4V27A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-isofagomine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
349
structure length
349
Chain Sequence
b'NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Kinetic Dissection of the Endo-Alpha-1,2-Mannanase Activity of Bacterial Gh99 Glycoside Hydrolases from Bacteroides Spp.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 127
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v27A00
1WDQA 3WF1A 2ZWZA 2BXZA 4D71A 5C8BB 1E6SM 4MNMA 1ESWA 3NDYA 3CO4A 3GZAA 2WXDM 5AYBA 3O2LA 3EMQA 5GQBA 4AYSA 1E5NA 4QCEA 3BMWA 1UWSA 5CSYA 2G3NA 4CN1A 2ZXBA 1LWHA 4PUEA 3VM7A 1QI0A 2W91A 4LX4A 4TVDA 2CEQA 4B15A 1C8XA 1BG4A 1GPFA 4PMOA 4WKHA 1UKOA 1HX0A 2A3BA 4JAWA 3UR8A 1G0CA 4UQ9A 1QW8A 4M81A 4BQ2A 5C71A 4AD2A 1QPKA 1M03A 5I77A 5E6YA 1JAEA 1XC6A 3ARZA 3FAWA 4J3XA 4OZOA 4ACZA 1FA2A 4F9DA 3NIYA 4QLLA 1UR8A 5EBAA 5ABFB 4M1RA 2D1ZA 1V3IA 3ARSA 3CZGA 3RIKA 2E40A 2V3GA 2FHFA 5DFAA 5IHSA 3PHAA 4HOWA 1GHRA 4HPGA 2GFTA 4E8CA 1FP8A 1F4AA 2WPGA 1JG9A 2WLYA 2WVUA 3I3DA 2VL4A 4UFHA 4R27A 1GCYA 3TONA 1B3WA 1TMQA 1JZ3A 4QAWA 4UOQA 3OG2A 1KXTA 4GXPA 1X6NA 1JZ6A 4P7QA 4FLSA 1W9PA 3W27A 2EPKX 4AY1A 2JEQA 1VAHA 5IHRA 4RE4A 1K9FA 3RMEA 3W81A 3ARUA 4NSBA 3N1AA 4RE2A 3QHOA 5ABEA 2XPKA 3UG5A 3WL1A 2GDVA 2QMJA 3VIPA 5LA2A 3BLKA 2DT3A 3MMDA 4IUGA 1O6IA 4F8XA 2JE8A 4MNLA 3CUFA 2FDMA 4AZGA 3W53A 3AMCA 4JIEA 3B9DA 1CXLA 4AZIA 2J47A 3WUEA 5HBFA 1VBUA 1JYNA 1QBAA 1CXKA 3CUHA 1LJYA 3POHA 3CHFA 4ZFMA 2EPLX 3W37A 4OJYA 3APGA 3T0BA 3AROA 4S3KA 3AHVA 5FD0A 3GXFA 1E3XA 2D24A 5CZKA 1ZU8A 2WC4A 3RM4A 1DWFM 3RM9A 2OWWA 1J0IA 4UOJA 5ABHA 2E8YA 1VFOA 5JBEA 1BPLB 2XVNA 2HVMA 4MADA 1W1YA 3RM8A 2W4XA 4J7RA 2G3MA 1JYVA 1JD7A 3FHQA 3RPMA 4CU8A 4EANA 1H09A 3W82A 1E4NA 5A8MA 2BHUA 3VGEA 1V0MA 4CD5A 2PBGA 1JDAA 4P8VA 1YQ2A 2ZX8A 1UWUA 3IJ7A 3UESA 3MMUA 5I5RA 1ZB5A 1WDRA 3U7VA 2V3EA 3VIKA 3N12A 3W0KA 1NWTA 2OSXA 3K4DA 3CHDA 2CESA 3SIMA 2W67A 3EMCA 1MW3A 3WH7A 5IFPA 2X8RA 4FLQA 4LYPA 3SCVA 4JZ5A 4AZCB 1EDTA 4AWEA 4UOZA 4LPCA 1OCQA 3TOPA 3VINA 1PIGA 3ZT6A 4HOZA 1V0NA 2FGLA 3HJEA 4W8LA 3N17A 4JKLA 1UR4A 4M56A 1NQ6A 2WHJA 5D8ZA 3W28A 3KWXA 3GXMA 2W66A 1WE5A 2WKLA 5GPRA 3W6MA 1J0YA 4FLRA 1Q6CA 1UR1A 2VO5A 3EYPA 1Z32X 5HXMA 1IV8A 2FGZA 1UR0A 1HKIA 1UHVA 4UR9A 3CZ8A 1UD8A 1G94A 3BC9A 1GJWA 2J74A 1OWQA 3WD0A 1B31A 4W5ZA 1TVPA 4XZBA 2CBUA 1BGAA 1EA9C 2J7BA 3AS1A 3LPOA 5A94A 3VDAA 4B3KA 4C7GA 2OWXA 1PJ9A 2JIWA 1TVNA 1VEPA 1OINA 4P8UA 3ZJ6A 4W85A 4OIFA 1H41A 1CBGA 1SFSA 4CCCA 3WL0A 2D0GA 5AYIA 1J0KA 1PBGA 1U2YA 2ZUWA 4AW7A 2YL5A 4JKMA 3WF4A 2VR4A 2EXOA 2BXYA 2E8ZA 2O9PA 2XTKA 1C93A 2W61A 1HXJA 3GTNA 1WZMA 1QNQA 4WKFA 3ZJKA 1EDGA 1CGYA 1V03A 4H04A 4AZCA 2C0HA 4UNIA 4HA4A 2E9BA 3QOMA 3TP4A 1FHLA 4MDPA 1MWOA 2VT0A 5A95A 2G3IA 2DSZA 1ZBKA 1LL7A 1UKPA 3L4UA 2XIIA 4TVUA 4Z2IA 4J3UA 2Y5EA 3GH4A 3W26A 4MB1A 3AMDA 2UY5A 2BVYA 3VM5A 4GI6A 3VGHA 3TTSA 2DT1A 2G3JA 2WANA 5BRQA 2PI6A 3WUGA 2BY0A 4CUCA 1UR9A 2ZWYA 1C8YA 4W7UA 4AEFA 5GNXA 1KCLA 3O9NA 4C7DA 1EO7A 3AIVA 1WPCA 4JFWA 1BYDA 3AIQA 2ZUMA 4B16A 4KWUA 4GIAA 4AD3A 3F4VA 2ZIDA 1NH6A 2UWFA 4L4OA 1V6VA 3SCPA 3NSNA 3AISA 2QHAA 4UQCA 2ZE0A 1IZJA 4N42A 5D9OA 1H0IA 4PCSA 2G4FA 2WWCA 4LYQA 4CD6A 4MPKA 1WZKA 1UYQA 3W6LA 1KXQA 3NCOA 1W3JA 5M17A 2CHOA 1X1NA 2G8ZA 1J12A 4H8HA 1BSIA 1GOOA 1BVNP 3UG4A 3WH5A 5BXTA 1GOMA 1EOMA 4P8XA 1HKKA 4Q22A 5M03A 2Y24A 4R5EA 1OD0A 3VGBA 1CPUA 3GXDA 4HZ6A 1H3GA 1ZBCA 3ECQA 1XGZA 3OIHA 2ZUUA 1QI4A 4F79A 5FL0A 2YOCA 1W1PA 1JZ5A 3GM8A 2VX7A 4DWSB 1GOQA 1H1NA 1VFFA 2YKKA 3SEPA 4PYSA 3VIGA 1ZBWA 2X1IA 2GDUA 1ZBVA 3OLDA 1DWJM 3SCNA 1UH3A 4UFIA 3D3AA 3VMNA 4OKDA 4PMQA 2EO7A 3ZQ9A 3VGDA 5EFDA 2WNWA 2J7FA 1HL9A 1JAKA 1W9BM 1RP9A 4IISA 4OUEA 4JFTA 1QHPA 1W3LA 1GVIA 1WP6A 3W38A 4RL3A 4OBRA 1QI3A 4D6FA 3AHXA 4MAZA 1XV8A 4QFUA 5BCAA 1UQYA 4UCFA 1UA3A 1QHZA 1GVYA 3A4WA 4IPNB 3VIJA 4E8DA 1NP0A 3VD7A 1UA7A 1CWYA 5CJ5A 2XG9A 4LXFA 4MNKA 4GZJA 4U31A 3AIUA 2IXVA 2WMFA 4EE9A 2BY3A 1F4HA 3CGTA 2ZICA 1J9YA 3ARRA 2YL6A 4JKKA 3KZSA 3EDFA 4AIOA 1SR0A 1E40A 3OLEA 1QI5A 2PWFA 1BFNA 2ZUTA 2VJXA 1E73M 3M6DA 2VZOA 5A6LA 5JBFA 1WZAA 3PZGA 4W89A 1FH8A 1CXIA 5D9PA 4LYRA 3VO0A 3DYOA 3ARVA 2IUZA 6A3HA 2DQXA 4OOZA 3L4VA 1QHOA 1KWGA 1TG7A 1XH1A 1J18A 1ISXA 1D3CA 2WVTA 1GQKA 1OB0A 4DWSA 1UD5A 4K68A 1UG6A 2WVVB 3IJ9A 3BSGA 3GXIA 1HVQA 4FK9A 3PZVA 1W2VA 2VRJA 2RGLA 5E0CA 2XGBA 2VRKA 1D7FA 2ZUVA 1B1YA 3MKKA 4U3CA 3HN3A 4KMQA 3OA5A 1W9UA 3BAJA 1FH9A 1B90A 3WFZA 1GQJA 3WEMA 1HL8A 5JBDA 5KZ6A 5EFFA 3BAWA 2J7HA 5I3DA 3SUSA 2XJ7A 4JCLA 2J7CA 4KH2A 2XSAA 5FKYA 1XH2A 4WF7A 1W3KA 2X2YA 3VIMA 1XCWA 3T2OA 1CLXA 1XYZA 4HZ8A 1OT2A 5CG0A 4J3WA 4M82A 3WMSA 5C70A 1IZKA 3NDZA 3LPPA 1NARA 2EEXA 3PTKA 3JUGA 2XVPA 4PEEA 4PMXA 1VENA 3GH7A 2VQTA 1OT1A 3IAQA 2WMIA 3CHCA 3K46A 1ZL1A 2E9MA 2V5DA 1HJUA 1KFWA 4QLJA 1M04A 5A6MA 1W9VA 5FOOA 3WQ4A 1HNYA 3B9EA 4BQ3A 1UD3A 2O92A 2PWGA 2NT1A 2CITA 1PPIA 1EXPA 3OZPA 1R8LA 3B8SA 1W9XA 1HJWA 1WO2A 2WVVA 2YA2A 3VDBA 1SYTA 1KQYA 3W25A 5LYRA 1DEDA 1I1XA 1JIBA 2XGIA 2YA1A 2WHKA 5A6BD 3RJYA 3VILA 