NA 5FO9B 1UG9A 1XWQA 3QWTA 2YIKA 3QDEA 5JMDA 2WYNA 5IM1A 3M02A 4GTRB 1S63B 3QXQA 4KKJA 1FCEA 1O79A 3E30B 3A0OA 2SQCA 5ILJA 3QFYA
chains in the Genus database with same CATH topology
1QBQB 3S4AA 2FV1A 2WINB 4GTSB 3Q78B 2D5JA 3E34B 1F9OA 3ACSA 2AHGA 3P5PA 3M71A 4D4CA 3P2CA 1X81B 3HXEB 1F9DA 4D94A 2H6GB 1TNBB 4GTVB 3DSXB 2BBCA 3W7TA 3TF4A 1GSZA 1W6KA 1N4QB 4Q2BA 1TNUB 4DODA 4ONTA 1KZOB 1WU6A 1DOGA 1GXMA 3Q7AB 1X9DA 1D8EB 4XUVA 1TN7B 1IA6A 1KSDA 3HXDB 1JCRB 1H14A 1NL4B 1V7WA 2CQTA 3HXCB 1TF4A 1FBOA 1O6QA 1KWFA 1W6JA 1QSJA 2XFGA 2PMVA 2XQWA 1SA5B 1CLCA 3ACTA 4BOJA 2RI8A 1DL2A 1LD8B 3M7LA 3CIHA 4DOEA 3QG0A 1ULVA 1V7XA 3QT3A 2RGKA 1N95B 4ZRPA 4ZRQA 1GA2A 5FO7B 4GL3A 3EZ8A 2NVPA 2F0YB 3C72B 3Q73B 5DGQA 1O1TB 2ZBLA 3SDRA 1JCQB 4YDOB 3S4BA 1KSCA 2GH4A 3QXFA 1H39A 4ZG8A 2FV0A 3H3KA 1N94B 2A73B 2V3PA 5JPMB 1FO2A 1N9AB 3OEDA 1H35A 3WKGA 3RX8A 2JG0A 4WVBA 3GZKA 2B4FA 5KKBA 3WUXA 3VW5A 2JF4A 3RJ3A 2OKXA 3A3VA 1O6RA 2ZISB 1KRFA 2P0VA 5M7YA 1GAHA 1KZPB 3G6JB 2BB5A 1FPPB 4L6XA 1TN6B 1NXCA 3Q7FB 4KKIA 2ZZRA 1V7VA 1JCSB 1G87A 5CZLA 1O5MB 2G0DA 5M7IA 4LNVA 1FP3A 1UT9A 2V8JA 1AGMA 4D4BA 1GXNA 2V3NA 1FT1B 1GXOA 4AYPA 5AGDA 1IS9A 3SDUA 1H13A 3PZ3B 3WIQA 1GHQA 2EABA 3Q75B 3SDVA 4L9PB 3KSQB 1N4SB 3D5RA 3M72A 4AYOA 1LTXB 3PMMA 4GTTB 4M76A 1N4RB 5CA3A 4YDEB 1JS4A 3OXUA 4MU9A 4GTPB 2JJBA 3M76A 3P5RA 1G9GA 4CE7A 1K72A 3SQCA 1KFGA 2I07B 2V8IA 4BOKA 2FBAA 2NOJA 3DRAB 3W7XA 4V1RA 3E6UA 4KTPA 3DSSB 3HXFB 4MBGB 3DSVB 4QT9A 3WIWA 2GOXA 2D8LA 1N4PB 1FAEA 4LNGB 3EU8A 1FMIA 5JPNB 3ANJA 4CJ1A 1V5DA 1GLMA 3GT5A 2DRRA 4LIXA 5MEHA 3E33B 2VN7A 3EQAA 1O1RB 1TN8B 4TXTA 3W5MA 1L2AA 3E37B 1XWTA 2VN4A 4YCRA 1L1YA 4LNBB 3RSYA 3SDQA 3WC3A 3EUVB 1TNOB 3K7XA 1WU4A 4JJJA 1TNYB 1AYXA 3QRYA 1H54A 3S4DA 3WKHA 3ON6A 3K11A 1O1SB 1UMPA 2F6DA 3GLYA 3VXDA 1TNZB 2AHFA 2B39A 3M7EA 4EL8A 1S64B 5FO8B 2WY8A 5DGRA 3PYBA 3E32B 3ANIA 1H3CA 1FO3A 1KS8A 4D4DA 1FT2B 2DRSA 4D4AA 2WIIB 3E73A 3H2WA 1IA7A 3M7CA 1WZZA 3HXBB 4Q88A 2DRQA 3W7WA 5GW7A 3EU5B 3PYAA 1FBWA 3WIRA 4AYQA 3DSWB 3RENA 2G02A 