4V27A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-isofagomine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Dissection of the Endo-Alpha-1,2-Mannanase Activity of Bacterial Gh99 Glycoside Hydrolases from Bacteroides Spp.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
total genus 127
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v27A00
1E6SM 1GOIA 4PMOA 3A3HA 1XD1A 2W66A 2EBNA 3AIBA 2W63A 4AYSA 2RGMA 4DWSC 5ABEA 3EMQA 6A3HA 2BVTA 1JDAA 5JIPA 4GZEA 3WUGA 3WMSA 4HA4A 5CXPA 5JBFA 4PMRA 4U3AA 1VFOA 1VFUA 2YLAA 3AMCA 5HPOA 3QHNA 1UR0A 3RM8A 4OOZA 3PZNA 1QI2A 3B8SA 4HPGA 4MB1A 1FP8A 4RE2A 5HNNA 2VQTA 2NT0A 3WEZA 2JF6A 4H04A 3K8LA 2CNCA 4AEFA 3U57A 1JYXA 1VFMA 3DHUA 4F8XA 4DUXA 1JAEA 1V6YA 3WELA 3L4WA 4H8UA 2VR4A 4OOUA 4LX4A 1V02E 3BSGA 4DUVA 1CXIA 1ZL1A 3WH6A 4F79A 4AZ5A 1J0YA 3AHTA 2RGLA 4TOQA 1W1TA 1TA3B 2D0FA 3SCRA 1GNXA 1E43A 3AFBA 4XZBA 1XH1A 5LA0A 2CBIA 3ARWA 2WZHA 3LPPA 3K8KA 3T0BA 3W82A 4MNLA 4D1JA 4UZSA 2DDXA 1NOUA 3PZTA 1U2YA 3KL3A 5I24A 3E1F1 4TUFA 2Y8KA 1KXHA 5E6YA 2ZWZA 3SCSA 4PTWA 1EOKA 4HPHA 2J7CA 1B31A 4CN4A 5AC5A 3POHA 2YA1A 4YHEA 2J47A 4HA3A 2F8QA 2PWFA 3AIQA 1KWGA 3OA5A 1UUQA 3VDCA 4CGTA 4PTMA 3RILA 2EPMX 3VM7A 2WCSA 5D8WA 5LYRA 2G3NA 4UZUA 4D6EA 2VQUA 1UZ1A 1WPCA 3THCA 5A8MA 1UQZA 1J0IA 2J7GA 2DSKA 3K4DA 1ITXA 1LWHA 1NWRA 4AD3A 1XRVA 2QPUA 3IJ7A 3GNOA 1GJUA 2AOSA 5CZKA 4M8UA 3T08A 4PUDA 1QNPA 2VVNA 3T0AA 3WD4A 4NRSA 1FFRA 1G01A 4TTGA 2WK2A 3WF1A 3VGGA 1W91A 1J12A 4U5IA 1I1WA 3PHAA 4C7FA 1CECA 3HN3A 1R87A 3K4AA 1H0IA 2ZX6A 1CENA 2X8RA 3WEOA 1HL9A 3WQ6A 2XGBA 4PSPA 1SYTA 4W7VA 3VX1A 2UY3A 2OSXA 1NOFA 1M7XA 1UD3A 4Q7NA 3GDBA 4Z2HA 2BHYA 1RPKA 1X6NA 1CBGA 1BYDA 3SUVA 4M80A 1QBAA 2DT1A 1H09A 1SMAA 3ZQ9A 3AHYA 3KZSA 3VO0A 5C8BB 2EXOA 4MTVA 2CHOA 1Q6FA 3AIVA 1KB3A 4AZIA 1BPLB 3WH8A 4LYPA 2BXZA 1V3KA 1CDGA 1OGSA 3AS0A 1WKYA 2PWDA 3VUPA 2WLYA 3MS8A 4CD7A 5D9PA 1BVNP 3ARPA 1UR2A 2WHLA 2EPKX 1JI2A 3UESA 4NRRA 2XVLA 8CGTA 4D6GA 4PMXA 1NWUA 1CLVA 1E6NA 3WDIA 2ZUUA 4MB3A 1JYNA 3WQ5A 3ZT7A 1V6UA 1E3ZA 2WVTA 2ZIDA 1JD9A 1PIGA 1W9BM 1JDDA 4MB5A 1C8QA 1LG1A 1V3IA 4W7WA 4GZJA 3VIHA 9CGTA 5M3WA 3WBEA 3L2LA 5DFAA 4ATWA 2BHZA 1VENA 4CD6A 1VFFA 2Y5EA 3FAWA 3IK2A 3MUY1 1PX3A 3BH4A 4L4OA 4YPJA 1BYBA 1FHDA 2DPEA 3CUJA 4QP0A 2V5DA 2X0HA 2WLZA 2W62A 1BF2A 3MMUA 1A47A 4W8BA 3SCOA 3VD9A 4MNJA 3AZRA 2YBUA 4JKKA 2GK1B 1K9DA 3WUEA 3WNPA 1US3A 1UKQA 4HOZA 3LPFA 2BV9A 3AXHA 1B3YA 2DSVA 5DEZA 5EMYA 4X0NA 5CSUA 2QMKA 3CZ8A 1ODUA 3RCNA 3WKZA 1V3LA 1CGXA 2BVYA 3AIWA 4ACYA 1GHRA 3A6OA 1H1NA 1QI3A 1B2YA 2J7FA 2E9BA 2YA0A 3NIYA 4ACZB 3GH5A 2XVNA 1XHGA 4FLRA 4PMNA 3RPMA 1E4LA 3WD0A 1V3HA 2UY2A 2D1ZA 5I3DA 2OYLA 4UFLA 1WZAA 3SCUA 4M24A 3KL0A 2YL8A 1UWQA 3VMOA 4Z2JA 1KXVA 2ZX5A 3EBVA 3VMPA 1UR1A 1DWGM 4EKJA 1HKMA 1BGGA 1FH8A 2VRQA 4TTUA 2WBKA 3AIRA 1KCKA 4Z2KA 3KWXA 1E0WA 4CD8A 2XWDA 1DHKA 1V0MA 4CU6A 4HZ7A 2CKSA 3AOFA 4WIWA 2XJ7A 4TX8A 1KGXA 4PCSA 2WXDM 1V03A 3WBAA 3BAXA 4UQEA 3L4ZA 2D3LA 3VIKA 3ARTA 3BGAA 4MJ4A 5D4YA 4DM1A 1XYFA 3VDHA 5I5RA 2FHFA 3MO4A 1V6VA 1OBAA 1JGIA 5JIWA 1OT2A 3CUIA 2TAAA 1X1NA 3SCPA 3UR7A 1CGUA 3D5HA 5FCZA 1F4HA 1ZBKA 5BXPA 3NJ3A 4K68A 4QAWA 2DT3A 4RL3A 1Q6DA 4PMUA 4Z2IA 4Z2GA 3MSGA 2WMFA 4DWSA 1QOXA 2VX7A 3O2LA 3CZKA 5DMYA 1VEPA 1FH9A 2JALA 4GO9A 5CPTA 5FIPA 2XTKA 1NWSA 2WNWA 5I79A 2JEQA 1V0LA 4Z2LA 2XIBA 3VD3A 2CXGA 2W92A 1TCMA 3WDRA 4ZENA 2E8YA 4D6DA 1GQIA 5AY7A 2MANA 3A4XA 4QLKA 3L4YA 1CPUA 1H11A 3F5JA 4P7RA 3BCDA 1HJUA 1R7AA 2WHKA 3SUWA 4W88A 3W6MA 1QW9A 2F2HA 3SUTA 1C7SA 4N0RA 1UA3A 1KBBA 4GIAA 1PZ3A 2GJPA 4CKQA 2VCCA 2VR5A 4IPNB 3ZMRA 2A3EA 2ESCA 1CYGA 3WDHA 1D3CA 4D6FA 3I3BA 1E5JA 2ZUNA 1KQZA 1QI4A 2WC4A 1HJQA 1UD2A 4UOJA 3NCOA 1WNOA 4MAVA 1OIFA 3PZVA 2O92A 5FL0A 1GQJA 4E8CA 5DF0A 5FOOA 3BAKA 3PZMA 2YL6A 1HVQA 2DGAA 1WB0A 3T2PA 3CH9A 4NZCA 3ARRA 2B31A 3AS2A 1WE5A 2ZUVA 3SUSA 3MKKA 4ATLA 4FF5A 4PYSA 4M29A 3W38A 4AXNA 5A6LA 3VIOA 3ZT5A 1C90A 1UD6A 2WKGA 5A94A 3ALFA 3IAPA 3AIUA 2YOCA 1IT0A 4A3YA 1D7FA 2X2YA 2WM0A 3OIHA 4A4AA 3VTRA 1V3JA 3WUBA 3KL5A 1JFHA 4AMCA 4J3UA 1BYAA 2QV4A 3N17A 2VMFA 5IHRA 3BAYA 3M46A 3T2QA 3AS1A 5HBFA 3BAWA 1E4NA 3WF2A 3G6MA 3VINA 2FHCA 3DHPA 4AY1A 1JZ5A 3BLPX 4UTFA 3W26A 1ZJAA 1PAMA 1HN1A 5ABFA 2AAAA 3HJEA 5AC4A 2YA2A 1FFQA 4J3WA 1JYVA 5ABFB 1E1EA 1GOMA 4GINA 3UG4A 4U5KA 1OT1A 1TR1A 7TAAA 2XFFA 4AIEA 4UNIA 1CXFA 3AISA 1NOWA 1EA9C 4GI8A 1US2A 1J9YA 1J0JA 4OIFA 1DWJM 4KGJA 4MDOA 1NARA 4LQ1A 5LA2A 5CJ5A 2VCAA 3ZM8A 2VJXA 4C7DA 2BY1A 3VNYA 1AQ0A 4XV0A 4W8LA 4M1RA 1KWKA 1EHAA 4QCEA 3CHCA 1ODZA 3TOPA 5BXTA 5I23A 3CO4A 2XM2A 3A4AA 2W61A 2ZX9A 2WCGA 2VVSA 3RM9A 2CESA 2OYKA 1GONA 3RDKA 3VOCA 2XM1A 1B3WA 1UD4A 4D1IA 1V6WA 5BYWA 4AD2A 2E4TA 4NSBA 1JZ8A 1OB0A 2YL5A 5D8ZA 1IZKA 4MPKA 4HMDA 2JF7A 4JKMA 1NWTA 1W32A 3NDZA 4U2ZA 1CXHA 2NW0A 2DQXA 1L0PA 1V3MA 3I3DA 