4V27A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-isofagomine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Kinetic Dissection of the Endo-Alpha-1,2-Mannanase Activity of Bacterial Gh99 Glycoside Hydrolases from Bacteroides Spp.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 127
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v27A00
1V0LA 4TOQA 3ZJ6A 5A94A 2YA1A 2ZICA 2X09A 3BCFA 3EBVA 2XGBA 4M24A 2XVKA 2Z1KA 1E4LA 1XSJA 3EDKA 1V6UA 1KXVA 2XM1A 1MWOA 5JIWA 1I1XA 1NQ6A 3U5YA 5E09A 2DT3A 3T0DA 3SCPA 1LL7A 3MSDA 4H8HA 4XZWA 1RPKA 5IXEA 2Q8XA 3AXIA 3L2MA 1V6YA 2XJ7A 3S2CA 1JFHA 4A4AA 5E0FA 2NSXA 1UQZA 1GQLA 3MMDA 1QOXA 3ARQA 3VD5A 4J3TA 4J28A 3SEPA 2UWFA 5F7UA 1HJWA 4ATWA 1MW0A 3GDBA 1JGIA 3DYMA 1P6WA 3SURA 3OBAA 3WF1A 2DSWA 4D1IA 4E8CA 2WHMA 1XHGA 3CUFA 1QI3A 4IM4A 4LGXA 4NSBA 3SCQA 2PB1A 4CU7A 1QW8A 5CSUA 1SMDA 1E6QM 1H09A 3WNOA 3L2LA 4HTYA 3GH7A 1E5JA 3MKKA 4EKJA 2DEPA 1VBRA 1W9UA 2EPMX 4R27A 1EDGA 1JZ5A 1V3LA 4NZCA 2XVGA 2DT0A 2GJXB 1D2KA 1GOOA 2OYKA 3UG4A 1H11A 3LPPA 1HNYA 3ZOAA 1WP6A 2WC7A 3OGVA 4AZ5A 1NARA 5D9NA 3ARSA 3SCOA 1BLIA 1UKPA 1XD0A 1ZBKA 2BY0A 4CUCA 3QOMA 1JFXA 4UFKA 2WMHA 1Q6CA 1NWSA 1IT0A 2ZUUA 1VFOA 1UG6A 5A2BA 2VRJA 3HN3A 2CBJA 2WM0A 3WH8A 4E4PA 3SCTA 3TONA 1D3CA 2J62A 3WNMA 2PBOA 1C90A 1CGUA 3WSUA 5ABGA 1K9FA 1IV8A 2QHAA 1VFMA 4WF7A 1VENA 1FHLA 1US3A 3AROA 2WBKA 1NP0A 3ARYA 4MJ4A 1I1WA 4AZBA 1BYDA 1EIBA 1NOWA 3BSHA 4UQDA 2CHOA 1UH2A 5EMYA 1H0IA 1W1PA 2X8RA 3TTQA 1E71M 5M3WA 2OYMA 1V6VA 3OLGA 1QHOA 3AXHA 2VCCA 1HKMA 1K9DA 3ALGA 3CPUA 1NOFA 3OGSA 4WK9A 1V0KA 3VD7A 1ZB5A 1BAGA 4CN6A 3EDFA 3CUJA 3AZTA 3VX1A 1IZKA 4B3KA 4QCFA 4PMYA 2PI6A 4CKQA 2D20A 3CZGA 3WELA 3OZOA 2AAAA 3BH4A 2XTKA 1CENA 3AISA 3MUZ1 1U2YA 2DT1A 2VI0A 1US2A 2FHCA 1BPLB 1XYZA 2Z1SA 3CZKA 4X0NA 4A3YA 1DWFM 3WMBA 1XGZA 1D7FA 2XSAA 3SUTA 2C0HA 3M6DA 2WHJA 4F66A 1E6NA 2JALA 2J8GA 5GNYA 4S3JA 3VIOA 3AMCA 2RGMA 3QR3A 1EHNA 1UHVA 1WCGA 1OD0A 1LL4A 3SCNA 1LWJA 3MU7A 4YHGA 1LQ0A 3CMJA 1DWJM 4YN5A 4RE4A 1JF5A 4V27A 1HJUA 1KR0A 3VUPA 1JZ4A 4J27A 1WE5A 3ZIZA 1HKKA 1GW1A 4PTVA 1W1YA 3NUKA 1VBUA 2WB5A 4PBGA 3DECA 3KL5A 1UD3A 1OIFA 3RCNA 2VZTA 1DWIM 3AOFA 3UESA 4KRUA 3VNYA 3OB8A 2BVDA 4AEFA 1W2PA 3WQ4A 1B3VA 2DIEA 2VNCA 1FP8A 1JNEA 1KCKA 3CHCA 1OWQA 3AS0A 4AC1X 1BYCA 1J11A 1CXHA 4BZYA 3W4RA 2XIBA 3WIJA 2D0HA 2WVTA 3WMCA 2BHUA 3PZTA 4DM1A 4H8UA 2QF8A 3MUIA 5I23A 3THDA 3WBEA 2Y8KA 3WH5A 1F4AA 4CU6A 5JBDA 1UD5A 2JFEX 1G0CA 1H3GA 5GNZA 3I3DA 1GVYA 1GZJA 4EK7A 3AIWA 4BQ5A 3AMLA 3OA5A 4EE9A 3SUSA 1PPIA 2CYGA 4ML4A 4F8XA 4U2YA 3OGRA 2ZIDA 1RH9A 2X0YA 4Q22A 2GJXA 3VILA 3RO8A 4UFHA 2Y24A 4RE2A 5EB8A 5C71A 3AIUA 3KL3A 2WMGA 1KR1A 1CEOA 4GXPA 3AHYA 2Y4SA 2GVYA 4PMOA 3AYRA 1GOMA 1E4IA 4P8WA 4P7RA 4M1RA 4DWSC 2A3HA 4W8LA 1B3YA 4AD1A 2BVYA 3CBWA 1KBBA 4Y7EA 2J78A 5I2UA 2QPUA 2YLLA 3BAXA 3WQVA 2EEXA 2J8FA 4K68A 3OIHA 1JNDA 1C8YA 4W89A 3NDYA 4HOWA 2XSBA 4MB5A 4DM2A 4U3AA 2XUCA 5BWFA 4LXFA 1R86A 2FH8A 1JDDA 3W82A 1XCXA 4HZ7A 4HA3A 4CN1A 3SUUA 1NWRA 2UY2A 1ISZA 2BS9A 1KGUA 2TAAA 3N11A 2VTFA 1CZ1A 2BXYA 4OOZA 3GBDA 1AQHA 4Q7NA 1HXJA 3WENA 3VDBA 1C93A 1KB3A 1NWUA 2C7FA 5ABEA 4BA0A 3ARUA 3RM4A 5D8ZA 4HZ8A 4HMEA 4MTVA 3VIFA 3IJ7A 3ARRA 3MV01 4W88A 3ALFA 1GNXA 2W4XA 5LYRA 2VRQA 1CPUA 3WDIA 1CGVA 5BXTA 1BYBA 4UQCA 2WZEA 3AYSA 4KH2A 5A6KA 1QPKA 2QMKA 2GK1B 1EGZA 1ODZA 1NM9A 1UR1A 2G8ZA 3OZPA 2G3NA 1C8QA 3CO4A 5A2CA 3UR8A 1BVZA 5AC5A 3AZRA 4CU8A 2E9MA 2WVUA 2FGZA 1M53A 1CXEA 5E70A 3W38A 1V3JA 1PBGA 2Y5EA 1UWIA 3CZLA 4X9YA 3FN9A 4AIEA 3WDPP 3WEMA 4MNLA 4TX6A 4UOJA 4BCEA 4P8XA 1A3HA 5I6SA 5HDRA 3BLPX 3NIYA 4D72A 5HXMA 1QNRA 2ZXDA 3B9EA 3K4DA 3SCVA 3ZMRA 3ZSSA 4R5EA 4GO8A 4OZOA 1E43A 2G3IA 3EMQA 3QHNA 4J3WA 3WFZA 5CQ1A 1PAMA 5FL0A 1V3KA 4NRSA 2WCSA 2DH3A 1MYRA 1CLXA 4W7UA 2D3NA 4OIFA 1GJUA 2WWDA 3VGBA 2VR4A 5DO8A 3ECQA 4Z2IA 3WEOA 3KZSA 2YDRA 3WD4A 1HKJA 4D6FA 2XIIA 4XB3A 2BFGA 3VX0A 1DTUA 2J7FA 3FY1A 4AYSA 3T2OA 4HA4A 4W85A 1ZBCA 1E40A 1U30A 1QNQA 4LYRA 2O9PA 3KL0A 5LA0A 2W92A 4D6IA 2YDSA 3MV11 4TVDA 5CXPA 1OGSA 5IHRA 1E6PA 2ZOXA 1UKQA 2GSJA 1RD6A 1G5AA 1E56A 4JHZA 4GQRA 4PCSA 4AWEA 4M56A 2CITA 1J01A 5A6MA 2DPEA 1H4PA 3VGFA 1Q6EA 1WDSA 3K8KA 4PTMA 3DC0A 2WKLA 1OD8A 1CGXA 4ZFMA 4DWSB 2X0HA 4W8BA 4FMVA 1J0JA 3QGVA 5A95A 1BG4A 3A3HA 2WAGA 1V3MA 5JUVA 1CECA 1PIFA 2OWWA 2WBGA 5A2AA 3UG3A 3WF4A 2VT0A 4A3HA 3BMWA 4MNMA 2VURA 4HZ6A 2PWFA 3WD1A 2VZSA 5M5DA 3PZIA 4ATDA 6A3HA 4W7VA 3O2LA 1GOIA 2W61A 4JAWA 4M82A 3AI0A 1C7SA 2XPKA 3K8LA 1H1NA 3NSNA 3THCA 3E1F1 1J9YA 4AZIA 4PEEA 4J3VA 5AC4A 1KWGA 4GO9A 3DYOA 4WKFA 3TTSA 2XFYA 4UZSA 2G3MA 3VDHA 1MW1A 3WDHA 4AZ6A 2BNJA 5EFDA 1WDPA 1QI2A 2JF7A 4MNKA 5A1AA 5CLWA 1XC6A 1QI4A 4MAZA 5E9AA 1W3HA 3TA9A 5C70A 1KXTA 2XG9A 8CGTA 3RM8A 3LMYA 2WANA 1FHDA 1KXHA 3GNPA 4P7QA 1JDAA 4B9YA 4RE3A 1WDRA 1JI2A 3FHAA 4U33A 5BXSA 3GXDA 3PTKA 3L4WA 4XX6A 3WH6A 3VGGA 1FH9A 1E6RA 2ZUWA 3WQ5A 2WC4A 3VDAA 3JUGA 5ECUA 2GJPA 5HOSA 3EYPA 1M04A 4AIOA 1J10A 3BGAA 1BQCA 3PN8A 3WNNA 3L4UA 5GPRA 1EXPA 1VEPA 1W3JA 4ZE4A 2GK1A 1W3KA 3VGHA 2WK2A 