3GBEA 1NOUA 5IDIA 2OSYA 3RDKA 1UQZA 5D9MA 5BXSA 4YHEA 3K1DA 4U5KA 2FHCA 1JFXA 1EGZA 2B31A 3WBEA 4PMUA 3SCUA 3MSDA 4AEEA 4GO9A 2FHBA 2CIPA 1DWGM 2JF6A 3IAPA 3L4YA 4CGTA 1ISWA 3AZTA 1DTUA 1AQ0A 4TTUA 5A8OA 4UZUA 2QMKA 3WQ6A 1DWHM 3VIFA 2E4TA 3WIJA 2XVKA 3WDHA 4AZ7A 4W88A 4HMCA 1V6UA 3N15A 1GJUA 5I2UA 3VGFA 1EHAA 2WC7A 1L8NA 2EQDA 3ARPA 3AZSA 3EMZA 4HTYA 3VD9A 1NOWA 1MYRA 3ZSSA 2DIJA 4U5IA 2BVDA 1CGUA 1EQCA 1OD8A 2PWEA 2YL9A 4W93A 1RPKA 5AC4A 3B9AA 5I78A 4J3SA 3UR7A 4B3LA 4PSRA 3WD4A 1WDSA 3L4TA 3AXXA 3ZOAA 3DYPA 4AD4A 3NSXA 2WLZA 1C7TA 1PZ3A 1BF2A 1HT6A 1VRXA 1CGXA 1BTCA 1PEZA 4WKAA 1XHGA 5ABGA 1CGTA 2EBNA 5M3WA 1V3MA 3TTQA 4PCTA 2WM0A 5ABFA 5DT7A 3ZM8A 1U33A 4ZXOA 3L4ZA 1G01A 3QR3A 2VMFA 4AMCA 2V3FA 1KR1A 4HU8A 2Q8XA 4TVCA 4EKJA 4V28A 8CGTA 1A3HA 2WVSA 1JF6A 1VFMA 4TTGA 2AOSA 3ALGA 4W7WA 3WH9A 3MUAA 1XSJA 3RILA 3HMCA 3WD1A 3CZJA 5CPSA 2W63A 3VNYA 3F5LA 2XUCA 3I3EA 1WAWA 5A6SA 3NUKA 3U5YA 3MUIA 3RO8A 2J25A 1X6LA 3CIVA 3FHAA 2WHMA 4PMDA 1CIUA 2WC3A 3N04A 3N11A 3SCSA 4QDMA 2BY2A 2CBVA 1OGSA 4YN5A 2J7DA 3FN9A 5JIWA 1GZJA 3WNKA 3AHYA 3ALFA 3SURA 4TXEA 1H2JA 3WNOA 2W5FA 1PX3A 3LPGA 1S46A 2DSWA 4HA1A 2VOTA 3LPFA 3CTTA 4D1IA 1JYWA 2J75A 4NZCA 3AS2A 3TA9A 3AXIA 1PX8A 3POCA 3VU2A 3FW6A 2Z1SA 5AC5A 5E09A 1ODZA 1P6WA 3WNMA 4JFSA 3KL0A 1E4IA 2Z1KA 3UERA 3WEOA 4FLOA 3PZUA 1I1WA 5I0DA 3M07A 5HOSA 5LA1A 3MV11 4GQQA 3PZ9A 3WQVA 2ZX5A 1B3ZA 1NP2A 3DYMA 2J8FA 1GONA 1J0JA 4P8WA 1WNOA 4DUXA 4XZWA 5CLWA 1B2YA 2VCBA 4UFMA 4H8VA 4JFVA 2CKSA 2E9LA 1C92A 4WJXA 4CD7A 1XRVA 2GK1B 4AZHA 2VC9A 5A2AA 1JI2A 2XFYA 2YL8A 1V6WA 2NW0A 3HU7A 2J78A 2VZSA 1DWAM 2DDXA 2WK2A 2GJXB 1HJQA 1B30A 1GW1A 5CQ1A 2NT0A 1KCKA 2D23A 2NSXA 1Q6DA 4V27A 3N18A 4F66A 5I23A 3GNPA 5CGMA 1XCXA 4D6JA 3VD5A 3AQUA 3OGSA 3VPLA 2ZUNA 1R7OA 4Y7EA 5A8PA 2JEPA 4TOQA 3BH4A 4H41A 4JL1A 3RCNA 4F9JA 2ZUSA 2HISA 1RP8A 1V3LA 2DEPA 5BXRA 1EOKA 1C91A 2XIBA 3PZQA 4RE3A 3KEHA 3NYDA 1JNEA 3CHEA 1C8QA 2WCSA 5KEZA 2VUYA 3AIBA 3E1F1 1ECEA 2WZIA 2YBUA 4Z2LA 2CNCA 1UKSA 3AIRA 3KL3A 2XYLA 1DHKA 1PX4A 4E2OA 5D8WA 2YA0A 2QPUA 4AXNA 2J4GA 1KGXA 1JGIA 1MFUA 3BCDA 4IPLA 1BGGA 3MANA 1BG9A 1J11A 3KL5A 4IM4A 1VB9A 3AICA 3AI0A 4S3JA 3T2QA 2Y4SA 5GNZA 2VR5A 2XFRA 1LWJA 4DUWA 5A2BA 2EPMX 1I75A 3AMLA 4Z2GA 1JXJA 2GK1A 3N13A 3S6TA 1GQLA 3GBDA 1E6RA 1J0HA 3SCOA 1CLVA 1VEMA 1GOKA 2CERA 1MVYA 3AMKA 4WIWA 2F61A 2A3CA 2CCRA 3WD2A 1CZ1A 1NWRA 3F5KA 1H11A 4CD8A 2IXUA 1LL4A 3WSUA 1V3HA 4ZXLA 4W8AA 3K8MA 2YDRA 4UQDA 1K9EA 1JD9A 4DWSC 3AHZA 3CMGA 4UFJA 1E5JA 2D0FA 4PMYA 4W87A 1CXFA 3AYSA 5HNNA 3AOFA 3T0AA 4URIA 1LL6A 2WCAA 2GJPA 2J77A 1R85A 1V6YA 2W62A 2BS9A 3WF3A 4A4AA 1TFVA 1E4MM 3O6AA 2WSKA 5HDRA 1V6XA 2UY4A 5GNYA 1LLOA 1QVBA 2GJRA 4CD4A 2J62A 1QNOA 1QNRA 1CGWA 1WZLA 3CUGA 2BFGA 1ISZA 2XWEA 4D6DA 1FH7A 3U57A 3QHMA 4UQAA 1QNSA 4UFLA 3WKZA 2QF8A 1E0XA 1V02E 2GSJA 1BYCA 3BXWA 3CUIA 9CGTA 3QOKA 1UWIA 1BLIA 1B0IA 4J28A 4HZ7A 3L4XA 3GYCA 1HKMA 3BSHA 4D6GA 1BVZA 3VTRA 2BV9A 2PB1A 3UCQA 1EDQA 2X05A 1TCMA 1VJZA 1EIBA 4A3YA 3W24A 1E6PA 2OLHA 2WMJA 1JZ8A 3WENA 4QLKA 1HP4A 1E1FA 1GQIA 4NF7A 4W5UA 2D3LA 4PSPA 2XVLA 4J27A 4MJ4A 2WWDA 4P7NA 1E56A 4XB3A 1VF8A 1EQPA 5A6AA 1FFQA 2BHZA 2GVYA 1W1TA 1G5AA 1E6ZA 3PZOA 5I6SA 2ZX9A 2VVSA 3TTOA 5LA0A 4AZ6A 1OIMA 3WH6A 2YJQA 3EDKA 3ZJ8A 5JIPA 2VNCA 1GHSA 2DPEA 2BY1A 4M29A 1KBKA 2RGMA 1B3XA 2WMGA 1JFHA 4CVUA 4BQ4A 3W4RA 3L2LA 4D6CA 4WLCA 2PF0A 3AYRA 1VJSA 4CCDA 4UTFA 2QV4A 3CMJA 2E3ZA 2X0HA 4MJ2A 1G1YA 4DM1A 3WMCA 4GO8A 2W92A 1H49A 4ACZB 4CN6A 1VFUA 1Q4NX 1U30A 5DMYA 4BS0A 4HP5A 1E6QM 1E9LA 1QW9A 3AJ7A 2WAGA 4GZEA 5DF0A 1E1EA 4AC1X 2D2OA 3VDHA 4YHGA 4JL2A 1V3KA 3WF2A 2CBIA 4W8BA 4QP0A 1E4LA 4PMZA 1HIZA 3BAXA 4OBSA 3GNRA 1XH0A 3MU7A 4M24A 3VKKA 2VX4A 1WDPA 3OLIA 4GINA 3THDA 4LQ1A 3SCTA 4AD5A 1W32A 3PTQA 3SUWA 1JI1A 3VX1A 1KWKA 5I79A 4X0VA 5EB8A 3VD4A 2CKRA 4HMEA 3WMBA 4U3AA 5DEZA 1TR1A 5BRPA 4PTMA 2VZVA 2V5CA 1N82A 3AS0A 3GNOA 3MMWA 1JNDA 4PMRA 4B9ZA 7TAAA 3BAYA 2QPSA 3VGGA 4TUFA 4AIEA 4KRTA 4BCEA 4EAMA 6CGTA 1PAMA 1J10A 3T09A 4C7FA 3WNPA 1HJSA 2TAAA 1AVAA 3VUPA 3BGAA 3M7SA 3K4AA 5M5DA 2A3EA 4ATDA 1MXDA 4P7RA 3WNLA 3BAKA 1BYAA 1E55A 5CLTA 3VDCA 1J01A 1US3A 7A3HA 4PMNA 1VEOA 2D22A 6TAAA 2EJ1A 2CYGA 1B9ZA 2ZXAA 2J8GA 4BZYA 3VIIA 1WB0A 1AQMA 4PMVA 1KXHA 1E15A 2JF7A 2CETA 1PIFA 2D20A 2AAAA 1GOIA 1ZS2A 3WQ8A 1A47A 2VRQA 3TTYA 3J7HA 4GI9A 5A8QA 1BHGA 3PZTA 3VMOA 4EK7A 2ZXQA 1HP5A 1KBBA 1LG1A 2OWCA 1Y7VA 3ZO9A 5E6ZA 2J79A 1B3VA 2WCGA 3A4XA 4X9YA 1JZ2A 2OSWA 5I24A 4U2ZA 1KB3A 4ZENA 1DWIM 1ITXA 3WNNA 2ZX6A 2Y8KA 1UH4A 3L4WA 1D2KA 1US2A 1FOBA 2JALA 1NOFA 1UD2A 5CSUA 4AZBA 3WDPP 1ISVA 2VX6A 1MQPA 3DHUA 1EHNA 1ITCA 1H4PA 5A6KA 5BROA 1BAGA 5D4YA 4KGJA 2G41A 3FXYA 3A6OA 2PWHA 4KGLA 1MQQA 1C7SA 4HMDA 4OOUA 1C3FA 1E71M 1OBAA 2YBTA 1SMAA 3ARWA 3NSMA 3ZT7A 3NJ3A 3AIWA 4TX6A 2DSVA 2V38A 3SUVA 2DGAA 2PWDA 2J7EA 3WDQA 2D3NA 5FCZA 5FL1A 2YDSA 3ZR5A 1UR2A 1RD6A 3PZMA 3U7BA 1HN1A 1CXEA 4WSKA 1E43A 3A47A 3CLWA 3EDJA 1JZ7A 1NM9A 4MB4A 5A6BA 5JUVA 2X0YA 1PZ2A 3WBAA 5DT5A 3ARTA 2E0PA 1CXHA 2C8NA 2VZUA 5A2CA 2DIEA 1UKTA 1R87A 