2WW5A 3ZIZA 4B3KA 3T09A 4J27A 1QPKA 2E8ZA 3TONA 2J74A 3PZGA 1JZ4A 1UWUA 2G8ZA 1EO5A 3L4TA 4JFUA 4X9YA 1C91A 3ZJKA 2XHYA 1H5VA 3CUHA 2XVPA 4D71A 2Z1SA 3NSMA 2FGLA 2UWFA 4QFUA 4ATDA 3WF3A 2EPNA 3MMWA 2PWHA 2C0HA 3BMVA 1W9PA 3MV01 3F5LA 1OD8A 3U7VA 2VX6A 1GUVA 1BG4A 3ARYA 1M04A 5JBDA 5CLWA 3GTNA 1ISWA 4JFVA 3APGA 1K9TA 3DECA 2VRJA 1VAHA 1HVXA 2BHUA 4WKAA 4S3KA 2C8NA 2BNJA 3WMCA 3NSXA 2QPSA 2OWXA 5I77A 1GZJA 2ZUMA 4QCFA 1Y7VA 1C8YA 5E6ZA 4UFMA 1UQYA 3S2CA 2UY5A 4P7LA 4EAMA 3G6LA 3QOKA 2XFYA 4CCDA 5EFDA 3K46A 4JHOA 3OG2A 4KRTA 1ESWA 1EO7A 4J7RA 5C71A 3TTQA 4B15A 3JUGA 3CLWA 4M56A 1B90A 4DWSB 1OD0A 4P8XA 1GOQA 4UFHA 1LLOA 4B9YA 2FGZA 1GW1A 2VI0A 1ZBWA 4QLLA 3BSHA 3GH4A 3AJ7A 2GJXA 3FAXA 2J62A 4LYRA 1VEOA 3WNMA 1KQYA 4KMQA 4GPNA 2WMHA 1I1XA 3PZ9A 4D6JA 1B3VA 2Z1KA 1SR0A 2O9OA 1J11A 2V5CA 1I75A 3WQ4A 3VIMA 3FN9A 4AISA 5BROA 3N13A 3UCQA 2WHMA 3CPUA 4AIUA 3SCNA 4BF7A 4EANA 1RP8A 3AS3A 1EIBA 3POCA 1H4PA 4IISA 2CPUA 4AWEA 4Q22A 1UWTA 2WZEA 4V27A 1V0KA 1LL7A 3WF4A 2XYLA 4XUYA 3GYCA 5C70A 3CUFA 1FOBA 1AMYA 5GNXA 1VBRA 5DO8A 4BCEA 3UG5A 3UETA 1S46A 4JL1A 3B9DA 3CMGA 4TXEA 3WNOA 2GUYA 3RJXA 3CIVA 1EDTA 4UR9A 3N18A 3GH7A 1JYWA 2WWDA 1EXPA 2WMIB 4P7QA 3VD5A 1E40A 1JNDA 3GXDA 1NP2A 1WDPA 1GCYA 1W1YA 4GZIA 5E9AA 5IXEA 3VIFA 3DYPA 1VF8A 1HX0A 1JF6A 3NYDA 4PTVA 4CD4A 4CN6A 3IAQA 2E0PA 2XVKA 1MXGA 2VURA 4MNKA 4UQDA 3O6AA 2VUYA 1G5AA 1QBBA 1GOWA 2J7BA 1BFNA 1BHGA 2JFEX 4U33A 3CZLA 3WQVA 2PB1A 3M07A 3EDDA 5FL1A 3EYPA 1R85A 5DT5A 3OLGA 5I0DA 1VIWA 4JIEA 5A8PA 2DEPA 2EQDA 3ZJ7A 2WB5A 3GXIA 1KXTA 2PWGA 1CTNA 2J78A 4PRWA 4JFTA 4H7VA 1YQ2A 3WN6A 1QHOA 4DM2A 2EEXA 4NF7A 2WKLA 4HTYA 3W4RA 2IXVA 1G94A 3W81A 4D6IA 4KRUA 1PX4A 4GQRA 2FDMA 5CGMA 3BLKA 3HMCA 4C7GA 2A3AA 5A8QA 3NUKA 4WF7A 3EMZA 3WDJA 2J8FA 2WAGA 4JKLA 3SURA 3THDA 3A47A 3F4VA 2WZIA 1TMQA 2VO5A 1C93A 3W6LA 5KZ6A 3A4WA 2WWCA 3W24A 1TVPA 2WVVB 1CWYA 2NSXA 1HIZA 5BRPA 1WDSA 3BAJA 5CGTA 5FKYA 1EHNA 4DUWA 2YDSA 1O6IA 2YL9A 1HNYA 1VEMA 2DSZA 4LXFA 4PMQA 1XH2A 1ITCA 4JL2A 4E2OA 1K9FA 5HPCA 2CHNA 4W87A 3FNDA 2J77A 2VZUA 1HL8A 1JNEA 3WNNA 2EO7A 5E0CA 3MV11 3ZSTA 3OBAA 4IUGA 1HT6A 4H8VA 1DTUA 1KR1A 1WZMA 4MADA 1E9LA 1E4IA 1CGWA 4KWUA 3O9NA 1JF5A 1KCLA 3N1AA 4NI3A 1VJSA 2WVUA 3VNZA 5M5DA 5IDIA 1BG9A 4ACZA 1V0NA 3M6DA 3S6TA 2BS9A 1E73M 2J7EA 8A3HA 1HKKA 2FH8A 2WMJA 3TA9A 4UFKA 1UWIA 3DYMA 1WDRA 4AEEA 5A8NA 2VT0A 4UQAA 3SEPA 1XSJA 2OSWA 4W86A 2O9TA 4W93A 1XD0A 1ISXA 4A3HA 4HU8A 2VRKA 2X0YA 1KR0A 2WC3A 1Z32X 1G9HA 3EMCA 3MUIA 1XC6A 2PWEA 1B30A 4BA0A 4CU7A 1H49A 4GQQA 4CN1A 4TX6A 1E72M 3VDBA 1E6XM 1XSIA 1LL6A 2WC7A 2VZTA 6CGTA 3BC9A 1OINA 5EFFA 1ISYA 1GQLA 1HKIA 3WY1A 3RM4A 4WLCA 3WMBA 1HJXA 4BZYA 1M53A 1E70M 2GJXB 2BVDA 4S3JA 1GJWA 2XWEA 4HMEA 1B3ZA 3WENA 5A6MA 1V02A 1JIBA 4CUCA 2YDQA 3CZEA 3GM8A 1IV8A 3VGDA 2VNCA 4HU0A 1WZKA 2X05A 1E6RA 3U5YA 1UOKA 3ZT6A 5HDRA 1MFVA 2O9RA 2JIWA 4OZOA 3WDPP 4H41A 2CIPA 2ZUSA 3CZGA 3EDEA 2BY0A 1W2VA 2DIJA 2ZXDA 3SCTA 3W27A 5CQ1A 3FW6A 4PCTA 3OGVA 3QGVA 4M82A 4ML4A 3GXFA 2O9PA 1UR4A 5D9MA 1J0KA 3LMYA 2CKRA 2FH6A 1WO2A 1B1YA 1PPIA 3CGTA 3ZR5A 5DT7A 1H2JA 1LQ0A 3RO8A 1DWFM 1TVNA 1CNVA 1NM9A 1EDQA 4ZE5A 1CIUA 1QHZA 5A6AA 1W2PA 4WSJA 3PBGA 4HMCA 4TVDA 1WAWA 4AZGA 2W67A 1W9DM 4PBGA 3CZJA 2D3NA 1QNOA 2Y8VA 3B9AA 1TFVA 2WMKA 2WSPA 4PMVA 1ZU8A 1VJZA 1PJ9A 1MXDA 1W9UA 2ZUTA 1QNQA 2C7FA 2E3ZA 3GXMA 1AQHA 1TUXA 5I78A 1AVAA 5CG0A 3QHMA 1XSKA 1QNRA 4KGLA 2QMJA 3PTQA 5D9OA 4JFSA 3B9EA 1WDQA 1JI1A 1RP9A 3AYRA 3SCQA 2D23A 3PZUA 1E56A 3CUGA 2EPLX 1ZJBA 5F7UA 1E6QM 2WVSA 4CCEA 1UA7A 5A8OA 2BXYA 2GDUA 3OZOA 4LYQA 3IJ9A 3T2OA 5IFPA 4FMVA 1BQCA 4BQ2A 2A3BA 2D22A 1MW2A 3ZOAA 2G41A 3L4XA 5ABGA 3VILA 3BCFA 4WSKA 5GQBA 1LWJA 4U31A 3UR8A 2EPOA 1SFSA 1Q6GA 4XX6A 2AMGA 2IXUA 3AYSA 5CPQA 3AMLA 3ARZA 3CBWA 1ECEA 4U3CA 3OZPA 2V3FA 3AICA 2GVYA 1W1PA 1TA3A 1EQCA 5GPRA 4EE9A 1E1FA 2ZUWA 3QR3A 2CERA 1OCQA 1KBKA 4L4PA 5E70A 2JIEA 1MQQA 1EGZA 4JHZA 4FLQA 1VRXA 3MANA 4IM4A 1A3HA 1W3LA 4ZFMA 2J7DA 2OWCA 2WPGA 2CCRA 4AD4A 1JD7A 3SCVA 4FK9A 2YBTA 4U2YA 1GQKA 1BLIA 4PTXA 4UFIA 2WVVA 5BXRA 1ZBVA 3PTKA 1RH9A 3OLEA 5FD0A 3VKKA 1OM0A 3TP4A 1C92A 1H41A 1JDCA 1J10A 2CBUA 3AI0A 1E0VA 1OWQA 1PZ2A 2J25A 3M7SA 3T0DA 3TTSA 2ZWYA 3BAIA 3KEHA 2F61A 1JZ3A 2D0HA 4UOZA 5TD4A 3TTOA 1QI5A 1CGTA 2V38A 4UQ9A 3MUAA 1ISVA 3GZAA 4UOQA 5EBAA 3OGRA 3VU2A 2W4XA 1HJVA 3DC0A 4P8UA 5A6JA 1FA2A 3VVGA 3SCWA 4AZ7A 2ZX8A 1UKTA 4BQ3A 2QF8A 3II1A 1JFXA 3VX0A 2WCAA 1GVYA 2YLLA 1X6LA 5A6BD 4FLSA 3VIJA 2DT2A 4HOXA 1UD8A 4DWSD 4X0VA 1J0ZA 3U5UA 3VDAA 2NT1A 4J3TA 1MW0A 1DEDA 1NP0A 1QW8A 3HU7A 4YN5A 5A95A 5E0FA 5A2AA 2E9LA 1LG2A 3WUFA 2G4FA 5A1AA 5CPSA 1GORA 5I2UA 5A2BA 1GVIA 5AYBA 1UYQA 3U7BA 2D2OA 3WH7A 1WZLA 1CXKA 3OLDA 1PBGA 4AD0A 3N11A 4ZE4A 1K9EA 4WKFA 4LPCA 1MFUA 2WMIA 1CGYA 1EDGA 3K8MA 2ZX7A 4CVWA 2YIHA 4W84A 5M03A 1V6XA 1U33A 