3VM5A 4LYQA 8A3HA 2UY4A 1V6XA 1H49A 1ZBWA 3ZJKA 1WDQA 3LPGA 4IISA 4AXNA 5I5RA 4UNIA 1HJVA 1G9HA 1VEMA 1JAKA 1W91A 1HL9A 1G1YA 1OGBA 2EJ1A 4AD5A 2YL5A 5IFTA 3EDDA 3WNPA 4H2CA 3WNKA 3VMNA 3SUWA 2VX7A 1KQYA 1J12A 4PMXA 1BYAA 2EBNA 3CMGA 1TE1A 1K6AA 2ZUVA 3AS3A 4QFUA 1BGGA 1MXGA 2J25A 4PSRA 3W29A 1LF1A 1BTCA 2FDMA 1TUXA 3WL0A 1DP0A 3AQUA 3WFLA 1GOWA 2A3AA 3L4VA 4HMCA 1CGTA 3RPMA 3ARPA 5BXPA 3FXYA 3CGTA 1B1YA 4PTXA 5DT7A 3MUY1 4CD7A 1Q6GA 2E4TA 4WKHA 3ZT5A 2ZUMA 4JFVA 3WUEA 5D8WA 4JFSA 5HNNA 4CCDA 2VX4A 1NH6A 2WMIB 4LYPA 3AMGA 4B16A 4BQ2A 3S6TA 4F9DA 1EQCA 1ZJBA 2WMFA 3L4ZA 2A3EA 2ZX7A 2WCGA 3AIRA 1F4HA 3PZUA 5DT5A 2VMFA 5JBFA 4JFWA 2V5DA 4LQ1A 3MMUA 1HKIA 3MMWA 4MDOA 4B9ZA 1XH0A 4TTUA 5A6BA 1OINA 4D6JA 4PMZA 4HOZA 4U5IA 4PUDA 3VDCA 3T08A 3ZJ7A 4MPKA 4JFTA 5JBEA 1QNSA 1XYFA 1KWKA 4DWSA 1EOKA 1E55A 4W87A 1VEOA 2BV9A 1JIBA 2OYLA 3DYPA 5FD0A 1SFSA 4UQAA 4AZ7A 1W1TA 4AD0A 1GQIA 4TXEA 1NP2A 2O9OA 2WZHA 2DIJA 4L4PA 3ZR6A 2G3JA 2NW0A 2W66A 5CZKA 1DWAM 1KQZA 3AJ7A 4HA1A 4J3XA 1PX3A 4GINA 4W7WA 3O9NA 5BRPA 1MQQA 1HF6A 3KEHA 3CUHA 2EPKX 2PF0A 5E6ZA 1H2JA 4W84A 1ISWA 3WUGA 3POCA 4JKKA 1W32A 2WVSA 3PZNA 4XV0A 3ZT6A 2Y8VA 1AMYA 2DSUA 2WSKA 1XV8A 1UUQA 5LA2A 1E6ZA 3PZGA 4PMVA 3W6LA 4JKMA 3VIMA 2D23A 2D3LA 3G6MA 4ZXOA 3WDQA 1V0MA 4UZUA 5CPSA 2J47A 2D0FA 1Q6FA 4W8AA 4PMDA 3BC9A 4J3SA 3SIMA 3VIHA 1EDTA 4KGLA 1PZ3A 2JIEA 3RJYA 1JZ7A 4AW7A 1GPFA 2Y2WA 3GYCA 1NWTA 1JZ3A 2QV4A 3PZMA 1JZ8A 2VVSA 2E0PA 3VMOA 1E4NA 3U7BA 4HPGA 5TD4A 2CBUA 1WZKA 3CUIA 4D71A 4UR9A 4IPNB 4X0VA 1CBGA 4DUWA 5D9MA 3AMDA 2CERA 3N17A 3CH9A 1UYQA 2ZE0A 4XZBA 1JYWA 4WJXA 3GZAA 1O6IA 5FL1A 3T2QA 3W27A 4E8DA 1X6LA 1Q4NX 1QBAA 1CGYA 1JXJA 1BG9A 2GDVA 3AHZA 4HOXA 3BLKA 4J7RA 5LA1A 2OSXA 5HPOA 4M80A 3A4XA 5D9PA 3F4VA 1PJ9A 2CBVA 1HJXA 1CWYA 4U3CA 3PZ9A 4TVCA 1FA2A 3OG2A 2WCAA 1GHRA 4H8VA 1CIUA 4AMCA 4LPCA 1JAEA 1W9XA 1S46A 3TP4A 3VIGA 1E9LA 3PZOA 3N1AA 3B9AA 1TMQA 1MQPA 5KEZA 3F5KA 1B31A 4WKAA 4AD4A 1KGWA 2CETA 2VQTA 1UKOA 1WZAA 2DGAA 3WD0A 2CKRA 3GXMA 3U7VA 1EOMA 3ZM8A 3I3EA 1B9ZA 2BXZA 1FOBA 4JCMA 1TG7A 1C7TA 1W1VA 1WO2A 5AY7A 3WL1A 3BAIA 3UERA 3WF0A 4IPLA 2PBGA 2FHBA 2X1IA 2F8QA 1QBBA 4KGJA 3AHXA 3A4AA 3OLIA 3CZJA 1XH2A 1CLVA 1WNOA 2XWDA 1MXDA 2J4GA 1TA3B 1E15A 1UR8A 2RGLA 3VOCA 2WMIA 2WHKA 1NOUA 1E72M 3EDJA 3CHEA 4ACYA 1WPCA 3BSGA 1DEDA 2A3BA 3ARTA 5I77A 5ABHA 2PC8A 3BAWA 3VIIA 5AYBA 3VD3A 5CGMA 3NYDA 5A6LA 1JG9A 3GXIA 4D1JA 4LX4A 1CYGA 1XSKA 1JD7A 4JL1A 2D1ZA 3A4WA 3HU7A 4JKLA 2VX6A 2XFFA 4GI9A 4PCTA 5D9OA 3OLEA 4F9JA 3N13A 1IZJA 3UEQA 3VPLA 3VNZA 1Z32X 1TVNA 4UFJA 2NT0A 2HVMA 2IXVA 2YIHA 4FLRA 4AY1A 2ZWZA 7TAAA 5A6AA 1E1EA 4PRWA 2QMJA 1B3XA 1OIMA 3UCQA 4UFIA 6CGTA 2YBUA 1GUVA 2W63A 1TR1A 4FLSA 5BRQA 3NSMA 5CPTA 4ZXLA 1J0ZA 1VFUA 1LLOA 1UR2A 3WH7A 1Y7VA 2DSVA 2J77A 3RIKA 2VCAA 2JEQA 1V08A 5EBAA 2WHLA 4WSKA 2NT1A 3WMSA 1VIWA 1E4MM 2VVNA 2VZVA 1WAWA 1PEZA 2UY5A 5CJ5A 2XGIA 2GJRA 4BS0A 2OSWA 1TFVA 3B8SA 2PWHA 3SCRA 2JE8A 3GTNA 1W9PA 5AYIA 3NSXA 4PTWA 3BCDA 3WKZA 5HBFA 1SYTA 1H5VA 5EFFA 4N42A 3W53A 2E8YA 1ISVA 4OBRA 1ITXA 3T2PA 2D22A 4TX8A 3MO4A 2CNCA 4AZHA 4PMUA 1QW9A 4C7DA 5FKYA 2VC9A 9CGTA 1R7AA 4GKLA 3GNRA 4JZ5A 3ZT7A 4M29A 1I75A 4Z2JA 2YLAA 1UR4A 2WW5A 5A6JA 3M07A 3W25A 2V3FA 1UH4A 1BF2A 4M81A 3UETA 3ARZA 4UFLA 1EHAA 5CGTA 3AIQA 3K4AA 2YA2A 2XVLA 5I79A 5HPCA 2BY3A 4C7GA 1C8XA 1QNPA 2YA0A 4AIUA 2AMGA 1E5NA 2VR5A 3RDKA 1QVBA 2V3EA 3VIKA 1M01A 3AICA 1KGXA 1JXKA 2ZX8A 4MAVA 3WH9A 2VO5A 4CCCA 2WWCA 1MVYA 1UH3A 1E0WA 2PWGA 3L4TA 1GONA 2WXDM 3NDZA 1ISYA 1EA9C 2YL9A 2WYSA 1HIZA 3W0KA 4AZGA 2EQDA 2CHNA 3K1DA 4V2XA 5CLTA 1UQYA 3QHOA 5BROA 5A6BD 2CBIA 3D3AA 4WIWA 3LPFA 3VD4A 1C91A 1UKSA 4UTFA 2UY3A 1K9EA 2CIPA 2PWEA 3RMEA 1V6WA 4HU0A 4DWSD 4CD4A 4AISA 4YHEA 4J3UA 1AQ0A 2ESCA 3M7SA 1GCYA 1M7XA 2YJQA 1TA3A 5ABFB 1ZU8A 3GXFA 2XWEA 2ZX6A 2B31A 2F61A 3CHFA 2O9TA 4P8UA 5FCZA 1G94A 4BQ3A 3ZQ9A 3IAQA 2VUYA 1VAHA 1OGGA 2MANA 3NCOA 2J74A 3WDJA 1VJSA 1R7OA 4HPHA 4CVWA 3VO0A 1FFQA 2BY2A 2V3GA 1CTNA 2E9LA 1GQKA 1CGWA 1EQPA 2CPUA 3T0BA 1EDQA 2CXGA 4TUFA 1G01A 3W37A 2VOTA 2ZWYA 3VVGA 1QI5A 5A6SA 1B0IA 1V3IA 3UR7A 3GH5A 4URIA 3DHUA 1E73M 2EO7A 1AQMA 1V0NA 1V03A 2VCBA 1UOKA 3A6OA 3CHDA 2OWCA 2W91A 4ACZA 3QOKA 2FHFA 4AZCB 3F5LA 1BGAA 1PZ2A 4HMDA 1MFVA 4MB3A 4B15A 4UQBA 1UWSA 3J7HA 5E6YA 3AHVA 3FAWA 3AIVA 1XCWA 3O6AA 3WQ6A 1WZMA 1OT1A 1WB0A 2A3CA 1LWHA 4QAWA 3AXXA 1UZ1A 1UWRA 5CG0A 4W5ZA 3ARXA 2WMKA 1R85A 3PBGA 4D6EA 2BHZA 4JCLA 3MUAA 2QPSA 5IHSA 1DHKA 1LG2A 1JL8A 1SMAA 4GPNA 4UOZA 4CGTA 5A8PA 1U33A 4QLKA 2XVPA 1HT6A 3LPOA 3ZSTA 3APGA 3AMKA 3GH4A 1GQJA 3RILA 1UR9A 2VRKA 2WZIA 4WLCA 1GHSA 1CXFA 4UQ9A 1JZ6A 2W67A 5A69A 4L4OA 4MJ2A 3AZSA 3NJ3A 1YHTA 3CUGA 2JEPA 3VM7A 1X1NA 3WF2A 2OWXA 3RJXA 5IDIA 1W9VA 4JHOA 5M17A 1KBKA 1W9BM 2JIWA 2OSYA 1KFWA 4QLJA 3W26A 3EDEA 1B3ZA 1W9DM 4CD5A 1CNVA 2FH6A 1E6XM 1UD4A 3VINA 2WMJA 4Z2GA 1UWQA 5IFPA 1WZLA 4BQ4A 2QLYA 5A8MA 3ZR5A 1V02E 4CVUA 3WEZA 3VU2A 1B2YA 4GIAA 4GZEA 5BCAA 1R87A 4OJYA 3W6MA 2HISA 5I78A 4AD2A 1MQRA 3WUFA 4PYSA 2CEQA 4XUYA 4OUEA 3WD2A 3WQ8A 