4FXGB 3S4CA 1KKTA 1SA4B 1KREA 2H6HB 1HCUA 4EHMB 4WVCA 2EADA 4KTRA 3H7LA 2XWBB 4V1SA 4C1SA 3W7SA 3DSUB 4WU0A 1NI1B 4TF4A 1NC5A 1GAIA 2CQSA 3D3IA 4GTQB 1LF6A 3M78A 3DSTB 5E2JA 4ZH1A 3AFJA 3KLSA 3PZ2B 1O6HA 2GZ6A 4GTMB 5CD2A 1G6IA 2DROA 2WY7A 3T33A 3RX7A 4FXKB 1H37A 1C3DA 1G9JA 2PN5A 1H3AA 3M77A 3DPYB 3SFXB 3M73A 3QT9A 3WKFA 3M74A 4Z4LA 2EACA 2FUZA 1QQFA 5GZKA 2EAEA 3CU7A 2Z07A 3SAEA 3D5SA 2H6IB 2AFAA 1R76A 4L0GA 2QNOA 4ZH5A 1LD7B 1MZCB 1LF9A 2IEJB 3KQ4A 3QFZA 3QPFA 3WKIA 4Z4JA 3M75A 3SFYB 3RRSA 1RQ5A 3KSLB 3QSPA 3X17A 1D8DB 1WU5A 1VD5A 1H3BA 3M7BA 1CEMA 2XWJB 3PZ4B 2V8KA 2BEDB 5FOBB 2H6FB 3PZ1B 4CJ0A 2ZIRB 3Q79B 1HZFA 4WVAA 3RX5A 4GTOB 3ANKA 2BB6A 1DCEB 2RI9A 2A8ZA 1XW2A 3SDTA 1H12A 1V5CA 1SQCA 3W7UA 4AYRA 3S9VA 2R2LB 1H36A 4FUSA 5GY3A 4J5TA 3W5NA 5FO9B 1UG9A 1XWQA 3QWTA 2YIKA 3QDEA 2WYNA 4GTRB 1S63B 3QXQA 4KKJA 1FCEA 1O79A 3E30B 2SQCA 3QFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPN B;  1QBQ B;  1JCQ B;  3DST B;  4YDO B;  4ZH1 A;  2WIN B;  3KLS A;  4GTS B;  3PZ2 B;  3Q78 B;  1H39 A;  3E34 B;  1N94 B;  2A73 B;  2V3P A;  5JPM B;  1O6H A;  4GTM B;  2WY7 A;  3E33 B;  1N9A B;  3OED A;  1H35 A;  4D4C A;  1O1R B;  4FXK B;  1X81 B;  1TN8 B;  1H37 A;  3HXE B;  1C3D A;  2PN5 A;  4D94 A;  1H3A A;  3E37 B;  2H6G B;  3DPY B;  1TNB B;  4GTV B;  3SFX B;  3DSX B;  2BBC A;  3RJ3 A;  4LNB B;  1O6R A;  1QQF A;  2ZIS B;  1GSZ A;  3EUV B;  1W6K A;  3CU7 A;  1TNO B;  1N4Q B;  3K7X A;  1TNU B;  1TNY B;  1KZP B;  3G6J B;  4ONT A;  2BB5 A;  1KZO B;  3D5S A;  2H6I B;  1FPP B;  1R76 A;  1O1S B;  1GXM A;  1TN6 B;  1UMP A;  1LD7 B;  3Q7A B;  3Q7F B;  4KKI A;  1MZC B;  1JCS B;  1D8E B;  1TNZ B;  2IEJ B;  3KQ4 A;  1O5M B;  2B39 A;  2G0D A;  1S64 B;  1TN7 B;  5FO8 B;  3HXD B;  2WY8 A;  4LNV A;  3E32 B;  1JCR B;  2V8J A;  4D4B A;  1H3C A;  1GXN A;  2V3N A;  1FT1 B;  4D4D A;  1FT2 B;  1GXO A;  3SFY B;  5AGD A;  3KSL B;  4D4A A;  2WII B;  3PZ3 B;  1D8D B;  1NL4 B;  1GHQ A;  3Q75 B;  1H3B A;  3HXB B;  4L9P B;  2XWJ B;  1N4S B;  3KSQ B;  3D5R