3N9KA 1FHDA 4WSJA 4AD1A 1UWRA 4ZE4A 5A6JA 2WHLA 4D6IA 5BXPA 1ZJAA 3K8KA 2CBJA 4P7OA 3ARQA 3SUTA 2O9TA 1KGUA 3F5JA 4M8UA 1QOXA 1UH2A 3WFLA 5HPOA 4PTVA 1V0KA 4NRSA 1YHTA 3AZRA 2X09A 1Q6FA 2BHYA 3OGVA 1V3JA 5CXPA 2WZHA 4MB3A 1SMDA 1K6AA 3I3BA 1GNXA 1FFRA 1NWSA 1UZ1A 4W86A 4JHOA 4UFKA 5BWFA 1W9DM 3BCFA 4ATLA 4PTXA 2XHYA 4N0RA 1OIFA 2WW5A 4HPHA 1M7XA 3GDBA 1UWTA 5IXEA 1E70M 1W91A 1VBRA 2VX5A 1CECA 4GZIA 1W1VA 4LGXA 4D6EA 4MTVA 4DUVA 2MANA 4XUYA 2JIEA 4GKLA 2WBGA 2XVGA 3AFBA 4V2XA 5HPCA 3MO4A 4Z2KA 4ZEPA 1MXGA 1E0VA 3CBWA 3PTMA 4PTWA 5CPTA 1G9HA 3A3HA 2WB5A 3FAXA 2VI0A 3BAIA 1QI2A 3ZIZA 4P7LA 3THCA 1TUXA 2BVTA 4HA3A 1J0ZA 1FP9A 1W2PA 3T2PA 3FY1A 3II1A 2OYLA 3DHPA 2A3AA 5BYWA 2VURA 3EBVA 3T0DA 2VQUA 3SCQA 2XFFA 1UD6A 3EDDA 4UQEA 2O9OA 1HJXA 4D6HA 5A3HA 3WUFA 2VCCA 1TE1A 3D5HA 3MUZ1 4U33A 1XSKA 3GH5A 3VIHA 2CPUA 4QCFA 4TX8A 3VOCA 1HF6A 3U5UA 4CKQA 2QLYA 5CGTA 3UG3A 4MDOA 1ODUA 1LF1A 3VNZA 1MQRA 2J7GA 4MNJA 3OGRA 4H2CA 1E72M 2DSKA 1MW1A 2XSBA 4PN2A 4AISA 5IFTA 2F2HA 1B3YA 1TA3B 3ZMRA 4Z2JA 3DECA 4ZE5A 3MS8A 3PZIA 3VX0A 1LQ0A 1KQZA 2YIHA 1H5VA 3AXHA 3A4AA 3IANA 4GQRA 3WY1A 3M46A 5EMYA 3W29A 3IJ8A 1UKQA 5A69A 3PZNA 2WBKA 3ARXA 3OBAA 1JZ4A 3RJXA 3WDIA 4ATWA 3AMGA 3MV01 4FF5A 2JFEX 4BA0A 2ZOXA 2PBOA 3OZOA 1OGBA 3BMVA 1CNVA 1UZ4A 2GJXA 3AHTA 2FH8A 4WK9A 3UETA 1EH9A 2UY3A 1JXKA 4Z2HA 4DWSD 3VD3A 2WMHA 1R86A 2BNJA 3MUY1 4D1JA 1V08A 2WZEA 1E6NA 2V3DA 4GPNA 4JCMA 1MW2A 1UOKA 2DH3A 5F7UA 8A3HA 3FNDA 1OSEA 2VVNA 1M01A 2WYSA 1AMYA 3ZJ7A 3ZR6A 1V02A 1ZJBA 3OLGA 4MAVA 4H8UA 5TD4A 1HKJA 3SUUA 1DP0A 4ML4A 4DM2A 1CEOA 3WN6A 3SCWA 3LMYA 3AIEA 1BQCA 1JYXA 1ISYA 4PUDA 3CPUA 2O9RA 1Q6GA 1TA3A 4H7VA 4B9YA 1UD4A 1IT0A 2DT2A 3WUBA 1HVXA 4CU7A 1XSIA 3QGVA 5DO8A 3CH9A 4A3HA 1GUVA 5CPQA 1UUQA 1MFVA 3WDRA 3WD3A 2GUYA 2FH6A 1W3HA 4NRRA 2VZTA 4GI8A 4L4PA 4UZSA 3PBGA 1WKYA 3EDEA 3PN8A 1CYGA 1K9TA 2C7FA 2WKGA 2ZXDA 5A8NA 3CZLA 1L0PA 1C90A 3ZT5A 1TZ7A 3WH8A 3OB8A 1EO5A 3VMPA 4BF7A 4HOXA 4U2YA 1KGWA 4MB5A 1E6XM 2VCAA 2WMKA 4E4PA 5E0FA 2CXGA 1BYBA 1E3ZA 4XX6A 5FIPA 4HU0A 4PBGA 3CZKA 1RH9A 5ECUA 2F8QA 4CVWA 2OYMA 4FMVA 2A3HA 3ZSTA 2VTFA 3CUJA 1JL8A 1NWUA 1CENA 1XD0A 5AY7A 4J3VA 4JHZA 3WQWA 4AD0A 2WMIB 2DH2A 4Q7NA 2Y2WA 1R7AA 4AZ5A 1JDDA 2XWDA 1JDCA 2YLAA 3VVGA 2YLLA 3WEZA 4J3TA 4ACYA 1O7AA 2Y8VA 3DC0A 4PRWA 2AMGA 2PC8A 1M53A 2ZX7A 1CGVA 4UQBA 3QHNA 2ESCA 7CGTA 1K9DA 1OGGA 3KE0A 3SCRA 1GORA 2DSUA 3K8LA 1HJVA 1V0LA 4D72A 1JF5A 5E70A 1AQHA 1UWQA 4CN4A 2D0HA 4CU6A 4YPJA 4KRUA 3G6LA 3AS3A 4NI3A 2CHNA 3S2CA 3WDJA 2OYKA 4AIUA 5A1AA 1GOWA 1KXVA 3UEQA 2WSPA 3MSGA 1WCGA 2XM2A 3WQ5A 1OM0A 1XD1A 1Q6EA 1H0GA 4W84A 2DT0A 1QBBA 1CTNA 2YDQA 1CDGA 3G6MA 4M80A 3ARYA 1MW0A 2XM1A 3VIOA 1KR0A 5D9NA 4XV0A 2EPNA 3IK2A 2UY2A 3CZEA 3WELA 3T08A 4W7VA 3BLPX 1LG2A 1QNPA 4BQ5A 5E9AA 3WF0A 4X0NA 1VIWA 4CCEA 1XYFA 2EPOA 1E0WA 4JFUA 3L2MA
chains in the Genus database with same CATH superfamily
1WDQA 3MVIA 9XIMA 5HNTA 1TQJA 2BXZA 5T26A 4D71A 3CL6A 3G0UA 3DN5A 5BMXA 3GZAA 1KV8A 2NXGA 1FDYA 2PDPA 4QCEA 5J04A 1S2AA 5CZJA 3BMWA 1Q7QA 1FXPA 5BW6A 1K8ZA 3VM7A 3LI0A 5D2YA 2W91A 2HNHA 3W01A 4B15A 1C8XA 3A24A 3TQPA 4D2JA 4XBJA 3SECA 1UKOA 1HG3A 2A3BA 3UYCA 3DENA 1QW8A 4M81A 4FPSA 5C71A 5I77A 1JAEA 3FAWA 4O1EA 1I2OA 4J3XA 1K70A 3NQDA 2OO6A 3NIYA 5EBAA 1S3TC 4M1RA 4RZ4A 3CZGA 2Z25A 4BR1A 5JXQA 2FHFA 1XR2A 2PDQA 5IHSA 2H9AB 3QN3A 3W7JA 1GHRA 3DFSA 2GFTA 4E8CA 1FP8A 3KP0A 1D9EA 2VL4A 4R27A 1GCYA 3TONA 1B3WA 1JZ3A 1RCQA 5C5YA 3W1NA 2LLEA 4XAFA 3K1GA 1WKEA 1JZ6A 3TUUA 4LYKA 5B7YA 1W9PA 4PRTA 2YXGA 5DMNA 1K9FA 3W81A 2INFA 4ERGA 4GNJA 1YBQA 3GXPA 5G1MA 4NSBA 4O0QA 3UG5A 3NQVA 3WL1A 4H00A 4RV3A 1R3RA 3QLDA 2QPXA 3MMDA 4IUGA 1O6IA 3HF3A 4UTTA 4GH1A 4M51A 5T91A 4Q4QA 2E5CA 5CBJA 4AZGA 3IVUA 4QX4A 3AMCA 2WNZA 4AZIA 3F7JA 2J47A 3KS6A 5LIUX 4O14A 3CUHA 1LJYA 5CPOA 3RLGA 4JDBA 5FD0A 1E3XA 3LG3A 3GHTA 3UYIA 4MIMA 1K3UA 2ZCGA 3RM4A 4GLEA 1EPVA 3RYSA 3CXOA 4UOJA 3GTFA 1K4GA 3OHIA 3BVJA 3T1GA 4UTKA 1OHLA 2G3MA 1KM0A 1WV2A 3T55A 2HJPA 3W82A 2BHUA 1QPRA 3PG9A 3C2EA 1DXFA 1JDAA 1Q2SA 2ZX8A 1UWUA 1BEUA 2J88A 3FKRA 5B7ZA 4GVGA 3OJGA 3DX5A 4O11A 3RLVA 2V3EA 3VIKA 2BP1A 1QWKA 2DJLA 4MZYA 4B3ZA 4OQVA 3WH7A 3L21A 2OQLA 4WVXA 3STFA 1DJIA 3N3TA 3SCVA 4F2UA 4DI8A 1BF6A 5ABTA 1EDTA 4AWEA 4GCXA 3EWBX 1HUVA 1TREA 1CW2A 1OK4A 1F6PA 3N17A 1UR4A 1P1XA 3SQMA 2WQPA 4RZ5A 4OT7A 3KVKA 1WE5A 3STCA 2Q8ZA 3UR5A 3GTXA 2VO5A 3LSBA 1Z32X 2V0TA 5HWMA 2GOKA 5RUBA 4MKSA 1HKIA 1R30A 2FZDA 3CZ8A 1UD8A 4KF1A 2NXIA 3LRKA 1GZ1A 5KINA 1K1DA 4ONVA 4EIVA 1UB3A 3M0IA 3N6JA 1TVPA 1KKRA 4K2SA 1EA9C 4TV5A 3AS1A 4KFNA 1GQNA 3S2JA 4A2SA 4C7GA 1XIIA 2PTWA 2J6VA 1OF8A 2XISA 1UP3A 3ZJ6A 4KEVA 5EA9A 1CBGA 3WL0A 3N2TA 1PBGA 4AW7A 1ME9A 2YL5A 1BXCA 4JY8A 2ZZ4A 2Y85A 3GTNA 3DERA 3OZYA 4WKFA 5HMDA 1EDGA 1G6CA 3GU9A 1EZWA 1SW0A 1DIEA 3CV1A 4UNIA 4PGLA 5A5WA 1R6WA 2DW7A 1FHLA 1WUEA 5AHLA 3PBUA 2OCZA 4QISA 3SRFA 1ZBKA 1NF0A 2WJDA 1ZY9A 2XIIA 4GFSA 3TR9A 3GH4A 2G96A 4MB1A 3AMDA 1WXYA 5DANA 3FGCA 3B8IA 4GI6A 3VGHA 3KUMA 1T0OA 2G3JA 5MF5A 1RR2A 1PZ0A 3SRKA 4IQLA 3ZVHA 4ICCX 4RW3A 