3N15A 1UD2A 4DUVA 1E70M 3W28A 1UWTA 1GJWA 5C8BB 3TOPA 1LL6A 1CDGA 3CLWA 3TTYA 2VZOA 2YL6A 2IXUA 3DHPA 2DSKA 3WQWA 3N9KA 1VF8A 2ZX5A 4S3KA 2XFRA 4P8VA 2VZUA 2XVNA 2J7BA 2EPLX 1JZ2A 5A8OA 2D2OA 4ATLA 3MANA 4GI6A 3ARWA 4HU8A 1ESWA 4TVUA 2YBTA 2AOSA 4NI3A 4QP0A 4F79A 1GVIA 4MB1A 1VFFA 4TTGA 3IK2A 2ZXAA 2IUZA 4U2ZA 1A47A 1E6SM 2EPNA 1JD9A 2E3ZA 1L0PA 3WUBA 3TTOA 2W62A 1HP4A 1FH8A 1M03A 3VGDA 1E3XA 4CN4A 1UA3A 2PWDA 3L4YA 2ZUSA 5JIPA 1J0KA 3G6LA 2J7DA 1H0GA 1XD1A 3AS1A 5ABFA 1R8LA 5I24A 1FFRA 3GM8A 1PX4A 5DMYA 1XH1A 3PHAA 2BY1A 1W2VA 4KWUA 2VJXA 1OB0A 1ITCA 1W3LA 3AFBA 4JIEA 3EMCA 4PMQA 3PTMA 1HX0A 4OBSA 5I3DA 1CXLA 1ECEA 4AD3A 4RL3A 2WNWA 4JFUA 1JYXA 4OOUA 2WSPA 1GOQA 1OM0A 2GDUA 1MW3A 4P7LA 3D5HA 3II1A 3POHA 4W86A 2XYLA 2X05A 4CD8A 1E0XA 1UA7A 4UOQA 3EMZA 1B3WA 1VRXA 2OLHA 3BXWA 3VIPA 3N12A 1HL8A 3CZEA 1E0VA 2WVVB 4AZCA 3IJ8A 3SCSA 1QHZA 1ODUA 3GBEA 4AEEA 2E8ZA 1OT2A 2DDXA 1EO7A 2EXOA 3IJ9A 3U57A 4NRRA 3BMVA 4D6HA 2E40A 1SR0A 1UKTA 1J0HA 1E1FA 3WNLA 1HVXA 3N18A 3WY1A 4PMRA 3SCUA 2WLYA 1C3FA 1JYNA 4W5UA 5A3HA 2YOCA 3N04A 3SUVA 2C8NA 2XHYA 3VIJA 1XRVA 2YDQA 4GI8A 5GNXA 4GQQA 1PX8A 1JDCA 3VTRA 1HP5A 2WPGA 4PUEA 1DWGM 1O7AA 1CXIA 3MSGA 4U31A 1MW2A 1TZ7A 4C7FA 2ZX9A 4H7VA 4P7OA 5A8QA 5CPQA 2YKKA 4FLQA 1KCLA 5BXRA 1HVQA 3B9DA 3UG5A 2FGLA 2JF6A 4BF7A 3HMCA 2G41A 3PTQA 4N0RA 2V38A 4ZE5A 4EANA 3M46A 2DH2A 4PSPA 1RP9A 3KWXA 2W5FA 3AS2A 5FIPA 6TAAA 1VJZA 1V3HA 1JF6A 3CZ8A 4U5KA 4D6GA 1BFNA 2WLZA 4V28A 1ZJAA 3FW6A 3FAXA 3IAPA 4W93A 3VKKA 1UD8A 4D6DA 2EPOA 3A47A 4OKDA 2YL8A 3VMPA 4MDPA 4MNJA 4ACZB 5D4YA 4QLLA 1ZS2A 1FP9A 1DWHM 3MS8A 1B30A 5DFAA 1UR0A 1LG1A 5M03A 2F2HA 1GORA 1RP8A 3VD9A 1L8NA 2BHYA 3OLDA 4CCEA 2ZUNA 4P7NA 1EH9A 3VGEA 1J18A 3QHMA 4KRTA 3T0AA 1YQ2A 2WC3A 2J79A 1UZ4A 1WKYA 1V02A 2ZXBA 4YPJA 4Z2KA 1TCMA 7A3HA 3I3BA 1JYVA 3K8MA 2VX5A 4CD6A 4E2OA 1XSIA 2J7HA 3L4XA 1PIGA 5FOOA 5GQBA 1QNOA 2O92A 4NF7A 3U5UA 1J0IA 2CCRA 4ZENA 4WSJA 2GFTA 1ZBVA 4B3LA 3WD3A 4Z2LA 2E9BA 2VQUA 1X6NA 3FHQA 4UCFA 4KMQA 4GZJA 4PN2A 4H41A 1JI1A 3ZJ8A 3ZO9A 1CXKA 1OCQA 4FF5A 3KE0A 5E0CA 4DUXA 2CKSA 1HJSA 1FH7A 4D6CA 2V5CA 3WN6A 4MADA 1TVPA 1QI0A 2J7CA 3IANA 4M8UA 3WBAA 2CESA 3W81A 3BAYA 2DQXA 1GOKA 2J7EA 4ZEPA 3CIVA 2DT2A 2ZXQA 1ZL1A 5A8NA 1UD6A 4UFMA 5BYWA 5KZ6A 2J7GA 5CSYA 3HJEA 5I0DA 2BVTA 3GNOA 1E3ZA 3SCWA 1Q6DA 3ARVA 1MFUA 4EAMA 4IUGA 1BSIA 2VL4A 4GZIA 2G4FA 3RM9A 2X2YA 1AVAA 5DF0A 3AIEA 1EO5A 4QCEA 1VB9A 3PZQA 1BVNP 4QDMA 7CGTA 1BHGA 5DEZA 3T09A 1K9TA 2O9RA 1C92A 2WVVA 1QHPA 4HP5A 2DSZA 1ISXA 1OSEA 4Z2HA 1LJYA 3AIBA 3WF3A 2D0GA 4FK9A 1KXQA 3BAKA 1HJQA 4PMNA 1OBAA 2D24A 2J75A 2GUYA 3FNDA 3W24A 2WKGA 1H41A 4MB4A 3WDRA 1J0YA 4H04A 4JL2A 3K46A 1N82A 3PZVA 3AHTA 1UWUA 2XM2A 3CTTA 3BAJA 2ZUTA 1B90A 1HN1A 4FLOA 4UQEA 3F5JA 2V3DA
chains in the Genus database with same CATH superfamily
3VKBA 4BEUA 4TOQA 5A94A 3GUWA 2R1MA 2X09A 3BCFA 5HK4A 2XGBA 3FVDA 4M24A 2P3EA 2GGGA 1XISA 3M41A 5FF0A 5AVHA 2XM1A 4ZQCA 1NQ6A 3O0KA 4JY9A 1MEHA 4G8TA 3WK3A 4EXBA 3MSDA 4GH3A 5KMYA 3KM8A 4JTFA 4IJBA 1V6YA 4IJRA 2XJ7A 4FNUA 5G1YA 1VFSA 5E0FA 2VWTA 1UQZA 1NF7A 1XM3A 4X2PA 1GQLA 5TIMA 3GW0A 1TJ2A 2NX1A 3G1VA 3SEPA 3QZEA 4MOZA 3RN6A 3GDBA 3E5BA 1JGIA 4DNMA 3UNTA 2H9AB 1A5CA 2PLKA 3OBAA 4UTKA 3CUFA 3MVTA 4LGXA 4NSBA 3V0SA 2PB1A 3LXCA 2QCMA 4RNIA 4QNWA 4QS5A 1ITUA 3PBYA 3MKKA 4EKJA 2CZFA 1VBRA 1YLVA 1FWTA 1UC4A 3MQTA 5CCZA 1V3LA 2DZTA 3P5YA 1ECQA 3WJSA 4J2MA 3UG4A 1GK8A 1HNYA 3ZOAA 1K4HA 3QPEA 4DBUA 4LRTA 4XKYB 5D9NA 2TPSA 2GVEA 1ZBKA 5KSWA 1FCBA 2WMHA 1Q6CA 3KCLA 2VRJA 3PULA 3LSBA 5HWJA 4E4PA 3PVFA 3WNMA 1TJRA 3BW3A 5D32A 2OZ8A 4CLMA 4L9XA 1VFMA 4UR8A 1US3A 3AROA 1HKVA 4RW3A 1PWLA 4ZOAA 1GWJA 3ABXA 4UUIA 3B3DA 4IF2A 4YCPA 1E71M 1GJPA 2V69A 1TV8A 2OYMA 1LT8A 1V6VA 3W75A 3EKGA 2PU1A 3BDKA 2NX3A 1RJPA 3VD7A 3KVJA 1ZB5A 2KX9A 1AG1O 1NFGA 1EJRC 3MPGA 1XUZA 2BDQA 3PBUA 4B3KA 4QCFA 2NX9A 3H23A 2QUVA 2D20A 1XLHA 1KA9F 3OZOA 2AAAA 3BH4A 4M51A 4PUMA 3MUZ1 3PM6A 3A5FA 2DT1A 3WK2A 1TV7A 1XYZA 2Z1SA 4X0NA 1ITQA 4FZIA 1DWFM 2WSRA 4ZOBA 3SUTA 1XLGA 3H7VA 3W1AA 4UNLA 2WHJA 3S42A 1DIOA 1M1BA 1ZGDA 3WG6A 2DZAA 2J8GA 3FGCA 3AMCA 3B40A 3LQLA 1P0KA 1OD0A 1T40A 1R5YA 4DPPA 1BQGA 3W2JA 3SCNA 1O1ZA 3R4IA 3MU7A 2XH2A 3UVAA 3DN5A 2HZGA 1L6SA 3FYPA 3RUBL 1I2OA 4IGHA 1O94A 4YYFA 1HJUA 3F4WA 4J4KA 3TYUA 1JZ4A 4J27A 4PUWA 3FA4A 1GW1A 1YKWA 4LANA 2HDJA 4ZZ9A 1I0DA 3EOLA 3DI1A 4PBGA 3DECA 3NQMA 1UD3A 1OIFA 4DEFA 2GVLA 3AOFA 4LCQA 4KRUA 1N55A 4B4FA 1EB3A 2DIEA 4DBWA 3DKLA 3VXGA 1RY8A 4XAGA 2W79A 4FXFA 1XYMA 3TJIA 1CXHA 1VBHA 2XIBA 3WIJA 1NU5A 4LU0A 3P5ZA 4H8UA 1T6MA 2QF8A 4L5ZA 3USZA 4KF1A 2I5IA 4JICA 2Y8KA 4S3CA 4O1AA 4DIAA 2H9AA 1RVGA 3L7RA 3UF9A 1H3GA 1GVYA 2J66A 1M7JA 1GZJA 4EE9A 5I3FA 1PPIA 4ML4A 2QVHA 3FCPA 3W7IA 3DBNA 3T4WA 1Q5MA 4U2YA 4GNVA 2Y5SA 3SECA 3HGJA 2OG9A 2FPVA 4XZHA 2DORA 5DRIA 4GXPA 5D2VA 3AHYA 2Y4SA 4XKYA 2GVYA 1BWVA 4P7RA 4M1RA 4ICNA 2DP3A 1B3YA 2BVYA 5I2UA 3BAXA 2ZC8A 2YCEA 1JNDA 3NDYA 2IKJA 3OVQA 2Z25A 3QN3A 2FJKA 4HA3A 4MWAB 1VLWA 1VPYA 1KGUA 2QCGA 1H7NA 1OC5A 2GZXA 4JTGA 1PKMA 