A;  3PZ4 B;  3HXC B;  3EU5 B;  2V8K A;  1O6Q A;  1LTX B;  1W6J A;  1QSJ A;  2PMV A;  2BED B;  4GTT B;  4M76 A;  1N4R B;  5FOB B;  2H6F B;  2XQW A;  1SA5 B;  3PZ1 B;  4YDE B;  4BOJ A;  3DSW B;  2ZIR B;  3OXU A;  3Q79 B;  1LD8 B;  4MU9 A;  1HZF A;  4GTP B;  2G02 A;  4FXG B;  4GTO B;  1SA4 B;  1DCE B;  2BB6 A;  2H6H B;  2I07 B;  3SQC A;  4EHM B;  2V8I A;  4BOK A;  2NOJ A;  3DRA B;  4V1R A;  1SQC A;  2R2L B;  1H36 A;  1N95 B;  2XWB B;  4V1S A;  4C1S A;  4ZRP A;  4ZRQ A;  3DSS B;  3DSU B;  5FO9 B;  1NI1 B;  3HXF B;  4MBG B;  5FO7 B;  3DSV B;  2F0Y B;  3C72 B;  3Q73 B;  4GTR B;  1S63 B;  2GOX A;  1N4P B;  4KKJ A;  1O1T B;  1O79 A;  4GTQ B;  3E30 B;  4LNG B;  2SQC A; 
#chains in the Genus database with same CATH topology
 1QBQ B;  2BRP A;  3S4A A;  2FV1 A;  2WIN B;  2J5C A;  4GTS B;  3Q78 B;  2D5J A;  3E34 B;  1OJP A;  1F9O A;  3ACS A;  2AHG A;  3P5P A;  3M71 A;  4D4C A;  3P2C A;  1HX9 A;  1I8Q A;  1X81 B;  3HXE B;  4MMI A;  1N24 A;  1F9D A;  4D94 A;  2H6G B;  1TNB B;  4GTV B;  3DSX B;  2BBC A;  3M01 A;  3W7T A;  1HXG A;  3TF4 A;  1GSZ A;  1W6K A;  1N4Q B;  4Q2B A;  5ILZ A;  5EAS A;  1TNU B;  3E80 A;  4DOD A;  4ONT A;  1X1I A;  1KZO B;  1WU6 A;  1DOG A;  1GXM A;  3Q7A B;  1X9D A;  1D8E B;  4XUV A;  1TN7 B;  1IA6 A;  1KSD A;  3HXD B;  3N0F A;  1JCR B;  4GAX A;  1H14 A;  2ONH A;  1NL4 B;  1OJM A;  3AFL A;  1N23 A;  4OJZ A;  1V7W A;  2CQT A;  3HXC B;  1TF4 A;  1FBO A;  1O6Q A;  1KWF A;  1W6J A;  1QSJ A;  2XFG A;  2PMV A;  2XQW A;  1SA5 B;  1CLC A;  3ACT A;  4BOJ A;  2RI8 A;  1DL2 A;  1LD8 B;  3M7L A;  2Q1F A;  5IK0 A;  5DHK A;  3CIH A;  4DOE A;  3G4F A;  1F1S A;  3QG0 A;  1ULV A;  1V7X A;  3QT3 A;  2RGK A;  1N95 B;  5EAU A;  4ZRP A;  4ZRQ A;  1GA2 A;  5FO7 B;  4GL3 A;  3EZ8 A;  2NVP A;  2F0Y B;  3C72 B;  3Q73 B;  5DGQ A;  2E22 A;  1O1T B;  2ZBL A;  3SDR A;  1LOH A;  1JCQ B;  4YDO B;  1QAZ A;  3S4B A;  1N1Z A;  2BRV X;  1HXC A;  1KSC A;  2GH4 A;  4FNV A;  3QXF A;  1H39 A;  4ZG8 A;  2FV0 A;  3H3K A;  1N94 B;  2A73 B;  2V3P A;  