5A3HA 2G3MA 3BMWA 5CLTA 3W25A 3VMNA 2CITA 3SIMA 3EDJA 3AQUA 1W1VA 4PEEA 1XYZA 1HJWA 3AMDA 3ZJ6A 1Q6EA 3WQWA 1KXQA 3CHEA 5EB8A 1JAKA 4J3XA 2X1IA 1PEZA 4W85A 1JXJA 5GNYA 4GO8A 5E09A 3AIEA 4WK9A 5BXSA 3WQ8A 2WMGA 3AMKA 4MB4A 4PSRA 4HOWA 2ZXAA 4UFJA 2ZE0A 4J3VA 3PZIA 4AZHA 2XPKA 1HP5A 1XCWA 3WL0A 4MDPA 4AD5A 2G3JA 3D3AA 4B9ZA 5A2CA 4OJYA 3OGSA 3CHDA 2D20A 1HXJA 4EK7A 4W89A 5BRQA 3UERA 3AHZA 2W5FA 1CXLA 3ARSA 1G1YA 1TG7A 2QLYA 1SMDA 2XFRA 3WD2A 3J7HA 4HA1A 5M17A 1J01A 2HVMA 4GXPA 1R86A 1KFWA 4WKHA 5LA1A 2WSKA 2VX4A 1QVBA 2XSAA 3AZSA 3AHXA 2CEQA 5HOSA 3DYOA 3IANA 2A3HA 1UZ4A 4MAZA 4PUEA 2J7HA 1XV8A 1E6ZA 1P6WA 1KGWA 4HP5A 1W9VA 1OSEA 3LPOA 4P7NA 2YDRA 4YHGA 1F4AA 3ZO9A 1ISZA 1VB9A 3ZR6A 2DH2A 1H3GA 3WFZA 2E9MA 3AHVA 3N04A 1Q4NX 3W37A 1MWOA 3UEQA 3N12A 2VZOA 3WNLA 4W5ZA 4CD5A 4HZ8A 4TVUA 2PI6A 3AROA 1TE1A 1E71M 3ZJ8A 1MW3A 2FHBA 4MJ2A 1DWIM 3W28A 2Q8XA 3LPGA 4GKLA 1RD6A 5CSYA 5A6KA 4E8DA 4ZXLA 1UWSA 3MU7A 1CLXA 1E15A 1XCXA 4AD1A 1JL8A 1NH6A 1CXEA 2PC8A 2DSUA 1K6AA 2V3EA 1J0HA 2OWWA 4QDMA 4JCMA 2VOTA 1J18A 2V3GA 3GNRA 3NDYA 4R27A 2D24A 1W3JA 3MMDA 4AZCB 4QLJA 3QOMA 2E40A 4LGXA 2V3DA 3W53A 4AIOA 4J28A 2OSYA 3AXIA 2GDVA 4XZWA 2UY4A 3ARXA 1MYRA 4OBSA 1B0IA 3GNPA 3WFLA 3ARQA 4JFWA 1BTCA 3L4VA 1XGZA 2BY3A 4CU8A 4F9JA 4CVUA 4JCLA 1OGBA 4UCFA 1JZ6A 4FLOA 3FXYA 4B3LA 1FH7A 2ZICA 4JAWA 1HJSA 2XVGA 1CZ1A 1JXKA 4TVCA 2GFTA 2VZVA 1B9ZA 1W3HA 3WF0A 1UHVA 1ZS2A 4GI6A 3UG3A 4GI9A 3RIKA 3EDFA 4OKDA 1GPFA 4Y7EA 2J79A 4UQCA 3ARVA 2JE8A 1OGGA 1O7AA 4IPLA 3VM5A 3PZOA 1UR8A 1U30A 2J4GA 1M01A 2VCBA 4BQ5A 3WL1A 4P7OA 3I3EA 1C8XA 3AMGA 1XH0A 3ALGA 4JZ5A 3VIGA 4OUEA 4B16A 3W0KA 1Q6CA 4AZCA 3VD4A 1HKJA 1UH4A 1BSIA 1R8LA 2WYSA 3PTMA 3PZQA 2DH3A 3VPLA 1E55A 2VC9A 4HZ6A 2ZOXA 2J75A 5ABHA 1JZ7A 1BVZA 3WH5A 2ZXBA 1HP4A 2HISA 2XIIA 1QNSA 2YKKA 1BYCA 1BAGA 2PBOA 4PMDA 3CMJA 1UD5A 1D2KA 4ZXOA 5IHSA 3AXXA 4PN2A 2D0GA 5JBEA 2X09A 1PIFA 3PN8A 1V08A 1LJYA 1GOKA 1OIMA 5BWFA 3SUUA 1WCGA 1DWHM 3OB8A 1UH2A 5GNZA 5A6BA 5I6SA 1HF6A 4D72A 1UG6A 3FHQA 1YHTA 4W5UA 1UH3A 1N82A 4P8WA 3OLIA 3L4UA 2OYMA 1E6PA 3RJYA 4W8AA 1E4MM 4H2CA 1JZ2A 5A6SA 1LL4A 1M03A 3ZSSA 1DP0A 4W7UA 3GBEA 3VGFA 2DIEA 3CHFA 3KE0A 4R5EA 4WJXA 3L2MA 1EQPA 1C3FA 3QHOA 3NSNA 1E0XA 4PMYA 1WP6A 3N9KA 1MW1A 5D9NA 2YJQA 5KEZA 1KGUA 3EDKA 1PX8A 1UKSA 2XUCA 4AC1X 4D6CA 3IJ8A 2Y24A 1CGVA 2IUZA 2VL4A 1IZJA 2VZSA 3VGHA 4RE4A 5AYIA 2VX5A 1JG9A 1L8NA 3FY1A 1LF1A 1UR9A 2J8GA 4F9DA 1CEOA 1AQMA 2WANA 4V2XA 5BCAA 2GK1A 4H8HA 5HXMA 1MQRA 2CETA 1E5NA 4AW7A 2XGIA 1G0CA 1ZBCA 3TTYA 5IFTA 1B3XA 4PMZA 4URIA 3VIIA 4P8VA 2QHAA 5A69A 2GSJA 1NQ6A 1QI0A 4D6HA 1W3KA 2OLHA 4BQ4A 4MNMA 1QHPA 3WD1A 1MVYA 2EJ1A 3VGBA 2Y2WA 4E4PA 3WH9A 3GBDA 4AZ6A 1DWAM 1H0GA 1FP9A 4UQBA 3WEMA 1UKPA 6TAAA 3F5KA 3N15A 4BS0A 2JEPA 2XSBA 3WNKA 1UKOA 4XB3A 2CBVA 1FHLA 7CGTA 2Y4SA 3RMEA 4RE3A 3W29A 2ZXQA 4OBRA 2WHJA 5ECUA 4KH2A 3MSDA 2PF0A 3ECQA 3WDQA 2PBGA 2BY2A 2A3CA 2G3IA 4N42A 3VGEA 1UWRA 4AZBA 2XG9A 1VBUA 1E3XA 2DSWA 4V28A 2BFGA 1W9XA 3FHAA 3K1DA 3CTTA 1EH9A 1BGAA 2WBGA 3ARUA 2W91A 1MQPA 1EOMA 4J3SA 2CBJA 2VTFA 5JUVA 4M81A 4CCCA 1ZB5A 3MUZ1 3WIJA 7A3HA 1GOOA 2DT0A 3BXWA 3WD3A 3AZTA 3VD7A 3WSUA 1C7TA 1R7OA 4F66A 1GHSA 2GJRA 3VIPA 1TZ7A 4ZEPA 2CYGA
chains in the Genus database with same CATH superfamily
4DF1A 1E6SM 4PMOA 3A3HA 5DBTA 1XD1A 3S8HA 4HNOA 3FX4A 3K1GA 3FJ6A 3LI1A 4TV5A 1OABA 4DWSC 3P5ZA 3KOYA 3GG8A 6A3HA 3AO0A 3WUGA 1VFOA 3DUGA 1VFUA 2YLAA 3AMCA 3TFXA 2DUZA 3CLMA 3OIXA 4H9VA 3QHNA 1G67A 1AA1B 2YGYA 4RE2A 4PB5A 3W2MA 4LALA 1Q3NA 4H04A 2GYIA 2R82A 3CWHA 4C5YA 3UZWA 1VFMA 2CXEA 3DHUA 2HTMA 4DUXA 1V6YA 1TPC1 4H8UA 4H9UA 5ECVA 3BSGA 1CXIA 3FXGA 3WH6A 1IXOA 4F79A 3U3HA 4AZ5A 4ZO9A 5K4XA 3AHTA 2QIWA 3L2IA 4K37A 3H6OA 3NQFA 1E43A 1AQFA 3S42A 1OCNA 3UT0A 2CBIA 1FKXA 1FWCC 3K8KA 3CAVA 3T0BA 3VNKA 4AB4A 3SR7A 2DDXA 1B4EA 1JRCA 3KL3A 1IT8A 4LF1A 1Z69A 4ADSA 3RK8A 5HUPA 1TJRA 2FVKA 3EWCA 4UUIA 2J7CA 1B31A 1AFSA 4NJKA 4HA3A 4RE0A 1XIIA 4RW5A 1OFAA 1ELSA 1O60A 3PJUA 2BVWA 3THCA 5A8MA 3ONBA 2B81A 1NDVA 4H6EA 3K4DA 2ADAA 4A8LA 2QPUA 4J1OA 3NOEA 4OBTA 1WA3A 2VVNA 3T0AA 5REQA 1NQKA 1G4TA 3PULA 2OQYA 4RXGA 3TROA 1W91A 1J12A 2QDEA 1I1WA 1CECA 5IBXA 4YTUA 2G4JA 2FDSA 1CENA 3Q58A 1SYTA 4KIEA 3VX1A 1M7XA 1KBIA 3GDBA 4Z2HA 4O52A 5TF0A 5LGZA 2V6AA 3SUVA 3NQAA 4UMBA 1SMAA 3ZQ9A 2Q6ZA 1PB0A 4CNTA 1JDEA 1Q6FA 3MQTA 4AZIA 2BXZA 1T96A 3NO5A 1WKYA 3VUPA 3LGEA 4MUPA 3MS8A 2ABAA 2PDBA 4M3PA 3NQMA 5E1QA 1UR2A 1YIXA 2WHLA 1H1YA 4NRRA 4G5DA 1E6NA 5DELA 4MB3A 4XD3A 1I2NA 2AQVA 3PUOA 3WJZA 4TIMA 1E3ZA 1P5BA 1R3VA 1JD9A 4IPJA 2HS8A 4H4IA 1W9BM 1JDDA 3GIQA 4NNCA 4W7WA 4GZJA 2FZ9A 1FCVA 4WCJA 1GVQA 3WBEA 3L2LA 2ZA3A 3IUHA 3KCJA 1UJQA 1XLAA 5C55A 3UXLA 1S5TA 3IK2A 3MUY1 1MUCA 2LLEA 4Y9MA 3LXCA 1TPDA 1H63A 3M0ZA 3B0YA 4QP0A 2FB3A 1UMLA 3V35A 2WLZA 3GC2A 4X3ZA 4F2BA 4FNUA 