5FF4A 1TWDA 4C7DA 4JFWA 5H1WA 3ZLFA 4XK2A 3F4VA 3LBCA 2ZIDA 3H7VA 3MA8A 3IWPA 1Q6QA 3D6NA 4UQCA 5C2CA 2A85A 4DZAA 2ZE0A 1DORA 4DPQA 2G4FA 5C0QA 3I7SA 3A22A 1WZKA 4NZ4A 5CZSA 3NCOA 4K1GA 3R7MA 1X1NA 3QRHA 4PR4A 1J12A 1UC5A 3W1PA 2PMQA 5BXTA 1O5XA 4JY9A 1EOMA 4GG9A 1WXZA 1HKKA 4Q22A 1M41A 1GTEA 4BF5A 1E0TA 1OD0A 4HHHA 4MZ8A 1JPHA 3N4FA 1MNZA 3LENA 1GGOA 2DUAA 1JCJA 1F9CA 2FVKA 3ECQA 3JVAA 4N7QA 2E7FA 1CT5A 1QI4A 5FL0A 5AYXA 2ALDA 3DHFA 4DWSB 4IQJA 1GOQA 5D37A 2YKKA 3S0CA 3NGFA 3WZ0E 2HROA 1L6YA 2EG7A 4E4FA 3BG3A 2FPYA 1ZBWA 2VC5A 1TTIA 1V6TA 2XH0A 1SFTA 3KDOA 3HZ3A 4PMQA 2EO7A 1XLKA 3ZQ9A 5EFDA 1PTAA 4IXXA 4L4MA 5EPDA 1GVIA 1WP6A 3FJ6A 4GBUA 4OBRA 3BLOA 1QI3A 4Y9OA 1JCTA 4D6FA 1QHZA 3WQOA 3ES7A 3A4WA 3C86A 4IPNB 4E8DA 1P7TB 1EJTC 1Q45A 4LXFA 3IIOA 1R5YA 2G95A 3RPTA 4US5D 1TO3A 3EPOA 4UTJA 3P60A 1S5VA 4IG2B 3CGTA 5F2MA 5AZ1A 4JKKA 4S3AA 4WDWA 3EDFA 3MCOA 1FWDC 2ZUTA 1E73M 5A6LA 5JBFA 2P88A 5C2XA 5IRPA 2P10A 1CXIA 3MCMA 3VO0A 3H4WA 2R1PA 1NFPA 3OTRA 3LXCA 3SAZA 1QHOA 1TG7A 1XH1A 2B7QA 1J18A 3VOIA 4ADUA 2R94A 3N2MA 4LW7A 3GXIA 4H7CA 4GC4A 1FWNA 2VRJA 3PTDA 2B4GA 4Q6XA 2VRKA 1I45A 4JTSA 2UV8G 2AGKA 3UJEA 2GJLA 3CT7A 3HFTA 4XZIA 3VKAA 1YPIA 1B90A 2J9XA 3W7MA 3WEMA 2ZZ6A 4GQGA 1XBZA 3NTYA 3SUSA 1I0DA 3PBWA 2X2YA 1IHIA 4X9SA 1XYZA 2Z1XA 3TX9A 3R10A 4WY0B 5B80A 2PGRA 3LPPA 1NARA 3A21A 3USZA 2OZ8A 2V2DA 2Y63A 1LCOA 4FXFA 3GH7A 2EKGA 1OT1A 3IAQA 5JH2A 3CHCA 2DVXA 3ZVIA 1HJUA 4XD6A 4DAFA 5T8GA 4QLJA 3W76A 4BQ3A 4DF2A 1UD3A 2PWGA 2V5BA 3NL5A 4JX5A 2I57A 1F3WA 2YA2A 3VDBA 1XWYA 1SYTA 1KQYA 1TTPA 1I1XA 1JIBA 1UUOA 1OC6A 1EYEA 5IDIA 4DUOA 1GVQA 3APTA 3RDKA 1UQZA 4F0HA 4YHEA 3P8JA 3B97A 1JFXA 1EGZA 2I9EA 2R24A 1U5JA 4GRSA 4S3GA 2BGSA 2FHBA 1DWGM 4QHRA 2I5GA 2JKEA 1OC5A 3FYYA 2YCJA 1NEYA 3TMQA 1RCOB 3AZTA 4FX6M 4IMAA 4PFHA 5D33A 1DWHM 5FF2A 2VFIA 1D8CA 2E4TA 4B5NA 2FMOA 2OT1A 4ZZ9A 3E02A 1FWHC 1TCDA 3SJ3A 3N15A 4XKYA 1L8NA 3ARPA 3TN6A 3DU0A 1MUWA 1RLDA 3DI0A 3NOYA 2VYOA 1EQCA 4W93A 3H2NA 3ITVA 3UR7A 4B3LA 4H6RA 1RQEA 1JRCA 3RRXA 4C5YA 3NSXA 3GVWA 4HSOA 4UUIA 2E28A 1ZHAA 1XHGA 1G7UA 2EBNA 4A21A 5M3WA 3TTQA 3W7GA 2QJGA 4FB7A 3LM3A 1H62A 2WM0A 4FXRA 2J66A 4HKPA 2NVDA 5DT7A 4ZXOA 3QR3A 3WX7A 1EF3A 1TPDA 4YNGA 3K30A 3QEZA 1KO0A 2CLMA 1JF6A 2AOSA 2NQ5A 3ALGA 4YTUA 3WH9A 2ZQ0A 4NXKA 3UNDA 4DYEA 2W63A 3B04A 3E2SA 3VNYA 5I3IA 1F3EA 2XUCA 3EPNA 5A6SA 3QZAA 4MY8A 1M3UA 5GVJA 4RCXA 4ZL1A 2VGGA 3CIVA 3PPFA 4Q33A 2WHMA 3QLLA 2V82A 3FYOA 4CQDA 3SCSA 2BY2A 3UF9A 3QR1A 3OW1A 5LNRA 3VOHA 2J7DA 5LNSA 4GIEA 3WJYA 4REQA 2V5KA 1SZGA 3AHYA 3GVRA 3WQGA 5EBUA 5DY3A 3TR2A 4TXEA 2BASA 4MWAA 1AW5A 1H2JA 3WNOA 4GKTA 2XIQA 2DSWA 3CTTA 4AQLA 3EZ4A 3RNDA 3CM4A 3AXIA 1UJPA 3C2OA 3VU2A 2E1WA 1ODZA 3GG0A 2XZ7A 1EJ7L 1P1MA 3D47A 3BARA 3H2OA 1E4IA 1SJDA 4QDWA 3E6EA 3UERA 4FLOA 3UZWA 3PZUA 3LZ3A 1I1WA 2IW0A 4ZQNA 3TJIA 3M07A 1VR6A 3G1YA 3MVTA 2ZRZA 4JOMA 3PZ9A 3DYMA 1B3ZA 1KTCA 3P62A 4OV4A 2Z2UA 1NVMA 2YZ5A 2FGBA 3TV8A 5CLWA 3WLNA 1PCWA 5TNVA 3SGZA 4MGGA 1TJPA 4JR5A 1C92A 4CD7A 1XRVA 3P7YA 3QM3A 1KLYA 4IT1A 5U7SA 4AZHA 3GFXA 3UJFA 2CLOA 5A2AA 3QV8A 1V6WA 2QW5A 3KBNA 2NW0A 1SQ7A 2J78A 1R3QA 4OBTA 1TZZA 4KCWA 5G2WA 2NT0A 2QCEA 1Q6DA 1WXJA 3N18A 1SZNA 1K6WA 2PTYA 4ORIA 1N2VA 3A9IA 2I56A 3AQUA 3U2CA 4PUWA 3OGSA 2Y0FA 1JUEA 1EBGA 2OKOA 4LRSA 4JL1A 3SRHA 4F9JA 1GOXA 1FHUA 1C91A 1W1IE 1BKSA 3BOFA 4Q4SA 1WDDA 4U28A 5F2LA 1S2CA 1ZGDA 1C8QA 4KEMA 4IX0A 3M0KA 3FVMA 2YBUA 1LQ2A 1P6CA 1PTGA 2F38A 3TCEA 4ICNA 2YA0A 1L6SA 3RXZA 1J79A 2ISSA 1KGXA 2I1OA 4PRRA 3TYZA 3I4EA 1R46A 3KL5A 3RF9A 4F48A 1TIWA 1VB9A 3B8DA 1SZEA 3AI0A 4IL2A 3SQLA 2Y4SA 2VR5A 2XFRA 1LWJA 4DUWA 5A2BA 3ZLGA 2G5WA 5LXXA 3N13A 1VGAA 4OFCA 4C1LA 1GQLA 1FKWA 2A0NA 1E6RA 3SCOA 3B0YA 2TRSA 2Y7DA 4Q8WA 2A3CA 3FLUA 2CCRA 3FDGA 4WIWA 3ITTA 2OFJA 1CZ1A 2IXUA 3COTA 3UA4A 4FNQA 2RDXA 4XO6A 4QITA 4UQDA 3N9RA 1K9EA 1E1CB 2Z1WA 3ITLA 4ES4A 3AHZA 3CMGA 3LTYA 4UFJA 4ERAA 4PMYA 4ADSA 5J5DA 2PWUA 3O15A 1VC4A 3PJTA 1FCBA 1VS1A 4JTHA 4B90A 2XU2A 1DIKA 1N7KA 2ZE3A 1V6YA 4G7EA 4HPNA 3O6AA 4IQEA 5HDRA 2EJAA 2QCDA 4KWSA 3VFLA 1LLOA 1B57A 2IKJA 1YLVA 3DI1A 5AYZA 1XICA 3Q4DA 4I7WA 3ANUA 2X41A 1QNRA 4O12A 1I8JA 4Y8FA 4M1BA 4UMCA 1DJZA 1ISZA 3TU9A 3U57A 1VYSX 3WLTA 4KW2A 4UFLA 3WKZA 2GOUA 1V02E 3S2NA 3IJLA 3VOGA 3AWOA 1BD0A 4TQTA 3NQBA 2PSNA 2IQ0A 2W3ZA 1VJZA 3KRUA 3PNUA 4KIEA 3W24A 7XIMA 2OLHA 4DJFD 4ZTYA 3WENA 4A6GA 3H21A 1TV2A 3LCGA 3R1ZA 2XVLA 4J27A 4YTQA 1PE1A 2PDBA 7TIMA 3GD6A 3BJSA 4P7NA 5KSWA 1VF8A 2BHZA 3ICJA 3DDMA 3H12A 1W1TA 4XISA 1F74A 1OFEA 3PZOA 1R38A 4UNKA 3U2EA 5LA0A 3B8VA 5D2WA 5XIMA 1PHWA 1GHSA 1NSJA 3WLIA 2RGMA 4H9MA 1XBXA 4JYDA 4BQ4A 3IVSA 3L2LA 2PA6A 3H2EA 4CCDA 3BICA 1WYIA 4GI4A 1BXNA 1G1YA 4R7JA 4Z1AA 3LXAA 3UR2A 3WMCA 4GXWA 4FX7A 1KM5A 1H49A 1VRDA 4OECA 1EC8A 3BWWA 5AZ0A 4BS0A 1PXGA 5FJOA 4NHVA 4MY1A 1E9LA 1JPIA 2JQXA 3U9IA 2WAGA 4HNVA 4AC1X 2AL2A 3VDHA 4DYJA 2VP8A 1XPYA 3WF2A 4R34A 4GYKA 5FEZA 3RAOA 3Q45A 5CSRA 4QG8A 1ICQA 2Z1VA 3MU7A 3PFRA 4GINA 2CZFA 3SCTA 4AD5A 4JBRA 3PTQA 1JI1A 2OT0A 3BGGA 2CKRA 3SGGA 3GSMA 1YBQB 5DEZA 