5JPM B;  1FO2 A;  1N9A B;  3OED A;  1H35 A;  4NEI A;  3WKG A;  3RX8 A;  2JG0 A;  1EGU A;  4WVB A;  4DI5 A;  3GZK A;  2B4F A;  5KKB A;  3WUX A;  5ILD A;  3VW5 A;  2JF4 A;  3RJ3 A;  1HMW A;  5IK9 A;  2OKX A;  3A3V A;  1O6R A;  2ZIS B;  1KRF A;  2P0V A;  5M7Y A;  1GAH A;  1KZP B;  3G6J B;  1RWA A;  2BB5 A;  1FPP B;  4L6X A;  1TN6 B;  1NXC A;  3Q7F B;  4KKI A;  2ZZR A;  1V7V A;  1JCS B;  1G87 A;  5CZL A;  1O5M B;  2G0D A;  5M7I A;  1RW9 A;  1J0N A;  2FUQ A;  4LNV A;  1FP3 A;  1UT9 A;  2V8J A;  1AGM A;  4D4B A;  1GXN A;  2V3N A;  1FT1 B;  1GXO A;  4AYP A;  5AGD A;  1IS9 A;  1HXA A;  1OJN A;  3SDU A;  1H13 A;  3PZ3 B;  1W3Y A;  3WIQ A;  1GHQ A;  2EAB A;  3Q75 B;  4OZV A;  3SDV A;  4L9P B;  3KSQ B;  1N4S B;  3D5R A;  3M72 A;  4AYO A;  5ILI A;  1LTX B;  3PMM A;  4GTT B;  4M76 A;  1N4R B;  5CA3 A;  4YDE B;  1JS4 A;  3E7J A;  3OXU A;  4MU9 A;  4GTP B;  2JJB A;  3M76 A;  5DHI A;  3P5R A;  1G9G A;  4CE7 A;  1K72 A;  3SQC A;  1KFG A;  2I07 B;  1LXK A;  2V8I A;  4BOK A;  2FBA A;  2NOJ A;  3DRA B;  3W7X A;  1HM3 A;  4V1R A;  3E6U A;  2E24 A;  5IL3 A;  4KTP A;  3DSS B;  3HXF B;  4MBG B;  3DSV B;  4QT9 A;  2FUT A;  3WIW A;  2GOX A;  2D8L A;  1F9G A;  1N4P B;  4E1Y A;  1FAE A;  4LNG B;  2ONG A;  3EU8 A;  1FMI A;  5JPN B;  3ANJ A;  1RWC A;  4CJ1 A;  5IKA A;  1V5D A;  1GLM A;  3GT5 A;  1RWG A;  2DRR A;  4LIX A;  5MEH A;  3E33 B;  2VN7 A;  3EQA A;  1X1H A;  4F10 A;  1O1R B;  1TN8 B;  4F13 A;  4TXT A;  3W5M A;  1L2A A;  3E37 B;  1XWT A;  2VN4 A;  4YCR A;  1HV6 A;  1L1Y A;  4LNB B;  3RSY A;  1HM2 A;  3SDQ A;  3WC3 A;  3EUV B;  1TNO B;  3K7X A;  1WU4 A;  4JJJ A;  4OK2 A;  1TNY B;  1AYX A;  3QRY A;  1H54 A;  3S4D A;  3WKH A;  3ON6 A;  1N7N A;  3K11 A;  1O1S B;  1UMP A;  2F6D A;  3GLY A;  3VXD A;  5IKH A;  1TNZ B;  2AHF A;  2B39 A;  3M7E A;  4EL8 A;  3NFV A;  1S64 B;  5FO8 B;  2WY8 A;  5DGR A;  3PYB A;  3E32 B;  3ANI A;  1H3C A;  1FO3 A;  1KS8 A;  4D4D A;  1FT2 B;  5JMF A;  2DRS A;  2WCO A;  1C82 A;  4D4A A;  2WII B;  3E73 A;  3H2W A;  1IA7 