3DIPA 3AZRA 1RCXB 1KO0A 2GK1B 1GOXA 3UZYA 1K9DA 1US3A 4HOZA 4RPQA 1PDZA 2DSVA 1FWRA 4X2PA 2QMKA 3CZ8A 1F3TA 1V3LA 3LLXA 4ERAA 4O57A 1OK4A 1IEVA 1H1NA 1V6TA 1B2YA 1QI3A 3VKDA 2J7FA 5AHEA 3SM0A 1FWTA 3GWQA 3GH5A 3U4FA 4FLRA 3FGCA 4L64A 4BF9A 3F2DA 5AYZA 4Z08A 3G18A 3VMOA 5D05A 1XFCA 2ZX5A 5HMFA 3D46A 3AXMA 2PDNA 1HKMA 1FH8A 2WBKA 4PCFA 3T07A 3AIRA 4L61A 1DIDA 1FWGC 4UR8A 4Z2KA 4CD8A 4FNRA 1D3HA 2E25A 2XWDA 4UNLA 1KTNA 5H8MA 4C6LA 5SWUA 2CKSA 3SRFA 4ZQNA 2H9AA 5G1MA 2BGQA 4EF9A 1XIEA 3PJWA 1DE5A 4MJ4A 1KKRA 4DM1A 1XYFA 3MO4A 1V6VA 1JGIA 1XQKA 1JUBA 1RQHA 2KAUC 3CEUA 1Q85A 3KOZA 4GXWA 5EKYA 1MUWA 3BURA 5BXPA 3OHIA 2NV2A 3GVGA 3EWDA 3LHVA 3NJ3A 4K68A 4ZA0A 3UG8A 3P80A 4RL3A 3CYJA 4S38A 4DWDA 4JD4A 1OZMA 1PYMA 1R9ZA 1UC4A 3RXZA 4ERGA 3CZKA 4AWTA 3DG3A 4ORMA 4GO9A 2I17A 2WSQA 3W7IA 1NWSA 2WNWA 2PTXA 5I79A 5CZ0A 4QE4A 2XIMA 3LS9A 4AG0A 2XIBA 3WDRA 1TCMA 2NXGA 1FUYA 3TUUA 2E8YA 3TN5A 5AY7A 4QLKA 4MFEA 3FIGA 3L4YA 1CPUA 3W7NA 2PP0A 3BCDA 1HJUA 1R7AA 3QRHA 2WHKA 3GFXA 3ITVA 5CPNA 2GPTA 4KF1A 3JZEA 3MDUA 3CU2A 4XTIA 4OECA 4ZO8A 1LBMA 5L9FA 2VCCA 3ZMRA 2A3EA 1XCFA 4ML9A 3R4IA 1XP3A 4GQBA 1QI4A 1HJQA 1UD2A 2R1KA 1ONRA 4CQ8A 3NCOA 4GNVA 4M1BA 1WNOA 3PZVA 4H3DA 2O92A 4H83A 3NOYA 4XUGA 4E8CA 5DF0A 4XO7A 3PC0A 4I8YA 1HVQA 2Y1HA 3LQLA 3T2PA 3ORWA 3PPHA 2OTDA 5CC3A 3LX9A 3QFWA 3D0CA 2OEJA 3SUSA 3W9ZA 1QMLA 5LNVA 1SFJA 4PYSA 3OBEA 4EPEC 2VFIA 2IPWA 3ZT5A 3TN3A 3IIVA 3AUJA 3PTDA 5FJPA 1SO6A 2HV5A 1NDZA 2ZZ6A 2YOCA 4HNVA 3DH7A 1IT0A 4A3YA 4ZZ9A 3RG6A 4FSAA 1IGWA 4UC5A 4A4AA 1XIHA 1JFHA 3W1XA 6ENLA 4GYPC 5C7HA 3NA8A 1BYAA 2QV4A 1H62A 3TK7A 5DQPA 3ONCA 3S5OA 3EWBX 1XWYA 3VINA 1SVDA 1ZJAA 1PAMA 5D2TA 2BBFA 3KLLA 5ABFA 3R7MA 3A64A 2Y85A 3BLOA 5ABFB 1DTNA 1E1EA 4GINA 3S3GA 1OT1A 1NELA 1XGEA 4AIEA 3AISA 1EA9C 2YCJA 4GI8A 1UP3A 1US2A 5U4NA 4RX0A 1L6FA 1QDSA 3WK1A 2P3ZA 2YYTA 1VBHA 1OK6A 3E5PA 4FXRA 2VCAA 4HGXA 3KS5A 4QJ1A 1RCOB 1FCBA 1KWKA 1GWJA 2IPGA 3CUZA 1RK5A 3BQ5A 2V82A 1HFBA 3TOPA 5BXTA 1YYAA 3CO4A 2XM2A 1SPQA 3TYCA 2ZX9A 2WCGA 3ZWTA 2VVSA 5EYWA 4DYKA 1GONA 1B3WA 4D1IA 1FDZA 4AD2A 1HQTA 1OB0A 1IZKA 3P74A 4MPKA 4HMDA 3QZ6A 4JKMA 1NWTA 3BZGA 1KCXA 1TMHA 2P76A 4PC8A 5C7VA 1YNPA 1L0PA 1V3MA 4XQ6A 3VFCA 2VHLA 1H7OA 2J74A 4AHPA 4IMAA 4DJDD 4JX4A 1UWUA 2WSYA 3CMFA 4XTDA 4B5UA 5E5CA 2G96A 2OVLA 3TW6A 1A49A 1LP6A 3ZJKA 2XHYA 1ZSXA 4S3DA 2XVPA 4D71A 2HS6A 3NSMA 1UW9A 3RF9A 4CEXC 3S46A 4ATDA 1VPQA 2EPNA 1XRTA 1W9PA 1ECQA 3MWAA 3AAMA 2IQDA 4HT3A 5C9RA 3W1LA 2VX6A 3CT2A 1BG4A 1M04A 2V2DA 5ENLA 3WG6A 2VDIA 4E5TA 2VRJA 3O3RA 1HVXA 5D02A 3BG3A 1SUXA 3AUOA 4F0RA 1YKWA 1SJCA 1P0EA 4RJEA 4IGHA 3NTYA 1NSJA 3QY8A 5E6ZA 4QS5A 4K8GA 3W7RA 4EAMA 3UGVA 3QOKA 2XFYA 4CCDA 1F73A 3WLTA 3UVAA 2VP8A 4QAIA 4KRTA 3G24A 5A6TC 3M0IA 5C71A 1K1DA 1S2CA 4B15A 4GJ1A 4M56A 4HHPA 1YLVA 1B90A 1U1UA 4XK2A 3R6IA 1QO5A 1B9BA 1GW1A 2VI0A 4LOCA 3BSHA 3GH4A 3LG3A 2PMQA 4DQWA 2DUAA 4BEQA 4CQAA 1VEOA 3NPWA 3WNMA 4KMQA 4JTJA 3VKJA 5DMMA 2WMHA 3B8WA 3V0TA 3N6JA 1B3VA 1XRFA 4WRHA 2ZCGA 2VEKA 3W7PA 4LVBA 2V5CA 2EG8A 3B9NA 3KOFA 5BROA 3UCQA 5BW6A 5DCDA 2J6VA 3SCNA 2HBVA 1EIBA 2YDAA 3OYXA 3DBPA 4AXKA 4O1AA 3S6DA 4DRSA 4Q22A 1HO4A 1V0KA 3WF4A 1PVNA 3JU2A 5DRIA 3CUFA 5GNXA 1VBRA 4BCEA 1MSSA 4H2HA 1IXPA 4KBXA 1S46A 1XIJA 3B9DA 3MO7A 1RV8A 5C2GA 4Z0SA 2C15A 4FF7A 1GQNA 4UR9A 3FA3A 1XI3A 3GH7A 1EGMA 3SSZA 1TSIA 3RRXA 3S5SA 2R1LA 2PE4A 3RCMA 4JYFA 1UWAA 1VF8A 1YBQA 3NYDA 1MI3A 1KFKA 2E0PA 1JCJA 3UXKA 1C8VA 1ICSA 4K2SA 1RHCA 2CZDA 4GJJA 5DRCA 1M65A 5AOUA 1GOWA 2J7BA 1UUOA 1BFNA 4FNSA 3KBMA 4UBPC 4IPIA 3FVDA 5AVHA 3ZJ7A 3GXIA 1QUMA 2D2GA 3UZ5A 4JYEA 4UWMA 3LRKA 2F6UA 2FZBA 5H2ZA 3H4WA 4DM2A 4ICMA 1FQ0A 2EEXA 4MMWA 2WKLA 2IXVA 4C1LA 1PX4A 1Q65A 2FDMA 5PTDA 2PDYA 4WF7A 3WDJA 3MI3A 3THDA 4GJIA 2R6OA 1LBFA 1I9CB 5B7YA 1K7FA 3W6LA 1F07A 2DVXA 1XLLA 4AY8A 1ZTVA 3W24A 1TVPA 3PG9A 4GH3A 3T0CA 2NSXA 1HIZA 2WZTA 5FKYA 2YDSA 3IVUA 5H8UA 3Q67A 1O6IA 1VEMA 2DSZA 3A22A 2DU2A 4E2OA 3M5VA 4B5WA 2J77A 4WOQA 2BOFX 3PM6A 3WNNA 3V0SA 3TXVA 2QXWA 1TQJA 3KXQA 1HT6A 5CEWA 1DTUA 5T9BG 3N34A 4HSHA 1WZMA 4YTRA 4MADA 4QE1A 4YYCA 2PD5A 4C6EA 1E4IA 2CZEA 5CZJA 4JN8A 5CC5A 1F3EA 1Q2RA 3SN0A 2NWRA 1NDYA 1KCLA 4NI3A 2DW7A 4GY7A 4O1BA 2P8BA 5HWMA 3VNZA 5BZAA 3QPEA 2YFOA 3VOJA 3M6DA 3MZNA 1HKKA 2QCLA 3S2NA 3B0PA 3TA9A 5JH2A 1AH3A 3WO8A 3GUGA 3HQOA 3MHGA 2X16A 2GLKA 1WOAA 1ISXA 4JTGA 4KCVA 3LCGA 4MJMA 2P53A 3ZLGA 4IIBA 3S47A 2V63A 1G9HA 4R33A 4NUWA 3WLHA 3LCIA 4Z1CA 4CU7A 1H49A 4ICNA 4GQQA 4CN1A 4TX6A 1U5JA 2HK1A 3QSRA 3NL3A 1XSIA 3WLQA 1LL6A 3RAOA 3BC9A 4Q33A 4NAFA 5EFFA 1ZUAX 3CUXA 3HPAA 3UJFA 3RM4A 4WLCA 4J5NA 4K7YA 5JMUA 4IG2A 1JCTA 1T8QA 1JQXA 5U7SA 1M53A 3BLDA 2BVDA 4S3JA 1S1PA 4HK5A 1D8WA 1H61A 3V75A 3E0VA 1Q45A 1A5BA 1E6RA 5CPLA 4O0ZA 1V5XA 1UOKA 5HDRA 1TX0A 5XINA 1MFVA 2O9RA 4H41A 2ZUSA 3KBVA 3SCTA 2BOEX 3GFZA 