4V27A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-isofagomine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Dissection of the Endo-Alpha-1,2-Mannanase Activity of Bacterial Gh99 Glycoside Hydrolases from Bacteroides Spp.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
total genus 127
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v27A00
3AHVA 1G1YA 1TE1A 4PMVA 4GQRA 4QCFA 4MDPA 1CDGA 4PTVA 2BHZA 1GORA 3AFBA 3WF0A 2EPMX 3ZSSA 2WMKA 3IANA 2J7BA 4MNLA 3PHAA 1EOMA 3WD3A 3VDAA 2O9RA 4KWUA 1VFFA 4W88A 1V3HA 1R8LA 3UETA 3CBWA 1AQHA 4JFVA 2W62A 1UHVA 1TZ7A 3OG2A 3BAXA 2WMIB 2VNCA 2EQDA 4GI8A 1PX4A 2DIJA 1MFVA 2X0YA 3KZSA 4DWSC 1XGZA 3SCVA 5A6AA 1OINA 1WAWA 1JL8A 4V28A 2VQTA 3L4WA 4ACZA 4B9YA 2NT0A 4MB1A 4CN6A 5I3DA 5I78A 3PZOA 1E3ZA 1JAKA 3O9NA 4KMQA 1HKKA 1PAMA 2WMHA 3VKKA 4DWSD 3CHCA 5A6JA 2J7FA 1QNPA 3VM7A 1V0MA 2G3IA 3VTRA 4EANA 2D0GA 2J7GA 1XCXA 1NWRA 4L4OA 4MADA 4E8CA 4U3CA 5CXPA 4AMCA 4AD0A 1JDDA 2YA2A 3WD4A 1K6AA 2EO7A 4AZCB 2W66A 2RGMA 1GNXA 1V6XA 5M03A 3TTQA 4EKJA 4EE9A 1CXIA 3SCNA 3CTTA 1KBKA 1WZLA 2O92A 1LL4A 5M17A 1BQCA 3WMCA 3VD5A 1SFSA 2CETA 2V3EA 4Z2IA 3UCQA 1E6QM 1XSIA 2ZXDA 5IXEA 2DT3A 3CZLA 4IUGA 3T09A 3IAPA 3W53A 3ZJ6A 1J9YA 2JFEX 4OBSA 1UD8A 2D20A 2UY2A 1ZBKA 1BFNA 3VGEA 3QHMA 4J7RA 1H5VA 4ACZB 1E5JA 2XVKA 3CZGA 1C91A 2WW5A 4W8BA 5A8PA 3MV11 4JZ5A 1GQKA 1TR1A 1V6UA 2GJXB 2XTKA 1NOUA 1JI2A 1KCKA 4PCTA 3WF2A 3TP4A 3OLDA 1CNVA 1PBGA 3F5KA 3WBEA 2BY1A 1UZ1A 2W61A 1SMDA 2EPLX 4R5EA 1XYZA 2XPKA 5DT5A 4RE3A 1JXJA 3B8SA 1E6XM 4MJ4A 1LL6A 3L4UA 4MB4A 2ZE0A 3ECQA 4LQ1A 4JIEA 3GH4A 4DM2A 2XSBA 3BAKA 3IAQA 3ALFA 2NT1A 4AEFA 4AEEA 4M81A 1V3MA 4HZ7A 3AOFA 2HISA 2DH3A 3VMNA 1WE5A 3WF4A 2WK2A 3TOPA 4W84A 1FH7A 1EH9A 1EHAA 2WYSA 2EXOA 3CHEA 1PX8A 4UQAA 4CD4A 5A6BA 5DMYA 2XWDA 3I3BA 2G3JA 5FL0A 1W9PA 1J18A 2WVVB 7CGTA 5M5DA 4GI9A 3ARRA 1YHTA 4JFUA 4J3VA 3AI0A 1E56A 3WH7A 4GXPA 1W9DM 2DSUA 4N0RA 4V2XA 1PEZA 3APGA 3L4ZA 3SCQA 3SIMA 3BSHA 5BXTA 1R86A 4QLJA 3W37A 1WP6A 1TMQA 4GZJA 2WHJA 4UQCA 1R7OA 3PZMA 3LMYA 2ZX9A 3AZSA 2YKKA 3GH5A 1ZB5A 1ITCA 2J7HA 3CH9A 2ZIDA 1KGXA 4H8VA 4MAVA 3RILA 4HOXA 4D1IA 3AMGA 1QI0A 1OIFA 1JYNA 1E6SM 3AIVA 5A6KA 4CN4A 2FHFA 9CGTA 1PZ2A 4WSKA 3QR3A 1QPKA 2FGZA 4IISA 1OIMA 4JL2A 3L4TA 3AIBA 4UZSA 5A95A 3U5YA 3OGVA 1RH9A 1PJ9A 4LPCA 3THDA 4MJ2A 1EXPA 1GUVA 1MQRA 2ZOXA 1WZMA 4NSBA 2VZOA 3M7SA 3SCSA 1SR0A 4JHOA 4TUFA 2WNWA 2D3LA 4ATLA 4F9JA 3MANA 4S3JA 4WKFA 1OSEA 1UD6A 3MKKA 4MB3A 5CPQA 3FN9A 1J0IA 1UA3A 3ARWA 2VURA 1Z32X 2PWGA 2YLLA 4FLQA 1EO7A 3SUWA 1Q6EA 3GXFA 1A47A 1BAGA 4CD8A 2W63A 3WEOA 1OT1A 1E4IA 3CZEA 2IUZA 4URIA 2PWFA 2PBOA 2AMGA 3ARQA 4CVUA 1OT2A 3ZJ7A 2VCCA 2UY4A 3CGTA 2VX5A 2FGLA 3UR8A 4AZBA 3EMCA 1IZKA 3GBEA 2JF7A 1JDCA 1X6LA 2E8YA 4U5IA 4D6CA 1MQPA 4PUDA 5EFFA 3OGSA 4BQ5A 1ZS2A 4CD5A 1JGIA 1V0NA 4TXEA 3SUUA 1QI2A 2WB5A 5I24A 1QHPA 4DUVA 3AZTA 3ZMRA 2WSKA 1JXKA 1E55A 1HN1A 2Z1SA 4CCEA 4PMYA 4D71A 4UQ9A 3EBVA 2BVDA 4A4AA 2X2YA 1GJUA 5KZ6A 3UG5A 1HP4A 1E4LA 1JDAA 3D5HA 2ZX5A 1K9TA 5BWFA 3VD3A 2WZIA 4AZHA 1TA3B 5KEZA 4PMRA 4AISA 5I23A 1K9EA 4HMDA 2GFTA 3VDBA 1V6VA 4OOUA 3S2CA 5I6SA 1J11A 4BQ4A 1GHSA 3LPPA 4CN1A 4F66A 3ZR5A 5A8QA 1UKPA 3II1A 3WD2A 3WFZA 4TOQA 3VMPA 3LPGA 1H09A 1KWGA 1MYRA 3ARXA 1EIBA 4P8UA 1NM9A 1OM0A 2ESCA 1B31A 1LJYA 3VGFA 2WMIA 3MSGA 2OYMA 1R87A 3AHYA 3ZR6A 4P8XA 2G41A 5CPSA 3BSGA 4U2YA 3QOKA 3PZIA 2V5DA 3WNPA 5I5RA 2WHKA 2XSAA 2XVLA 2XIIA 1NWTA 1G9HA 1Q6FA 3PZUA 3N13A 2XVNA 4JCMA 1E9LA 5E0FA 1UH3A 3EDJA 2UY5A 2XJ7A 1UWQA 1XH2A 4FK9A 5FKYA 5AC5A 3SEPA 4NI3A 5EFDA 4PYSA 3AIQA 4UFHA 1VBRA 1CLXA 3M6DA 2C8NA 5A8NA 3ZO9A 1CXLA 1ZU8A 2CKRA 1XC6A 4H7VA 5ECUA 1E6ZA 3RCNA 4PMDA 4LX4A 4XUYA 2X8RA 3WSUA 4D6EA 1FFQA 2BVYA 1MVYA 5AC4A 1J01A 2Y8KA 1H49A 5FOOA 4E4PA 1CGVA 2YDSA 1I1XA 3W6MA 4GIAA 5DEZA 2CNCA 1ISVA 1UQYA 1GQJA 5CGTA 1EDTA 2NW0A 3VIGA 1ZJBA 3W38A 1UKSA 2B31A 1XCWA 2WCGA 3BMWA 2GJRA 1ISWA 4GZIA 5FL1A 1BYBA 1UQZA 4AWEA 1UWSA 4AD3A 2PWHA 1JF6A 3CUGA 3AMDA 4PMOA 1XSJA 3QOMA 4RE2A 1JYWA 1CIUA 5D4YA 2XHYA 5FD0A 4CU8A 2VO5A 1HJVA 3PZGA 1JNDA 5CSUA 2DSZA 4PRWA 1I1WA 1H0IA 3A6OA 1K9FA 4LYPA 5HBFA 1CYGA 4AIEA 1H11A 5CQ1A 4PEEA 4UZUA 1US3A 4W7VA 6TAAA 1KXQA 5GNZA 2WVVA 4QLKA 3WN6A 2CBIA 1C8XA 3M07A 4ATWA 1KWKA 1J0ZA 1E4MM 3RM9A 1BG4A 4QAWA 1DWGM 3VD7A 3VIMA 2BXZA 1C3FA 4B16A 2CKSA 1ZJAA 2DT0A 4MDOA 4YHEA 4F9DA 4BZYA 2QF8A 5JBEA 3GM8A 4XZWA 4HOZA 5BYWA 3M46A 1DWIM 3ZQ9A 3MU7A 2Z1KA 1JD7A 1OGBA 3VVGA 1UD4A 1ZBVA 3BCDA 3RJYA 3FY1A 2BY2A 3B9DA 6CGTA 2JE8A 2XGBA 1UKQA 3VD9A 4U33A 2ZUWA 1XD0A 1GOOA 1JAEA 1AQMA 1HIZA 2YOCA 2XVGA 3TA9A 4KRUA 2BV9A 4PMXA 3WD1A 1VBUA 3LPOA 5A69A 5IFPA 2VRQA 1UD2A 4UQBA 2X05A 4F79A 3PTKA 1CEOA 3GDBA 1S46A 1UKOA 2C0HA 3SURA 3DHUA 3E1F1 1UH2A 3FAXA 3WMBA 2UY3A 4IPLA 4TVUA 4TTGA 2VZTA 1BPLB 1QI3A 1HT6A 2WHLA 4PSRA 3WENA 1FP8A 1NOFA 5C8BB 4CU7A 2CHNA 4Z2JA 1NWUA 1WDPA 1FP9A 1UD5A 4H8UA 4UOJA 3GBDA 3NCOA 4UFKA 3AQUA 1GOQA 1PIGA 3WH6A 2VRKA 4AZCA 4JAWA 4AZ5A 4P7OA 1QBAA 5EB8A 3AS0A 1CXKA 3IJ9A 3FAWA 2E3ZA 1R7AA 2PBGA 4E8DA 3GXDA 