A;  3M7C A;  5ILK A;  1WZZ A;  3HXB B;  4Q88 A;  2DRQ A;  3W7W A;  5GW7 A;  3EU5 B;  2BRW A;  5ILY A;  3PYA A;  1N1B A;  1FBW A;  3WIR A;  4AYQ A;  3DSW B;  3REN A;  2G02 A;  4FXG B;  3NNB A;  3G4D A;  3S4C A;  1OJO A;  1KKT A;  1SA4 B;  1KRE A;  2H6H B;  1HCU A;  4EHM B;  4WVC A;  2EAD A;  4KTR A;  3H7L A;  2XWB B;  4V1S A;  4C1S A;  1N7R A;  3W7S A;  5IL8 A;  3DSU B;  4WU0 A;  1NI1 B;  4TF4 A;  1NC5 A;  1GAI A;  4OK4 A;  3M00 A;  2CQS A;  3D3I A;  4OZW A;  5ILH A;  1HMU A;  4GTQ B;  1LF6 A;  3M78 A;  1LXM A;  3DST B;  5E2J A;  4ZH1 A;  3AFJ A;  3KLS A;  3PZ2 B;  4RNQ A;  1O6H A;  2GZ6 A;  5C05 A;  4GTM B;  5CD2 A;  1G6I A;  2DRO A;  2WY7 A;  3T33 A;  3RX7 A;  1N7P A;  4FXK B;  1H37 A;  3VSM A;  1C3D A;  1G9J A;  2PN5 A;  1N20 A;  1H3A A;  3M77 A;  3DPY B;  3SFX B;  3M73 A;  3QT9 A;  3WKF A;  3M74 A;  4Z4L A;  2EAC A;  2FUZ A;  1QQF A;  5GZK A;  2EAE A;  3CU7 A;  2Z07 A;  3SAE A;  3D5S A;  2H6I B;  2AFA A;  1R76 A;  4FJQ A;  4L0G A;  2QNO A;  4ZH5 A;  1LD7 B;  1MZC B;  1LF9 A;  2IEJ B;  3KQ4 A;  1J0M A;  1RWH A;  3QFZ A;  1CB8 A;  3QPF A;  3WKI A;  4Z4J A;  1X1J A;  3M75 A;  3SFY B;  3RRS A;  3VSN A;  1RQ5 A;  3KSL B;  3QSP A;  3X17 A;  1D8D B;  1WU5 A;  1VD5 A;  1H3B A;  3M7B A;  1CEM A;  2XWJ B;  3PZ4 B;  1N7O A;  2V8K A;  2BED B;  5FOB B;  2H6F B;  3PZ1 B;  4CJ0 A;  5EAT A;  2ZIR B;  1N22 A;  3Q79 B;  1HZF A;  2WDA A;  3N0G A;  4WVA A;  3LZ9 A;  3RX5 A;  4GTO B;  3ANK A;  2BB6 A;  1DCE B;  5IK6 A;  1RWF A;  4MMH A;  1HN0 A;  2RI9 A;  2A8Z A;  1XW2 A;  3SDT A;  1H12 A;  1N21 A;  1V5C A;  2X03 A;  1SQC A;  3W7U A;  4AYR A;  3S9V A;  2R2L B;  1H36 A;  4FUS A;  5GY3 A;  4J5T A;  1N7Q A;  3W5N A;  5FO9 B;  1UG9 A;  1XWQ A;  3QWT A;  2YIK A;  3QDE A;  5JMD A;  2WYN A;  5IM1 A;  3M02 A;  4GTR B;  1S63 B;  3QXQ A;  4KKJ A;  1FCE A;  1O79 A;  3E30 B;  3A0O A;  2SQC A;  5ILJ A;  3QFY A; 
#chains in the Genus database with same CATH homology