2XN2A 1F6PA 4PCTA 2P8CA 3OGVA 3HV8A 3A5VA 4ML4A 3MCMA 3PPCA 4QE5A 5HAOA 1UR4A 3VZZA 5C9XA 2FH6A 1TWDA 4LCSA 3W1AA 3FA4A 1B1YA 3EXSA 4ZQCA 4E2BA 1H2JA 4DXXA 1EP3A 1QK0A 3QY7A 3HPFA 1GEQA 1CIUA 4GQGA 2PDKA 1ML1A 1W2PA 3LNPA 4AWUA 4AYGA 2FTPA 4TVDA 1W9DM 4HN4A 4PGLA 3EZ4A 1XUZA 3CZJA 3UJSA 2OXNA 2D3NA 3ES8A 2Y8VA 4ADUA 3PJTA 4DPPA 3TQPA 2WSPA 4PMVA 1OHLA 1YPFA 4WXZA 2PDCA 1KLZA 1W9UA 3GXMA 3TOYA 3SRKA 4DB7A 5I78A 4IGMA 1AVAA 3LHYA 4E8GA 4KGLA 2Z1VA 3NQ8A 5D9OA 2CLKA 4JNZA 1XISA 1FRBA 5D30A 1RP9A 1AD1A 2UBPC 5F4WA 4B4HA 1E56A 3TLLA 2DY3A 5HJXA 3K2GA 3LERA 2ZRVA 3B4YA 5LIKX 4R9XA 3GR4A 3NWRA 5IFPA 3ID7A 2R94A 1LBLA 4BQ2A 1PSCA 2D22A 3W7GA 2G41A 3BCFA 4WSKA 2VM8A 4NYYA 1VCGA 2OO6A 2WJZA 2JKAA 2JK2A 3U2OA 4IXXA 2AMGA 4I8DA 3V16A 5CPQA 5CJNA 3ARZA 3LV6A 2CHRA 5CSRA 3V1HA 1MXSA 2V3FA 2RH9A 3E2VA 5GPRA 4EE9A 2PRMA 2ZUWA 2Z6IA 4IIHA 2HDJA 1W0MA 3W72A 3O0FA 4JHZA 3BV4A 3VZXA 2V8ZA 3H2EA 3MANA 3MUXA 4AY7A 3EOEA 4IM4A 1A3HA 1W3LA 2J7DA 4C1NA 2WPGA 4U2YA 1GQKA 4HSNA 4DN1A 4M5PA 4IIDA 2PUZA 2WVVA 2HXTA 4JTEA 3E38A 3PTKA 1RH9A 1FXQA 1W5OA 5KZEA 7PTDA 3EX3A 3IPWA 5EMJA 4LAUA 1JDCA 1FXPA 4Z17A 1D7KA 3SBFA 1Z89A 2QVNA 1OWQA 1PZ2A 3M7SA 1D8CA 3THAA 2ZWYA 4LY4A 3NZPA 3BAIA 2F61A 4UTMA 3W02A 3M5YA 4EWJA 1RD5A 1QI5A 4GIRA 1CGTA 1ISVA 3M9YA 1HJVA 4PUWA 5A6JA 4IMFA 3SCWA 2ZX8A 4FB7A 2QF8A 2Z1BA 1LTDA 2WJFA 4C90A 1MMFA 1GVYA 4NJHA 2DZTA 2GSHA 3DENA 4N6EA 4X0VA 3U5UA 4C1KA 3HU7A 5A2AA 2E9LA 1R47A 5D2WA 3RRAA 4JTLA 1FKWA 3CL6A 1UYQA 1DIEA 1KM6A 3N11A 1E1CA 2PGFA 4LPCA 1MFUA 1CGYA 4FXFA 3P60A 1JCXA 3KRZA 4CVWA 4W84A 1XYMA 1V6XA 4FALA 3BGGA 2ZBTA 4TMBA 2HNEA 2CITA 3IWPA 3EDJA 3KS6A 3AMDA 3BCJA 3UCDA 4Q4PA 1IQ8A 5GNYA 1FX6A 5E09A 2WMGA 4HOWA 3PZIA 2BOGX 3AYTA 1EX5A 1NY1A 2G3JA 3D3AA 5I7GA 1HXJA 2A7RA 5BRQA 4LFYA 3AHZA 2W5FA 3DX5A 4WJEA 1CXLA 5AB3A 2BASA 3FYYA 4IFOA 1TG7A 4G9PA 3TW7A 2XFRA 5XIMA 4A35A 3WQGA 1J96A 2HVMA 4WKHA 4M7SA 3UWQA 2VX4A 4WY0B 4GYPA 2CEQA 3LU2A 1UZ4A 4PUEA 3CYVA 2J7HA 3UZJA 1ZAIA 1W9VA 3S1UA 5I3GA 1F9CA 3G1SA 1F4AA 1P6BA 1SSDA 2C19A 3N04A 5CBBA 2PRLA 3W37A 1MWOA 4Q8NA 4OQVA 1T5AA 3WNLA 4FX6M 4CD5A 4HZ8A 4TVUA 2BZNA 1E71M 3ZJ8A 1SW3A 1DWIM 3CXOA 4XG1A 4CLMA 4IP4A 4DYEA 4ZXLA 4E8DA 1UWSA 4JX5A 5HQLA 3DFQA 1R6WA 2FMOA 2PLKA 1KM5A 1JPIA 3G5EA 2Q8LA 3GVRA 1K6AA 2OCZA 4HYVA 2OO0A 1P48A 2O0TA 3QBUA 2UV8G 3E2QA 1DJQA 1FCQA 3GNRA 2V3GA 2OGJA 4GISA 2D24A 4AZCB 1J6PA 1PZ1A 4JN6A 4O1CA 3KAOA 3QOMA 3IJ6A 5H8PA 4LGXA 3W53A 4J28A 1M7PA 2PD9A 3OTRA 5DY2A 1S3TC 3QZAA 2UY4A 2VC7A 1B0IA 3SQMA 4JFWA 1W37A 1J2BA 4CU8A 3MP5A 4F9JA 3TR2A 4CVUA 2Z7KA 3PR2A 2TMDA 2A21A 4BY3A 2WM1A 3DG6A 1S5VA 1JXKA 3EB3A 3QVQA 4GI6A 3EDFA 3I7SA 4OKDA 4C65A 3F03K 3GDKA 1O7AA 1JJKA 3VM5A 2ACUA 3HA1A 5HA7A 4HNTA 1MRQA 3KBNA 2ZKMX 3VIGA 1JCLA 4B16A 1A5LC 3BPWA 1QK2A 5AHFA 1M3UA 4S3FA 2PDXA 3WJXA 2CLEA 2P1FA 4B5VA 3VPLA 2VC9A 4XAPA 1JZ7A 3U9IA 2HISA 1QNSA 1TRDA 2NVDA 1WBJA 4WZHA 1DQXA 1XKJA 1AJ0A 4AF0B 2W6RA 4UTTC 3RUBL 3FYOA 4E38A 3LGDA 1D2KA 1KTBA 3AXKA 3IJQA 2ISDA 2X09A 1AH4A 5I02A 1LJYA 3CV2A 5BWFA 2Q01A 4D72A 2GL5A 3FHQA 1K7EA 1UH3A 4XD6A 3OLIA 3L12A 2OYMA 1E6PA 5HNUA 2ZVIA 4H2CA 2QYGA 1M03A 3K13A 1DP0A 5IM51 3GBEA 1D9EA 3CHFA 3UFYA 5BNKA 2Q09A 5DCBA 3TAKA 2ZZ3A 1V79A 2ZRXA 3G1AA 3O0KA 5KEZA 2YSWA 3EDKA 1MZRA 5AYYA 1RBLA 4G6CA 3S9IA 4GCXA 4LAZA 3W7JA 1UUMA 1BQGA 2Y24A 3R0KA 3IJ8A 1IZJA 1KBJA 2E6FA 3VGHA 4NAFB 4L7ZA 1JPKA 4YTSA 5CAKA 2YYUA 2WNNA 3FY1A 3O6DA 1UR9A 2J8GA 3QQ1A 1VP5A 4F9DA 4V2XA 2WANA 3LEPA 3I6EA 4LEFA 3PFMA 3VAVA 4MFDA 4NZ4A 4QNEA 3MP4A 1ZBCA 2INEA 3TTYA 3QLDA 5IFTA 4URIA 5A69A 1NQ6A 1QI0A 4IHCA 1W3KA 3W88A 4Q8QA 3ANUA 5AC7A 9RUBA 2PDMA 2EJ1A 2I1OA 4BI6A 1SO3A 3ABXA 3UD6A 3TJ4A 1ONXA 4H6RA 6TAAA 4ZO7A 2ZRZA 2ZZ1A 5LXXA 3SJ3A 2G97A 4K1GA 4DJFD 4XB3A 4HK7A 1J8VA 3PBUA 3LQGA 3W84A 4F0MA 3W29A 1H50A 5JVLA 1Y8BA 5DY3A 2HE8A 2ZYFA 3HO8A 3HPXA 1UWRA 4AZBA 1R3RA 1KFBA 2DSWA 2O56A 3ANYA 4V28A 2BFGA 3W2UA 2GVGA 3CTTA 4AFYA 2W91A 1Q13A 5HR7A 4J3SA 3H4GA 4IFRA 1O1ZA 3MUZ1 3KP1A 7A3HA 4HYRA 3BXWA 3VC5A 3WD3A 4RUBA 4IXHA 1QTWA 3GS6A 3AZTA 3R8GA 3WSUA 1GHSA 3VIPA 1K7XA 2QCEA 4MWAC 2Y70A 2INFA 4AYSA 1R30A 3B3DA 2VGFA 4R85A 1JDAA 4ROQA 3C61A 4HA4A 3IRSA 4RPPA 4U3AA 3RLVA 1LRNA 4LBSA 1LROA 1CLKA 3FOKA 1I8JA 3CQJA 1QT1A 1UR0A 2FJKA 3RX4A 5FF2A 4OOZA 3PZNA 1QI2A 1J5SA 4G7EA 2NT0A 1R46A 4GVIA 4JTAA 5AKQA 1VBGA 3K8LA 4GLEA 2CNCA 2RKXA 3U57A 1BTMA 1VBJA 1XBYA 1YXDA 3MCOA 4F8XA 3CL7A 2QUUA 5AN7A 2QAPA 3STEA 3PWIA 4LX4A 1V02E 1H7RA 4XZ9A 3GRIA 1J0YA 4J2MA 2RGLA 3VKBA 4CEUC 2D0FA 3BICA 1GNXA 4XZBA 4ZB2A 3SAZA 1JUEA 4QJ5B 2QCHA 4R7OA 3LPPA 3W82A 4MNLA 1SR9A 3NDOA 1NOUA 2EKGA 2AKZA 3IJIA 3PZTA 2HBXA 1KXHA 4PCPA 3HGRA 2H8XA 1EEXA 1T7LA 4ZOBA 3MVIA 1ONWA 3IJLA 2WOQA 4L1XA 2YA1A 2F8QA 2YXOA 5CZTA 2HPMA 2J6XA 3OA5A 3VDCA 1KM4A 3MUCA 4CGTA 3VM7A 3MZ2A 5LYRA 2G3NA 4UZUA 