1XV8A 3UEQA 4U2ZA 1QNRA 3K46A 2EPNA 2QV4A 3RJXA 1B1YA 3NSMA 1GCYA 1EOKA 1WZKA 1VJSA 1HX0A 1GQIA 1UR8A 2J47A 3L2MA 1DWHM 1V3KA 2CEQA 3ARTA 4HP5A 1HJWA 3RM8A 3WH8A 5LA0A 1ISYA 4W7WA 3ZM8A 1ZL1A 4HZ8A 3GNRA 2G8ZA 3SUTA 3WQ8A 2OYKA 3EDFA 3B9EA 3PZNA 3VILA 1J0HA 1DWJM 3NIYA 2YDQA 5E70A 4J3XA 1V03A 3VIIA 3KWXA 1UWUA 2Q8XA 1U33A 4RL3A 4BQ3A 1ODZA 3AZRA 3N15A 4M56A 3K8MA 1I75A 1D3CA 4JKLA 2X09A 4HU0A 4CGTA 2GDUA 3W27A 2VTFA 1CLVA 4QP0A 5E09A 1E43A 5CJ5A 1BTCA 1LF1A 5CLTA 1B30A 2BXYA 3U57A 1DHKA 2CYGA 3LPFA 3UG3A 3WELA 2D0FA 4HOWA 1VB9A 3IJ8A 4AW7A 3N04A 1RD6A 4M1RA 3CPUA 7A3HA 5E9AA 2WLYA 2VUYA 2G4FA 3VDHA 4ACYA 2WKGA 1B9ZA 3EYPA 3DHPA 1LWHA 3EDKA 2WKLA 4W8LA 2DIEA 1GJWA 1J12A 1A3HA 3VIFA 1QI5A 4V27A 5JBFA 1KQYA 1UH4A 1E6RA 3ZT6A 2GUYA 5BXSA 1QHZA 1VFOA 2YL9A 5CG0A 1M53A 1JZ2A 4JCLA 2WBKA 4MNKA 1HVXA 1WPCA 3DC0A 4ZENA 3N12A 2J4GA 1XH0A 3O6AA 3WFLA 1CGWA 2J74A 3CHDA 1EDGA 3PZTA 3WF3A 2O9PA 1M01A 4CD6A 2WAGA 1GPFA 2YBUA 4HA1A 3AHZA 3BLPX 2EJ1A 5CSYA 4TX8A 3AIEA 3GXMA 4RE4A 3WDIA 2CCRA 4U3AA 2D22A 3NSXA 3WUBA 4YHGA 4UFMA 4PMZA 2J7EA 1J10A 4NRRA 1N82A 3MUIA 5A1AA 1VJZA 3CZ8A 1Y7VA 1L8NA 5HPOA 2A3CA 1H41A 3W4RA 3POHA 1IV8A 4CVWA 2ZWYA 2CPUA 1E71M 5AYBA 2JEQA 3MUY1 3OLGA 3VX0A 3AMKA 4PTXA 1JZ6A 3W24A 3WQ5A 4HMEA 1UOKA 3RO8A 3WDJA 3MUAA 2WZHA 4BF7A 4R27A 1UG6A 4AYSA 1E4NA 3W28A 3K1DA 4AZGA 4AD5A 1UD3A 4A3YA 1OB0A 3T2QA 3VIPA 1QOXA 1TCMA 2ZUUA 4AD1A 3A47A 5JIPA 2F8QA 2WMGA 1BYDA 3WQ4A 1M04A 2OLHA 1IT0A 3CZJA 2PB1A 1E6NA 4MNMA 3TTOA 3PZ9A 4XV0A 3OZOA 3AICA 4H8HA 3VU2A 4N42A 5A8MA 1PZ3A 4LXFA 1F4AA 1JZ8A 1Q6CA 1W3KA 1ISZA 1XH1A 2D0HA 1IZJA 1JYXA 4ZFMA 1E5NA 4FLSA 3VM5A 2WMFA 1U30A 4MNJA 1CWYA 1E73M 1GHRA 4E2OA 3AISA 4TTUA 3GTNA 2X0HA 5BXPA 2GJPA 1W9UA 2VCAA 1VAHA 1B90A 2V5CA 2ZUVA 1ODUA 2OSWA 2VT0A 1EA9C 2VOTA 2VL4A 1QNSA 4XZBA 1L0PA 3L2LA 3WUFA 3PBGA 1VEMA 1TVPA 1ECEA 3VMOA 2YA0A 1HP5A 3OBAA 4HPGA 3A4XA 2E40A 2QMKA 1YQ2A 1TVNA 1P6WA 1UR0A 2VZUA 2DQXA 1M03A 1AQ0A 1E1FA 1ESWA 4KGJA 2PF0A 2DPEA 4F8XA 3PN8A 2YL5A 1CPUA 3AS3A 1ZBCA 1G5AA 4D6DA 5FCZA 5CZKA 2QHAA 1VRXA 2J77A 4GINA 4PTWA 4D6GA 4AIUA 1VF8A 1NARA 2FHBA 4WK9A 4JFSA 1O6IA 3CIVA 1WNOA 3AYSA 1CGYA 3WNOA 1B3XA 3AXIA 1UWRA 3CMGA 3RM4A 2YJQA 3NYDA 2XVPA 1QI4A 1V08A 1XRVA 4AD2A 2BS9A 2DDXA 3AIUA 3N18A 2XGIA 2YDRA 4CCCA 2ZXAA 3OB8A 4UFIA 4ZE4A 3W0KA 1KQZA 2VMFA 4ZE5A 1AMYA 1M7XA 1NOWA 3F5JA 4W87A 5A2CA 1H2JA 2W92A 4DUWA 1GOMA 2OYLA 4UFJA 4QCEA 3SCRA 1C90A 2G3MA 3NUKA 3WDHA 4MTVA 3BAYA 5A8OA 1O7AA 2J7CA 2AAAA 5F7UA 2WWCA 1FH8A 4L4PA 1VFUA 2E9MA 3OZPA 1C92A 1KFWA 3RMEA 1E72M 3AROA 1OGGA 1OWQA 5ABEA 3SCUA 2WWDA 1EO5A 4OJYA 5BRPA 2CXGA 2PWDA 3FHQA 4AZ7A 1BGAA 4QFUA 5A6SA 1D7FA 3MS8A 3AMLA 3T0DA 5TD4A 1HF6A 5A94A 1EQPA 2CESA 3OA5A 5A2BA 2DSKA 5E6ZA 4CKQA 5LA1A 5D9MA 4A3HA 3ZT5A 1JNEA 4AZIA 1KGWA 1W1PA 2FHCA 1C7SA 4OUEA 1R85A 4W5UA 2E8ZA 2V3GA 4FLRA 3W82A 2F2HA 1XSKA 4YPJA 2YIHA 2Y24A 5GNXA 3WD0A 4TVDA 3B9AA 5LYRA 5GNYA 3GZAA 4FMVA 3NJ3A 2DEPA 2J7DA 4PCSA 3G6LA 1UWIA 3CUIA 4NRSA 3BAIA 5D9OA 3WNKA 1LG2A 3G6MA 1W3HA 2Y4SA 3EMZA 3A4AA 4ZEPA 1VENA 1KB3A 1BYAA 3WKZA 1G01A 1UR4A 1CTNA 1WO2A 5BXRA 5I0DA 2W91A 2WVSA 1LQ0A 1W91A 1B0IA 3NDZA 3BCFA 3VINA 2OWXA 1QW9A 2JIWA 3F4VA 1H4PA 4FLOA 3K8LA 3HJEA 3HN3A 1HJQA 2HVMA 1HXJA 2JEPA 2WBGA 1F4HA 1Q6DA 4K68A 2UWFA 1DP0A 2WC4A 3U7VA 3BLKA 2VVNA 3BMVA 3ALGA 4TVCA 1UYQA 1OBAA 1UKTA 4CUCA 3ZIZA 4WJXA 3UERA 3AHTA 3AXXA 1VEPA 2XG9A 3NDYA 1OD0A 1QNOA 4WKHA 3PZVA 4NZCA 3AS1A 1UWTA 5ABHA 1JF5A 3KL5A 1FFRA 1E3XA 3SCWA 1MXGA 2V3FA 2ZXQA 4X0NA 4PUEA 1NWSA 3MO4A 3WUGA 2WVTA 3UESA 5EBAA 4XX6A 3GNPA 1HKJA 5EMYA 3T0BA 3K4AA 4GO8A 3N17A 4UFLA 5CLWA 4HTYA 2OWWA 3AJ7A 4H04A 4JFTA 1V6YA 4GI6A 1G0CA 2W5FA 3EDDA 3WF1A 2D2OA 2VZSA 4GPNA 4UQEA 4Z2HA 2WC7A 2J25A 1MW2A 3W29A 3I3DA 2D3NA 4LYQA 3S6TA 4Q22A 2TAAA 1E40A 4J3WA 4W86A 2YBTA 1PIFA 2BVTA 4W93A 3T0AA 5GQBA 1JFHA 4UOZA 1JZ3A 2MANA 5GPRA 1PPIA 4OOZA 2J79A 3KL3A 2J78A 1HJUA 4CU6A 2EPOA 2CIPA 1DTUA 4J27A 1XYFA 2QMJA 5DF0A 1E0WA 3OIHA 2ZX6A 4J3SA 1H3GA 5D8WA 1BGGA 5HOSA 5A3HA 4GZEA 1MW1A 2Y5EA 1LLOA 5D8ZA 2PC8A 1V3LA 3VGGA 5HDRA 4AIOA 1V02E 3WDRA 1OD8A 4HPHA 3QHNA 1BSIA 1Q4NX 2E9LA 3PTMA 2ZUSA 2WANA 5AY7A 1RP9A 2XFRA 2VX6A 4KH2A 3FXYA 2FH6A 3AS2A 3KL0A 3VO0A 3FW6A 5JUVA 4C7GA 4D6HA 1US2A 5LA2A 5M3WA 3WL1A 1GONA 1KBBA 3CUFA 3EDEA 3WEMA 1FA2A 4J28A 1W2VA 4PMNA 4U5KA 2GVYA 3AIWA 1HKMA 4JFWA 2RGLA 2GK1A 1KXHA 3BC9A 4BA0A 3BGAA 1QVBA 3ARYA 4C7DA 2GDVA 3O2LA 3L4YA 2VCBA 1GOKA 4WKAA 4AZ6A 4B3KA 4P7NA 1X6NA 1B2YA 1JG9A 1GVYA 3AXHA 3WNMA 1WCGA 3W26A 1X1NA 4D6JA 1UUQA 5ABFB 2WMJA 3ARPA 3WL0A 3OLEA 2DT1A 1QHOA 4PMQA 2A3AA 2WVUA 3RPMA 3W6LA 3ZOAA 1SMAA 4U31A 5E0CA 5CPTA 3CO4A 3WQVA 3THCA 1TA3A 6A3HA 2J8FA 1HJSA 5IDIA 3D3AA 1XHGA 3SCPA 1BLIA 4PTMA 3TTYA 2DT2A 1U2YA 2FDMA 1W1VA 2WLZA 3A4WA 1E1EA 1GW1A 5A6LA 5E6YA 4YN5A 3VNYA 2DSWA 1BVZA 1HKIA 1QBBA 4UOQA 1E15A 2VX4A 1Q6GA 2G3NA 5DFAA 1FH9A 1CZ1A 3VGHA 3AYRA 1CXHA 1DWFM 3VGBA 3BH4A 3WIJA 1OGSA 1J0KA 2JALA 1DEDA 4X0VA 3WQ6A 2YL8A 2ZUNA 2J75A 1JI1A 2E0PA 4JKMA 4HZ6A 2YLAA 1RPKA 1B3YA 2DH2A 