1CZ1A 3WJYA 4OOZA 3W7QA 3NDOA 4Q7NA 4A8IA 4BA0A 4IIFA 1XRTA 3E0VA 4HMEA 3QMRA 2QUMA 3MV01 4C90A 1K7FA 5LYRA 5BXTA 1BYBA 1TJ1A 2B7PA 5DMMA 4L64A 1T0OA 1QU4A 4GFIA 4KH2A 1EGZA 2HS6A 1GEQA 1E9IA 3W88A 2G3NA 2WO5A 3CO4A 3YPIA 3RLUA 2CU0A 2FGZA 1A5UA 3DFPA 5MKGB 5AB3A 3QEZA 5F4SA 7ENLA 3FYOA 5KITA 2YCLB 1IQ8A 3QR1A 4AIEA 3W7HA 4AWSA 1UCWA 3WEMA 4UOJA 3QF0A 1PTDA 3Q67A 5HXMA 1QNRA 1DIEA 2IPWA 2ZXDA 2VUNA 4R88A 3KBJA 2G3IA 1OADA 1ZSXA 3NO1A 4NT0A 4MSSA 1XG3A 1V3KA 2Y63A 1MYRA 1KW1A 4HMNA 1SUXA 3VGBA 5DO8A 3ECQA 3LENA 5DBUA 3CAVA 3GDKA 1HKJA 4A22A 2BFGA 5HNRA 3VX0A 2V67A 4E8GA 3HPAA 4W85A 3LGDA 4I6VA 3G0UA 3UZJA 3N25A 5LA0A 1Q4WA 4QRNA 4BI6A 2ZBTA 4TVDA 3DX5A 2ZOXA 3SJNA 2VGBA 4LVGA 3IRSA 2PD5A 4JPGA 3MT1A 1S38A 1QT1A 1IXNA 1K8XA 4ILSA 4DO7A 3QBUA 3NG3A 4DQWA 5LNSA 5C5YA 3C4UA 4PTMA 2JK2A 2X0HA 1GOXA 4O0KA 4FMVA 3QGVA 3GTHA 1BG4A 4IFKB 4MG4A 1V3MA 1Z3NA 3OBEA 3PPHA 2OWWA 3CU2A 3UG3A 3BMWA 1RUSA 4MNMA 2PZNA 3H7UA 2MNRA 4AWUA 2F2KA 3NZQA 4GYPC 3W2KA 4ATDA 6A3HA 4LS0A 3OHMB 1QW7A 3O2LA 4H7ZA 1GOIA 4GUIA 4LYKA 2XPKA 3D6NA 3FEMA 3NSNA 3H24A 1MRAA 4DRSA 3F2CA 1AW1A 2O56A 4MWAA 2G3MA 3WDHA 1GZGA 1QXLA 1K8ZA 5C55A 3TYAA 2QJGA 2Y7DA 5H1WA 1OJXA 4C91A 1QATA 1JUBA 2RAGA 4LAUA 2V30A 1OFDA 3TJXA 2IPJA 4RV3A 3TH6A 1KXTA 1HG3A 1GKPA 2ZA2A 1ZY9A 1KV5A 1XIFA 1YTDA 3KWSA 3P80A 3GB6A 4IX0A 1ZZMA 3NQFA 3VNDA 1FH9A 1E6RA 4IMCA 3P74A 3JUGA 4IGMA 5LIKX 5HOSA 4A3RA 3BGAA 4RUBA 1ZAJA 2V5JA 4AHQA 4KEUA 4OWGA 1W3KA 1DHPA 2BOFX 4NVTA 1EP1A 8A3HA 2DVTA 3AC0A 3ZJKA 2R14A 5MKGA 2YCLA 1XLJA 2EJ1A 1DJXA 3Q58A 1NVMA 3N14A 3Q94A 3BGGA 2QGYA 3AO0A 3WNKA 3SUWA 4CNNA 2VX7A 4HVXA 1RBLA 3V4BA 2ZUVA 4WQ6A 3D3FA 2YGYA 2JKPA 3CHVA 2AL2B 1BGGA 1TRDA 5K7JA 3A9IA 1LF1A 1TUXA 2PLJA 3GC4A 1KM1A 3MWCA 3WL0A 3C2YA 3W7RA 3UR5A 3ABOA 1EXBA 3AQUA 4Q7BA 2GVGA 3R7MA 1YDYA 3QGKC 2A0NA 3N6QA 2A3AA 4JTRA 2BODX 5AYYA 3BPWA 1FQ0A 1H5YA 3KTCA 5BXPA 3CGTA 3JZUA 4DAIA 3AUOA 3MUY1 1Z48A 2RH9A 1A49A 1LM1A 1PVNA 2Q3RA 1VD6A 4JFVA 4D8ZA 3PFRA 5D8WA 4Z1YA 5JH2A 3I6EA 4MKSA 3NZRA 4IPPA 4MM1A 1AJ0A 5DXXA 2WCGA 4DI8A 3TFXA 4GK8A 4KESA 2I57A 3MMWA 2PD9A 2YZRA 3O8AA 3UFYA 5A6BA 1OINA 1JRBA 5LGXA 2OZ0A 3LU2A 4GBDA 1JPMA 1WA3A 3T07A 1XQLA 5BNKA 4BI5A 4MPKA 4JFTA 4C1NB 4HNLA 2RJHA 1TVLA 2BV9A 1W5NA 2ZVRA 5C9XA 3W2MA 4IFKA 4UQAA 4AZ7A 3WYZA 1W1TA 2O9OA 2WZHA 3ZR6A 3DFHA 2H6RA 4FIRA 2NW0A 4TV5A 3AJ7A 2R82A 3QTGA 4LB3A 1JJKA 4GOAA 3CUHA 4ZQRA 4JNYA 4PFHA 1H2JA 2GQ9A 3BV4A 4R9OA 1SGJA 3PZNA 2Y8VA 1XLEA 2A4AA 1XV8A 4X2RA 1TTIA 1EP2A 4JKMA 4FIQA 3VIMA 4I6KA 1OX4B 3LGEA 1V0MA 3ICJA 2GUBA 3BANA 5BW6A 1MXSA 3R8HA 4PMDA 1ICPA 4FXRA 1PZ0A 4J3SA 5DANA 4KGLA 4LUIA 1JZ3A 3PZMA 2E0PA 3U7BA 4UWMA 1WZKA 4GUJA 3UA3A 3CUIA 2BXVA 1CBGA 4HYWA 1LDCA 2CERA 4QIUA 4IIEA 2ZE0A 3F4NA 4XZBA 1IXPA 4Q8WA 4GY1A 4LVDA 4XO7A 4ZGYA 5FL1A 3V36A 3E0FA 1X6LA 4D9PA 1CGYA 4WY0B 2VGFA 2E28A 4LVBA 4M80A 1F05A 1KTBA 2YYTA 4J3ZA 4U3CA 3WLMA 3UXAA 4L61A 3OG2A 4TU1A 1GHRA 3HV9A 1SSDA 1TKKA 3K2GA 4JX6A 1E9LA 2Z24A 1X6UA 4UBPC 3TK7A 4O57A 4LC8A 1MQPA 5KEZA 2AL2A 3RG6A 4O11A 2DV0A 3F5KA 3NPXA 1TPEA 4WKAA 1EGVA 1XPGA 5HWNA 2CETA 2VQTA 1YXDA 1TPFA 5CZ0A 2X16A 3U7VA 1EOMA 1TV3A 2C16A 1H1YA 1XGEA 3ITXA 1C7TA 3UERA 1F7BA 3WF0A 2PBGA 1SM9A 1RPXA 2FHBA 3ITGA 2GWGA 3VNKA 3U2CA 1FXPA 1TIWA 3AHXA 1VH7A 3OLIA 3ZFHA 3CZJA 4NJJA 4RK8A 5T26A 2XWDA 5CC6A 1GW9A 1MXDA 3PPGA 4IP4A 2RGLA 4O50A 3W1MA 2QUUA 3ATYA 4AB4A 4MVAA 2ISVA 1QPQA 4CQ9A 3VUSA 3P3BA 2FQIA 3NVTA 3R43A 3ARTA 5I77A 4AY8A 3T81A 2OOGA 3TIMA 3VIIA 1DV7A 3C61A 4YTQA 4C6QA 5CGMA 3NYDA 4JS3A 3DKJA 2QIIA 1XSKA 4FB7A 1VFLA 3W76A 2SFPA 3A4WA 3S2MA 3DERA 3HU7A 5D2YA 3CWNA 4JKLA 1RVKA 1ICSA 2Y7EA 4F9JA 3N13A 1IZJA 1R3WA 3W9ZA 5DX7A 3FKKA 1FWRA 2NT0A 2IXVA 2YIHA 3MVIA 1E1EA 2QMJA 1B3XA 2VGGA 3H8AA 3VOGA 1WV2A 3BARA 1A0CA 4C1NA 6CGTA 3HGOA 4AHOA 2LLEA 1O5RA 3N6JA 1VHCA 2QJMA 1J0ZA 3WQEA 3WH7A 4P61A 1Y7VA 1CX9A 2DSVA 4N6FA 2VCAA 1ZFJA 5EBAA 3UZYA 3W1TA 1XR2A 4W9TA 4S3AA 4LS2A 3LS9A 1WAWA 4DBEA 2UY5A 2HS8A 4GVFA 3TE9A 2R24A 4DNHA 4TV6A 3UCDA 2XZ9A 3N4EA 3B8SA 1K1DA 3P67A 5AYIA 1R38A 2VR2A 3BCDA 4D8LA 2PGRA 3WKZA 1SYTA 3MJYA 1KFJA 3MJMA 2G96A 3MCOA 1KM0A 1OX4A 3W7JA 4TX8A 4PBEA 3DFTA 3MO4A 2BASA 4JY8A 1UOZA 1TJPA 5CC7A 1K6WA 1QW9A 1POKA 1K3UA 5FKYA 1MUCA 4IFOA 4R3UA 4LB4A 4B91A 3UJRA 1X98A 1R7AA 3LM3A 2DY3A 3ZT7A 4K6AA 3TFCA 3G8RA 1UR4A 4RZ6A 1UR3M 5A6JA 1KBJA 4QROA 3M07A 3C2RA 4IMGA 3AWOA 2QGHA 3IIZA 4WY0A 4RDYA 2UBPC 2WNZA 3AIQA 5D04C 1K02A 1EJWC 2IKHA 3HGSA 4AIUA 1LP6A 3TQVA 5LKYA 3RDKA 2PLMA 3VIKA 2AL1A 5CZSA 2XH0A 2ABAA 2WWCA 1MVYA 3U9IA 1GONA 2OEKA 1EA9C 3IJDA 3W70A 3LI1A 1UZHA 1AW2A 2GL5A 3LQGA 2DW7A 2CBIA 3LPFA 2R1LA 3SN0A 3N9RA 1GGOA 1EWDA 2Z1BA 2PF8A 5TBOA 4UTFA 1K9EA 5I03A 3TXZA 3TC3A 4GISA 4J3UA 4PCPA 2ESCA 3RK8A 3LRKA 1B3OA 3M7SA 3NOYA 2OB3A 2B31A 5EY5A 2F61A 2ZRVA 4JN6A 4JTUA 4BQ3A 3IAQA 2VUYA 2MANA 2J74A 4JYDA 1VJIA 2PDMA 4JTAA 3VO0A 2BY2A 2V3GA 4AF0B 3BG3A 3T0BA 2RDWA 2R94A 1HL2A 3RAOA 2CXGA 1QI5A 5LIUX 1F6PA 5E93A 3UR7A 3ITVA 1OFRA 4ROQA 1J79A 3P82A 3KCJA 4GE8A 1E73M 4E2DA 4TMCA 1V0NA 