5BRPA 5LIYX 2CLHA 2CZDA 3WQPA 2VZVA 1N82A 3GNOA 4PMRA 1JNDA 4LVBA 4IZGA 7TAAA 2QPSA 2ZRUA 3VGGA 4TUFA 4BCEA 3M16A 2C15A 4IPPA 4C6QA 1AVAA 3M7SA 4JQ2A 5CZTA 4ATDA 3NM1A 1E55A 2GUUA 1FDZA 3N2XA 3ONBA 4HCLA 1US3A 7A3HA 3IIVA 4IIEA 4UC5A 3AAMA 3EKLA 1VEOA 5AECA 4AC7C 2J8GA 4BZYA 1WB0A 4N4QA 3P14A 1AQMA 4PMVA 2CETA 2AAAA 1ZS2A 2W0UA 2VRQA 3J7HA 2X7VA 3OZMA 3QY6A 4E2BA 1LG1A 1RQBA 3CJPA 2J79A 4C91A 2WCGA 1MMFA 4DJDC 3N14A 3VK5A 3ITXA 1KB3A 1HGWA 5LHFA 1ME7A 1MEWA 4ZENA 3T78A 4F2TA 4B2DD 3W7NA 3R5EA 3EWZA 2HV5A 4I90A 4DXKA 1FOBA 1NOFA 1EJUC 1MQPA 3V7PA 1ITCA 4H9ZA 3CV2A 1OYCA 3KRZA 3BJTA 2G41A 4IFRA 3BLIA 3GVGA 4GYFA 4HPJA 1LBFA 4I6KA 1XLMA 1J8VA 4KGLA 3M5XA 1MQQA 1C7SA 3WLOA 1MUMA 3ABSA 2XH2A 4ZMGA 1OBAA 2CW6A 1LLZA 2XN0A 4TX6A 1OK6A 3EB2A 3M41A 3LV5A 3F03K 5C9UA 1EWEA 1W8GA 2PWDA 3WDQA 4HK6A 2YDSA 3GVQA 3PZMA 4J2MA 2QCFA 3LRLA 3OVGA 2OODA 3SY8A 1NM9A 3U48A 3EEGA 1UJQA 3S5SA 3LXBA 1AL7A 2E0PA 3IPWA 5A2CA 5I3FA 2DIEA 1R87A 1FHDA 3SGUA 4ZE4A 2Y7FA 4D6IA 3MQTA 4P7OA 1BVWA 3C0JA 1WUFA 3K5XA 1KGUA 1TWZA 3U4FA 3W2KA 4RNFA 1UH2A 2PFHA 2OQYA 4N9DA 3O0KA 4PEKA 1KTBA 1V0KA 3XIMA 1LT7A 2Z2BA 4O19A 3OGVA 4Q3MA 4J40A 3KRSA 3PS7A 4MB3A 5AC8A 3PWGA 3I3BA 3SO7A 4Y90A 1NWSA 3GDMA 5CPMA 2FFIA 4DZ5A 3BCFA 4ATLA 4PTXA 4Q4PA 3STPA 3IRSA 1OIFA 4HPHA 5IXEA 2JKPA 4GE8A 2O7SA 3RG6A 1AUSL 3ELFA 4UBPC 5FEWA 2Y1HA 3ZVHB 4CQCA 4AHPA 1CLKA 4I6VA 4HCDA 3URBA 5HPCA 2E25A 4QROA 1E0VA 3PTMA 4C65A 3RLHA 1EBHA 4P7LA 3K13A 1TUXA 2BVTA 4QJ5B 1FP9A 3ATZA 1IYXA 1IXPA 3II1A 2A3AA 4O8RA 4QJ3B 3T0DA 2VQUA 1EX5A 3WCZA 5LIXX 4IFOA 3TIMA 4ZODA 3D5HA 1TE1A 3ISIX 1FWTA 1XSKA 1R0MA 3GH5A 2QVNA 3EWCA 3TC7A 3PANA 3VOCA 5K9XA 4K7VA 1UP0A 5HNUA 1ODUA 3NQCA 4MNJA 4H2CA 4AISA 4PCPA 2YX0A 3DECA 1EUNA 3PZIA 2Z6IA 2YIHA 1KRBC 4Z17A 5DX7A 3CT2A 4GIYA 4EP8C 4N02A 4WUIA 5EMYA 2FDSA 3W3OA 5A69A 4GNKB 2BX7A 3LGDA 3GVVA 1XDMA 3S47A 4C6NA 1LZOA 3OBAA 2F6KA 3RJXA 3U3HA 4BHYA 5REQB 3ENLA 4MMWA 4RNJA 2VGBA 1OGBA 2PDJA 3AHTA 2FH8A 3UETA 1EIXA 3DCPA 3VD3A 2DZUA 3ITYA 1SW7A 4XD4A 3L0KA 2HTMA 1MW2A 1UOKA 2DH3A 4I9MA 3FNDA 1OSEA 1X6UA 4Y9AA 3CASA 4BI7A 2OQHA 5AC6A 1DP0A 2E5DA 2GQAA 2GVLA 3MSYA 8RUCA 1ELSA 2WO5A 5D2VA 4DM2A 2DZWA 4O53A 1JQXA 1XRSA 3CPUA 1LRTA 2HE5A 1Q6GA 2OOFA 3EX1A 1RPXA 1JVNA 2X7WA 1SO5A 1IT0A 3R0UA 3WUBA 5G2HA 3C8FA 2YBVA 2GL5A 3E12A 3CS2A 3PB0A 5CPQA 1UUQA 2VC6A 1MFVA 3WDRA 3WD3A 4NKCA 3O8AA 4NRRA 5HAOA 4NJIA 4L4PA 1DJGA 2WKGA 1Z9AA 3S3GA 1C90A 3LN3A 1G7VA 1EO5A 5HNRA 1VPXA 2QR6A 3UG8A 4BF7A 3L67A 1ICSA 4H4IA 4MB5A 4WSHA 2R1LA 3MWAA 3PPGA 3F2DA 4PL2A 2FZNA 4ZTXA 2PDFA 3SR7A 5BMWA 4R3UA 5LKYA 4J1OA 5H8MA 1E3ZA 2QAPA 2VEFA 4PBGA 3GXNA 1RH9A 5ECUA 1SJAA 1EX1A 1CCWB 4Q8NA 1POJA 2A7RA 3ZSTA 2VTFA 4L65A 5BOOA 3PY2A 1NWUA 1S2VA 4HN4A 4I9TA 2WJFA 4J3VA 1XIGA 4JHZA 2NQ9A 4L56A 3UXAA 3PJUA 1JDDA 2XWDA 3S46A 2KZHA 1EUAA 2QJJA 3M0MA 4J3TA 2C79A 3QVQA 3JS3A 3EOLA 1A80A 1Q65A 3W1XA 3VZZA 4DBSA 1EP3A 1Y5XA 1OGGA 5LNUA 2ALRA 1GORA 3K8LA 3I6RA 1V0LA 4D72A 5E70A 2WV8A 5EGRA 4YPJA 4FEZA 5T9BG 3WDJA 4WXZA 3SN0A 2WSPA 3JZUA 3EAUA 3OP2A 3WQ5A 1UC4A 2QV5A 1GKQA 5DY2A 4BWLC 3DKLA 4W84A 2DT0A 1U5VA 1XF0A 4GX9A 3KBWA 2G97A 3VIOA 5D9NA 3C61A 2UY2A 3TC3A 3WELA 3T08A 4W7VA 1D8WA 5HJXA 1QNPA 4OE7A 1XL9A 2PRHA 4X0NA 1VIWA 3R0KA 4JYFA 1S5TA 4JFUA 4UR7A 3LTPA 4QBXA 2QQ6A 4XD3A 3WF1A 3D0CA 2KAUC 1F07A 3PULA 3UBPC 3NDYA 1Y0EA 5AYBA 3O2LA 3EMQA 5GQBA 4UR8A 3ZFHA 3SADA 2V67A 2ZC8A 4PUEA 1YMYA 1CX9A 2CEQA 3O6CA 4I5XA 2F7FA 1BG4A 4PMOA 3KOFA 1XXXA 3UWUA 2D69A 2OU4A 4DJEC 3UR8A 3KTXA 1QPKA 3RHGA 4LB4A 3FK4A 1XC6A 1UUMA 4OZOA 2QUMA 1VP5A 1UR8A 1OFDA 3B8WA 3BANA 4EF9A 3I6TA 4A22A 3SBFA 4ZGYA 3I65A 4IIGA 2XINA 3PHAA 1I2RA 1O5KA 2YGYA 3BO9A 2JGQA 2WPGA 2Q09A 2QIIA 4N9BA 4G6CA 3QMSA 1A5LC 1EL3A 3DGRA 1IGSA 2C1GA 1IEWA 3MHGA 4P7QA 4FLSA 3W27A 4H9YA 3W7CA 1EJXC 5IHRA 2E6YA 3V36A 1IXQA 4QAIA 2ONEA 1K7XA 4K8HA 3N1AA 5ABEA 5E9XA 3A3WA 1EEXA 3TWAA 2GDVA 1HKWA 1RBLA 4IJRA 5LA2A 4A3UA 1BWLA 2PUZA 3WO8A 5CZ0A 4MWAB 3NGJA 3LLXA 3B9DA 2ZA3A 2QDDA 1VBUA 3W88A 2VFHA 3HPXA 5LIWX 1G69A 1XFCA 5U4NA 2QCNA 4QDPA 3U2OA 4OJYA 1S39A 3T0BA 3AROA 4S3KA 5C2GA 2D24A 3H2FA 2WC4A 3H4XA 1UMYA 3RM9A 2H9AA 3LTSA 2E09A 4A05A 1J6OA 5ABHA 2E8YA 2EPHA 3OHMB 1VFOA 3BLFA 2XVNA 1H7RA 1W1YA 2QEZA 1S2TA 1A3WA 1VFSA 1JYVA 1Q85A 3GRIA 4CU8A 4DNMA 3THAA 1H09A 3UPMA 5JMUA 3VGEA 3OYZA 1LORA 3QKZA 1MRQA 4P8VA 1W1A1 1YQ2A 4YU1A 3MMUA 4L9XA 5FJPA 5HWNA 3U7VA 1H1YA 1C8VA 1QPOA 3QPZA 1NWTA 2X42A 2QDGA 2DP3A 2OSXA 3DAQA 3UU0A 4NI8A 5IFPA 5EMMA 1VKFA 1FQ0A 1NAL1 5JH1A 1OCQA 3TOPA 2POZA 1PIGA 1QXLA 4OTKA 1B4EA 5LGZA 1Q13A 1ZJHA 2CU0A 3O6YX 4DAIA 3NQGA 4M56A 1NQ6A 2H3BA 4DJDA 4M5PA 3MZNA 3KWXA 4DNHA 1XQLA 3GXMA 4HNNA 3ANYA 1QPNA 3W6MA 1Q6CA 2PWVA 1UR1A 3EYPA 5DLCA 1IV8A 5AHNA 1UHVA 5I3KA 3MMTA 1DQUA 3MBFA 1JEZA 3HGOA 1H63A 3G8RA 4B91A 1OX6A 1VPQA 3T6CA 1BGAA 2J7BA 4TX9A 2BOFX 4X60A 2PZNA 1IIHA 3BL3A 1TV4A 3KBJA 4B3KA 2I16A 3UWYA 4FX8A 3SN4A 1PJ9A 4XBSA 3V35A 1S3HA 3O0FA 4W85A 2OLSA 1H41A 4MWAE 4UCGA 4EWJA 1J6PA 4IIFA 1U2YA 4QGCA 2IKGA 4YXGA 1C9WA 2BXYA 3IRDA 1TPWA 4C6KA 