4IPNB 2VZVA 2BY0A 5A6BD 4FF5A 1UA7A 1KR1A 5FIPA 4MB5A 1ISXA 1ZBWA 2WXDM 4KRTA 3POCA 1VIWA 3BXWA 1MW3A 4B15A 3WUEA 2O9OA 4B3LA 2D1ZA 4KGLA 3UR7A 1WDSA 2D23A 3VNZA 1GOIA 4OBRA 2W4XA 1FOBA 3K4DA 3MV01 4Z2KA 4WSJA 2WPGA 5IFTA 5I2UA 2V38A 3CUHA 4M24A 4UNIA 1MXDA 3WNNA 4BQ2A 1CGTA 1C93A 2PI6A 1VFMA 1JFXA 1OCQA 3CMJA 3DECA 8CGTA 3F5LA 5AYIA 2PWEA 4BS0A 1LL7A 3ZT7A 4DWSB 3WDPP 4WLCA 1CGUA 2XM2A 4LGXA 2WC3A 4UR9A 2VC9A 1FHLA 4W5ZA 1QW8A 3SCTA 1W2PA 4HA3A 2V3DA 3NSNA 3ARZA 4UTFA 1NQ6A 2E9BA 1E0VA 1KCLA 3VUPA 1JD9A 3MSDA 3AHXA 1E0XA 3EMQA 3DYPA 1W3JA 3IJ7A 4Q7NA 3T2PA 3JUGA 4EK7A 1LG1A 2WZEA 4P7LA 4M82A 4Z2GA 2ZUTA 3VD4A 4M80A 1MQQA 2ZICA 4NF7A 2QPSA 4HU8A 2OSYA 1D2KA 1XD1A 3A3HA 1EGZA 1J0YA 3HU7A 5HPCA 4J3UA 4GKLA 1C8QA 1UR2A 4GQQA 3SUVA 3RDKA 4W89A 5ABFA 4OZOA 4Y7EA 3TONA 2NSXA 1H0GA 2CHOA 2AOSA 5A6MA 1JZ5A 3OGRA 2J8GA 1NH6A 3N9KA 3T08A 1DWAM 4GO9A 1BG9A 4P8WA 1MFUA 2ZWZA 4PMUA 3AIRA 1UR9A 2D24A 2WM0A 4B9ZA 2A3EA 1HJXA 2VR4A 1ITXA 3HMCA 2VR5A 3GXIA 2EBNA 3N1AA 1E70M 5D9NA 2VQUA 4HMCA 1TUXA 4D6FA 4P7QA 4QDMA 3FNDA 2EPKX 4MAZA 4S3KA 2VJXA 3L4XA 1GVIA 4P7RA 3ARUA 2BY3A 2OSXA 1FHDA 3VIHA 3MMUA 3J7HA 1J0JA 5DO8A 3IK2A 5JIWA 1BHGA 2YL6A 3OLIA 4QLLA 1UZ4A 5I79A 3WQWA 1V0KA 2GJXA 1V3IA 1HL8A 3WMSA 3ZJKA 3GYCA 2BFGA 4W7UA 4EAMA 1UR1A 4H2CA 3W25A 2F61A 4XB3A 5C71A 3WDQA 3T2OA 4Z2LA 1W32A 3BAJA 4J3TA 1QNQA 3VIJA 1JIBA 4W8AA 2BHYA 2Y2WA 3DYOA 3CZKA 2QLYA 1HNYA 1HVQA 4HA4A 3CUJA 3DYMA 1B3WA 5D9PA 3WBAA 1BVNP 5DT7A 5IHSA 3N11A 3WH9A 3GNOA 2JF6A 3PTQA 3QHOA 3WEZA 3VOCA 1EHNA 4TX6A 3SUSA 2A3HA 4WIWA 2O9TA 1V3JA 2BNJA 4P8VA 1B3VA 2VI0A 4AXNA 4DM1A 1C7TA 1KR0A 2ZUMA 5BROA 1V02A 2X1IA 4D6IA 4ZXOA 4M8UA 3CLWA 2VRJA 3ARVA 1W9XA 3BAWA 1BYCA 3TTSA 2DGAA 1CENA 3PZQA 2XFYA 2YA1A 4DUXA 4MPKA 4UQDA 2CBJA 3QGVA 1W1YA 2E4TA 1WDQA 2GK1B 4JKKA 5BCAA 2ZX7A 2IXUA 7TAAA 1GQLA 4AD4A 1C8YA 1PX3A 1AVAA 4M29A 4OIFA 1W1TA 2XUCA 4D72A 1VEOA 3MMWA 5IHRA 1HL9A 2WCAA 3L4VA 3VIKA 3W81A 3RIKA 5CGMA 5C70A 1NP0A 2C7FA 4ZXLA 1MWOA 1V6WA 2A3BA 4PBGA 3U5UA 4CCDA 1K9DA 4C7FA 4JHZA 2OWCA 1V0LA 3VPLA 1JZ4A 2EEXA 2XM1A 2VVSA 4ATDA 1CXEA 5I77A 1LWJA 2BHUA 1KXVA 1W9VA 3ARSA 2ZX8A 3I3EA 3CHFA 3VDCA 5BRQA 1TFVA 3ZSTA 2CBUA 4IM4A 2CBVA 4OKDA 5A2AA 1CBGA 1RP8A 1B3ZA 1SYTA 1WDRA 3WNLA 3WH5A 4W85A 1EDQA 1CGXA 4JL1A 3VX1A 3VIOA 1G94A 2CITA 2WSPA 4D1JA 2IXVA 3MMDA 2CERA 2WCSA 4UCFA 3MUZ1 1TG7A 4AC1X 2J62A 5HXMA 1KGUA 4WF7A 3SCOA 1JYVA 2GSJA 3GH7A 3ZJ8A 2QPUA 3KEHA 4BCEA 1MW0A 1JZ7A 4CD7A 2DSVA 1GOWA 5ABGA 2W67A 3AMCA 1WB0A 2WHMA 4X9YA 2Y8VA 8A3HA 4PN2A 4H41A 3KE0A 4AY1A 1GZJA 2XIBA 5JBDA 2XWEA 1W3LA 1W9BM 5HNNA 2JIEA 1NP2A 2FH8A 1BF2A 3K8KA 1E6PA 1WZAA 3U7BA 4DWSA 2VX7A 4LYRA 3FHAA 1EQCA 1CXFA 3WY1A 3VGDA 1KXTA 3UG4A 2XYLA 2ZXBA 4ML4A 1CECA 4PSPA 1H1NA 2XFFA 1WKYA
chains in the Genus database with same CATH superfamily
1OYCA 4I7VA 1TE1A 4GQRA 3G1XA 4MDPA 4R7JA 3IIXA 1GORA 3OBEA 1I0DA 1XRSA 4C6BA 3C8NA 4IQJA 2RAGA 4DO7A 3PHAA 1OX5A 4LV9A 4GNJA 1V3HA 2NQZA 3M0YA 3UETA 1AQHA 4JFVA 5HMDA 3BAXA 2WMIB 3E9AA 1JPMA 1YKWA 2O7QA 1RCOB 3SCVA 4V28A 2VQTA 3JVAA 3L4WA 3MMTA 2NT0A 5I78A 3SECA 1N7KA 4KMQA 4RDVA 1O60A 2PURA 5A6JA 4DJFA 4H19A 4IFKB 3VM7A 2G3IA 2F6UA 4EANA 2WZTA 4B5WA 3HPZA 4KCVA 2YYTA 4DBWA 1KM1A 1SR9A 4E8CA 4H7CA 1HKVA 5I3GA 4F0KA 3QQ1A 2W66A 4L9YA 2RGMA 2VDGA 1GNXA 4EKJA 4G2DA 4EE9A 3SCNA 1JCXA 4A8NA 1LL4A 3BWWA 2Z24A 1PVNA 5BMWA 3HV8A 4B5NA 4Z2IA 2PGWA 1IZCA 1Z6KA 1XSIA 2G3FA 2DT3A 3CZLA 3T09A 3VZZA 2HS8A 5AOUA 2D20A 2NX1A 1OCJA 4K8HA 3VGEA 3QHMA 3DDMA 2X40A 2P5NA 5BW6A 2R91A 1W0MA 2R1PA 2JKPA 2Z1BA 4Z0SA 3MV11 4HK7A 1TR1A 3GXPA 1S5VA 1Z48A 1NOUA 1KCKA 4PCTA 3QZ6A 2BVWA 2DZUA 1CNVA 3G1SA 4O4WA 2QQ6A 3DX5A 1JUBA 4KWOA 2VC6A 1SMDA 5FJJA 3K1GA 1RR2A 3UJEA 3SY5A 3B8SA 3ITXA 3NZQA 4JIEA 3GH4A 1BF6A 3U4FA 4C6IA 4AEEA 1V3MA 2HISA 4B5UA 3THUA 1FWAC 3GTXA 3TOPA 1R9XA 3W7MA 1OG0A 2WYSA 4FPSA 3E74A 4H6QA 5F2IA 5DMYA 2XWDA 3I3BA 3G1DA 3CU2A 5FL0A 1J18A 4JFUA 5C0QA 4QJ4B 4J3VA 4DLFA 2ACUA 3WH7A 4PA8A 2PGRA 3KDNA 4WOQA 7REQB 5HMSA 4N6EA 1TCDA 1F9CA 3RR4A 3SIMA 3QQWA 4KFNA 4A2SA 1R86A 3MTWA 2YZ5A 1V4YA 2WHJA 1R7OA 2RDTA 2XIQA 2YKKA 4Q8WA 1YPXA 1JRBA 4K8EA 4H8VA 3RILA 3AMGA 1QI0A 4S3DA 3M0LA 3QPZA 3VFCA 1IT8A 4BEUA 3HG3A 3GC4A 5GVJA 3SRKA 2Z2UA 4FNRA 9CGTA 3WQGA 3QR3A 1JUKA 1SSDA 3B0XA 3DBNA 3FFSA 5I3JA 3AIBA 3CT7A 2PZ0A 5A95A 1TV2A 4JN6A 3GDTA 4TO8A 3OGVA 2PGEA 3OYXA 3LTYA 1EPVA 1EXPA 1J5TA 3QBUA 1IEIA 5H8MA 1WZMA 4NJJA 3IUDA 1E1CB 2EG6A 4JHOA 3NOYA 4ATLA 3TJIA 4LUTA 3BLDA 1ONWA 1F3WA 5F2MA 4XG1A 3U9IA 3PY2A 3C0SA 1J0IA 1N8WA 3UJ2A 3MI2A 4RZBA 3B0VC 1XINA 2ZTKA 1F61A 4QEHA 3KBNA 3IIZA 3GXFA 1S1RA 3C0JA 5T9CE 4N9CA 4O10A 3OA3A 2W63A 3C6CA 3P80A 3UGVA 4M6QA 1HL2A 1Z41A 2H8XA 3H22A 1JJKA 1IIHA 1K70A 2Y70A 2VCCA 3W7PA 2FGLA 1MRAA 1PKNA 1Q3NA 3NQFA 1CT5A 3DFHA 3GBEA 4GYKA 2QVNA 2EAWA 3IJDA 2E8YA 2ZDSA 1AJ0A 3ZS4A 3W3OA 1JGIA 1KRAC 2PP1A 3KBJA 3UXIA 4UMAA 2PDWA 1EP2A 3RR1A 4KW2A 3UF9A 3SDOA 1E55A 4D71A 3W72A 3M1ZA 4QJ3B 4HNNA 4A4AA 4H3DA 3B05A 1JQVA 2J66A 2RKXA 3DU0A 1HP4A 4UTKA 3H2OA 1XIDA 1XYCA 