3FS2A 4PUKA 4D6EA 2VQUA 4GUFA 1UZ1A 2SFPA 3AALA 3UWYA 5T8GA 1ITXA 3W7EA 1LWHA 3NVTA 4AD3A 3IJ7A 4NZ5A 3EEGA 5CZKA 4LCRA 4PUDA 1QNPA 4JTTA 4IPPA 4EACA 4NRSA 4OU1A 4YLWA 3W7OA 4LVGA 3VGGA 4FI4A 1FWNA 4C7FA 2XU2A 4LT9A 1TCDA 3HN3A 3EB4A 2X8RA 1XLHA 3WQ6A 3WLOA 4W7VA 3BZJA 2UY3A 2OSXA 1UD3A 4C6FA 3NQ2A 3DGBA 1X6NA 3VUSA 2QDHA 1BYDA 3LSBA 3E0IA 4M80A 1QBAA 2DT1A 3IS4A 5DANA 4O1DA 4HCDA 4O50A 2CHOA 5G5IA 1KB3A 1OGSA 4CCZA 5CZSA 3A21A 1KFLA 3QY6A 3BMXA 2PWDA 3E3HA 2WLYA 1YBQB 4I7UA 3ARPA 1XPYA 1XXXA 1EYEA 2F84A 2W0UA 2WQPA 5FJTA 1CLVA 4BEUA 4ZQRA 2ZUUA 3QC3A 4I9JA 1JYNA 3WQ5A 3ZT7A 1V6UA 2H3DA 3DFSA 3DHDA 2ZIDA 3C86A 1GVSA 4Q3MA 3TMQA 3UNTA 4DHGA 2HROA 3VIHA 9CGTA 2Y8UA 5M3WA 3TW9A 1XPGA 1VFFA 1R5YA 3FAWA 3EXTA 4IF2A 4J35A 3GIPA 1PX3A 2VWSA 1RLDA 4L4OA 5D09A 4BWLA 5LIXX 4YPJA 1EC8A 3CUJA 1IT7A 1O12A 3MMUA 1A47A 4JTSA 3SCOA 4GIEA 1TV8A 3PFRA 1K8XA 3R5EA 4JGDA 1UKQA 4I5XA 5D38A 1B3YA 2CZ5A 4EP8C 1CGXA 4YU1A 3ZVIA 4I9AA 2EKCA 3NIYA 3F4NA 2C71A 4US5D 3RR1A 3RPMA 1E4LA 3WD0A 3LD5A 5I3DA 2OYLA 2FJUB 1TUFA 1WZAA 2DORA 3SCUA 4JTCA 4YXGA 1UWQA 2P3EA 4WY0A 2YPIA 3THUA 3VMPA 1DWGM 4GUJA 2Z7GA 3N9SA 3U6WA 5EGRA 3A3WA 3H53A 3QQWA 3HGOA 5FI8A 2J9XA 1FWJC 1DHKA 1V0MA 3KLKA 4CU6A 3AOFA 3NL5A 4WIWA 1QAPA 4XVDA 2WXDM 1V03A 2Y0FA 3WBAA 1F61A 1WKFA 2JBMA 3BGAA 1W56A 3TYZA 5J8LA 3CJPA 1P6CA 3RO6A 3MBDA 4F0KA 5JIWA 3QPYA 3W07A 1FCUA 3B9OA 1X1NA 3PP7A 2NVCA 1YDNA 3IV8A 3UR7A 1NVMA 1H7XA 3D5HA 3FSTA 3CT7A 1XRSA 3VNMA 1Q6DA 1JCNA 4PMUA 2CLMA 4Z2GA 3UF9A 4UTLA 3SY5A 1XLIA 3T40A 1KV8A 2GQ9A 1WKDA 4DWSA 1CCWB 2MUCA 3O2LA 3FJLA 4QEHA 5FIPA 4FOJA 2DJXA 2ZZ4A 4Z2LA 3PB0A 1OC7A 4EX4A 2YCLB 1VYPX 4ZENA 4JY9A 1GQIA 3PJXA 2MANA 3A4XA 3DN5A 4JTRA 4U10A 4P7RA 1OC5A 3SUWA 1TTIA 3V36A 4W88A 1M7JA 3TYAA 3SUTA 4N0RA 2I5IA 1KBBA 1YPIA 1PZ3A 3BG9A 3INPA 4NX0A 4IPNB 1WQ5A 4XWUA 4D6FA 4QHRA 1KQZA 4N6FA 3UY7A 2ONEA 4UOJA 4GG9A 4KEZA 4QG8A 4A8IA 1QNVA 4MAVA 4F2TA 1XLFA 4Z1BA 3CK5A 2HCVA 2R14A 1OIFA 2PAJA 3C2RA 5FL0A 5I00A 2QUNA 4XSLA 1SZRA 5EPDA 4JIRA 3BAKA 3GD6A 3KVLA 2AL2B 4G7FA 1WB0A 3NPVA 2QPXA 4NZCA 4DJEC 4ASTA 2B31A 1N2VA 1T40A 4WSHA 4KRZA 2ZUVA 3MKKA 3W23A 4BI7A 4FXSA 4ATLA 4FF5A 3H21A 1SJBA 3W38A 1Q4WA 1BXCA 4R7WA 3RLGA 1TTPA 4GY0A 1MDLA 3ALFA 3IAPA 2ZFAA 1WAUA 3AIUA 3KDOA 1OCBA 3E9AA 3I68A 4GC3A 1SJDA 1PDYA 3KOXA 1D7FA 1UZDA 1OX4A 4LUTA 1ADSA 2F9RA 4HNCA 2X2YA 3I10A 2WM0A 5I03A 1GVOA 2ZE3A 3I7RA 1V3JA 3M0MA 4JQ3A 3WUBA 1IF2A 4ZOAA 4AHQA 4AMCA 5F4XA 4J3UA 3AS1A 2EG6A 3M0XA 2FVLA 3D6NA 5HMSA 3SIZA 3G6MA 2FHCA 5HULA 4PMJA 1O95A 3BO9A 4RNIA 2YB4A 3B8TA 1J79A 2AAAA 3UR2A 4LV9A 1FFQA 4J3WA 3ITLA 4OGZA 1AL7A 4NJGA 2C6QA 3UG4A 2ZTJA 4AX6A 5I3IA 2PDGA 7TAAA 3H7RA 3G8RA 1CXFA 1NOWA 4RZ6A 1HUVA 1XIGA 2OQHA 1YADA 1J9YA 1J0JA 2VFGA 4OIFA 1LRQA 3HZ3A 5LA2A 1H7PA 3P3BA 3ZM8A 2VJXA 2V0TA 4XV0A 4W8LA 2CFFA 3EX2A 1SM9A 2HSAA 3E2SA 3P82A 1ODZA 5I23A 1ZZMA 2W61A 1NDWA 2CESA 3STFA 3GDMA 2OYKA 3VCRA 3VOCA 1E0TA 1G4PA 4YYFA 1UD4A 5BYWA 2E4TA 4NSBA 4O13A 2YL5A 3GYEA 1WX0A 4NKCA 3LDVA 3WJYA 2JF7A 1JEZA 3NDZA 3QGAC 1G7UA 3ES7A 1FWHC 3W1TA 2WW5A 1ZRQA 3IVTA 1QPKA 2E8ZA 2AL2A 2O4MA 3CB8A 2QJJA 1HTIA 1DXIA 3O05A 1KTCA 2G8ZA 4QS6A 1ITQA 1T6MA 1H5VA 3CUHA 3GKAA 4H7ZA 1RXOB 4GE8A 2FGLA 2NQ9A 4RNJA 1KM3A 3H55A 3N73A 1DL3A 4F0HA 1BWKA 5REQB 3MV01 5C9WA 5G4EA 2OKOA 4IL0A 5F2LA 4JQ2A 3FEMA 4JTUA 5JXQA 3ARYA 3NZGA 5JBDA 5CLWA 1TPVA 5G1TA 4Q8TA 4L6HA 1PO9A 2E6YA 4JFVA 1VAHA 1K9TA 4JTDA 1SU5A 2GSEA 2C8NA 3M43A 1MEIA 1H7WA 1VS1A 3WMCA 4IX0A 4PBEA 4UTKA 2Z24A 3BVJA 1WOBA 3S2LA 1ZPTA 1GZJA 2ZUMA 5G2IA 3ME3A 2H9AB 1UQYA 2Q71A 2C3ZA 2UY5A 1IWAA 4LVAA 5EFDA 4ES4A 3V5CA 5BMXA 4TQTA 1R0MA 2TRSA 3FDKA 4LRSA 4Q8UA 3LGGA 4J7RA 3TTQA 5FJUA 1TQXA 5T9CE 4DWSB 2QW5A 4HYWA 4P8XA 3B0UX 1LLOA 2FGZA 4ZSUA 1ZBWA 4DBWA 4QLLA 4M6UA 3AJ7A 2GJXA 1P0NA 2P50A 3UJ2A 2HE5A 3DAQA 3EPOA 4GPNA 3E5BA 1RAKA 2HJPA 1I1XA 1BRLB 3JVAA 4JICA 3TFCA 4OFCA 1KA9F 2Z1KA 4XZMX 2C91A 3KX6A 1RSCA 5CBJA 1J11A 1ENUA 3QMTA 3WQ4A 3FN9A 3OW1A 2X42A 1SFTA 4AIUA 5HWNA 5C9ZA 4JS3A 4BF7A 4EANA 3MYPA 1H4PA 1L8PA 3U4AA 2RDWA 1C9WA 4KW2A 1RCQA 3L68A 4WDXA 4K6AA 1DHPA 5K2ZA 3W1QA 1AW1A 1XYLA 2XYLA 4V15A 4KIRA 3LLFA 3UG5A 5LNSA 3ATZA 4Y90A 4TXEA 4GNJA 2GVLA 1OF8A 2WWDA 2V69A 4GACA 2WMIB 4LUSA 1PCKA 1DIKA 1P4CA 1TPWA 1I2PA 1E40A 1JNDA 3GXDA 4P2VA 1A5NC 1NP2A 1WDPA 1W1YA 3AWOA 2ZVRA 3M0YA 3VNLA 2ZZ7A 5E9AA 4GD0A 4QQUA 3VIFA 2W27A 3EAUA 5JU6A 4WQ6A 1TR9A 4PTVA 1DJZA 4MNKA 1MXGA 2VUYA 1G5AA 1GTEA 1Q63A 4QIUA 4JN7A 4MYAA 5M2FX 1BHGA 1WUEA 3WQVA 3TJIA 2PB1A 3C2VA 3EDDA 5FL1A 3EYPA 3OLGA 3CPGA 3GO2A 3NQDA 5A8PA 2DEPA 4K8HA 1B57A 4LF2A 2NX3A 1EF2A 1QPRA 3P0XA 1KM2A 2QJGA 1KXTA 4RLIA 1V93A 4JFTA 2EF9A 3SRDA 4NF7A 3W4RA 3QXBA 5CGMA 4S39A 3W70A 5A8QA 1MZHA 1UIOA 3QJAA 2J8FA 3CV7A 4JKLA 4ZBCA 3ICJA 3A47A 2O7SA 2VO5A 3TA6A 1V7AA 1TRIA 4PUUA 4C6QA 