3EOSA 2IPJA 2W61A 1WZMA 3P5ZA 1QNQA 3W86A 5D2TA 3LYEA 2WSQA 1VD6A 4P61A 2NWRA 4L6HA 2C0HA 4NZFA 3SJNA 4HA4A 2Q3OA 4PC8A 1EEPA 5CSSA 2NV1A 1M65A 3NAVA 2BDQA 2XZ9A 4RDZA 1Z7AA 1V4YA 2GPTA 5BZAA 3QV9A 5I02A 1FWIC 1TX0A 1LL7A 3L4UA 4J3UA 2Y5EA 2EHHA 2BLEA 4HYRA 3W26A 2X40A 3QH2A 2UY5A 5KITA 2BVYA 3VM5A 3M64A 4JGDA 1GTHA 5CBIA 4G1NA 4G7EB 3P84A 4GGBA 2DT1A 2YW3A 3DGBA 5D05A 5BRQA 3WUGA 4CUCA 1UR9A 4ORMA 1VHCA 1XBVA 3D46A 3A3XA 2ZWYA 3S5NA 1JDFA 1VBHA 4W7UA 2QCDB 1EO7A 1WPCA 3AIQA 4B16A 2GQ9A 2GWNA 1XLDA 2BMBA 4FSAA 3G3MA 3OVRA 3TYCA 1XYMA 1NH6A 2UWFA 4L4OA 4KESA 3NSNA 1FX6A 1XISA 2GGIA 2YXXA 4R9XA 5D9OA 4PCSA 2OMAA 1F8MA 1OFOA 2WWCA 4O54A 3G3DA 3C2FA 2E77A 3V16A 2F9RA 1UYQA 1KXQA 1YE6A 4KS0A 3I7QA 5FJUA 3HM7A 2G8ZA 3VCRA 2GVEA 1BSIA 4QS5A 3WH5A 1O1HA 4U10A 3T40A 5F4SA 2GUBA 1OQFA 3ITOA 5M03A 2XDFA 3BQ6A 3VGBA 4F40A 4Y8EA 1EXBA 1YTKA 3GXDA 3TYBA 6PTDA 3LCHA 3W7EA 2UZ9A 1ZBCA 3LDVA 4CNTA 4LCRA 1HW6A 2D2JA 2YOCA 1W8SA 1W1PA 4RNHA 1JZ5A 2TSYA 3QR0A 1EP2A 3GM8A 1XKJA 5EL1A 1FWSA 1H1NA 3NZRA 1XC4A 3B0VC 5FF0A 3N29A 2YFOA 1O68A 1R9ZA 2V5JA 1J2WA 1DWJM 3WLSA 3D3AA 3VMNA 4OKDA 1GG1A 2BSLA 4XAYA 4PUUA 4WX2A 1RXOB 1E0UA 2J7FA 1D3HA 3HGSA 4E38A 5LIKX 1RA0A 4OUEA 3LCFA 4JFTA 1QHPA 1W3LA 3VNDA 3W38A 4RL3A 1FY6A 4JTAA 1ONWA 3AHXA 5J8LA 4QFUA 5BCAA 1UA3A 2PP0A 1GVYA 3W72A 2VM8A 3NXFA 2I5IA 4Q8MA 4R9OA 3VD7A 1UZHA 1CWYA 3DESA 2XG9A 4I9AA 4ROQA 2ATMA 2WMFA 4EE9A 4JTIA 2AL2B 1J9YA 3KZSA 3FSUA 1FKXA 3BZJA 1BFNA 4NVTA 4QSHA 4FR1A 1RA5A 3HG4A 1WZAA 4W89A 1FH8A 2YPIA 1TR9A 4IJCA 4TR9A 3ARVA 2DV0A 5FAJA 3KCLA 3L4VA 2Y70A 3JRKA 4GOAA 1HQTA 2YYTA 1ISXA 1D3CA 2WVTA 1GQKA 3EKGA 4DWSA 1VQTA 1YXDA 5G1TA 3BZGA 2RGLA 3R25A 2XGBA 3NNTA 3TN5A 2F6XA 2ZUVA 3MKKA 2Q02A 3FA5A 3HN3A 2Z1BA 4E8GA 1W9UA 1TB3A 1ZAHA 1A5OC 1TV5A 4HN8A 2J27A 1P7TA 1XDLA 2ZA1A 1XLLA 3UCDA 4JCLA 4EXBA 5FKYA 1XH2A 3KDNA 1W3KA 2NSOA 5T9CE 1CLXA 1IQ8A 4XVEA 3T44A 4J3WA 1C9DA 4YS1A 3MO7A 3DH7A 3WMSA 5C70A 1IZKA 1QJWA 4IIDA 2EEXA 3PTKA 1EKOA 4HU3A 4PEEA 3L7RA 4PMXA 4K37A 2VQTA 4UTTC 4NXSA 1ZL1A 4LVGA 2E9MA 5D03A 1PKNA 4AVFA 1RJPA 1SSDA 1IT7A 3AC0A 1W9VA 1JDEA 4L6OA 4YIWA 3URQA 3B8SA 4PTNA 1W1B1 2H8XA 4M7SA 2YA1A 1A0EA 4R88A 5A6BD 1OZQA 1NOUA 4HBKA 3GO2A 3SIZA 3TK7A 2OSYA 3K1DA 4ADTA 2B31A 3WBEA 1ZP4A 1R2TA 3SCUA 1QR7A 1S5WA 3NM3A 4AEEA 1TUFA 2JF6A 4IP7A 1YPXA 1SJBA 4IIBA 4XZMX 5A8OA 3WFAA 3V75A 3LBMA 5XIAA 4MFEA 1SGJA 3WDHA 1UPMB 4W88A 4ZA0A 2HS8A 4KBXA 1V6UA 8XIAA 4YL2A 1I2PA 4GBDA 3V3WA 3XISA 3VGFA 2WC7A 5I3HA 2W79A 7ENLA 1NOWA 1MYRA 5FJJA 3ZSSA 2DIJA 4Z1CA 4C6LA 3MKCA 1CGUA 3TSMA 4K39A 1OD8A 5I3JA 5AC4A 3F4DA 3B9AA 3MC5A 2IKIA 5K7JA 1WDSA 3AXXA 1I9CB 2X0SA 3UXKA 1NTHA 4O10A 4HVXA 3L65A 5MKGB 5EKYA 1VRXA 1Y65A 4X63A 1D7KA 4I5RA 5ABGA 3NQFA 1N8IA 3ZLHA 4PCTA 1XIEA 3ZM8A 1U33A 3EPMA 2VMFA 4AMCA 1KR1A 4OGZA 1D3GA 1O94A 3WMLA 4TVCA 4EKJA 2HK1A 4IHCA 1AH3A 4V33A 3GW3A 5HATA 4HNCA 4BI6A 1A3HA 3M0YA 4W7WA 1XLHA 4ECLA 3MUAA 2P8BA 1UCWA 2CLKA 3CZJA 3OIXA 1KBLA 3F5LA 4ZOAA 4RXFA 4JTTA 3NUKA 1NFBA 4DX3A 3U5YA 3W70A 3OO2A 1K8YA 3RO8A 3TYDA 4ZQCA 2WC3A 4KEZA 3WK3A 3GK0A 1EJVC 4A3QA 4KIRA 2R9RA 2P5NA 4GUIA 3GE7A 4AHOA 3MI2A 4Q8VA 1XGDA 3SURA 2MNRA 4PCFA 2OXNA 1NDYA 2VEKA 1BXBA 5D32A 1S46A 3S9IA 4HA1A 2VOTA 3P2VA 3GR7A 1QOPA 4V1XA 1YPFA 1PX8A 3IS4A 4LNYA 3GDLA 2OG9A 4LALA 1XS2A 3AXMA 4HK7A 3AO0A 4CNSA 4O1CA 3KL0A 2P0IA 2Z1KA 3WQDA 3VNLA 2FFCA 4H9TA 2GJNA 5HOSA 3EKZA 3HQ1A 3HBLA 3MV11 1U22A 1QT1A 2OLAA 4LF2A 2TODA 2XFWA 2O7QA 4UFMA 4H8VA 2PCEA 4RXGA 2I9UA 2E9LA 4PBEA 3HGJA 3ABOA 3TQKA 1VYRA 2GK1B 2VC9A 1UBPC 1JI2A 1G4EA 3B8TA 1DWAM 2DDXA 2WK2A 2GGHA 4NL1A 2QT3A 4RDYA 2NSXA 4C6FA 4DBWA 4F66A 5I23A 3GNPA 1XCXA 3LY0A 4F4RA 4NY2A 1R7OA 4GYJA 3C56A 3WLKX 2JEPA 3W2MA 3BH4A 1REQA 1RP8A 3W1LA 4HIBA 2XIBA 1EGVA 3ZWTA 1NQKA 3CHEA 3R12A 1H7OA 3MDWA 1YADA 4Z2LA 1L2QA 3AIRA 1RAKA 1DHKA 3NZQA 4Z08A 3H4GA 3WLJA 2YR1A 3FJ4A 2QPUA 2J4GA 3MW7A 1NY1A 1JGIA 4V15A 3BCDA 3MANA 2VC7A 1BG9A 4S3JA 3T2QA 3PSVA 1A5MC 4GISA 2EAWA 3AMLA 4A29A 4NAEB 3E0VA 3KOWA 3IARA 5HINA 2AKZA 3EX2A 3G18A 3S6TA 5ENLA 3GG7A 2ASHA 3OG3A 4B5VA 2CERA 2H3DA 3OODA 4LAUA 1RSCA 1NWRA 3AYTA 3H54A 3I6EA 1TQXA 2R1KA 4XBKA 1X39A 3VKDA 2PEVA 1Q2RA 2AAMA 3K8MA 3W1MA 5IM51 1JD9A 2HEJA 1E5JA 2D0FA 2Z0IA 1CXFA 4BI5A 3AYSA 4PH6A 1RLCL 4URIA 4I9JA 2J77A 3S4TA 3W1AA 3N25A 1R85A 2W62A 4A4AA 2ZFAA 1ADDA 1E4MM 3RK8A 2J6XA 3B0UX 3P81A 3BW4A 3TXVA 4LC6A 3KOXA 4GABA 2OTDA 4IL0A 4HYVA 2A79A 1ZCOA 1QK0A 4EPBC 1QNOA 3JU2A 3B0XA 2CLIA 1CGWA 4EF8A 3GLCA 1IXNA 1MDRA 1W5PA 2ZDSA 2PRLA 4Y9NA 5E1QA 1FH7A 2INEA 1IEXA 3QHMA 4L80A 3BURA 2OEMA 4XAPA 1UWIA 1BLIA 2YB4A 1B0IA 3L4XA 4LWWA 2GDQA 8XIMA 3RX2A 2V2HA 4C60A 3UCQA 1EDQA 2X05A 1TCMA 3LNMA 1EIBA 3EOOA 3JR2A 4BY3A 1HGYA 1YX1A 4GUHA 2QAFA 2X1SA 4LANA 1JZ8A 3S1XA 2BTMA 1E1FA 1GQIA 4NF7A 3KVLA 2FLIA 4WEVX 4XAGA 1MEHA 1XLGA 1E56A 4XB3A 2P76A 5A6AA 1MDLA 2ISFA 1E6ZA 2ISWA 4O50A 1WDWA 2J9YA 4PUMA 4Q8OA 3WH6A 2HXTA 2PAJA 3IVTA 3Q2DA 4YCPA 1OY0A 2VNCA 1B3XA 2WMGA 1TPFA 3GB6A 3EEZA 3WJWA 3AYRA 4M0XA 2QV4A 1ZFJA 4DO4A 1NELA 3PG8A 1TPB1 2X16A 