3BE7A 4HSNA 1K9TA 2C71A 3V1HA 5KEZA 4W9TA 3UWEA 4PMRA 5FF4A 1J8VA 5ABTA 1VS1A 3VDBA 1D3GA 1XDLA 4N6FA 4CN1A 4R3UA 2CU0A 4WSHA 4JYDA 1GVEA 4YL2A 3KRUA 2JGYA 3I4EA 4TOQA 3VMPA 1EIBA 3QRHA 3FX4A 1EJRC 4MOZA 1LJYA 2WMIA 2OGYA 2OYMA 2YB1A 3N4FA 3OEXA 3MCMA 5G1YA 1SJBA 4FNSA 2V6AA 1SU5A 3PZIA 3WNPA 3CK5A 3ONCA 4JTRA 1NDZA 5CG7A 4WXYA 2G95A 1G9HA 3PZUA 1E9LA 5E0FA 1RQHA 4HT3A 3P60A 4CQCA 2UY5A 4O12A 1UWQA 2ZA1A 3SEPA 3PK7A 3W83A 1HW6A 5EFDA 2Q8ZA 3AIQA 2DVTA 3FEMA 2BP1A 3ERPA 3M6DA 4ZQCA 2QJHA 4MWAD 5A8NA 3ZO9A 4P2VA 1MEHA 1XC6A 3L5LA 4UR8A 1XGEA 2GGJA 5AHIA 3RCNA 3W74A 1U1HA 3PJXA 4L9XA 5K4XA 3E38A 3WLLA 2X8RA 3QY7A 5AYZA 3U2ZA 2NQLA 5D30A 5GJNA 5H8UA 3TN5A 2YDSA 4YYCA 1CLKA 1XWYA 3EX6A 1YNQA 1ISVA 2E09A 1EDTA 2NW0A 1ZJBA 2WCGA 2VWSA 4YJ5A 1ISWA 1BYBA 5A6TC 2FVMA 3LM7A 4WDTA 2XDFA 4ADSA 4AD3A 4MGGA 1DJGA 2YXXA 1XSJA 2Z1XA 4JTDA 7ENLA 2CLKA 1J96A 1CIUA 1T5AA 1O66A 3ZVHB 4CU8A 3DAQA 4Q4QA 1HJVA 5BOOA 4IG2B 1EJXC 1KTNA 1H0IA 5HBFA 1CYGA 2QDGA 2DZPA 2BGSA 4XZHA 4AVOA 2EKGA 4PEEA 3CQJA 6PTDA 2VHLA 1XYMA 1KXQA 1U22A 3EX2A 2WVVA 1R38A 3IJ6A 3M07A 3B8WA 3NO3A 3UCCA 2TYSA 4DI8A 1DWGM 1DJQA 3M5XA 1MEIA 4BZYA 5DLCA 3FA4A 3E2QA 3DKLA 1F3TA 3ZQ9A 1O94A 4GNVA 1JD7A 2PD9A 3L5AA 1OGBA 3VVGA 3MKVA 3WQOA 3OQ8A 1W3TA 3LZ5A 2G5WA 3VNJA 3KHDA 1GTHA 3EA2A 2QCGA 2Z0IA 1AQMA 1ICPA 4KRUA 3URNA 4Q8UA 4PMXA 3WD1A 1TPC1 3GR7A 5A69A 3N29A 4UQBA 1CEOA 2OG9A 1AMKA 1EBGA 1S46A 3DHUA 3RO6A 3CAQA 4TVUA 2VZTA 2CLHA 1HT6A 4PSRA 2DP3A 4M6UA 4MZ1A 1EEXA 4Q4OA 1EZ2A 1UIOA 1WDPA 3DG3A 3E02A 4O57A 4UFKA 3EOOA 4AEOA 2VRKA 2NV1A 4AZCA 1Q2SA 5CPLA 1QBAA 3AS0A 3IJ9A 3BJFA 2GLKA 4IXXA 5HR7A 3UEQA 4H7ZA 2Z25A 2RUSA 2BDQA 4HU3A 1JDFA 5K9XA 1TTQA 2EPNA 3RJXA 1ELSA 3G1RA 2PDHA 1HX0A 1I2RA 3E0FA 2J47A 5D37A 3ARTA 3WH8A 2A3LA 2YCIX 3TJXA 3ZM8A 4L56A 3ABQA 3H4XA 2G8ZA 2ZZ2A 2YFNA 2OYKA 3NIYA 3VIIA 3KWXA 1U33A 3TNOA 3UP8A 2J6XA 4R33A 3OVQA 4BQ3A 4F40A 3UPWA 1D3CA 2INZA 1TTPA 2X09A 5U7SA 4UBPC 4HU0A 3C61A 1CLVA 1YDOA 4DRSA 4DZHA 5CJ5A 4HCDA 1SJCA 4GE8A 4UTMA 1WAUA 4Y8EA 2BXYA 1DHKA 4LVGA 2D0FA 3M47A 1QWKA 1RD6A 9RUBA 3TH6A 3RYSA 1Q85A 3PVFA 3DFSA 4GVGA 3VDHA 4PBEA 4UTTC 2WKGA 1B9ZA 3EYPA 1S3TC 1Q63A 5LIYX 2BGNE 4AX6A 4LV4A 3KBWA 3LHVA 3GHTA 3H7UA 3ZT6A 2ISDA 1NEYA 3V5CA 5CG0A 2B7QA 1A5MC 3EX3A 3BLIA 3U0HA 4MNKA 5H91A 4R34A 4ERAA 1EDGA 2ZRZA 4NYUA 4QAIA 4FOKA 4LF2A 5F2LA 2WAGA 3S5YA 3T4WA 2NX3A 1FWCC 4JBRA 3RCMA 4ROQA 5IBXA 3VKDA 4DF1A 2BTMA 3GXMA 1DJXA 2D22A 5CPMA 3DGBA 3WUBA 3SRFA 3GFXA 4UFMA 1O4UA 4GUJA 5D2XA 1N82A 1A5UA 1TWIA 2XN1A 2DZSA 1EJSC 2ZCGA 4RZ4A 1IV8A 3CQHA 2C79A 2ZZ7A 1XLIA 3VX0A 3MDWA 3B0UX 3AMKA 4PTXA 3MO7A 1TRDA 1VHNA 3IEBA 4JX6A 1UOKA 1GZ1A 3MUAA 2PA6A 3Q37A 5GJMA 4TMBA 4JX4A 1SQ7A 3C3NA 2P3EA 2E68A 4ZQRA 1LZOA 4A3YA 1OB0A 3T2QA 2O7SA 1QOXA 3ES7A 2Z27A 4XVDA 4AD1A 2WMGA 3SQSA 3GB6A 4DPPA 4HJWA 1DTNA 3CZJA 3E12A 3TTOA 3OZOA 3GG8A 3VU2A 3DGRA 2CLPA 3G1VA 4AHOA 2DIKA 4LXFA 2XH4A 2ISVA 4XIAA 3O8AA 3ID7A 3V0SA 3H24A 1Z44A 1RA5A 2FGBA 4E2OA 4MUZA 2X0HA 5C7VA 3IVSA 3EKGA 2GJPA 2XFWA 2MNRA 3KTCA 1EC7A 3P82A 2ZUVA 4ZOBA 2OSWA 3DCPA 2VOTA 2VL4A 4XZBA 4YVPA 1L0PA 4ZB2A 3WUFA 1Q66A 1TVPA 1ECEA 3MWAA 2YA0A 3HPXA 5J5RA 5DRIA 4M5PA 3WLTA 2HTMA 1A5NC 3B8IA 3LCGA 1K4GA 3KCLA 1G4TA 2HPMA 1P6WA 3V4BA 4CNTA 4LAKA 3PUDA 1E1FA 3W00A 2PF0A 1RY0A 5HUOA 1PZ0A 3Q45A 4BF5A 3COTA 1ZBCA 1G5AA 1Q8AA 1VRXA 2I16A 4PTWA 3L2IA 1NDWA 1PTAA 4LSBA 2FHBA 4C6DA 4IQEA 3T0TA 2VGBA 1XLBA 8RUCA 1PZ1A 1RAKA 3QQ0A 1I4NA 2H8ZA 3CMGA 3NAVA 3RM4A 3L12A 4LUIA 4H8NA 2OB3A 1XRVA 4GNKB 4PODA 4AD2A 1WQ5A 2DDXA 3AIUA 3PJWA 3QGAC 2XGIA 4NY2A 4CCCA 1R30A 4UFIA 4C60A 3URAA 4X9SA 3HQOA 1Q2RA 2OELA 1NOWA 3HA1A 2W92A 1I6NA 3B4UA 4HCHA 2OYLA 3T40A 2AAMA 3NUKA 3WDHA 1EGVA 2E6AA 2J7CA 1FWNA 5AYYA 3LA4A 4XKYB 1AJ2A 5TBOA 1OCBA 4UNLA 1E72M 2NVAA 1OGGA 3KTSA 4XVEA 4RNIA 4AU0A 2CXGA 3G24A 3FHQA 4AZ7A 1D7FA 3AMLA 3T0DA 3LENA 3L7RA 4UXDA 2QCLA 2GUUA 1EQPA 3OQEA 5I06A 3V5FA 2CESA 3OA5A 2DSKA 1OC5A 3WLKX 5D9MA 4YTQA 4GUGA 2B7NA 1JCLA 2WSYA 3LY0A 1D8CA 4LAMA 3RLUA 3W82A 4GD0A 3PF3A 3NQAA 3CB8A 2Y24A 5C55A 3AXMA 1RV8A 3W7OA 5GNYA 3NJ3A 1V7YA 4PCSA 3G6LA 3M43A 3CUIA 3W2LA 2FFCA 3RX3A 4FX8A 2F2KA 4GBDA 4C6EA 1FWEC 4ZEPA 3MI6A 3CXOA 1XR2A 3APTA 4E4FA 5BXRA 2HWGA 2W91A 1LQ0A 2NUXA 5MKGA 1W91A 1LLWA 3NDZA 1QW9A 2JIWA 1PSCA 3HJEA 3HN3A 1HJQA 1XIFA 5D2WA 3E0IA 1WOBA 2JEPA 4GACA 1Q6DA 2A0NA 4C1LA 1DP0A 4IGHA 3BMVA 3ALGA 4TVCA 3LSBA 4FXFA 1R2RA 3ZIZA 4ORIA 2W0UA 3UERA 1VEPA 1OD0A 1RD5A 3BG5A 3PBWA 5HMEA 2R6OA 4NZCA 4HD5A 3LBOA 2AQWA 3TDFA 4AG0A 1FFRA 3QEZA 4YYFA 1UW9A 1X1ZA 2PLCA 2WVTA 3UESA 1VH7A 4WVXA 2QJIA 1KRBC 4HTYA 3W7LA 3TZNA 4JFTA 1V6YA 4GI6A 4LEQA 3GIQA 7XIMA 2D2OA 4FEZA 4Z2HA 5JVLA 2Z29A 3W29A 1ECQA 4LYQA 3S6TA 5AC8A 3H7RA 4PC8A 3W1QA 2E67A 1OJXA 1PIFA 3KRSA 4W93A 3TU9A 1W1B1 4MM1A 1JFHA 4E0CA 2MANA 4IIEA 5GPRA 1MUMA 2EPOA 4WJ8A 5DMNA 1OX6A 1XYFA 3KOYA 3KBMA 1E0WA 3OIHA 1BXCA 3RGTA 4QRNA 1BGGA 3HFTA 2VEKA 3P2VA 5G4EA 2Y5EA 4JEQA 4DO5A 3TW6A 4JQAA 1V02E 4B2DA 2ZZ3A 3MVIA 1B57A 4RUBA 1XP3A 2G50A 1Q4NX 3EPNA 3BUVA 1U1JA 