 1QBQ B;  3S4A A;  2FV1 A;  2WIN B;  4GTS B;  3Q78 B;  2D5J A;  3E34 B;  1F9O A;  3ACS A;  2AHG A;  3P5P A;  3M71 A;  4D4C A;  3P2C A;  1X81 B;  3HXE B;  1F9D A;  4D94 A;  2H6G B;  1TNB B;  4GTV B;  3DSX B;  2BBC A;  3W7T A;  3TF4 A;  1GSZ A;  1W6K A;  1N4Q B;  4Q2B A;  1TNU B;  4DOD A;  4ONT A;  1KZO B;  1WU6 A;  1DOG A;  1GXM A;  3Q7A B;  1X9D A;  1D8E B;  4XUV A;  1TN7 B;  1IA6 A;  1KSD A;  3HXD B;  1JCR B;  1H14 A;  1NL4 B;  1V7W A;  2CQT A;  3HXC B;  1TF4 A;  1FBO A;  1O6Q A;  1KWF A;  1W6J A;  1QSJ A;  2XFG A;  2PMV A;  2XQW A;  1SA5 B;  1CLC A;  3ACT A;  4BOJ A;  2RI8 A;  1DL2 A;  1LD8 B;  3M7L A;  3CIH A;  4DOE A;  3QG0 A;  1ULV A;  1V7X A;  3QT3 A;  2RGK A;  1N95 B;  4ZRP A;  4ZRQ A;  1GA2 A;  5FO7 B;  4GL3 A;  3EZ8 A;  2NVP A;  2F0Y B;  3C72 B;  3Q73 B;  5DGQ A;  1O1T B;  2ZBL A;  3SDR A;  1JCQ B;  4YDO B;  3S4B A;  1KSC A;  2GH4 A;  3QXF A;  1H39 A;  4ZG8 A;  2FV0 A;  3H3K A;  1N94 B;  2A73 B;  2V3P A;  5JPM B;  1FO2 A;  1N9A B;  3OED A;  1H35 A;  3WKG A;  3RX8 A;  2JG0 A;  4WVB A;  3GZK A;  2B4F A;  5KKB A;  3WUX A;  3VW5 A;  2JF4 A;  3RJ3 A;  2OKX A;  3A3V A;  1O6R A;  2ZIS B;  1KRF A;  2P0V A;  5M7Y A;  1GAH A;  1KZP B;  3G6J B;  2BB5 A;  1FPP B;  4L6X A;  1TN6 B;  1NXC A;  3Q7F B;  4KKI A;  2ZZR A;  1V7V A;  1JCS B;  1G87 A;  5CZL A;  1O5M B;  2G0D A;  5M7I A;  4LNV A;  1FP3 A;  1UT9 A;  2V8J A;  1AGM A;  4D4B A;  1GXN A;  2V3N A;  1FT1 B;  1GXO A;  4AYP A;  5AGD A;  1IS9 A;  3SDU A;  1H13 A;  3PZ3 B;  3WIQ A;  1GHQ A;  2EAB A;  3Q75 B;  3SDV A;  4L9P B;  3KSQ B;  1N4S B;  3D5R A;  3M72 A;  4AYO A;  1LTX B;  3PMM A;  4GTT B;  4M76 A;  1N4R B;  5CA3 A;  4YDE B;  1JS4 A;  3OXU A;  4MU9 A;  4GTP B;  2JJB A;  3M76 A;  3P5R A;  1G9G A;  4CE7 A;  1K72 A;  3SQC A;  1KFG A;  2I07 B;  2V8I A;  4BOK A;  2FBA A;  2NOJ A;  3DRA B;  3W7X A;  4V1R A;  3E6U A;  4KTP A;  3DSS B;  3HXF B;  4MBG B;  3DSV B;  4QT9 A;  3WIW A;  2GOX A;  2D8L A;  1N4P B;  1FAE A;  4LNG B;  3EU8 A;  1FMI A;  5JPN B;  3ANJ A;  4CJ1 A;  1V5D A;  1GLM A;  3GT5 A;  2DRR A;  4LIX A;  5MEH A;  3E33 B;  2VN7 A;  3EQA A;  1O1R B;  