3QQWA 2W92A 4MHBA 3M0ZA 4CN6A 4IICA 4ZQPA 1Q4NX 3UGRA 1E6QM 4Q7IA 3AJ7A 4JX6A 4GZEA 2OOGA 2VDIA 2D2OA 2DZXA 3STGA 3NZGA 4JL2A 3C0SA 1V3KA 2CBIA 4C5ZA 5EMLA 3BAXA 2NUXA 4OBSA 4KWOA 3GNRA 1WDPA 4LUYA 3T05A 3THDA 3UZXA 2XIJA 4LQ1A 5DMLA 4NNCA 2WZTA 1W32A 1B54A 3GU2A 3VX1A 5D09A 3VD4A 4RV8A 2BOGX 3WMBA 2HPMA 4LU0A 4WOQA 2TPSA 1NU5A 2FZ9A 2V5CA 3MMWA 1K8XA 4US5A 5FACA 4XQ6A 4EWND 3W83A 4EAMA 1PAMA 1V8EA 1TJ0A 3XINA 1LRNA 4GA8A 1HJSA 1IWBA 5BOFA 4FNTA 3VUPA 1SVDA 3M0VA 4QG9A 3K4AA 5M5DA 3LBOA 4IMEA 3QV6A 3BAKA 3S1UA 5CLTA 3H8AA 1RY0A 3TXZA 3VDCA 3WG6A 1GPWA 3TW6A 2ADAA 2HNEA 3PUOA 5LNWA 4PMNA 1W17A 4O1FA 1TRIA 5HA7A 3GG8A 3RPDA 1KXHA 2JF7A 3I10A 3WQ8A 4OVXA 2FB2A 4GJJA 3KWSA 2RDWA 3CL7A 1BHGA 3P8IA 2RJHA 5CPNA 1XLCA 2QXWA 1XYAA 5K4XA 4GGHA 5F2GA 2H6RA 3E38A 3LQLA 4MWAC 5E6ZA 5D30A 1NIUA 4I7UA 1YNPA 3L5LA 3Q65A 3A4XA 1JZ2A 3GR8A 3W75A 3VFCA 4ZFCA 3LD5A 3LHZA 3TFCA 5I24A 3P0XA 1V5XA 1XUZA 1DWIM 4FR6A 4IMDA 1Q6LA 4NJKA 1FHVA 3BV4A 4KCTA 4NZ5A 4HNUA 3HG5A 2A4AA 1UD2A 5CSUA 3O3RA 1PSCA 1XLBA 4AYGA 3DHUA 1EHNA 1FWRA 3M7WA 3NR0A 5C9WA 4P2VA 5A6KA 2XH4A 5D4YA 4KGJA 1YE4A 1P43A 1ZRQA 4HMDA 1TPC1 1ICPA 2DU2A 1SMAA 2Q71A 2R6OA 3OBKA 2V38A 5MHBA 3G0XA 3P80A 4WOZA 4QNWA 4FNSA 5E0KA 2Z26A 5FL1A 3I7RA 4F2BA 2WOQA 1RD6A 3U7BA 3EOEA 4DBDA 2NQLA 1E43A 3OU8A 3EDJA 3LNPA 1JZ7A 2OX4A 5DBTA 5DT5A 2X1UA 1GK8A 2CXEA 5FJTA 2PD5A 2YCIX 2FPTA 3LMZA 4WSJA 3N9KA 3VKJA 4QE4A 1EC9A 1UWRA 4GQ0A 1OYAA 2WHLA 1ZJAA 2P3EA 2VFFA 3K8KA 2CBJA 1Y5VA 3HJZA 3SUTA 4QM1A 3R13A 3EA1A 2REQA 2QVHA 4I7VA 3R4IA 1O5QA 1IEQA 4YTSA 1V3JA 2AGTA 1I4NA 1J2BA 2Z4GA 1ENUA 1SUXA 1XINA 1GNXA 4L9YA 1W37A 4W86A 4JHOA 5BWFA 1R2SA 1VH7A 1DIOA 1EF2A 2QS8A 2XHYA 4LS1A 1M7XA 1UWTA 1W91A 1VBRA 2VX5A 1CECA 4GZIA 3TDFA 3CAQA 4D6EA 3A13A 3QSRA 4H19A 5JVLA 1PCKA 4LT9A 1QOQA 4MTVA 2MANA 2TMDA 4DUVA 4XUYA 3PWAA 1ZAJA 3AFBA 3MO4A 2VGIA 4ZEPA 2BZNA 3DKJA 4WDUA 1G4SA 1L6GA 1Z69A 4E3VA 4O17A 4AFYA 2WB5A 3BAIA 3THCA 1J0ZA 3EGJA 3T2PA 5C7HA 2OYLA 1GG0A 4A8LA 1O66A 4XSLA 2VURA 1ONXA 4BF9A 4K3ZA 3SCQA 1IF2A 2PDHA 3S9ZA 2XFFA 4ZQRA 1JPMA 3EDDA 2O9OA 5A3HA 1OG6A 4JXCA 4U33A 3B9NA 2W6RA 5H2ZA 1KNWA 4ZOBA 3E2RA 3BLEA 4LUSB 3WJSA 1HO4A 1KW1A 4CKQA 5HULA 4ZSUA 4MDOA 3U6WA 1WQ5A 1PUDA 2J7GA 3UWWA 5CAHA 2DSKA 3LLFA 4PN2A 1B3YA 3ZMRA 4B4FA 3MS8A 3VX0A 1J5SA 1T96A 3IUHA 3A4AA 2Y8UA 3N2CA 4GQRA 3WY1A 3M46A 4JIIX 2I7GA 4ZO6A 4FHAA 1OCJA 1XBYA 3IJ8A 3N6QA 3WQFA 3CU2A 3M0XA 3KXQA 4AXKA 1V7YA 1EYWA 3OOQA 4MUZA 3WDIA 4NILA 3MV01 4FF5A 2JFEX 4BA0A 1UW9A 3CNYA 4K36A 4MLJA 4DLFA 4N6FA 1Y5WA 2W9MA 1CNVA 2C91A 3SY5A 3PBVA 1UZ4A 2GJXA 3BQ5A 4WK9A 1EH9A 4MF4A 2UY3A 1WA3A 2B7OA 1IEIA 2OO0A 2WMHA 2BNJA 3W6YA 3MUY1 4ICMA 2BB0A 3KBMA 3M0LA 1EZ2A 2V3DA 4GPNA 1EJRC 4JCMA 2OGYA 5F7UA 4S3BA 8A3HA 1CB7B 2JKAA 1FCUA 3ANVA 3SW6A 1GWJA 3OLGA 4MAVA 1MZHA 4KRZA 4K8EA 5TD4A 2QJIA 2E6FA 3RU6A 1CEOA 3WN6A 1Q3NA 1BQCA 4RLIA 4XZHA 1JRBA 3R11A 4PUDA 3LQGA 2HBXA 1QATA 1THFD 4H7VA 3GDRA 1VBGA 2DT2A 3NQ2A 4IFKA 2NV2A 3W84A 4EAYA 1WKDA 3L5MA 5DO8A 4XKMA 4A3HA 1DQWA 3RCYA 1GUVA 4UTLA 5AVHA 4OV9A 4DEFA 4Q4KA 5D2XA 1ADSA 2EKCA 4JIQA 2GUYA 1W3HA 2AQVA 1WX0A 3GC2A 3LX9A 2C6QA 4UZSA 3PBGA 3ZZ1A 5REQA 1WKYA 3EDEA 1O60A 1LYXA 3CZLA 1TZ7A 3WH8A 3OB8A 3ZYZA 1RV8A 4HOXA 1UROA 1KLZA 3CAWA 1UIOA 2WNQA 1E6XM 4PZVA 4IUOA 3OPSA 2ZZ7A 3G1HA 5E0FA 1TWWA 3HGRA 2Z6JA 2IS7A 2DQWA 2RHGA 1WKFA 4YMZA 3VCCA 2A1YA 5FIPA 4CNUA 4QEHA 4AY7A 2F8QA 4FMVA 3TQVA 2A3HA 5D02A 1F3TA 1JL8A 3ZR4A 4M6UA 2NQHA 1ZSXA 4MLRA 1IIGA 2O56A 3W00A 4JD4A 2YLLA 3E9AA 3WEZA 1YEYA 2NQJA 1W5NA 1K03A 4PRWA 3UFYA 1SU5A 1SO6A 4JQ4A 3LLDA 2PC8A 2ZX7A 1CGVA 4UQBA 4CQ9A 3QHNA 2ESCA 7CGTA 5E5CA 3SCRA 1A49A 2GGJA 5G1YA 5KZMA 3A23A 1ZNNA 4LV9A 1GEHA 4LUTA 2D0HA 3ABZA 4KRUA 3AS3A 4NI3A 2CHNA 3S2CA 1KXVA 4LAOA 4MKVA 2XM2A 4UB9A 1OM0A 1XD1A 3RCMA 2V9DA 1FUYA 4L1WA 1CDGA 1KFEA 3VABA 4J3ZA 1KR0A 1J93A 4XV0A 5I3GA 2EPNA 3IJ6A 4GIRA 2RUSA 3BLPX 4O16A 5LSMA 3WF0A 4E5TA 3TC6A 2G3FA 2VEPA 1QMLA 2WZMA 2FJUB 3FYPA 1PTDA 3PAOA 2ZWZA 4JTGA 4CQBA 4LS0A 5C8BB 4MNMA 3NQEA 3CO4A 2WXDM 1GVSA 4AYSA 1E5NA 1V7AA 1BWKA 4IJBA 3LM7A 3UD6A 1LOQA 2ZXBA 1LWHA 1YYAA 1P0KA 1QI0A 4LY4A 2F6UA 4TVDA 1M68A 2QUTA 2ZRWA 3MHUA 4B5XA 3CQ0A 4KCUA 5BRBA 2QUNA 4Z1BA 2OGJA 3E0FA 4R53A 1YNQA 4GY7A 2CLPA 4NIRA 1G0CA 3RGTA 2CWXA 4IGSA 4LAZA 4DJFA 4LFYA 2ZBTA 1GVOA 1Q6OA 3ARZA 3DUGA 4PA8A 2VDHA 4F9DA 1V3IA 3ARSA 4C6CA 3IJQA 2E40A 5DFAA 2J24A 5CJNA 2PDUA 3TYAA 2IQDA 2PDYA 2V68A 1I0BA 3NO1A 1IWPA 1JG9A 4G56A 2WLYA 4UFHA 2CHRA 3TYEA 2HBVA 3UA3A 1H5YA 3W7IA 4GXPA 1X8CA 2Y88A 3LGGA 3MSRA 2CWNA 4AY1A 2JEQA 1VAHA 4GUJA 4UTHA 4RE4A 3RMEA 3CK5A 2NX9A 3ABXA 3ARUA 3GFZA 3QHOA 4QQ3A 2QMJA 2ACUA 3VIPA 3IIPA 4S3FA 1ML1A 1VCVA 2DT3A 1MO0A 2DUXA 4F8XA 4MNLA 3CUFA 3GTIA 4ZO7A 1UPPA 1KFKA 1FCVA 4JIEA 2Y7GA 1CXLA 3WUEA 5HBFA 1JYNA 1QBAA 1TV7A 1ZTVA 3POHA 4NJGA 3CHFA 4FO4A 2EPLX 3W37A 5KZDA 3APGA 3AHVA 3IV3A 3GXFA 2PDXA 1B3OA 5LXEA 4ILSA 1DWFM 1DPMA 3TLQA 2OWWA 4AH7A 1J0IA 2GSHA 3GR4A 4H01A 3NL6A 1IGWA 3QQ0A 1ZLPA 4HB7A 3GDTA 3NYZA 2PTXA 2IQTA 1PKMA 1JD7A 1PO9A 3RPMA 3CEUA 