5HJYA 2ZUSA 4JPGA 3N2TA 5AY7A 3CO8A 2FH6A 1RBLA 3AS2A 3TMQA 4NP7A 4DNMA 4NJGA 3W7GA 4LBUA 3WL1A 1M7JA 3SN1A 4J28A 4S38A 4PMNA 4U5KA 2ZKMX 1HKMA 4KS0A 1S39A 1QVBA 4C7DA 5XINA 2GDVA 3S9YA 4WKAA 5BRBA 4FIQA 1BXBA 1X6NA 3W22A 3L0KA 4S3GA 1JG9A 3ITYA 3T8QA 1JEZA 5DMMA 3MP5A 3BGJA 1VFLA 5CPNA 3WNMA 2WMJA 3GK0A 4RZ5A 2TPSA 3WL0A 3OLEA 2J27A 3EB2A 1W5OA 1QHOA 3LDVA 2PDFA 1ADSA 1YXDA 2WVUA 2PDBA 1T8QA 3EAUA 1SMAA 3M5YA 3WQVA 2VC7A 2J8FA 2R14A 3TAKA 2BBFA 3D3AA 3AYTA 3NFUA 2HQAA 5CSSA 2W27A 1VYSX 2DT2A 2YXGA 4AC7C 1W1VA 3NR0A 4W4QA 2FZ9A 4FSAA 3LBCA 2ATMA 1I2PA 4UB9A 1QBBA 3DI0A 4DELA 3T9PA 1ZALA 2HEJA 4QITA 2QR6A 1CXHA 3W7JA 3W1NA 3MHUA 1DEDA 1WBJA 4X0VA 2GDQA 2ZUNA 4JKMA 4LVDA 1RPKA 1B3YA 1ZLPA 3HM7A 4US6A 4L6OA 2X2GA 3PAJA 3W2NA 3G0SA 1J93A 4MB5A 4MKSA 3POCA 4Y9OA 3L23A 3KWSA 1W6TA 3QYSA 1WOAA 4B3LA 1DXIA 1ITQA 3NQDA 1WDSA 4JD4A 3VNZA 2I9UA 4RX0A 1GOIA 4AF0B 4OBRA 1FOBA 3MV01 3EWXA 3OZYA 1QOQA 4M24A 3M5VA 5G2WA 4H83A 1IEQA 5CGQA 1C93A 3CMJA 3F5LA 4PL2A 4BS0A 4ENLA 4EXBA 3QV7A 3M44A 5G1MA 4DWSB 3WDPP 4UR9A 1G4SA 1F3XA 2VC9A 1WKFA 4H9ZA 1FHLA 1L8PA 1U83A 5E0KA 2GQ3A 2H3DA 3QTPA 4L4LA 3SCTA 3TYCA 2V3DA 3TOYA 1KFJA 1UB3A 2R24A 2P0IA 3RITA 2CLFA 1UCWA 3VUPA 1GEQA 1E0XA 3IVUA 2XN0A 1ZNNA 1LORA 1LRTA 4PULA 4DJDC 4EK7A 2WZEA 1UMYA 3VKAA 2CZFA 4M80A 2ZICA 1G7UA 1GVOA 2QCCA 1EX5A 2QPSA 4HU8A 4HB7A 4KKXA 2OSYA 3B8TA 2A2IA 2PDIA 5IDZA 3H54A 5HPCA 5CEWA 2I7GA 4W89A 3LM3A 5ABFA 4OZOA 3TONA 2FB2A 1X8FA 1UJPA 2P0OA 2NQ5A 1JZ5A 1EC9A 2Q6ZA 1NH6A 3T08A 1LBMA 1TPVA 3E49A 1HGYA 4J40A 1SW3A 1H63A 2V5LA 5HJLA 2ZZ5A 1XIJA 3QW4B 1DJYA 3TVAA 2NQHA 1ZTVA 3BICA 3NDOA 1FCVA 1VFTA 4TU1A 1R9ZA 2VR4A 1ITXA 1EGMA 5D9NA 1E70M 3I6RA 4HMCA 1AH0A 5DCDA 3BGGA 1D7KA 2VD8A 2EPKX 2D2JA 3B9OA 1GVIA 4YMZA 3W1RA 3PS7A 5CC5A 3VIHA 3MMUA 2OO0A 4QNWA 1J0JA 4Z0JA 4HHMA 4K7YA 3IK2A 1NAL1 1QPRA 2QIWA 5JIWA 1VD6A 5ENLA 1YLVA 1M6JA 2QCDB 5I79A 1V0KA 4I6VA 3GYCA 3OHMB 2CZEA 3UGRA 2IKIA 2BFGA 2F61A 5C71A 3WDQA 4EPEC 3GSMA 4J3TA 3QMTA 2X7VA 4G5DA 3BOLA 1TPWA 2VGIA 3KTXA 3DYOA 3GIYA 2OZ8A 3WFAA 4O11A 3IIPA 1HNYA 3NZRA 2UV8G 2HBVA 4G9PA 3IGXA 1W37A 4YCPA 2GGHA 2HVNA 3V7PA 3WH9A 3GNOA 1I45A 2W3ZA 1VHCA 4K3ZA 1B3OA 2SFPA 2B81A 4WIWA 2PTZA 1B3VA 4MYXA 1LQAA 3IJQA 4IGSA 2ZUMA 3H26A 4M8UA 1NDVA 2PRHA 3CLWA 1W5PA 2QJGA 1W9XA 2XIMA 4LS0A 5JQ9A 1CENA 2P10A 3GAKA 2XFYA 2Z26A 2YA1A 2PDKA 3ZYZA 3LERA 2YSWA 3QGVA 4OFCA 1V6TA 4JKKA 3HGJA 2ZX7A 2PP3A 3N6HA 2IXUA 1OFQA 2HDJA 4AD4A 4GUIA 4O18A 1K77A 1Z9AA 4OIFA 1W1TA 1EUAA 4A8RA 3PJUA 1UZHA 1NP0A 2C7FA 3UWQA 4ZXLA 1EJUC 3NQEA 1W56A 2A3BA 3DC8A 3U5UA 4QGCA 1T40A 3VPLA 3ONBA 3NNTA 4IFRA 2EEXA 5I00A 5HJXA 4NAFA 4EP8C 2Y0FA 2FVKA 1LWJA 1Q7MA 2BHUA 2A6NA 3ARSA 4Q6XA 3GTFA 2ZX8A 2WKJA 3DI1A 2CLIA 3PUGA 2G37A 3P0XA 3ZSTA 1F3EA 4XAGA 2CBUA 3HZ3A 1ONEA 3PWIA 4LCQA 1B3ZA 4ZQOA 3WH5A 4W85A 1CGXA 4JL1A 3VX1A 3REQA 4MMWA 1WUFA 1X38A 3B03A 2CITA 1PDYA 3MUZ1 4G7EB 2P3ZA 3ZWSA 4ASTA 1KGUA 1TV8A 4Y8FA 1R3TA 1JYVA 3ZJ8A 1R0MA 2QPUA 3W1AA 2WJEA 3MBDA 3H8AA 1DQXA 2ZC8A 4X61A 5ABGA 4C1NA 4EACA 2W67A 4XUGA 1JDEA 4A3QA 3A5VA 2Y8VA 8A3HA 3LCWA 3CPGA 2PD5A 2XWEA 4ONVA 5CBIA 1NP2A 3W7DA 4O14A 4QJ5B 3K8KA 3GR8A 1I9CB 3A12A 2GZXA 3ANYA 4CQDA 2JGQA 1N8IA 2QGHA 5KITA 5C9UA 1AJZA 1R47A 4RLIA 4ML4A 4CQ9A 4NAFB 3LRKA 4I9TA 3R1ZA 1FDJA 3W1UA 4QCFA 1IR2A 1CDGA 3LXBA 4FP1A 2EG8A 1SO6A 1YE4A 3NPXA 3QJAA 1J5SA 1P5BA 3WF0A 2EPMX 2WMKA 3VOFA 2R82A 2POTA 2Y7DA 3CWOX 2OKTA 2Y8UA 2AKZA 1C8VA 2O9RA 1VFFA 1EF2A 1R8LA 3CBWA 2X30A 1XFCA 1XQLA 2VNCA 2EQDA 4IMEA 1PX4A 2DIJA 5D32A 3QV8A 4ZFCA 3STFA 1MFVA 2IKJA 1XGZA 1WAWA 2WZMA 2INFA 3P0WA 1XIBA 4KEMA 1RHCA 3O9NA 1F2JA 2DJXA 1PAMA 4L5ZA 1IXNA 2J7FA 3BPWA 3VTRA 1UUMA 4DY1A 2V8ZA 2J7GA 4ZA0A 1XCXA 3MI3A 4F3HA 2AGTA 3CQKA 4U3CA 5CXPA 3HV9A 2YA2A 4Z1DA 2QS8A 1K6AA 4LALA 4AZCB 4Y9AA 1V77A 3E5PA 1OX4A 1V6XA 4MSSA 1XIMA 4A3UA 2E25A 1YIXA 1FXQA 1WZLA 1U1UA 4HNTA 5FAGA 3UG8A 1BQCA 5XIAA 3WMCA 1SFSA 1YXYA 1W3NA 4J2PA 3USBA 1HO4A 1E6QM 2ZXDA 3C4UA 3CQ0A 4WR3A 3ZJ6A 3I65A 1UD8A 3QPEA 2UY2A 1QCWA 4AX7A 4ACZB 2ZRYA 3CZGA 3FVMA 4JZ5A 3EKLA 1XIHA 5JXQA 1K1DA 2XTKA 1JI2A 3WF2A 2QCDA 1WV2A 2ANUA 2Q3RA 3WBEA 1X7IA 1SM9A 3UZZA 1UZ1A 3F2DA 1MSSA 2W61A 1XYZA 3DHFA 4F48A 3KVKA 3KP1A 1JXJA 1E6XM 3L68A 3GKAA 3L4UA 3IRDA 4DM2A 3BAKA 2J8TA 4E2BA 2NT1A 4M81A 3CPRA 4GFSA 3VMNA 4MFDA 3L65A 4LW7A 3WF4A 2CLMA 2WK2A 3WYZA 4QROA 4QE4A 4FOUA 2Y5JA 1EHAA 2EXOA 4HIBA 4UQAA 4CD4A 5A6BA 4L9ZA 4IICA 2G3JA 5M5DA 2WVVB 7CGTA 3W2MA 4GI9A 2RH9A 1JR1A 5HAOA 3AI0A 4B3ZA 1KBIA 4F2UA 1W9DM 4V2XA 3QZAA 4PUKA 1EP3A 3R13A 3UJSA 4IG2A 2A21A 5BXTA 1OEPA 3BOFA 4QLJA 2NZLA 5M1TA 4NJKA 3W37A 3HF3A 4GZJA 3PZMA 3NQMA 3R5EA 1ITCA 2J7HA 3CH9A 2ZIDA 1PCWA 1KGXA 4JTJA 4L7ZA 3WO8A 4IZGA 3L9CA 3AIVA 3V5OA 1TPB1 3OPSA 3G8EA 3CUZA 1O5KA 1VGAA 4WSKA 4Q6JA 4QEEA 3KZPA 4UZSA 2X1SA 3T8LA 4IMFA 3KCOA 1GTEA 3GD6A 1SO5A 2VR2A 4RXGA 8XIAA 1NVMA 1PS9A 4NSBA 1TJRA 2IPJA 4ALDA 3HB9A 4F9JA 3MANA 4UTUA 4MB3A 5CPQA 2ZRXA 4HNOA 3W2UA 3V3WA 2E7FA 5FEZA 2VURA 3QM3A 4UTJA 3OOQA 2PWGA 1X39A 4CQAA 3ITGA 1H7XA 2J13A 