1V03A 3M0JA 3A6OA 2I9EA 1KO0A 3H21A 1W5QA 2PTDA 2E68A 4CQAA 1KFBA 1MFVA 3BWWA 1UWSA 3J7HA 1TPC1 2IKIA 1XCWA 3O6AA 4HK7A 1OFQA 3GNNA 4I9JA 1WZMA 3CQIA 3L23A 1OT1A 2XGZA 3GU9A 4XQ6A 1DJYA 2R1NA 2WMKA 3O1NA 3OHIA 3R0KA 4OV4A 2BHZA 3BJSA 3TWBA 3MUAA 2QPSA 1SO3A 3M0LA 3KBSA 4UOZA 5I3HA 1R2SA 4CGTA 4DYEA 1MDRA 1XYAA 3APGA 1XIJA 3GH4A 3PSWA 3F4DA 2WZIA 4WLCA 4IQLA 1EBHA 5C7HA 2D2GA 3FDKA 3AZSA 4MJ2A 2CHRA 3WF2A 1W1IE 3TDFA 1R3YA 1L6GA 1VHNA 3BLOA 5M17A 1W9BM 4JQ1A 4LUTB 1B3ZA 4RLIA 4UTMA 1CNVA 2FH6A 1E6XM 6TIMA 4Z2GA 2WQPA 3BLFA 1Q7MA 1UWQA 4BQ4A 1T99A 2QLYA 3ITCA 2GGJA 5A8MA 4AX6A 1TRIA 2OT0A 2O4MA 1V02E 1B2YA 3HM7A 4GZEA 2G50A 5E1QA 4OJYA 1EZ2A 4X60A 4H6RA 3M0XA 1MQRA 1LWIA 4PYSA 3BTNA 1S2TA 3FOKA 4IHCA 3GIPA 4FR6A 4A3QA 3N15A 1UD2A 4DWDA 2JQXA 3W28A 4KCTA 1GJWA 1A4MA 2AQOA 5FF7A 1CDGA 2Y1HA 2E5BA 2VZOA 4K8EA 2IXUA 4EACA 1Z8AA 3N9KA 1IXOA 2ZX5A 3FSUA 2ZRZA 3PBWA 3GHRA 4ALDA 1TWWA 3WFAA 2D2OA 3S4TA 4ATLA 5F2GA 3GLCA 4KERA 3ARWA 3TSBA 4N4PA 4XAYA 2JKEA 4QP0A 1XIIA 1VFFA 4ZODA 4DAFA 2GGEA 4G56A 3E2SA 4U2ZA 3GRIA 3SY1A 1E6SM 3R1ZA 3WUBA 3VC5A 2W62A 1HP4A 1FH8A 2C15A 2PWDA 4H83A 3C0JA 3QV7A 4X63A 3PS7A 3N2MA 1UPMB 5DQPA 1XH1A 3LCWA 4IJCA 3JRKA 1VYSX 1S1RA 3NQDA 4IXXA 1W3LA 1ITCA 3AFBA 1O68A 1F5ZA 3PTMA 4OBSA 2A21A 3TR9A 1ECEA 2VENA 4I7VA 4AD3A 3S9ZA 1T8XA 1OX5A 1SW7A 4GC4A 4AF0A 1FWFC 5GJPA 4HCDA 2PDYA 2GDUA 1QNVA 3VZXA 1ADSA 3NQEA 2HWGA 4NJIA 4B3ZA 4CD8A 3SGZA 5AC6A 2GVJA 3AU6A 5SWUA 3S1VA 3RU6A 4DBSA 4ZMGA 2ON3A 3FLUA 1TE6A 2QCNA 4GD0A 5I00A 3B8VA 4S2CA 4ZO6A 4DXKA 1VRDA 1OT2A 2DDXA 1OFEA 4DJDD 3FX4A 4EVZA 4NRRA 3BMVA 3CB8A 3LN3A 2E40A 4UTUA 3DFOA 1JULA 4HZMA 4CNTA 4XK2A 3CNYA 5XINA 2RKXA 3V35A 4AQLA 2NVDA 3F7JA 3W1RA 3VIJA 2F38A 1A4LA 2YDQA 3A23A 3WJXA 2X1RA 1AH3A 4WDXA 4FNTA 4H8NA 1HP5A 4O1BA 1MRQA 2WPGA 1UZDA 4GXWA 2EKCA 1CXIA 3FS2A 3GIQA 4N7QA 2NLYA 1W3NA 4P7OA 1K70A 4AX7A 1V7AA 3GWQA 2OGJA 3KDNA 3M4HA 1PHQA 3B9DA 4DBDA 4V1XA 2FGLA 2BOEX 2G41A 5REQB 5G1TA 4M1BA 5FSDC 2ZA3A 1A5SA 4LUTA 3QZ6A 1EC7A 4PSPA 4O10A 1VJZA 1V3HA 3PWGA 3OTRA 3ITOA 1BXCA 2DUAA 4HHPA 4O53A 1NFPA 1AH4A 1NTHA 3SRKA 3IAPA 2FLIA 1Q7ZA 4D6DA 4GUHA 4BFAA 1OY0A 3A47A 3TQPA 2YL8A 1LQ2A 3R8GA 3N19B 4ACZB 1FWWA 5D4YA 3GZ3A 4MKVA 1ZS2A 3K1GA 1FP9A 1VIZA 2ASHA 3KX6A 1FWSA 2YW4A 5M03A 2OPJA 1EJXC 3ZS4A 3VD9A 5LZLA 2BHYA 4PMJA 3E96A 4CCEA 1Q66A 3S9YA 1YPFA 3R0DA 4Q8MA 2QF7A 1TELA 1YQ2A 2WC3A 2J79A 2G0WA 3S2LA 1TWDA 3Q45A 3G1SA 1Q2RA 1JYVA 4CD6A 3BG9A 1KRAC 1A5BA 1PIGA 2Q8LA 2O92A 1PXGA 3U5UA 1J0IA 4ZENA 4WSJA 4UTWA 3STCA 3HV8A 5I02A 2VC7A 3WD3A 3L65A 4YNGA 2PURA 1IIGA 1S2WA 3PG9A 2CLOA 1GVQA 3LI0A 2BOGX 1X39A 2O4QA 1J5TA 1JI1A 1OCQA 5TF0A 5IDZA 5F4WA 4E4FA 3KE0A 1R3TA 2NQLA 5CBJA 4JTTA 3S5SA 3W7KA 3W1XA 1XDLA 3L67A 3TX9A 2J7CA 2V0TA 2DQXA 3PAJA 4AEOA 2QPXA 2ZXQA 1ZL1A 5BYWA 2PDUA 1VFTA 5CSYA 1DJWA 3CS2A 3VFLA 3P0WA 2C0AA 2BVTA 3SQSA 4UMCA 2C79A 3I4KA 1G4EA 1I2RA 1N8IA 4MFEA 1Q6DA 3ARVA 1MFUA 4IUGA 2QAFA 2VL4A 3NM1A 3L0KA 3MUXA 4QCEA 1PYMA 4GX8A 1DJNA 1BVNP 4QDMA 7CGTA 1BHGA 5DEZA 3T09A 3NWRA 2A3LA 3WK0A 1P0BA 3TCSA 3JR2A 5HQLA 2XSXA 3HURA 3CPGA 3VK5A 5CC3A 1OSEA 3AIBA 3B0PA 3EWWA 1E0TA 1KXQA 1PCKA 1OBAA 4QX4A 4Z1BA 1FWCC 3M7WA 4HT3A 3F03K 1GPWA 2XM2A 1H1ZA 2ZUTA 4JOMA 4WRHA 3E49A 3ENLA 3GVWA 2FJUB 2PP3A 2ZICA 3QV8A 4MF4A 2VEIA 3VA8A 3URBA 1XSJA 1V6UA 3TLLA 1KXVA 1TUFA 1I1XA 3U5YA 3N2OA 1W5PA 3SAZA 6REQB 4HSHA 1ME9A 3T0DA 1P4CA 4H8HA 4XZWA 4QG9A 3AU2A 4HBKA 3AXIA 3L2MA 3DGBA 4NZ4A 1JFHA 3NTYA 1I60A 5REQA 4R9XA 2Y89A 2NSXA 5HMFA 4KFNA 3MMDA 4KETA 3ARQA 4JYFA 3T44A 4M6PA 3SO7A 2ANUA 4J28A 1SO4A 2G97A 3XIMA 5C2XA 4LAKA 4XUGA 3ATZA 1MW0A 3DYMA 1TTQA 3SURA 3UPMA 4E8CA 3WF1A 2DSWA 2WHMA 4Q4OA 5CSUA 1SMDA 1JVNA 1H09A 3WNOA 1NFBA 4HTYA 1IF2A 3GH7A 4M7TA 1E5JA 1GQNA 1TPB1 1FBAA 1W9UA 2E6YA 3RF9A 5FESA 4AVNA 4ADSA 1JZ5A 2GJXB 1D2KA 3NFUA 3BSMA 4O15A 4E4UA 3KS5A 5HQEA 3W71A 3ITTA 2BY0A 2BGSA 1C9DA 1JFXA 4UFKA 2G37A 4J9JA 1RSCA 1IT0A 2ZUUA 1P6BA 1UG6A 5A2BA 2WM0A 3VE7A 3TONA 2EKGA 3L5MA 3CEUA 1C90A 1MZRA 1K9FA 3USBA 3HO8A 3WO8A 3BLDA 4A6GA 4WF7A 3S8HA 1VENA 3MHGA 3PAOA 3TW6A 1NP0A 4GA8A 3RU8X 1ONRA 1I1WA 2WKJA 3CAKA 4AZBA 1NOWA 2CHOA 3FVMA 5EMYA 3RR1A 4IWWA 3BLEA 4ZQNA 3REQB 1PB0A 4IOTA 3SSZA 4DELA 2CLIA 3AXHA 2VCCA 1S2CA 2PWUA 2F6XA 1L6FA 3GG7A 4WJ8A 1V0KA 1HTIA 4H9VA 1PSCA 3CQ0A 1FWAC 1NIUA 2P50A 3EDFA 1EPVA 3CUJA 2D2HA 2BWGA 3HPFA 1IZKA 3QKEA 4PMYA 2CZ5A 2DU2A 2QUNA 2Z1VA 1AL7A 3WELA 2ZKMX 4ERGA 3MDUA 1U2YA 3G1RA 4RKAA 4B2DD 1US2A 1BPLB 3NXFA 1FUYA 4A3YA 3DGRA 2FKPA 1XGZA 3IRDA 3M6DA 2JALA 5GNYA 4S3JA 3VIOA 2RGMA 1VR6A 5J8LA 3C0QA 1GKQA 1JUEA 1LL4A 3U3HA 2BLEA 1RV8A 1LWJA 4YN5A 3UXIA 1I2QA 4FX8A 1TTPA 4UR7A 9XIMA 1QWGA 3I10A 1EIXA 1WE5A 1P0NA 1VBUA 4U10A 4FNSA 1QO5A 3KL5A 3LK6A 4XWUA 4F2UA 4XKMA 2Z1WA 6REQA 3VNYA 4AEFA 3WLHA 2J24A 1B3VA 4JGDA 3CHCA 2RUSA 3LTYA 3H2NA 1AUSL 2DFAA 2G5WA 2XU2A 3H4GA 4GCXA 4MY1A 3IGUA 4JTEA 4Q8TA 2D0HA 3DHDA 5T9BG 2X7WA 3R12A 4EIVA 3PZTA 3GFYA 3B8IA 1VGAA 4D8AA 2Q02A 5HINA 3WH5A 2PDLA 5JBDA 4WXZA 3R11A 4XAZA 2JFEX 3FXGA 1G0CA 5GNZA 