1VPYA 1XIMA 2ISWA 2WWCA 1ADOA 5AVNA 4XD4A 1EHNA 2PTDA 2YL9A 2NXIA 4LXFA 1XH2A 1EUAA 4H1ZA 3I4EA 3CQ0A 2E77A 2VDGA 4W87A 3P6LA 3E96A 3FNDA 2VZUA 1C9DA 3QEZA 2NQZA 3HM7A 5E0CA 1A0CA 3ZSTA 3OBAA 4MZ8A 5B7ZA 3THQA 1KR1A 2OLAA 2NV1A 4GVGA 2CLOA 4AEOA 3ELFA 2WNZA 1OEPA 4BI5A 2G0WA 1M7OA 2QGYA 4JDBA 5M5DA 5IDIA 1QPNA 3T05A 3PNZA 1W1B1 2BS9A 2R91A 1ZALA 2I57A 4UFKA 3DYMA 2ATSA 1WDRA 3R13A 5A8NA 4BHYA 2JKEA 3SEPA 2OSWA 7XIMA 1XD0A 4A3HA 4HU8A 1BKSA 2VRKA 2NX9A 2X0SA 2X0YA 4NQ1A 1R3QA 1JGMA 1KRBC 1XC6A 4LAKA 4AHOA 1B30A 2QCNA 2WJDA 3O8AA 3FKRA 2V5BA 4IIGA 3P8JA 4AH7A 2VZTA 6CGTA 3TSBA 4XAFA 4YNGA 1OINA 4MLRA 3EX1A 4NU7A 1GQLA 3MI6A 3WY1A 2A85A 3LHTA 4ERIA 1HJXA 1TELA 1OQFA 1E70M 2BMBA 4UMCA 1GJWA 4HMEA 4KEVA 3WENA 2XH2A 2B7QA 3FGCB 2YDQA 3GM8A 1JDFA 3ITTA 5F2MA 3EWXA 1GKQA 4YTQA 4R53A 3NXFA 2PDQA 2VNCA 1WZKA 4MVAA 1E1CB 1XGDA 3TVAA 4WDUA 4LU0A 2JIWA 4OZOA 3O6CA 3KTSA 5J5DA 1W2VA 2QUVA 1WKEA 2ATMA 1UP0A 2OR2A 3E0LA 3FW6A 4M82A 3QF0A 4M6PA 5CH9A 5D9MA 3LCWA 3QKEA 4O1EA 4L9ZA 4EIVA 4FX8A 4RDVA 4GGBA 3RO8A 4WR3A 2A79A 4S3BA 1TVNA 1CNVA 4ZE5A 2B7OA 1I0BA 2GUUA 1QHZA 5A6AA 1NF0A 1OFQA 4NAEA 4WSJA 4AZGA 2W67A 4IQEA 1GKRA 2I56A 2ZZ5A 5EY5A 3P81A 3CTLA 3QQ0A 3TMLA 1VJZA 1M68A 1XQLA 2X2GA 3GAKA 4IWWA 4JTQA 2C7FA 3UA3A 1OG0A 3JZUA 3W85A 2C13A 4UTHA 3GXPA 2WSRA 5DXXA 1HG3A 5AZ1A 3W86A 4O4WA 3RN6A 4LH8A 5HATA 2GJNA 3TR9A 2QMJA 3PTQA 5KMYA 4F40A 2Y7EA 3MKCA 3UCCA 4E3VA 2NUXA 2AGKA 1ZJBA 2C0AA 1E6QM 3N29A 1YXCA 3S1VA 1UA7A 5FJIA 2BSLA 4JX6A 2GDUA 4FZIA 4R88A 2E5CA 1KBLA 1DQUA 3R89A 1BQCA 2FFCA 1TPB1 1MW2A 3MY9A 3L4XA 5ABGA 1AMKA 1LWJA 4U31A 3T4CA 2EPOA 1SFSA 2BXVA 2IXUA 9XIMA 4Y8EA 2OJPA 1W3IA 4EPKA 1XL9A 2GVYA 3D47A 5CJMA 5LIWX 3QR3A 3OQ8A 1M6JA 3FEQA 4H01A 3R0DA 4GVFA 4NVTA 1VRXA 3ATYA 1XX1A 5TNVA 2P0OA 3SW6A 1K77A 1T41A 3SCVA 3C52A 1W1A1 3BARA 4GUGA 3MI2A 2J9YA 4ZODA 1P0DA 1BWLA 4I6VA 4KERA 2I9EA 2R9RA 3QV9A 1H5YA 1X8CA 1Z41A 4ZSTA 4RZBA 1U1HA 3EOSA 2CBUA 5BOOA 3VDGA 2VGIA 3S5YA 3W2NA 3T0DA 1GGOA 3N2TA 2JQXA 1HKWA 1LUCA 4WEVX 3S2MA 1EJUC 3GB6A 1S38A 3N2XA 4UOQA 3TC7A 3OGRA 2W4XA 1LOSA 3SY1A 4DLFA 4JTIA 4AZ7A 3B0XA 3T7VA 5AFDA 4DAIA 1JFXA 2WCAA 4MYXA 2YLLA 3PVFA 4FLSA 3UYIA 2REQB 4HOXA 1HW6A 2WQDA 1UD8A 3UGRA 4DWSD 1G6CA 3VDAA 3UBPC 4J3TA 2DZPA 1QW8A 4YN5A 5A95A 3APTA 1TREA 4IQLA 3WUFA 4AF0A 5A1AA 2RDXA 1DPMA 5I2UA 5AYBA 3U7BA 4E0CA 1YX1A 1ITUA 1POKA 1CXKA 3OLDA 4IGSA 4Y9AA 3QN3A 4ZE4A 1LLZA 4H9MA 4WKFA 3IIZA 3NO3A 2NQ5A 4U4MA 2DIKA 5I06A 1EDGA 4TMCA 2V30A 2YIHA 4IFKA 5M03A 3N14A 3BJSA 8XIAA 2R1PA 5A3HA 2BTMA 2G3MA 3BMWA 2PA6A 3V5OA 2RDUA 4N9BA 3SIMA 2Z00A 1XLMA 1W1VA 2Z1WA 1HJWA 1Q6EA 2QT3A 3OU8A 2X1IA 4W85A 5FEWA 3NM3A 4NL1A 4YCOA 1OC6A 4GO8A 3GNDA 3DU0A 3B8IA 1GYLA 4WK9A 3TJXA 5BXSA 3WQ8A 5IDZA 3WQDA 2ZXAA 4UFJA 2X1SA 1MEWA 3WMLA 3PPGA 3W74A 2CLPA 4GVHA 5MKGB 2PWUA 2R1MA 3WL0A 4MDPA 4AD5A 3SFWA 3IIPA 4B9ZA 3OGSA 2IKGA 4DIAA 4W89A 4S3EA 5GJPA 5C54A 4MLJA 4DPQA 1X6UA 2E6AA 4QR6A 3S2JA 4UNKA 1IEWA 1A5UA 1SMDA 3J7HA 4I3GA 1QVBA 4BWLC 1ZNNA 3AZSA 2TYSA 5HOSA 3DYOA 3AWNA 3IANA 2RJGA 5HWJA 1OX4B 4HP5A 1OSEA 1UZHA 2VOMA 4EXBA 4QTGA 1VB9A 1W8SA 2DH2A 4ZOCA 3GHUA 2E9MA 1IWPA 2W79A 3KHDA 3UEQA 5D2YA 4UR7A 1A5MC 3MCNA 2Y62A 2OOGA 2OQLA 2PI6A 2QCDB 4Z0JA 2FHBA 4MJ2A 3W28A 4G1KA 3H2CA 4M6VA 1CLXA 5CBIA 3UP8A 3SQSA 2J66A 4AD1A 3U0HA 3BANA 4B91A 1JL8A 3TNOA 4XKYB 2PC4A 2V3EA 5IOBA 2X7VA 4AVFA 2BGNE 3UZXA 3KVJA 3NDYA 1FVPA 4R27A 4IFKB 1W3JA 5I3JA 2QQ6A 6TIMA 3EB2A 4WHBA 3JS3A 1PZ0A 4DO5A 5LSMA 3TC3A 2OSYA 1Q2SA 1H60A 4OBSA 1JRBA 3VE9A 3ARQA 4O1FA 3L4VA 3UR5A 2BY3A 1KRAC 1OGBA 2DZSA 1JZ6A 1Z42A 4ZO6A 3FXYA 4B3LA 1FH7A 4JAWA 1HJSA 3DOPA 1PKYA 1B5TA 3ZZ1A 3M16A 1UMYA 4MSSA 3N3MA 2XSXA 2J79A 1FWEC 3ARVA 4UQCA 2JE8A 1U83A 1R3YA 1VLWA 1UR8A 3TQ0A 2J4GA 2VCBA 4P7OA 3QH2A 3ALGA 3PS7A 4XIAA 2JKPA 1CI1A 3W0KA 3APYA 4AZCA 3VD4A 3REQB 3FYPA 1BSIA 3SO7A 1E55A 4HZ6A 3TSMA 3H2FA 4GC4A 1JVNA 2GGEA 2ZXBA 4D9PA 1BYCA 4PMDA 1DOSA 4JY8A 5EMUA 4KCTA 4IQDA 2DP3A 1UD5A 2HVOA 1EJWC 4V1XA 4Y96A 3AXXA 2TSYA 4CNNA 3BLEA 1KM0A 1V08A 3USZA 3GY1A 1OIMA 3OB8A 1DWHM 1UP2A 5C5YA 5GNZA 2RJHA 4GGHA 4YL2A 2RAGA 4L56A 5I6SA 1HF6A 5DN1A 1YHTA 5D04C 1CB2A 1N82A 1TO3A 2GOKA 3L4UA 4GKTA 1E4MM 1SW0A 1FWFC 4W7UA 2DIEA 1EEPA 5HNRA 3ZLHA 4WJXA 3GZ3A 1CX9A 2IMRA 1R2RA 3SY8A 2OELA 3SI9A 3NSNA 3R0UA 5FF3A 1LOLA 1WP6A 2GVEA 3N9KA 5HUOA 3B8VA 1KGUA 2PSNA 3MPGA 1F6YA 3GW0A 4F0SA 1OVDA 1X96A 1S1RA 3HGJA 2X1RA 3DFPA 1YDYA 2PDHA 2OEMA 5BWAA 1QPQA 3GU2A 2OKTA 3F7JA 4WGXA 4FOUA 1CW2A 3C0LA 4S23A 3TWAA 4RK8A 5JH1A 3DKJA 4C6JA 1LF1A 2I16A 3CIXA 3NPUA 4H8HA 4IOTA 2E5DA 3H12A 4LW7A 4QJ3B 4GH1A 2AGTA 2XGIA 2PWVA 3VIIA 4P8VA 3OVQA 4ROPA 5D33A 1L9WA 2E67A 2GSJA 3E2RA 1AH0A 3S5ZA 4KEMA 4DX3A 2OLHA 4BQ4A 1YNQA 3E02A 4FNQA 4MNMA 3SFKA 3WD1A 2CW6A 3OQEA 3IACA 3GBDA 4AZ6A 2C79A 4Q7BA 1H0GA 3HTWA 1FP9A 