1ZP3A 1E4NA 4KWVA 4Q4OA 1V0MA 3IJ7A 3AUJA 2PE4A 1KA9F 3UESA 5I5RA 1ZB5A 1RJQA 1WDRA 2QJNA 2VWTA 2R8WA 2HCVA 3K4DA 3CHDA 2CESA 3SIMA 1XPGA 2W67A 3EMCA 1MW3A 4LYPA 4AZCB 4LPCA 3ZT6A 4C6IA 1W5OA 4HOZA 2X1RA 2PDNA 3HJEA 4W8LA 3NPVA 4DBUA 4JKLA 3S2MA 1QNVA 2HZGA 2VD8A 4S39A 3TJ4A 1REQB 2DZBA 3GUGA 2HWGA 1J0YA 4FLRA 4GMEA 3ZS4A 5HXMA 1E9YB 1UR0A 4UR9A 1W3IA 7ODCA 1G94A 2NVAA 1LDCA 2INZA 1GJWA 1GVFA 2BOEX 4B2DA 2J74A 1OWQA 3WD0A 4DYKA 4XZBA 3RX3A 3TJLA 5HJYA 2CBUA 5A94A 1S2WA 1VIZA 3QQ1A 2OWXA 3MP5A 1TVNA 3TH6A 1VEPA 1MXSA 4P8UA 2ZDRA 2NV9A 2CZVA 4Y6GA 1SFSA 3BV7A 2PRMA 2PP3A 4WY0F 1J0KA 4R7WA 5AYIA 5EMUA 4E6MA 2C0AA 4JKMA 4D8ZA 2QIWA 4MPQA 2EXOA 3S5YA 2O9PA 1C93A 4LNCA 2PGEA 2E67A 3CPGA 4H04A 3T0TA 4JQ1A 1BSLA 3KVMA 5F4XA 3W7KA 3QOMA 2FVMA 1XLEA 4MDPA 3LEPA 1GEQA 1K7EA 3TCSA 1DJYA 2DZVA 2Q8LA 1UKPA 3UQNA 4S3EA 3LRMA 2BWGA 3ME3A 1XIBA 2ISVA 4FNPA 4C6PA 3UCCA 2BY0A 2BGNE 4PTDA 1JPKA 1Q6RA 1M9HA 1L6FA 1NDWA 4UMAA 4AEFA 5GNXA 1KCLA 3O9NA 1QO2A 3AIVA 5AHEA 1ADOA 2E6DA 3CHVA 2VHLA 4GYPA 3N34A 2ZTJA 4L1GA 3DIPA 1NFGA 1Q63A 1R3SA 3SCPA 3AISA 3GTHA 1JCLA 4O13A 2DY3A 1UR3M 3TMLA 1H0IA 2ZADA 3VC5A 4LYQA 4LH8A 4MPKA 1OEPA 4NAFB 5JQ9A 2IMRA 1H51A 3OBEA 1W3JA 2CHOA 4S2BA 4H8HA 3R8RA 3PJWA 4INFA 3W7PA 4NJHA 4CEXC 1ZAIA 4HCHA 1MRAA 2GWGA 1LRQA 3GY1A 4LTSA 2Y24A 4R5EA 4QJ4B 4X61A 4WGHA 1CPUA 2ZZ3A 4NNAA 4O4VA 3H2CA 2QZRA 3UWEA 1XGZA 2O4QA 4J9JA 1PYMA 2P50A 4X2PA 4NU7A 3QV7A 1VPYA 5I09A 2VX7A 1LT8A 3UXIA 1VFFA 5ECVA 3SEPA 1F2JA 3VDGA 3HG2A 4O1BA 4DQWA 3C0QA 1ZBVA 2Z7GA 3ERPA 5M1TA 1UH3A 2DIKA 1AD4A 1K7FA 5FJRA 4AAJA 3VGDA 3UJ2A 2WNWA 1HL9A 4YVVA 3SB0A 1L8PA 1W9BM 1RP9A 2VFGA 3T0CA 3RFAA 1XRTA 1LUCA 1FXQA 1LOSA 3MYOA 3E2QA 4F0SA 1KFJA 4B4HA 1A5UA 3FOKA 3T8LA 1TWSA 1NP0A 5CG7A 1UA7A 5CJ5A 7REQB 2ACRA 4U31A 3AIUA 1LBMA 3B40A 2DORA 2IXVA 3H70A 2C19A 4AWTA 9XIAA 2BY3A 4JNMA 2ZICA 1Z48A 3ARRA 4YCOA 3BW3A 1RK6A 3CIWA 1E40A 5TIMA 3CV7A 5KZEA 3VNIA 3V0TA 3TOYA 2VJXA 4H9VA 3M6DA 2VZOA 1FWGC 3PZGA 3KLKA 4ZQOA 3DYOA 3LS9A 4QJ1A 2IUZA 6A3HA 2DQXA 1XIDA 4JTUA 4HSHA 1KWGA 4CNPA 2RJGA 1OB0A 1DXIA 1DOSA 1FWWA 3GNNA 4RNIA 4JX4A 2AL1A 2WVVB 3HV9A 4F0MA 3BSGA 3T42A 4KFOA 3W07A 2HE8A 1HVQA 3DEQA 2P1FA 3PZVA 1W2VA 4LUJA 3C3NA 1D7FA 2WSYA 1A4MA 1B1YA 3NZ1A 4U3CA 1R3VA 4XG1A 3EXTA 3BAJA 3WFZA 3W7HA 2E6AA 3ZXWA 2QCMA 3H2AA 1L6WA 3HOJA 4O0KA 3IIXA 5EFFA 3BAWA 3ABRA 5I3DA 1IEVA 3SI9A 4KH2A 2WPBA 3REQA 2OZ0A 3EX3A 1P48A 1IT8A 3W7RA 4HZ8A 5CG0A 1TTQA 4M82A 3NDZA 1IR1A 2V2CA 1SJCA 3JUGA 2XVPA 3GUWA 4Y2WA 4HQVA 1A5NC 3K46A 3OQEA 2V5DA 1KFWA 1UBSA 1B5TA 4DJED 3UXLA 5F1VA 1XUUA 1M04A 3WBYA 3M0JA 3WQ4A 1HNYA 1LTDA 2O92A 4GY0A 2NT1A 4BK9A 3HB9A 3VZYA 3OZPA 2ACSA 1R8LA 4RJEA 1W9XA 1AD1A 4D8AA 1VLWA 1WO2A 1DVJA 3QY8A 3TQ0A 3GW0A 3PUEA 4Q8PA 2XSXA 4OU1A 4HGXA 3C8NA 5LYRA 1DEDA 2XGIA 4M6PA 1SPQA 1TKKA 3RJYA 2MUCA 2A7PA 4O18A 1VYPX 3EB3A 5D9MA 1Z3NA 4MVAA 1KM6A 1PV8A 3GIYA 6TIMA 4O8AA 4HT3A 4YVXA 5FEXA 1GKPA 4Z0JA 2E68A 1XQKA 4GO9A 1R3YA 4D9PA 1Q5MA 3E3HA 3NQ6A 2QKFA 3L4YA 4CGTA 1A5CA 1ISWA 2DZTA 2YZRA 1AZ1A 1DTUA 3DBPA 4UZUA 3WQ6A 3TJXA 5C6MA 3WIJA 2XVKA 2QCLA 4JN8A 1NJJA 3O7UA 4OWGA 4NT0A 3E74A 4O57A 5I2UA 3VNJA 5I00A 3EMZA 4HTYA 3VD9A 5AHMA 5FAGA 1KCZA 1MUCA 1TTJA 2DVTA 4S23A 2PWEA 3M5ZA 2J13A 4AWSA 2G37A 4PSRA 4E4UA 1DE5A 5CCZA 3WD4A 5HUOA 1QFEA 3L4TA 3CMFA 5CBBA 3DYPA 1M7PA 3W87A 1PZ3A 1BF2A 4WJ8A 2REQB 5FEPA 1HT6A 4DXXA 1M5WA 1PEZA 1CGTA 4MFDA 4LY8A 1V3MA 2ZC1A 3G1AA 2V63A 5ABFA 4PL1A 4K38A 1NDVA 4YTTA 3BG5A 3L4ZA 2V3FA 2Q8XA 4H7ZA 3T81A 3R58A 3NURA 8CGTA 2WVSA 4I8DA 3C52A 4TTGA 3DC8A 1RCXB 1X97A 3UZYA 2IPWA 4FXSA 3N19B 2NUWA 3RILA 3SSZA 1AL8A 1QASA 3WD1A 5CPSA 1WOBA 1VBJA 4F0KA 3I3EA 4N2YA 3EXSA 2C16A 4K6AA 2PU1A 2ANUA 2AQWA 3MUIA 3FHAA 5CAKA 1LOLA 3MBDA 3L2IA 3W7LA 3PB2A 3UNTA 2V30A 3N04A 4AIBA 1KRMA 3N11A 4QDMA 4FP1A 1YDNA 2CBVA 3HQOA 3NQ7A 4YN5A 3WK2A 2O0TA 3LHVA 1DYSA 2VXNA 3FN9A 1GZJA 1ZQ5A 2XH7A 2BGQA 3CB3A 2PP1A 1V79A 1Z6KA 3CC1A 3IV8A 3CQJA 4MZ1A 2W5FA 1VHNA 1PX3A 3LPGA 1OVDA 4D1IA 1PS9A 5MKGA 3R79A 1PL9A 2B7PA 2J75A 3QZEA 4NZCA 3TA9A 3I4KA 3QC0A 2Z1SA 5C9ZA 3CTLA 5AC5A 5E09A 3CO8A 2I17A 4B5UA 5LGXA 3EWYA 4JIPA 3MHFA 1UASA 1I2NA 3BTNA 1TV3A 1JCMP 4XZ9A 3IJDA 3WBXA 1KKOA 4LEQA 3PUGA 2DUZA 4DZIA 2C1HA 2RH9A 3WQVA 1NP2A 1JUBA 3M6YA 3QGAC 3MP4A 4DHGA 1T5AA 1J0JA 1WNOA 3E2VA 4DUXA 2R91A 4TMCA 1ITQA 2PZ0A 2VCBA 3B8UA 4YLWA 2CKSA 4WJXA 1NF7A 5HMSA 2QJHA 2O4MA 3P3BA 1S2UA 3WLRA 5AC7A 2XFYA 2YL8A 4AMAA 3CWNA 4B92A 2EGZA 2FKPA 2HSAA 3W1UA 2GJXB 3W9ZA 5CQ1A 1KCKA 2D23A 3KTSA 4V27A 3IGXA 3KOYA 1T7LA 1VFTA 3FS2A 5CGMA 5CC5A 3PSWA 2ZUNA 3CQKA 4Y7EA 2RAGA 5A8PA 3OVQA 3SRDA 4EXAA 3RCNA 3QTPA 2ZUSA 3HTWA 2DEPA 3KM8A 3GHSA 3PZQA 3SQSA 4WR3A 5AKQA 1JNEA 3QXBA 2D2HA 3DG7A 1F3XA 4GVIA 1H7NA 2VUYA 3AIBA 5EU9A 1ECEA 1BQGA 2E1DA 1LWIA 3F4CA 1KD0A 3CH0A 2CNCA 3KL3A 3TZFA 4IFKB 1UZDA 4O1DA 1YXYA 4JQAA 2VKZG 4E2OA 3OVPA 4RPPA 1BGGA 3IIZA 1J11A 4IM4A 3AICA 3VYLA 1O5RA 3CYJA 1LROA 1XI3A 5I03A 1G4PA 5GNZA 3KLLA 1XGEA 1I75A 4RR4A 4LBRA 1JXJA 2GK1A 2VEGA 1IXOA 5I06A 1CLVA 1VEMA 5K3VA 1GOKA 1Q7MA