3I3DA 5CSRA 2Y7FA 3RPDA 1M5WA 3R0UA 3OA5A 4N9BA 4PL2A 1V6TA 3INPA 5DMLA 4LEQA 3UPBA 3RGTA 1JRCA 3LHVA 3LLXA 2ZIDA 4RNHA 3VAVA 2GJXA 5BOEA 3RO8A 4DJED 2Y24A 4RE2A 3ZVIA 5EB8A 2WNQA 4CQBA 1KR1A 4K36A 4XZ9A 1L8PA 4B5VA 1TX2A 4H00A 3AYRA 4DWSC 3H2AA 1R47A 3OBKA 3UBPC 1ZAHA 4N4QA 1WYIA 2AKZA 1ICQA 2A79A 1TZZA 4Y7EA 2J78A 1TPWA 2QPUA 2EEXA 2WM1A 4BWLC 2J8FA 2VWSA 4K68A 3OIHA 3OO2A 1C8YA 4MB5A 5CAHA 1R86A 2FH8A 1JDDA 1XCXA 4C5YA 4QJ4B 1QPOA 1RLDA 4CN1A 1ZALA 1J5SA 3HG4A 1XKYA 2ICSA 1R2TA 1R3RA 2BXYA 4N02A 2I9UA 3LV6A 4F48A 1C93A 1IHIA 3WLKX 3ARUA 2F7FA 3RCYA 4F0MA 3REQA 4YXGA 2XN0A 3LMZA 4H9MA 3IJQA 4IQDA 3IV8A 1LRTA 3UWEA 1CGVA 2INFA 1BXBA 2ZZ3A 3M5YA 1ENUA 3C6CA 3KLKA 1ONEA 3QC3A 4GLEA 1QPKA 2GK1B 4C6PA 1ODZA 1NM9A 4IIHA 1YE4A 3RRAA 5AC5A 3AZRA 4CU8A 2R8WA 2WVUA 3TC6A 1G7VA 3S83A 1O66A 2VFHA 3G3DA 1GVOA 3C2VA 3TSDA 3ZLFA 1PBGA 2Y5EA 4R7JA 1UWIA 1HO1A 3B8DA 4JNZA 4DJFC 3FN9A 1DKWA 5G5IA 3QYQA 1A3HA 3N34A 3EA2A 4N9EA 3B9EA 4R5EA 4OZOA 4Q4SA 4F2TA 2BGQA 4H9ZA 5HQMA 3DFSA 2Z28A 1IR2A 3E2VA 4Q6JA 3SSJA 2DH3A 3NQCA 2Z2AA 1QOPA 2D3NA 4OIFA 3DDMA 3HPXA 3LTSA 2WV8A 3KZSA 2XIIA 3GAYA 4HN4A 2HSAA 1Z6KA 1A5LC 1DTUA 3FY1A 1H61A 1DJZA 2RDXA 3QPYA 2PDBA 3BJTA 1QNQA 4JXCA 2OQYA 5H8PA 4ZTXA 3PNUA 3ES8A 3KL0A 3OQ8A 5D03A 3VC6A 1S5WA 1AJ2A 4IIBA 2EHHA 3THUA 3ZLHA 2W92A 4D6IA 3MV11 4OFCA 2R6OA 2UV8G 2FGBA 3M0MA 3KBMA 1U1JA 3B0UX 3JU2A 1GT8A 2ZZ6A 4NX0A 2DUZA 4YTRA 4PCSA 3NQVA 2VXNA 1OCJA 4M56A 3W7OA 2CITA 1R30A 3EX3A 1J96A 5A6MA 3VGFA 1I45A 4YWIA 1Q6EA 1WDSA 4XISA 1TV5A 2WKLA 4PR4A 4YWSA 1OD8A 2TODA 4ZQOA 4W8BA 1J0JA 3B4YA 3H2OA 1EX5A 1PIFA 2WBGA 1R6WA 4Q6XA 2VT0A 3LZ5A 2C14A 5CJMA 2VFDA 4MUZA 4ZB2A 2VURA 4HZ6A 1P7TB 3OU8A 3W84A 2W61A 4F2BA 3L21A 4DLMA 3K8LA 3BCJA 4L7ZA 3LX9A 3GDRA 2DZVA 3I6RA 4J3VA 4C6MA 5D2TA 1KWGA 1LRQA 4WKFA 5EMLA 3TTSA 2XFYA 2Y88A 4HYRA 3VDHA 3LNPA 2BNJA 3FJNA 1WDPA 4MNKA 2GPTA 3S0CA 4I5UA 3S9IA 4MZ1A 5AHNA 3V5FA 4YJ5A 3TC7A 4K38A 5DXYA 4GQGA 5AC8A 4UTTA 3C2OA 2E77A 2NSOA 3H6OA 4UMBA 1KXHA 3A3XA 4KCUA 2WJDA 5I3GA 1JI2A 3FHAA 5BXSA 4XX6A 4OT7A 2X1UA 2OX1A 3GTIA 3TOYA 3VDAA 1VS1A 3KRUA 4AIOA 1UP0A 3FSTA 3PN8A 1S5NA 3WNNA 3RLHA 2NQ5A 5GPRA 1W3JA 2GK1A 1UC5A 3TAOA 3XINA 4JDBA 3TVAA 1V6XA 2E09A 3EXSA 2OO6A 4A8RA 3WJZA 4E2VA 4ADUA 1FTXA 4PH6A 1OGBA 3SY5A 2PCQA 3UJFA 2HNHA 3R25A 5IFTA 3EDDA 4NYUA 3TROA 3VMNA 4H19A 1KQYA 1J12A 4PMXA 4JIIX 3NQBA 4H6EA 1XLDA 4LF2A 4I5RA 5BMXA 2AGTA 1I4NA 1OZQA 3AS3A 2J25A 3MTWA 1BTCA 2CZVA 1XLCA 1H7RA 4EF8A 5DY3A 1MEIA 5BOFA 2QUTA 1G7UA 4OE7A 3U2OA 8RUCA 4PUKA 2CWXA 3B0YA 2J8TA 3RPMA 4I90A 3TZNA 3B8WA 1S2UA 4R7OA 3VKCA 4WJEA 4GIEA 5DT7A 3EOEA 4WKHA 2QZRA 1ALDA 5EGRA 3S1WA 2DQWA 3NO5A 3WUEA 3TW7A 2H3DA 4LYPA 1JUKA 3AMGA 3GR7A 4B16A 3GNXA 3LA4A 3HZ3A 1EQCA 4MY8A 2BP1A 1ZJBA 3GC2A 3R10A 4CNSA 5I09A 2A3EA 3OIXA 2Y6ZA 2GQ3A 2ZX7A 3O06A 4L1GA 1WX0A 4L6DA 5DT5A 2VMFA 2CLPA 2G95A 3C2FA 3MMUA 5CSSA 4LAMA 4MDOA 4B9ZA 5A8GA 4D6JA 1XKJA 4HOZA 4FOKA 3H22A 1OEPA 2B4GA 1F6YA 4RCXA 2IMRA 5BU9A 1S3HA 2WQDA 4PB5A 5G2HA 4W87A 1JIBA 3P8JA 1YBQB 4HN8A 2OYLA 4FS9A 1SFSA 1GQIA 1CT5A 3BVJA 4UNKA 4ZBCA 2QEZA 2CLFA 1KQZA 4J3XA 3PK7A 1BRLB 4IP7A 1LOLA 4W7WA 1KTCA 1P7TA 3DG6A 4CNOA 3B04A 1SO6A 1MQQA 1L6WA 4RNJA 5E6ZA 1ISWA 5F4XA 3KOWA 3ZT6A 1US0A 1NDWA 3LSCA 3CJPA 4X61A 4J1OA 5LA2A 3VOJA 1A5MC 1BVWA 4M6VA 3DG7A 4UZUA 4JIPA 3VYLA 4HKPA 2J47A 4JBRA 5DY2A 1Q6FA 4U4MA 4I3GA 3EA1A 5MF5A 1EDTA 1JZ7A 1PZ3A 2JIEA 2I7GA 3KVKA 1GPFA 4H9XA 3GYCA 1NWTA 4O14A 2QV4A 1OFAA 3TA6A 5TD4A 4ORMA 4D71A 4C6IA 4UR9A 2OODA 1SZNA 1GTEA 3O16A 3CH9A 1UYQA 3PNZA 4WJXA 1O6IA 1GVSA 3UZXA 4Q4MA 1P1XA 3W27A 4A8LA 4ZQPA 1AQFA 3G1YA 1QBAA 3GDLA 2PDPA 4HTBA 3QMSA 2GGHA 4E6MA 4TMBA 3BLKA 2OSXA 2PDIA 3PZ9A 5HJYA 3MCNA 1FA2A 3NPWA 3M44A 1CIUA 5C54A 1JAEA 1XIDA 4L6HA 4Q32A 3L12A 3TP4A 2YZ5A 4F40A 1DIDA 3C3NA 3GXNA 3FYYA 5AYXA 1REQB 3R2GA 4HYVA 1B31A 3NPVA 1XLMA 4AD4A 4LOCA 1XDMA 1GEHA 1WZAA 2DGAA 4IGSA 2BTMA 3WD0A 3G22A 2HPIA 3RO6A 3SADA 3ZM8A 3I3EA 1B9ZA 2BXZA 1FOBA 4JCMA 1TG7A 3OZYA 1WO2A 1W1VA 4I9TA 3WL1A 1WDDA 4HU3A 1QBBA 5E0KA 5AZ0A 3GNDA 3B06A 4CQDA 1XH2A 1CLVA 3PPCA 4NY2A 1WNOA 4DYJA 1TA3B 4UTLA 2DZUA 1TREA 2WHKA 3EDJA 1E72M 3CHEA 1LLZA 2Z7KA 4H01A 1FVPA 3BSGA 3KOFA 1JCJA 1NDZA 2RFGA 4LBRA 3XISA 2XFFA 5D9OA 1ONWA 1XLBA 4ES4A 1IWPA 1XS2A 3L0NA 4DUOA 4MLJA 4E5TA 5KETA 1TVNA 4UFJA 3R5EA 7TAAA 3GQYA 5A6AA 2QCHA 3CLMA 5FAJA 1W54A 3W87A 1OYAA 3TMLA 3RX2A 1UPPA 1LUCB 2W63A 3BQ5A 3S47A 3LOTA 4PRTA 1YBQA 1VFUA 1LLOA 4XSLA 3EEZA 3RIKA 3A9BA 1V08A 4XBKA 5DCDA 3FJ6A 4WSKA 5EA9A 2NT1A 1BRLA 1DORA 1VIWA 3TWAA 1E4MM 1T8QA 4GG9A 2VZVA 3ERPA 2L5HA 3NL5A 1A0EA 2GJRA 2XGIA 4DX3A 4BS0A 3EB4A 4RPPA 2V5LA 4Z1AA 3H26A 2JE8A 2VEFA 5T8GA 1W9PA 1AJZA 3NSXA 4PTWA 2PRMA 3MBDA 4FX6M 2QDHA 1ISVA 4OBRA 4OVXA 2AGKA 2YCKX 3TXVA 1KM6A 2D22A 3HQOA 4AXKA 3T78A 4AZHA 4LV9A 3IJIA 2CLKA 4PMUA 2VGIA 2PWVA 1H7WA 4AAJA 3GNRA 4DJDA 3V5CA 2HVNA 4B5NA 3LUTA 4M29A 2YLAA 1QO2A 2WW5A 4ONVA 1S5VA 4C1KA 4NI8A 1KM4A 4C6LA 5DLCA 4I7UA 3UETA 3G18A 4UFLA 2PUZA 5CGTA 3O63A 2W3ZA 2XVLA 3UZ5A 4XAFA 