1TN8 B;  4TXT A;  3W5M A;  1L2A A;  3E37 B;  1XWT A;  2VN4 A;  4YCR A;  1L1Y A;  4LNB B;  3RSY A;  3SDQ A;  3WC3 A;  3EUV B;  1TNO B;  3K7X A;  1WU4 A;  4JJJ A;  1TNY B;  1AYX A;  3QRY A;  1H54 A;  3S4D A;  3WKH A;  3ON6 A;  3K11 A;  1O1S B;  1UMP A;  2F6D A;  3GLY A;  3VXD A;  1TNZ B;  2AHF A;  2B39 A;  3M7E A;  4EL8 A;  1S64 B;  5FO8 B;  2WY8 A;  5DGR A;  3PYB A;  3E32 B;  3ANI A;  1H3C A;  1FO3 A;  1KS8 A;  4D4D A;  1FT2 B;  2DRS A;  4D4A A;  2WII B;  3E73 A;  3H2W A;  1IA7 A;  3M7C A;  1WZZ A;  3HXB B;  4Q88 A;  2DRQ A;  3W7W A;  5GW7 A;  3EU5 B;  3PYA A;  1FBW A;  3WIR A;  4AYQ A;  3DSW B;  3REN A;  2G02 A;  4FXG B;  3S4C A;  1KKT A;  1SA4 B;  1KRE A;  2H6H B;  1HCU A;  4EHM B;  4WVC A;  2EAD A;  4KTR A;  3H7L A;  2XWB B;  4V1S A;  4C1S A;  3W7S A;  3DSU B;  4WU0 A;  1NI1 B;  4TF4 A;  1NC5 A;  1GAI A;  2CQS A;  3D3I A;  4GTQ B;  1LF6 A;  3M78 A;  3DST B;  5E2J A;  4ZH1 A;  3AFJ A;  3KLS A;  3PZ2 B;  1O6H A;  2GZ6 A;  4GTM B;  5CD2 A;  1G6I A;  2DRO A;  2WY7 A;  3T33 A;  3RX7 A;  4FXK B;  1H37 A;  1C3D A;  1G9J A;  2PN5 A;  1H3A A;  3M77 A;  3DPY B;  3SFX B;  3M73 A;  3QT9 A;  3WKF A;  3M74 A;  4Z4L A;  2EAC A;  2FUZ A;  1QQF A;  5GZK A;  2EAE A;  3CU7 A;  2Z07 A;  3SAE A;  3D5S A;  2H6I B;  2AFA A;  1R76 A;  4L0G A;  2QNO A;  4ZH5 A;  1LD7 B;  1MZC B;  1LF9 A;  2IEJ B;  3KQ4 A;  3QFZ A;  3QPF A;  3WKI A;  4Z4J A;  3M75 A;  3SFY B;  3RRS A;  1RQ5 A;  3KSL B;  3QSP A;  3X17 A;  1D8D B;  1WU5 A;  1VD5 A;  1H3B A;  3M7B A;  1CEM A;  2XWJ B;  3PZ4 B;  2V8K A;  2BED B;  5FOB B;  2H6F B;  3PZ1 B;  4CJ0 A;  2ZIR B;  3Q79 B;  1HZF A;  4WVA A;  3RX5 A;  4GTO B;  3ANK A;  2BB6 A;  1DCE B;  2RI9 A;  2A8Z A;  1XW2 A;  3SDT A;  1H12 A;  1V5C A;  1SQC A;  3W7U A;  4AYR A;  3S9V A;  2R2L B;  1H36 A;  4FUS A;  5GY3 A;  4J5T A;  3W5N A;  5FO9 B;  1UG9 A;  1XWQ A;  3QWT A;  2YIK A;  3QDE A;  2WYN A;  4GTR B;  1S63 B;  3QXQ A;  4KKJ A;  1FCE A;  1O79 A;  3E30 B;  2SQC A;  3QFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...