4D8LA 2D2HA 4I9AA 1EO7A 2ZZ1A 4PB4A 1Q6EA 4LOCA 3NQBA 4S2BA 1JQXA 1E4IA 2IUZA 4URIA 3H53A 3A21A 1OT2A 3A4JA 4OE7A 4O1FA 4Q4KA 4F0LA 3INPA 1ME8A 5HQEA 3EMCA 3ZLGA 3T7VA 4OT7A 2FZBA 2JF7A 1JDCA 1X6LA 5TF0A 2Z7GA 2V5JA 1FVPA 1NF0A 5C9WA 1QHPA 1YNYA 2HNEA 3R11A 4DVOA 2I17A 1A53A 1BRLB 1A0EA 3HPFA 1WDWA 2Z6JA 3F03K 1ENUA 1GJUA 5KZ6A 1YADA 2A6LA 4WY0A 3D5HA 2ZX5A 3JZUA 5BWFA 4RNFA 2GWGA 2FJUB 4HJFA 2PDMA 3G1YA 1K9EA 1HG3A 1Y65A 2PWUA 1TPFA 2QCEA 1UC5A 1Q45A 1NU5A 1XICA 4FHAA 2GFTA 4Z1YA 5HQMA 3RHGA 3MZNA 3MP3A 1S2VA 4DQWA 1BWLA 1LDCA 1J11A 1GHSA 3LPPA 4F66A 3ZR5A 4AVNA 3WK3A 5A8QA 3II1A 3WFZA 3CL8A 2DZWA 3LPGA 3UY8A 1F8MA 1KWGA 3LTPA 4L64A 5DXYA 2ESCA 4PGLA 1DXFA 3VGFA 1VZWA 1NSJA 2OEJA 3ZR6A 1ZPTA 2V5DA 1MZRA 2WHKA 2ACQA 2XSXA 4JY8A 4F2BA 4YNGA 1E0UA 2J24A 2EGZA 2ZQ0A 3LCFA 4JTTA 3CWHA 3EDJA 4MF4A 1GPWA 2XJ7A 4FK9A 2Y7FA 5FKYA 2GYIA 1SO4A 1FWJC 4PYSA 3BVJA 3G0XA 2X1TA 1EXBA 1FCUA 1ZU8A 2CKRA 4C6JA 4NZ3A 5FJRA 5FJIA 4EF8A 4IIBA 1P43A 1E6ZA 2HE8A 4LX4A 1M68A 2IQ0A 4XUYA 3LNMA 3SGUA 4NASA 3SRHA 1OYBA 3TV8A 5AC4A 4HPJA 1A50A 3PB2A 3GC2A 3QZEA 5FOOA 4L65A 5LIKX 2AL2A 4MZ8A 5DEZA 4NNCA 3WBYA 1UQYA 3STGA 1GQJA 3QV9A 3VIGA 4WDUA 1XCWA 4J5NA 4NX0A 5AHMA 3VKCA 3HQ1A 3EB3A 4M51A 3GFYA 3KBSA 4CNPA 1IHIA 2PTYA 3UWVA 1IEVA 3LRMA 4ZVJA 2TMDA 1H7WA 3AMDA 5BOFA 3MKCA 4RE2A 4S3EA 1NY1A 2VO5A 3CNYA 3PZGA 2FLIA 1YE6A 2QUUA 4PRWA 4GX9A 4DWDA 3M0XA 2ODOA 3OW1A 4N2YA 2QJJA 4TV6A 4UZUA 1NFPA 3TLLA 4W7VA 3UFYA 2V69A 3R2GA 3GG0A 1Q6OA 4IIGA 3WN6A 1T41A 4RV8A 1C8XA 5DX7A 4ATWA 4NZ4A 1J0ZA 3SGZA 3RM9A 4K7VA 2PDPA 1BG4A 4QAWA 4RDZA 3VD7A 3VIMA 4PRTA 4B16A 1ZJAA 4H6EA 5RUBA 2BSLA 4KWWA 2I5QA 4HOZA 3MU7A 2Z1KA 5HR6A 3NPWA 1WBHA 3FJ4A 3LCXA 1J2BA 4XAFA 4MIMA 3B9DA 4NZFA 2QEZA 1FXPA 4FIRA 4BK9A 2QGYA 3UYIA 4U33A 3KS5A 1TZ9A 3TA6A 1XD0A 1GOOA 2WJZA 1HIZA 1OF6A 2XVGA 5DXXA 4YWIA 2V30A 3GFZA 1VBUA 5IFPA 1BTMA 2X05A 4F79A 1G4EA 4XBSA 1MI3A 1MDLA 5EPDA 4BI7A 4TTGA 2C91A 1BPLB 2WSQA 4F0HA 1F6YA 4JY9A 3MA8A 2CHNA 2P8BA 1GW9A 1NWUA 1Z7AA 2REQB 1UD5A 1GOQA 3I7QA 4JAWA 1YX1A 4AZ5A 3SBFA 4FX6M 4P7OA 5TIMA 3UWYA 2Y7GA 4GX8A 1CXKA 2E5BA 1GVSA 1KM6A 1R7AA 2PBGA 3KRZA 3MCNA 4E8DA 1XV8A 4NILA 1F5ZA 3IUIA 2VFEA 1EWDA 4U2ZA 2QV4A 2YZRA 3R6IA 3KLKA 3NSMA 1B1YA 1WZKA 1EOKA 4PCFA 1TTJA 4ROPA 1H51A 1UR8A 1YTDA 2EJAA 5F4SA 3B40A 3S8HA 3F7JA 1HJWA 1QASA 3BLLA 1R46A 5LA0A 1W1IE 2QCHA 2FDSA 3RRXA 1ML1A 5E5CA 2DZBA 3WQ8A 3BZJA 3AUJA 3VILA 3PZNA 5HMFA 2YDQA 3QSRA 2Q8XA 2GOKA 3C0LA 4JR5A 1U5HA 5IRPA 4K36A 3EB4A 1ODZA 3AZRA 3ABOA 3P14A 3K8MA 2ZA2A 3HGSA 3VYLA 4ZQPA 3LI0A 3VZXA 1VYRA 3DESA 2GDUA 4ZODA 4JTIA 1BTCA 1XKJA 3QF0A 4GG9A 2V68A 3U57A 3O05A 2CYGA 3UG3A 3WELA 4TMCA 3OVPA 3I7RA 3PNUA 3GDKA 1JUEA 4DYKA 2TRSA 3N04A 4J4KA 4NHVA 1FBAA 2RDXA 4ACYA 2P53A 3QFEA 4BWLA 3ATZA 1LWHA 1H7PA 2WKLA 2YCJA 4W8LA 3A22A 3M0ZA 4A05A 3MHFA 1GJWA 1J12A 1POJA 1A3HA 2HBXA 3GXNA 3LLDA 4IX2A 3VIFA 4V27A 5JBFA 2IQTA 1UH4A 4YIWA 2GUYA 5EMKA 2C1HA 1VBJA 3VNIA 2YL9A 4JCLA 2WBKA 3KHJA 3IV3A 3ENLA 4QIUA 1HVXA 1WPCA 3LV6A 4ZENA 3OBKA 1ZQ5A 3N12A 1O12A 3KAOA 3CIWA 3C0QA 5CZTA 2PZNA 2FFIA 1XPGA 1W5QA 1BD0A 3PUEA 3NA8A 3S46A 2VOMA 1UP2A 3SSJA 5G2HA 1GPFA 3F1QA 3WLNA 1GEHA 2A5HA 5AECA 4RE4A 3WLIA 4U3AA 1HUVA 3NSXA 1R3QA 3EWUA 5K7JA 4PMZA 1K6WA 4NVTA 5A1AA 1VJZA 3A24A 3S9IA 1TWDA 1FWHC 1VFSA 3GHRA 3U48A 4GFIA 4LVFA 3W4RA 2CXEA 4G1KA 4C6LA 1T99A 4FI4A 3AC0A 4CVWA 1E71M 2FTPA 3HPSA 4Y9NA 5FACA 5J5DA 1JZ6A 3W24A 1CB2A 4NX5A 3S3GA 3WQ5A 3OG3A 2VFHA 4HMEA 2E6FA 5D2VA 3H2AA 1F6KA 1TELA 1QO5A 1UC4A 4BF7A 1XC4A 4R27A 2VUNA 1UG6A 4R9OA 4V1YA 1ONXA 5K3VA 3W28A 4C1KA 2HZGA 1VPXA 3QV6A 4LU0A 3H2EA 3TYEA 1KO0A 5KMYA 1SW0A 1M04A 1QDSA 1IT0A 2PGFA 3PZ9A 4OTKA 1YDYA 1JZ8A 4LUYA 1TJ1A 1Q6CA 4C6MA 1G6CA 4JHMA 3FKRA 2D0HA 1TVLA 4FS9A 1XLCA 4FLSA 1FWSA 3RU6A 3GQYA 2FJKA 2I56A 2DY3A 3AWNA 3M16A 4MNJA 1CWYA 4EAYA 1TRIA 3H23A 4TTUA 4B91A 3P81A 1AQFA 5BXPA 1TREA 4GWEA 1M3UA 1VAHA 4DBDA 4TV5A 1PDZA 4KIEA 4I8YA 3BQ5A 4KESA 1LOQA 1QNSA 1OX4B 1IT7A 2AQVA 3PBGA 1VEMA 1OFBA 3VMOA 2R94A 1KBLA 2ZADA 3QXBA 2E40A 5AHFA 2QMKA 2D2GA 2V0TA 3I10A 5D03A 5CZJA 1AQ0A 4NIRA 3QC0A 3FDGA 2XH7A 2DPEA 1PUDA 4HNCA 3UXKA 3O6YX 4F8XA 1KCXA 1CPUA 4D6DA 5FCZA 3GWQA 2QHAA 2NXHA 4GINA 4U4MA 1XBZA 2L5HA 3LTSA 3PULA 3H6OA 9XIAA 4JFSA 2YYUA 1GVRA 2UBPC 4J1OA 2BOGX 1B3XA 4IOTA 4ML9A 1DJHA 4OWGA 2V9DA 4DLMA 3EWBX 1QI4A 1R3YA 1K7FA 2YDRA 3HMJG 1X98A 2VMFA 2VENA 1V93A 3GS6A 3F5JA 4W87A 5HINA 1H2JA 3UY7A 4UFJA 4QCEA 3SCRA 3E0VA 3BAYA 4TQTA 2AAAA 4XSMA 5CPOA 4L4PA 1VFUA 5DBUA 3LLXA 3W7KA 1MRQA 5C5YA 4I5UA 3RMEA 4PRRA 1OWQA 3LSCA 2PRMA 4H9TA 2X41A 5AVNA 1XIEA 1VR6A 5A6SA 2IS7A 1ZENA 3MS8A 2ACRA 2GUBA 4BKNA 3MJMA 4QSFA 4Q8OA 3T81A 2V63A 1XBYA 3UZYA 3JS3A 1F73A 5G5IA 2FPVA 3BG9A 3M4HA 3P5ZA 1RY8A 3OVRA 4O28A 3RLHA 3ZT5A 1JNEA 4AZIA 3ICJA 1QT1A 4O1DA 4OUEA 1R85A 4W5UA 5E1QA 2V3GA 4LRSA 2R9RA 4EX4A 4EWND 1S2UA 3GE7A 4M0XA 2CFFA 1BWVA 2YIHA 2CZ5A 2R1MA 2HV5A 1QXLA 3VCNA 3WD0A 4XZNX 1SFTA 3B9AA 5BU9A 4PCNA 5LYRA 1W54A 3GZAA 1LOSA 4FMVA 4KT2A 2DEPA 3KVMA 1S5TA 3BAIA 4R88A 