2BY3A 3H2EA 4C7GA 1VYPX 4LTSA 2YA0A 4N6EA 5FF3A 1WQ5A 1P6CA 4LUJA 2EJAA 2HNEA 4KEZA 3QM3A 1M01A 3AYTA 1B54A 1WBHA 2ZX8A 4NYYA 4CCCA 1UH3A 1E0WA 3KBNA 1REQA 4AHPA 3HG3A 4R33A 2WNNA 1DE5A 1RXOB 2EQDA 3LCFA 5CLTA 3MSRA 3QHOA 5BROA 3D3AA 4RPQA 4EX4A 2E5CA 1K7EA 1R0MA 1U1UA 1FDJA 4RXGA 2UY3A 2CIPA 3MO7A 4LUYA 2NWSA 4CD4A 1BF6A 4L9YA 1IWBA 1AQ0A 3WQOA 4PCFA 1GCYA 1M7XA 2YJQA 1TA3A 5ABFB 3M64A 5FJPA 2XWEA 2OEJA 1E1CB 3F2BA 3CHFA 4P8UA 3K4WA 3CTLA 3FKRA 2IQDA 3I7SA 3KBVA 1VAHA 3E12A 3ORWA 3NCOA 3AXMA 3P2VA 4Y9AA 1VJSA 1R3SA 1GQKA 1EQPA 1YPIA 2CPUA 4M6UA 4DJDC 1ZQ5A 2WPBA 4KFOA 3G8EA 4TUFA 1GYNA 1R9XA 1SZGA 3MYOA 3DHUA 3BJFA 3P62A 2BZNA 1AQMA 4WSHA 1OFBA 2VCBA 2OX4A 3OYZA 1UOKA 3LDVA 4KRZA 2FHFA 1LUCA 4AZCB 2CZEA 1BGAA 4HMDA 3ONCA 3GXPA 1A3WA 4R7WA 3AIVA 4L6OA 3WQ6A 2FYMA 1WB0A 1F3TA 2A3CA 1LWHA 3IUDA 4QAWA 3RX3A 1UWRA 4W5ZA 4GQ0A 5CH9A 4D6EA 1TMHA 4GC3A 3TSMA 4JCLA 8XIMA 1DHKA 3AYVA 2NZLA 3ITYA 4GNKB 1LG2A 1SMAA 1VCVA 1UJPA 1XX1A 3W2NA 1DXFA 1A5NC 3ME3A 1U33A 4QLKA 2XVPA 1HT6A 1ZUAX 3AMKA 5AYZA 4EXAA 3W1QA 3B8TA 3PG8A 1GVFA 2ZE3A 1JZ6A 1XRSA 2J9ZA 2W67A 4ZVJA 3TJ4A 5KZMA 2ZVIA 1YHTA 2A85A 3CUGA 1V51A 5FJOA 3VM7A 5MHBA 1X1NA 4NJKA 3G3MA 2GSHA 3RJXA 1QMLA 2YXOA 1YXYA 2FIQA 3B05A 1W9VA 1KBKA 3TYZA 2JIWA 2QCCA 1KFWA 5K3VA 2Q6ZA 4CD5A 4NAEB 1UD4A 3G1FA 3VINA 2WMJA 2RDUA 3E0IA 1WZLA 4FEZA 1DOSA 3SDOA 5FF4A 3ZR5A 4IXHA 4Y2WA 3M9YA 4GIAA 2HISA 2POTA 3L68A 4JTJA 3WUFA 2CEQA 4XG1A 3QTPA 4OUEA 3WQ8A 2O7QA 5I07A 5A5WA 3W86A 1W31A 4F0SA 5C8BB 4O1EA 3TTYA 1M3UA 2P3ZA 2YL6A 1MI3A 3O7UA 1G4PA 3KS6A 1A5KC 1KLZA 1P43A 4S3KA 3KXQA 1QTWA 2HXTA 3B97A 1H60A 4JR5A 1XYLA 2VD8A 3S5NA 2OOFA 3CXOA 4HU8A 4TVUA 4GVHA 4N9CA 1UUMA 4YTSA 4MB1A 1TPVA 4TTGA 3AAMA 3L66A 1JD9A 3EOOA 2E3ZA 2Z00A 2ISSA 3TTOA 1M03A 3VGDA 1E3XA 3AJXA 1UA3A 2ZUSA 1JCXA 5JIPA 3G6LA 2J7DA 2VHLA 1H0GA 1GG1A 5ABFA 4H1ZA 1R8LA 4QITA 5I24A 1FFRA 1E1CA 3PHAA 2BY1A 4KWUA 1J6OA 4I7WA 1OB0A 4P2VA 3WQPA 1I6NA 2D2JA 1CXLA 1EJ7L 2WSQA 3PTDA 3IARA 3W83A 3GTXA 2FB2A 2ZA1A 3S46A 4IFRA 2PTWA 2WSPA 4TO8A 1MUWA 5DELA 1Y5WA 4P7LA 2B7NA 3QVQA 3D5HA 2BBFA 4LUSB 4W86A 3SIZA 2X05A 1UA7A 4GJ1A 4NUWA 1B3WA 3BK0A 3MZNA 3BXWA 4XZLX 3TV8A 4XTIA 2HBXA 1E0VA 1UUOA 4O8RA 2QJIA 3KHDA 4AZCA 2H8ZA 4C6DA 3WK1A 1QHZA 3W7NA 1ODUA 5AHEA 1EO7A 3IJ9A 3U57A 4QGCA 2DZPA 3UR2A 4IGNA 2FVKA 3N18A 5CEWA 4RXFA 3SCUA 4W5UA 3PJXA 2YOCA 3N04A 1ME8A 2UZ9A 5D2WA 3SUVA 4I8DA 3LHTA 5C0QA 1IIHA 3S6OA 4M6QA 1XRVA 2YCJA 4NZ3A 4EPEC 3PANA 2A5HA 3H55A 2QYGA 1WKFA 4U31A 1MW2A 3QQ0A 2CLEA 1TCDA 1OG6A 1EJSC 4H7VA 5A8QA 5CPQA 4FAMA 2YKKA 4F0LA 2Y61A 4FOUA 1HVQA 4B2DA 3UG5A 2VFIA 1EEXA 3IGXA 1DQXA 3P93A 3CUXA 1P5BA 1UMLA 2V38A 1KD0A 3G24A 5HR6A 2DH2A 4TR9A 5F1VA 2JKAA 4NAEA 4QG8A 1JF6A 3ANUA 1EJTC 4U5KA 4D6GA 5AHIA 1JQXA 1ZJAA 3LLDA 3FW6A 5EMMA 1JCNA 2V68A 3FAXA 5J5DA 2ACRA 3NM3A 3DIPA 1UD8A 5LNRA 2EPOA 3KOZA 3VMPA 3TCEA 1NY1A 5LNVA 4Q4KA 3GYEA 1DWHM 3EXTA 3MS8A 1Q6QA 2DZWA 1UR0A 5AC7A 2O0TA 2HBVA 1RP8A 6PTDA 1L8NA 4Y6GA 1YPXA 4P7NA 1EH9A 4QJ5B 5HMDA 1J18A 4KRTA 3HF3A 1UZ4A 3QFEA 5IBXA 1V02A 4Z2KA 3I7QA 1TCMA 1UJQA 3I3BA 5HA7A 2VDGA 1QWKA 4E2OA 2J7HA 3L4XA 5FOOA 3S5ZA 1QNOA 3VZZA 3H4XA 1D9EA 5G4WA 1OX6A 2CCRA 1ZBVA 4AUBA 4B3LA 3W73A 4HCLA 5RUBA 1WKDA 2E9BA 3NNTA 3LY0A 4ECLA 4I5XA 4FF7A 2PDJA 3CEPA 4GGHA 4QE1A 2OZ3A 2Q71A 5JH1A 4GZJA 3SRDA 4PUJA 4B4HA 1E9ZB 3ZJ8A 4A8NA 1CXKA 2V5BA 5E0CA 3SBFA 4DUXA 3T8LA 2CKSA 1FH7A 4D6CA 1WXYA 2V5CA 4MADA 4HGXA 2ZRXA 1TTJA 2CESA 4DJEA 3IJLA 1GOKA 2J7EA 5A8NA 2F9RA 4DZIA 1UD6A 5KZ6A 2ZADA 3PF3A 2NQZA 4IT1A 1DQUA 2BGNE 4QE4A 4A05A 4B5WA 3HJEA 1F9CA 5I0DA 3GNOA 3S5OA 1PTAA 3CUZA 3QLLA 4UMAA 4LUSA 1CLKA 1BSIA 4O1DA 5L6UA 2G4FA 4LCRA 4DN1A 2E25A 1VB9A 3PZQA 3O6DA 4LAZA 4Q33A 1FRBA 3KVLA 5EBUA 4G7EB 4Z17A 1CI1A 5FSEC 1C92A 3EOUA 1SFTA 3W02A 2YB1A 4HP5A 1ISXA 3G1AA 3P14A 3WF3A 3P60A 1SVDA 4FK9A 3BAKA 4YVXA 4PMNA 2P0OA 3FNDA 4E3VA 2WKGA 4GJIA 3BQ6A 3K46A 1N82A 2V82A 2NWRA 1Z41A 5C9UA 4PL1A 1HN1A 3KRZA 1SJAA 4FLOA 5E5CA 2JGQA 3F5JA 3F2DA 1IEVA 3ZJ6A 1IEXA 3LCHA 2QCEA 3EBVA 4H3DA 3QW3A 2XVKA 2Z1KA 1E4LA 3V1PA 2XZ7A 3JZEA 1MWOA 1Z69A 1VKFA 2DT3A 2PCEA 4BF9A 4DF1A 1FHVA 3SCPA 5CG7A 1WKEA 4FHAA 4INFA 3NQGA 3S2CA 4A4AA 3VNJA 2D69A 3WMLA 1ZTVA 3GK0A 1QOXA 3VKAA 1EPXA 1TX0A 3DBPA 3VDGA 3VD5A 4J3TA 4DJEC 1O95A 4Q4PA 1VPXA 3GDTA 1JDEA 4QHRA 4ATWA 4Y90A 4DF0A 1P6WA 2YCIX 3TN3A 4F3HA 1XHGA 4IM4A 4FOJA 3SCQA 3V0TA 1QW8A 1E6QM 1LBFA 3G1DA 2R9RA 3QXBA 1HUVA 3WX7A 1XLFA 2DEPA 1FCVA 2H3BA 2I16A 1RALA 4R27A 2B81A 1EDGA 3FK4A 2DT0A 5D33A 1GOOA 4K1WA 4L80A 3O6CA 3GVGA 3W72A 1UIOA 1H11A 2PDWA 3LPPA 2WC7A 3OGVA 1VP5A 1TQXA 4AZ5A 3CMFA 3CWOX 3W2UA 1NARA 3GR4A 3MWAA 2J6XA 3D46A 3SCOA 1YDNA 2VYOA 4BHYA 1BLIA 1KRCC 1UKPA 1YE6A 1XD0A 3VOFA 1X7FA 4KWWA 2PA6A 4Y8EA 1UASA 1NWSA 5LSMA 1VFOA 2F84A 3KLLA 3E3HA 3HN3A 2CBJA 4JQAA 2G3FA 4EPBC 4D2JA 4FP1A 3PC0A 1CGUA 1T7LA 3EB2A 5ABGA 5I3IA 1F8MA 3EOSA 1TMLA 4GZ7A 3ARYA 1QUMA 4MJ4A 1BYDA 4O1FA 4UQDA 1EUNA 4MWAC 1XBVA 5EL1A 3AXKA 1C8VA 1H0IA 1W1PA 7TIMA 1LOQA 5M3WA 3APYA 2VP8A 1RD5A 1QHOA 5HAOA 