1W3HA 2Y4SA 3EMZA 5FI8A 3W2JA 3ZWTA 3HBLA 4H9MA 1VENA 1P7TB 2ZVRA 1UR4A 4A29A 1YW1A 4N02A 3N73A 2NVCA 3A13A 4BY3A 3W7RA 3RXZA 1B0IA 1I2QA 4JXCA 1RVGA 2OWXA 3S1WA 1SJDA 3F4VA 7TIMA 3IUHA 3WLQA 4FLOA 2ALDA 4JYFA 1HXJA 5LXXA 3RF9A 4K68A 2ZE3A 3U7VA 3IGHX 1FCBA 2GQ9A 4CUCA 1XFBA 7PTDA 3WLSA 2OJPA 2H9AB 1QNOA 4WKHA 4LS2A 1PIIA 4QDPA 5ABHA 3RUBL 4X2PA 1A5AA 4Q4SA 2V3FA 1EKOA 4X0NA 3QTGA 3IGSA 1JPIA 4WHBA 5DQPA 3FEQA 3GNPA 1XCFA 3UVIA 1UZDA 3K4AA 1N55A 3AJ7A 4Y90A 1EEPA 4G7FA 1G0CA 2PU1A 4C5ZA 3WF1A 3CEPA 3M5ZA 4JTQA 4GPNA 4MZYA 1KKRA 1V51A 2WC7A 1QRQA 3FA3A 5FJPA 3GO2A 3GY1A 3I3DA 4IP7A 1S2CA 3O6CA 3JZEA 4W86A 1R9YA 2KX9A 5GQBA 5HNTA 1JZ3A 3CYVA 4GGHA 2J79A 3CQIA 1H1ZA 5J04A 4J27A 3TYBA 4Q8QA 2ZX6A 5FA5A 4FR6A 4J3SA 3LCIA 1S1PA 2OQLA 5HOSA 4HZMA 1MW1A 4IT1A 1R2SA 4DI9A 3S2MA 2JBMA 1W1A1 3N19B 4GXWA 3VGGA 3MHGA 4AIOA 3WDRA 3WQPA 2E9LA 3PTMA 1XLAA 1P4CA 2WANA 5B80A 1DPMA 4H01A 3TSBA 2VX6A 4KH2A 3QR1A 3VO0A 1ZUAX 3FW6A 4C7GA 2JKAA 3SO7A 3TYUA 4BI5A 3UZXA 4IPPA 1W2VA 4ZOAA 5GJPA 3AIWA 2QCFA 3ATYA 4MPQA 4BA0A 1HO1A 3BGAA 3ARYA 1PKMA 1R3RA 3O2LA 1VQTA 2VCBA 1GOKA 1W3IA 2Z2AA 2R1KA 3WK1A 1Y0EA 4M6PA 5CKSA 1DYSA 4EXQA 2ONEA 1AG1O 4XIMA 3FKKA 3QR0A 1QK2A 4XD4A 1UUQA 5JH2A 5ABFB 3NQ2A 3DH7A 3C2EA 3P62A 3F2CA 2GVGA 3W6LA 3R8HA 5E0CA 1HKWA 4FR1A 1O5RA 1TPDA 5CPTA 3LOTA 1Y5WA 3CAKA 1Z89A 5IDIA 2BX7A 3G18A 5CZSA 3SCPA 4PTMA 3TTYA 4TX9A 4XZ9A 2FDMA 2WLZA 4A21A 5E6YA 4U10A 3EWYA 3G5EA 2QDDA 1HKIA 1OFAA 3S42A 3DFOA 3W02A 1FH9A 3NQ8A 1CZ1A 3VGHA 3WLMA 1FQ0A 1WX0A 4Q8TA 1Q6RA 1DWFM 1SSGA 3TZFA 3VGBA 1I8JA 2WOQA 1OGSA 1POKA 1U5VA 1F7BA 2C15A 1RCQA 2YL8A 1K3UA 4JIHA 4LH8A 4IPNB 1KCZA 1UA7A 5T8GA 3EX4A 4B2DD 1KR1A 5FIPA 3T07A 1AK5A 2F6XA 4RPPA 2NV2A 1MW3A 1XLHA 2IMRA 4UWMA 1XDMA 2D1ZA 4KGLA 5HNRA 2Y62A 2A1YA 1XG4A 3PG8A 2W4XA 3K4DA 1DE5A 2GGGA 3BLEA 5I2UA 1AD4A 1ADOA 3ABRA 3CUHA 5KZMA 5C6MA 3WNNA 5PTDA 1VFMA 1JFXA 4LUTB 3DECA 1XM3A 1E9IA 3N3TA 2PWEA 1QU4A 1LL7A 1PTDA 3ZT7A 4JOMA 1MUCA 1JRCA 2WC3A 3TYDA 3WBWA 4IL0A 1W2PA 4MUPA 3L0GA 4HA3A 3KVJA 1BWKA 2YDAA 4KWVA 4Y9PA 1XLGA 1JD9A 3MSDA 3WJYA 3EMQA 3IJ7A 4O8AA 4MHBA 3O16A 4AVFA 4Z2GA 1TV5A 3IJLA 4XTDA 3AXKA 1AODA 3UXAA 3M0VA 2OO6A 1EPXA 3LEPA 1XD1A 3A3HA 4QS5A 4F0SA 3HURA 4JTCA 4ZQMA 1J0YA 4GKLA 1UR2A 4GQQA 1S2WA 3RDKA 5HWMA 3BARA 2Q02A 4ZR8A 4GVHA 2OR2A 3T78A 4CEXC 4HYVA 2PDYA 4FNPA 4E6MA 3USZA 3RLGA 1BG9A 3DZ1A 1LBFA 3AIRA 4OV9A 4BR1A 4HN8A 3T0CA 4B9ZA 1JPDX 3G8RA 4KWSA 5FEXA 3HMCA 2VR5A 3GXIA 2EBNA 3WLJA 5LNUA 4PTNA 2ZRUA 4P7QA 3UU0A 3FNDA 1TV7A 4MWAE 3GVWA 4MAZA 4S3KA 3LBMA 2YW3A 2Y85A 2E1WA 1P48A 1R3SA 4XKMA 1QAPA 3J7HA 4X2RA 1SJAA 4HN4A 2YL6A 3OLIA 3SAZA 3WQWA 2AQOA 1V3IA 4IQDA 3WMSA 3ABXA 3N25A 3LLFA 4W7UA 3SQMA 4H2CA 3W25A 1H7RA 4AY8A 4Z2LA 1W32A 4F2TA 4B5VA 3DFQA 3VIJA 3AWOA 3IIOA 4Q8NA 1EWEA 2DW6A 2Y2WA 4BWLC 5AVHA 5MF5A 3ITOA 4Q8PA 4BJHA 1TR9A 3BSMA 1HVQA 3FSUA 3RCYA 4HHHA 1K8YA 1Q13A 2ZA3A 5D9PA 1KLZA 3WBAA 3KP0A 2TSYA 2J88A 4OQVA 4WY0B 3KFTA 2CW6A 3SJNA 2GVJA 3WEZA 1XLLA 2Z1VA 4X63A 4A8IA 3SUSA 1K4HA 4P8VA 4NXSA 2VI0A 2PPGA 2OTDA 1T0OA 1UIPA 1V02A 3BANA 1H50A 5T26A 1UROA 3BDKA 3GHUA 2VRJA 3ARVA 1ZCCA 3BAWA 1BYCA 2DGAA 2CHRA 1EUNA 3DFPA 1DQUA 2V5BA 1XL9A 2VFDA 4D2JA 1Z8AA 4MPKA 3V36A 2OT1A 5K4ZA 2CBJA 1WDQA 5KZDA 4B5TA 1F76A 2FZDA 5BCAA 3GAYA 3U4AA 3U2EA 4AHQA 1GQLA 4KF1A 1PX3A 1AVAA 1XJBA 2XUCA 4ORMA 4ERGA 3MMWA 5IHRA 5KETA 1HL9A 2WCAA 3VIKA 3W81A 3RIKA 3S83A 2HXTA 2P8CA 2PCEA 3K5XA 1EZWA 1KA9F 1OFRA 2OLAA 3BW3A 4CCDA 4C7FA 1NTHA 3F2BA 4JTHA 3NL5A 4EF9A 2XM1A 3HOJA 4ATDA 1CXEA 4JNMA 2YCEA 2NWRA 4N9BA 2PDLA 2DJLA 4FNUA 1O5XA 3PSWA 5BRQA 4D8ZA 1TFVA 3M0KA 3EOUA 4PR4A 3B8VA 5A2AA 3SFWA 2HK1A 1KRMA 1RP8A 3F4DA 3KOZA 1JPKA 1WDRA 1TB3A 1SO3A 3WLOA 1EDQA 3I6EA 4S3FA 3O07A 2POZA 4DEFA 4MWAB 2OZ3A 4D1JA 4GA8A 4UCFA 2CERA 5D33A 2ZRWA 1TG7A 4AC1X 2WNQA 4DJED 4EOUA 1ZFJA 3HG4A 4WF7A 4R85A 5C9XA 4ZOEA 5EMMA 1YTEA 3KEHA 2PRLA 4BCEA 2Q01A 3QPYA 1JZ7A 4WZHA 3QKZA 1G69A 3SY8A 3AMCA 1P0KA 3STCA 2WHMA 4WQ6A 1OF8A 3KE0A 4H41A 3GU1A 4AY1A 3O7UA 1GZJA 1EFZA 3KS6A 3CV1A 4GISA 1W3LA 1W9BM 3QMRA 4MJZA 4N9DA 1LCOA 4RKAA 4O1AA 3PG9A 1QW7A 2VM8A 1CXFA 1MNZA 3VCRA 3VGDA 1KXTA 4YTRA 1CECA 1H1NA 3OHIA 4GY0A 1T7LA 5ECVA 3AHVA 1G1YA 4C6KA 4PMVA 4POCA 4DPQA 1KTCA 2NX9A 3K2GA 4PTVA 2VEFA 4XO7A 3AFBA 4AWSA 4EWJA 1VIZA 2E5CA 3IANA 3TW9A 4PB5A 3DKJA 1EJTC 1NQKA 1MXSA 2J7BA 1EOMA 3PUOA 3WD3A 3VDAA 4KWUA 4E2VA 3GYEA 1P7TA 1UHVA 4EVZA 4DYJA 2X0YA 1A5KC 3T42A 3B0PA 3ISIX 5A6AA 1OINA 4B9YA 4ACZA 4MB1A 1ZAHA 3B0YA 3W7EA 5I3DA 4G6CA 1E3ZA 1JAKA 3LGDA 3MPGA 2WMHA 4DWSD 4ZO8A 2WNNA 2QUMA 2D0GA 5T9BG 3C52A 4DJDA 3KOFA 1NWRA 4GJJA 3R79A 1OADA 4GIRA 1W8SA 1ME7A 5D05A 5DCEA 4AD0A 4AMCA 3WD4A 2EO7A 2Q09A 5LIXX 3D0CA 5F1UA 5M03A 1NJJA 4H1ZA 2UZ9A 1CXIA 1KM0A 3FGCA 1XF0A 4XTIA 3CTTA 3NEHA 1KBKA 2PFHA 4QTGA 4FX7A 3VD5A 3HG5A 2CETA 3M0HA 5EA9A 3UWUA 5TNVA 3M6YA 1A0DA 3W88A 1W1ZA 1RLCL 5TAOA 3ZFHA 4V33A 3W53A 1J9YA 4EPKA 1A5LC 1H5VA 5A8GA 1C91A 4W8BA 1GQKA 3D3FA 4ICMA 4GQBA 5CSRA 3TP4A 3F5KA 1THFD 3TR2A 3W1XA 1RJQA 4R5EA 5DT5A 3LX9A 