3WLJA 3ALGA 3NL2A 4DPQA 3OGSA 4WK9A 5AOUA 4RZ4A 3SI9A 4H7CA 1EC8A 2PDKA 4GYKA 3VX1A 1U83A 4TX9A 4GCAA 2PI6A 4CKQA 2W27A 3CZGA 2GJLA 1J6PA 2PGFA 5F2IA 3ES7A 4KEVA 1CENA 3AISA 3AUJA 2FPTA 2J88A 2VI0A 4L1WA 4G7EA 1W56A 3NPUA 4KPLA 2HE5A 1PTGA 1D7FA 1D3GA 3EKLA 1TWZA 4MUPA 3G5EA 3GS6A 2DVUA 3QR3A 3FDGA 2FTWA 1UHVA 3B03A 5LNWA 7XIMA 3DG3A 1MSSA 1HGYA 4V27A 1RHCA 1Z42A 1KR0A 2EG7A 4CNUA 2NQHA 4Q3MA 4UXDA 3B8UA 3ZIZA 3MMTA 5CAKA 5H91A 1R2RA 5K4XA 1HKKA 3NUKA 3T05A 3MP3A 3MA8A 3RCNA 3QSTA 2E7FA 1HKWA 1SJCA 3T55A 2ISWA 3OB8A 1XBXA 2BVDA 3H7RA 1OG0A 1TPH1 1FP8A 1JNEA 1OWQA 3DFYA 2WSYA 2PGWA 1V5XA 2GQ8A 1LROA 4Y96A 1OABA 4BZYA 2VOMA 4YTUA 2BHUA 2OFJA 3TEVA 2FTPA 4IG2B 3KRBA 4O13A 3PP7A 3MUIA 3RITA 3ZXWA 1KCXA 4CU6A 1ZENA 3LM7A 3UA4A 4ERIA 4X3ZA 1WXZA 2E1DA 1XBYA 4DXVA 4BQ5A 3IGHX 5ABTA 4WY0F 8XIAA 2FVMA 3T1GA 3VKDA 4F8XA 1GVEA 3SGGA 3O6YX 3OGRA 5C9ZA 4Q22A 3VILA 1Q13A 5C71A 3AIUA 3KL3A 5LXXA 2NQJA 2WMGA 4H9UA 1NELA 1XCFA 4PMOA 1GOMA 3GXTA 3DOPA 4AD1A 3DENA 3CBWA 3EWUA 2YLLA 3WQVA 3BURA 2YW3A 4W89A 4HOWA 3OVPA 2XSBA 4FSAA 5BWFA 3SW6A 4NILA 2CLLA 4HZ7A 5JVLA 2TSYA 3QY6A 2BS9A 3C86A 4S3BA 3N11A 2VTFA 1XIGA 4LSBA 3DZ1A 3TR2A 1QR7A 2X42A 5TAOA 5GJMA 1BKSA 1NWUA 2Q3OA 4E0CA 2C7FA 4PBFA 3W7PA 5LIYX 5D8ZA 2CXEA 4HZ8A 1WBJA 4MTVA 3IJ7A 1K03A 4S3GA 3ARRA 4LAOA 3EWCA 4QXIA 3UG8A 1XRFA 3RPTA 1UB3A 4RDWA 4RV8A 4DXXA 4MLRA 3CT7A 4O4WA 3EZ4A 2VRQA 1CPUA 3A12A 3WDIA 3E2RA 4XZMX 4UQCA 2WZEA 4N9DA 3AYSA 2FZMA 3O07A 2WZMA 2IPFA 3A21A 4HNVA 1A53A 1C8QA 2Y70A 4QEHA 3EEGA 4H2HA 4K2SA 5A2CA 3KBWA 5D05A 3SN1A 3BW4A 3NGJA 1M53A 1CXEA 1PDYA 4F4RA 3E0LA 3UGRA 3W38A 2RHGA 4K37A 3BE7A 3CZLA 3LHYA 1Q6RA 1FY6A 4GIYA 4TX6A 3H2CA 3OODA 4BCEA 2FPYA 4O4VA 5I6SA 5HDRA 3W07A 3ELFA 2GJNA 3BLPX 1FCQA 3CIXA 3NIYA 3ZSSA 1X8CA 5KINA 3LNMA 3QHNA 4H9YA 4J3WA 1DJGA 2BG5A 5CQ1A 4Q4QA 1DJIA 4ZFCA 5G2IA 4Q8UA 4HNTA 5FL0A 6ALDA 5JXQA 1S5MA 3WCZA 2WCSA 1AODA 3VOIA 3RNDA 1CLXA 1VLIA 4W7UA 4LY8A 3PB2A 1R9YA 3WEOA 2YDRA 1V93A 3WD4A 4XB3A 4YIWA 2GDQA 3QY8A 2X1SA 3MP4A 2P1FA 2J7FA 4AG0A 3CQKA 3T2OA 1U5VA 1U30A 1DYSA 5DCBA 4WZHA 2O9PA 4KWOA 5FJIA 5CXPA 3M0KA 4G5DA 3EWZA 1OGSA 1YEYA 3G0SA 4IG2A 1E6PA 1UKQA 3STGA 4DZHA 1TSIA 1RD6A 1G5AA 2XINA 1FDYA 4R53A 1FWBC 1OQFA 4GQRA 3O0FA 1YTKA 1QFEA 4AWEA 1J01A 2DIKA 2FZNA 2DPEA 4JYEA 3V5OA 1AD4A 1W3TA 2E6AA 3UT0A 1DVJA 3DC0A 4ZFMA 1VPQA 5A95A 5C2CA 2ZZ5A 3ITLA 4I9MA 4ADTA 2WAGA 1CECA 2FTYA 3URQA 3F4CA 3H12A 3NURA 2V2HA 2HPMA 5DRCA 2FZ8A 3GR8A 3EPMA 3WD1A 3IK4A 2QDEA 3PZIA 4ZO7A 2ZFAA 5HJLA 4JAWA 3AI0A 1DJQA 1H1NA 3M6YA 3THCA 1HFBA 4RZ5A 1J9YA 4EWJA 5AC4A 2PTZA 1WXJA 4GO9A 3DYOA 4UZSA 4HNNA 5J5RA 1MW1A 1FXQA 5A1AA 1EX1A 2JF7A 4AVOA 5CLWA 3LLFA 1OFPA 1XC6A 1KTNA 1QI4A 5E9AA 4DO6A 3FEQA 4O8AA 2PAJA 3TA9A 5C70A 2XG9A 1P48A 4HJFA 2WANA 5HWMA 1FHDA 4P7QA 1N8FA 1Y65A 1JDAA 4A35A 1OYBA 4RE3A 3IJ6A 4U33A 3GXDA 3PTKA 4GY0A 2YX0A 4PA8A 2ZUWA 4LBUA 1B4EA 3TLQA 2PDCA 1J10A 4ZO8A 2JBMA 1Q45A 4IP5A 3LYEA 1EXPA 4ZE4A 1MEWA 1XIHA 2PP1A 2WK2A 2ISDA 3VM5A 1KRMA 5HJXA 1N2VA 1AL8A 4IQJA 4IISA 3DFQA 4UNIA 3M0HA 1HJVA 1VEMA 2DUXA 1HL9A 1G1YA 1Q6LA 4K3ZA 1EYWA 2O55A 2YL5A 2GYIA 4LV4A 3CYJA 1BWKA 3WNPA 2XFWA 4NZJA 5B80A 4Q8VA 4EF9A 2EBNA 1EF3A 1G67A 2I17A 3CIWA 4UTJA 3N2TA 1MXGA 4PSRA 3W29A 5B7ZA 4LT9A 5CJNA 3U4FA 4XD3A 3WFLA 3N29A 4AVFA 4NX5A 1QDSA 1JPDX 1AA1B 3WBYA 3LERA 1O5XA 3IVSA 2QNEA 3KCOA 2QULA 3ARPA 2HV5A 1B1YA 4PGLA 4PTXA 6ENLA 1Q6GA 2E4TA 3ZT5A 2ZUMA 4RX0A 5HNNA 4FNPA 5D09A 4CCDA 4OTKA 4NZ1A 3RMJA 4CEXC 2VX4A 1VBGA 4LH8A 3W22A 3Q4DA 1NH6A 4XAPA 4BQ2A 3S6TA 4F9DA 3RLVA 3I65A 1XFCA 4GKTA 4KT2A 2WOQA 4JTSA 3B9OA 2C1HA 4GUGA 3L4ZA 1MNZA 3Q2DA 4MYAA 2HQAA 3AIRA 4B92A 3PZUA 5JBFA 1XIBA 3LBMA 1TV2A 3IUHA 4JFWA 4JTQA 5IRPA 2V5DA 1K8YA 1YX1A 4NXSA 4S3FA 1HKIA 2ZRWA 1XH0A 3N2CA 4TTUA 1WAUA 2Y5JA 1B4KA 4U5IA 4PZVA 3WLSA 3T08A 4CCZA 1RY0A 4AC7C 5FEXA 2QIWA 1QNSA 1XYFA 1S2VA 1EOKA 1E55A 4PB3A 4C60A 3QLDA 1VEOA 3W7GA 4LY4A 4GYFA 4E2BA 1OC7A 4AD0A 4TXEA 3TZFA 1NP2A 2DIJA 2I5GA 1PKNA 3M5VA 1JCMP 2G3JA 2W66A 4OGZA 3NL3A 5G1MA 3K30A 4HA1A 3STFA 4GINA 3EX4A 1S1PA 3O9NA 2YB4A 1NJJA 1G4TA 2XIQA 1B57A 5K9DA 2EPKX 2PF0A 4LF1A 3ZWSA 1SFLA 3VKJA 4JKKA 3WQGA 4XV0A 1RAKA 2QXWA 3EPOA 3CO8A 1UUQA 3NO3A 1E6ZA 1YXCA 1W0MA 3W6LA 2D23A 2D3LA 3G6MA 5FJUA 4ZXOA 1R46A 3IVTA 5CPSA 1M68A 3CH0A 3GY1A 3CT2A 1VQTA 3BC9A 3SIMA 4NXKA 3VIHA 4O18A 1SO5A 3RJYA 3G0XA 3T9PA 4FXJA 3IEBA 3IIPA 4LEFA 2Y2WA 1JZ8A 3KDOA 1E4NA 2CBUA 1UMYA 4IPNB 3BZGA 4X0VA 4F0HA 1WDWA 4EWND 4J40A 3N3MA 3GZAA 4V33A 4WEVX 1SSGA 4ML9A 2V8ZA 3T2QA 1FDZA 4E8DA 2ODOA 1Q4NX 5D38A 1EUAA 3PPFA 2ZZ4A 1LORA 4WVXA 4HOXA 1FWHC 4J7RA 1PYFA 1JPKA 3A4XA 1PJ9A 1HJXA 2P88A 4GFSA 4JDYA 4BF5A 4TVCA 3UWQA 3NA8A 2ZQ0A 2WCAA 4H8VA 4AMCA 4LPCA 3HFYA 2VKZG 4NIRA 4QSHA 2W9MA 2ZCGA 1S46A 3W74A 3ID7A 3PR2A 4NAFB 3LD5A 1NSJA 4HCHA 1OK6A 1V8EA 2W6RA 4JTLA 5LXEA 3TUUA 3B4UA 1V79A 3SFWA 2NUYA 5AY7A 5T91A 3SQLA 4WOZA 3W7MA 3LGGA 5AKQA 3A4AA 2CLMA 1RJQA 3OQEA 3PUEA 3IIOA 2X0SA 4DI9A 2J4GA 1UR8A 1E15A 2VFFA 3VOCA 2QR6A 3QQ1A 1NOUA 2PP0A 1WPCA 1JPIA