4RE3A 2ISSA 3IGUA 3TXZA 1IXOA 1XUUA 4MJ4A 4LQ1A 4HBKA 5CJMA 2GVLA 3T1GA 4DJEA 3BOXA 3QKEA 2MUCA 4HZ7A 1DQWA 1LT8A 3KUMA 1XIGA 1GG1A 1P1XA 3VNDA 4ZTXA 5G4WA 1K8ZA 3WLHA 1EH9A 4PTDA 4RW5A 4O15A 4UTTA 4AQLA 1W9PA 3ARRA 3PP7A 3P6LA 4X22A 2V2HA 1E56A 4GXPA 1ZP3A 4N0RA 3DUGA 4L1WA 4LRTA 2OODA 4UUIA 1PEZA 5C2XA 3TROA 1V79A 3L4ZA 3BJSA 3BSHA 4HHLA 3GVQA 4NG3A 4NL1A 1T96A 3R0KA 2DZXA 3SGGA 3LMYA 3KW3A 2I1OA 2ZX9A 2AL1A 5FF2A 5LNVA 2NQJA 2WV8A 4MAVA 4HOXA 4D1IA 1L2QA 1E6SM 4E4UA 5A6KA 1WA3A 4CN4A 2BB0A 2A7RA 1KBJA 2P50A 3WQDA 2VKZG 4G7EA 1Q6LA 1Y8BA 1PZ2A 1PWLA 2OGJA 2FGZA 4LCRA 4C6CA 1OIMA 4Q7IA 3L4TA 1Y5XA 5F4XA 2IKGA 3U5YA 1QJWA 2CZVA 4QDWA 4LPCA 3THDA 4MJ2A 1HZYA 4KPLA 1GUVA 2ZOXA 2VZOA 1AUSL 1XLMA 1SR0A 3MUCA 2WNWA 2D3LA 4M6VA 1JCJA 4WKFA 1OSEA 1UD6A 3MKKA 3ITCA 4DZAA 3G2GA 3FN9A 1DV7A 3ARWA 2OU4A 1Z32X 2YLLA 4E3TA 1LYXA 3EGJA 3AJXA 3AU2A 3SUWA 1S5NA 1BAGA 3WEOA 1NFBA 4ZCWA 1DJWA 3K4WA 2WJDA 2PBOA 2AMGA 3ARQA 1XGDA 3CGTA 2EF9A 2TODA 2ZYFA 4LYKA 3UR8A 4BF9A 3A3WA 4Q32A 4AHPA 3QY8A 5LGXA 3OGSA 2RDUA 1ZS2A 4CD5A 4BHYA 3V75A 3SUUA 1QI2A 1R2TA 1XS2A 2WB5A 3W23A 3LV5A 1AZ1A 1LWIA 2OT0A 4RJEA 3SM0A 4XISA 4DUVA 3W73A 3ZMRA 2WSKA 1JXKA 5EGRA 3QW3A 5AC7A 2Z1SA 4IX0A 4U28A 1UJQA 3KCJA 4EPBC 2Q71A 3EBVA 4LVBA 2BVDA 2HPIA 3O6DA 4LF1A 2IPFA 3V0TA 1E4LA 1ZZMA 2OCZA 3GHSA 3BV4A 3E2SA 3UPMA 1TMLA 2WZIA 3U2CA 3R8GA 2GJLA 2DUAA 4AISA 1RBAA 4HMDA 1OC7A 4GVFA 4B4HA 4MWAC 2AMXA 2PU0A 3S2CA 2OX1A 3JRKA 4BQ4A 3G0UA 5I02A 3WD2A 5AHLA 1H09A 3ARXA 3CB3A 3UPBA 1NM9A 2J9XA 4IQLA 5D04C 1OM0A 4JYEA 1B31A 3MSGA 4UCGA 2ZZ4A 4KCTA 2HNHA 5CPSA 3BSGA 4WGXA 3EZ4A 4DJFC 5I5RA 2XVLA 2XIIA 1NWTA 5JH1A 1QPNA 3B04A 5K9DA 4JCMA 2ACSA 4DBEA 5AHNA 2V81A 3IK4A 5AC5A 3BURA 1BSLA 4NI3A 1JCNA 4UFHA 1EYWA 1VBRA 1CLXA 3W70A 2C8NA 3S2JA 3S0CA 1H60A 1CXLA 5B7ZA 3O06A 3FJNA 4OVXA 4IJRA 1VCGA 3B8DA 3KLLA 3LHWA 1U5JA 2EHHA 1SVDA 4ICNA 1A5OC 4NXKA 9XIMA 3WSUA 5FSDC 4HU4A 1OZMA 5FJTA 2Y8KA 1H49A 1QO2A 1O68A 1SZRA 1CGVA 4E4PA 4ZMGA 1HGWA 1I1XA 3W6MA 1B9BA 4DJFD 2CNCA 3GW3A 2GGIA 3R94A 3O0KA 4YVVA 3W38A 2B31A 3BMWA 4AMAA 2X16A 1Z69A 4GZIA 2F84A 4IP5A 4JNYA 1UWSA 4O0QA 2PWHA 3CUGA 4K2SA 5HANA 4PMOA 1UR3M 2YCLB 3QOMA 1JYWA 3HJZA 3WBXA 5D4YA 5FD0A 5CSUA 3VE9A 2DSZA 3E0WA 3F4NA 3B4YA 4LYPA 3A6OA 3T44A 4AIEA 1ZCOA 5CQ1A 5CBJA 6TAAA 2ALRA 3S47A 2CBIA 2C3ZA 2BXVA 2QZRA 3GUWA 3C3UA 4ZGYA 3CL7A 5A5WA 3W07A 1E4MM 2BG5A 2NSOA 5EBUA 2BXZA 1C3FA 3DENA 3FJ6A 4MDOA 4YHEA 2IW0A 3DFTA 5JBEA 4HTBA 1C9DA 1SFJA 3GM8A 3GDLA 5BYWA 1N8FA 1F8IA 3M46A 2WJFA 3NZ1A 3TJ4A 1ZBVA 3BCDA 1ME9A 1UMLA 4JQ2A 3RJYA 3TIMA 3FY1A 1OK4A 1FWGC 3GG1A 6CGTA 3HPAA 2E77A 2JE8A 2QW5A 2XGBA 1UKQA 4QJ1A 3T05A 3OU8A 5HWJA 3SJ3A 1YDVA 3TA9A 3UJFA 2BV9A 2NV9A 3LPOA 2VRQA 4ZSUA 1UD2A 1L2UA 1VCFA 3PTKA 3GDBA 2HRWA 1SPQA 2C0HA 2YW4A 3IARA 3SURA 5DY3A 4MY9A 3E1F1 1UH2A 3UR5A 2UY3A 1QI3A 3WENA 2AKMA 1FP8A 1O5QA 1TIMA 2O0TA 1KFKA 3ITVA 2V82A 4Z2JA 3GBDA 1IYXA 3NCOA 4Q8MA 2E6DA 3R89A 3C2FA 4WXZA 1L6GA 3H2MA 5EB8A 2QCMA 1MO0A 3GXDA 4R9XA 5HA7A 1Q5MA 1N2VA 5LNWA 3SI9A 1QNRA 5I3FA 1PYMA 4LB3A 4QQUA 1VJSA 1GQIA 3PBVA 2QVHA 1DWHM 1FWDC 4GRSA 3SR7A 3G3DA 1Q7QA 3ABSA 3EA3A 1ISYA 1PL9A 1TWZA 4MJMA 3GNRA 2W6RA 3BK0A 5AYXA 3B9EA 2GWNA 3O3RA 1J0HA 5E70A 4J3XA 3FYYA 1V03A 3RRAA 3F4WA 4RL3A 1RQEA 3QSTA 4PUJA 4LANA 4M56A 4IIDA 1TYGA 4CQBA 4JKLA 3QMSA 4DF0A 3W1LA 4CGTA 2VXNA 3ANUA 4QP0A 1ZHAA 1S5WA 4XAYA 3NQCA 2DZAA 5HATA 1OZQA 4HOWA 1G4PA 4DBSA 1VB9A 3IJ8A 2IPWA 2EKCA 5HWNA 3WLPA 5CBBA 3MBFA 3MYPA 1LP6A 4M1RA 3CPUA 2ZVIA 3S1VA 7A3HA 1FX6A 2VUYA 2QAFA 3PWGA 5AN7A 1EIXA 3EDKA 3U6WA 3TK7A 1KM2A 4NYYA 3NQ6A 2ZRVA 3VXGA 4S3CA 1QI5A 3DERA 1E6RA 5BXSA 1WKDA 4M19A 5L6UA 1QHZA 1VFOA 2C18A 1M53A 1JZ2A 4O0KA 2YFOA 1FWWA 3RK8A 3VNMA 2J4GA 1XH0A 4Z42C 2J74A 3KOWA 2FYMA 2O9PA 4CD6A 3S6DA 4IIFA 1TJ0A 3CH0A 5FJUA 1GVFA 4IMDA 2VELA 5CSYA 1KM4A 1LROA 4Y96A 3WDIA 2CCRA 4Y2WA 3ANVA 7REQA 2VFFA 4NRRA 3W7CA 3MUIA 1QPOA 1YPFA 1JGMA 1Q4WA 3POHA 3TC3A 2CPUA 5AYBA 3GR4A 1LRQA 2EPHA 4DJDD 1XYAA 4DZ5A 4P5UA 1J79A 1JCTA 3WDJA 4QXIA 5FJOA 2WZHA 2RJHA 3MWCA 4E8GA 4MLRA 3SY1A 1KFCA 1MMFA 4N4PA 3HTWA 2D69A 4AZGA 4AD5A 1UD3A 4RDYA 1QATA 3CL6A 1RK6A 1YBQB 4AYGA 1XX1A 3A47A 3G3MA 2V2DA 1OFPA 1BYDA 1GYLA 1AW5A 1Q6QA 3WK0A 2OLHA 1E6NA 4MNMA 3NXFA 3HIJA 1MNSA 4XV0A 3AICA 5A8MA 1PZ3A 4LBSA 1W3KA 1ISZA 1WYIA 1XH1A 4O54A 4PL1A 4JTUA 5F2GA 1IZJA 1LUCB 2PUZA 2OFJA 1RLDA 4LVAA 1U30A 4QR6A 2R1LA 1GHRA 3AISA 4OUIA 3N6JA 1FDZA 3GTNA 4JIIX 1AL7A 1YEYA 4XAZA 3UCDA 3IVTA 4H9UA 1W9UA 1ZRQA 2FMNA 2VCAA 2YCLA 4B90A 1L6SA 4FZIA 1E0TA 2VT0A 1EA9C 1VJIA 2FMOA 3OVGA 3FV9A 3L2LA 1IEWA 3TW7A 1CW2A 4IF2A 3N2OA 3W6YA 4IPIA 1HFBA 1PV8A 3OBAA 3TX9A 2C0AA 3FXGA 3A4XA 1BRLA 1C9WA 4HCLA 3EXTA 4K38A 4JEJA 3LXAA 3BQ6A 1UR0A 2XU2A 3QYQA 2DQXA 3LS9A 1ESWA 3MT1A 4L1XA 4XBKA 4N9EA 3PN8A 3AS3A 2YBVA 2GQAA 3GVVA 3LCLA 3H12A 4LUJA 4AIUA 1NARA 2PC4A 1EP1A 3I4KA 8XIMA 1O6IA 3EX1A 3AYSA 1CGYA 1XYLA 2PEVA 3ZLFA 4H9XA 3AXIA 4PB3A 1V5XA 1UPMB 3NYDA 4GYPC 2XVPA 2DV0A 1R5YA 4LWWA 4DX3A 2BS9A 1PKLA 3N18A 3HGRA 2YPIA 4Y9MA