4UQBA 3ITCA 3P14A 2R24A 4D8LA 3WEMA 1UKPA 5B80A 2J13A 4Y9OA 4BS0A 1GKPA 1TWSA 2JEPA 1Z8AA 3WNKA 1X98A 3EPMA 1HKVA 1FHLA 3A12A 7CGTA 2Y4SA 2FTWA 2Z29A 4LJ3A 3UXAA 3RMEA 5ECUA 3P8IA 1QASA 2PF0A 4Z1AA 1RQBA 4FNPA 3WQCA 4K38A 1VC4A 4N42A 3VGEA 2VDHA 2Z4GA 3H7VA 4XAZA 3W22A 1W9XA 3FHAA 2Y7GA 4RDWA 4XBKA 4AMAA 3GC4A 4QX4A 3GK0A 2VXNA 2Y89A 1DV7A 4GI4A 4AWSA 3WQEA 2FB2A 2CBJA 2VTFA 3NZQA 5BMWA 4HU3A 1K4HA 4MIMA 1DVJA 5HNTA 5G1YA 1C7TA 1T0OA 1MNZA 4LUSB 3U8GA 4I90A 1TZ7A 3ABQA 2CYGA 1GOIA 2WJEA 3W1RA 3LBOA 4R3UA 3URAA 2W63A 4GABA 4ZTYA 4REQA 3M5XA 3N25A 1XBXA 4I9TA 5CXPA 5JBFA 4PMRA 3FFSA 2E1WA 1LM1A 5HPOA 3NURA 5CPMA 1W3TA 4L4MA 4UMAA 3SRHA 3KRSA 5F1UA 3G1XA 5HNNA 2VQTA 3QFEA 3WEZA 2X1UA 4UTTA 2FPTA 2AKMA 3WYZA 4C6IA 1RJPA 1JYXA 4V1YA 3CNYA 2J9ZA 3B06A 2PDIA 2V68A 1JAEA 3R58A 2VR4A 3TQKA 3FLUA 1PIIA 1ZL1A 3ABOA 1UBPC 3BE7A 3DGRA 3W76A 4TOQA 3W7HA 1TA3B 3UA4A 3H2OA 3AFBA 4WX2A 1GPWA 2QCGA 2PDJA 5LA0A 3ARWA 3WLLA 1E0UA 4O10A 7ENLA 4IIFA 1DJHA 4D1JA 2FGBA 3ENLA 2XIJA 3Q4DA 4FP1A 2IKJA 4DZIA 2QV5A 5E6YA 1S2AA 3W7DA 4UTJA 3KBJA 2VEIA 4DY1A 3SCSA 4IICA 1ZY9A 4PTWA 1J2WA 3PF3A 1EOKA 4HPHA 2FPYA 4GWEA 4CN4A 2HEJA 5AC5A 3POHA 4YHEA 3S83A 2XINA 1RA0A 4OE7A 2DV0A 3S5NA 3PBVA 1REQA 4Q4KA 4PTMA 2WCSA 5D8WA 1W5MA 3W3OA 1UQZA 3G0SA 2CLHA 3QTPA 4X61A 2IKIA 1XC4A 4DNMA 1NWRA 1XRVA 3QKZA 3C8NA 5G4WA 3FV9A 4RKAA 2YCIX 1ZAHA 3GNOA 2V5JA 5BU6A 2VR2A 3ZVHB 1FFRA 1W6TA 1G01A 4UCGA 4DELA 4HHMA 4U5IA 2D2HA 1XF0A 3P93A 4Q8PA 3LI0A 2V81A 1R87A 3K4AA 1E9IA 2ZX6A 1A4LA 2NVAA 2XGBA 4KFPA 4MWAB 2OGYA 2BHYA 3BOLA 1LOQA 1RPKA 2PTWA 2BX7A 4IP5A 1CBGA 1VHCA 4K7VA 3ITXA 3OEXA 2A2IA 1CB7B 2V9DA 3UW6A 2QS8A 2JGQA 3PPFA 1H09A 3AHYA 5HINA 2XH7A 3KZSA 5C8BB 2EXOA 1GT8A 1P1XA 3T9PA 4LANA 3AIVA 3GVWA 1QRQA 4LYPA 2Y63A 1V3KA 1CDGA 5A8GA 3C2EA 5D9PA 1BVNP 3NQVA 4O0KA 1LT8A 3LRMA 3LV5A 2EPKX 1JI2A 1EZ2A 4JEQA 4PMXA 1F3XA 2DZAA 3WX7A 2Z1XA 2WVTA 3TQVA 1PIGA 4MB5A 1C8QA 3NYZA 1LG1A 1EWDA 4O15A 5DFAA 5H91A 1VENA 4CD6A 5DXYA 4LCQA 1FWBC 3T81A 5RUBA 3HIJA 1FHDA 2DPEA 4GBUA 2W62A 1BF2A 3GDRA 3S9YA 4W8BA 5FJOA 3VD9A 1V8EA 2CU0A 3DZ1A 4MNJA 4BJHA 4O8RA 3NQCA 3WUEA 2CLLA 3LPFA 1TPEA 1XG3A 4UTUA 5CSUA 3VXGA 4LUJA 4A29A 4JTFA 1ODUA 3WKZA 3G1DA 3PWGA 4K1WA 6PTDA 1XLCA 2BVYA 3C5QA 3AIWA 4ACYA 1VD6A 1GHRA 4M51A 2E9BA 2YA0A 1OF6A 3R43A 1BRLA 4PMNA 3XIMA 3P7YA 4XBJA 2A7NA 2UY2A 2D1ZA 4H8NA 1ZCCA 2GDQA 4K36A 3VYLA 2YL8A 2QJNA 4Z2JA 1KXVA 3EBVA 2TPSA 4EKJA 1BWVA 2VRQA 4TTUA 1B3OA 1DYSA 1KCKA 3ZWSA 1E0WA 3MB9A 1VGAA 1Z3NA 4HZ7A 3GFYA 3W00A 3RGTA 2DZVA 1X97A 4Z1YA 2XJ7A 1KGXA 3E74A 3NZRA 4FR1A 1O4UA 4S3CA 3BAXA 4G7EB 4UQEA 3L4ZA 3VIKA 3Q65A 1K70A 1Y5XA 5D4YA 2CWNA 4JXCA 3VDHA 3F1QA 5D2XA 2ACRA 1EA0A 4HMNA 3CUIA 1I45A 3SCPA 3NQBA 1V77A 1WXJA 3OVRA 2NX1A 3UPWA 4D8ZA 1F4HA 1ZBKA 5FCZA 1GJPA 3IGHX 4KS0A 3HGSA 3LXAA 4Q6XA 2DT3A 4DLMA 1DJXA 2Q3RA 1XINA 3TLQA 1TE6A 1PXGA 1UOZA 2QKFA 2WMFA 1QOXA 2VX7A 1QW7A 3RLHA 5DMYA 1M1BA 1VEPA 2POZA 2QCCA 3TV8A 1FH9A 2JALA 3MYOA 5CPTA 4X22A 2XTKA 2UZ9A 1OADA 4M19A 4RZ5A 3N3TA 4FOKA 3H23A 3UXIA 1Q66A 3VD3A 2CXGA 2W92A 3W7CA 4S3GA 3C56A 4INFA 4HJWA 3R10A 4D6DA 4B4FA 1IIGA 1H11A 1EYWA 3U2ZA 1A5CA 2GWNA 1RLCL 1FWAC 2F2HA 1Z9AA 4LS2A 4REQB 3KTCA 3O06A 2PDUA 3WK0A 2HQAA 1JQVA 4W4QA 4CKQA 4DEFA 3M0KA 3WDHA 1D3CA 1ZCOA 1E5JA 2ZUNA 2A1YA 1TJPA 3ZS4A 1US0A 2WC4A 2GWGA 2NLYA 2L5HA 4YVPA 1P0KA 1WXZA 3BLFA 3PAJA 4GBDA 2PURA 1Q5MA 4MKSA 2GQ3A 3O16A 1Q7ZA 1IGSA 5FOOA 4LSBA 3PZMA 1O5RA 3EKGA 4RR4A 1LT7A 3URNA 3CH9A 3ARRA 1EWEA 3AS2A 1WE5A 1GYMA 4FAMA 1TKKA 2Z0IA 2V67A 4PRTA 4WD0A 4XIMA 4DI8A 4M29A 2XIOA 5A6LA 3VIOA 2FTYA 4GXMA 4L80A 5AZ0A 1C90A 2IQTA 1UD6A 3EKLA 4O0QA 4Q32A 3UWEA 3Q45A 4LY8A 3BL3A 2NSOA 4XZNX 1RR2A 4O4VA 3OIHA 1S3HA 3VTRA 3M1ZA 4PRRA 2INZA 3BG5A 2FZ8A 3N17A 1ZQ5A 3SADA 2GQ8A 3BAYA 3M46A 5IHRA 5HBFA 3BAWA 4QG9A 3O15A 2Z26A 3G1YA 5FF0A 1JZ5A 3BLPX 1PKMA 1L6WA 3W26A 1HN1A 3CM4A 3HJEA 5AC4A 4DYJA 4N7QA 1GOMA 4HPXA 4JIPA 4U5KA 3HBLA 1TR1A 2XFFA 3L67A 1LORA 1KRCC 4YJ5A 4GK8A 1LQAA 3FK4A 1JR1A 3IGUA 5FF7A 4GHRA 4JTHA 4MDOA 4XSMA 1LRTA 3L65A 3NZ1A 2H3BA 2DZXA 1I2QA 2O4QA 2G3FA 3D3FA 5CJ5A 3PSWA 4C7DA 3VNYA 1RK6A 2WZMA 1AQ0A 3W7KA 1V51A 3DBNA 3STGA 4M1RA 3WLJA 1XLKA 2C1HA 4QCEA 3LA4A 4G56A 3CWOX 2A4AA 1A4MA 1XR2A 2E6DA 2P0IA 3A4AA 1F8IA 3RHGA 2PU0A 3EA1A 1TTJA 3RM9A 3DXIA 4LAMA 1XDLA 1JZ8A 3TU9A 1YE6A 1MUMA 5D8ZA 5DBUA 3NVDA 3JW7A 3LZ5A 5D03A 3LB0A 4IIEA 4U2ZA 4ZR8A 4XZLX 2NW0A 4HN8A 3DC8A 3I3DA 4HA0A 3TTEA 1F05A 3ZIZA 4J27A 4NZ3A 1U1JA 4Y9NA 4QROA 1JZ4A 5HQMA 3RU8X 3W2KA 1EO5A 5LNUA 3L23A 8XIMA 3IGXA 3UPMA 1C91A 3WLRA 2Z1SA 2YR1A 4LBUA 2C1IA 4FIQA 3GKFA 1PTGA 4BR1A 3BSMA 1SGJA 3MMWA 4Q4SA 2PWHA 3WF3A 1I60A 2C0HA 3TH6A 2F6XA 3BMVA 5K9XA 1OD8A 3U7VA 3F2BA 1GUVA 4I6KA 3MHFA 3APGA 4WKAA 3DECA 4FHAA 2BHUA 3LLDA 3URBA 4S3KA 4O54A 1XLGA 3A9BA 1EB3A 2Z2AA 1LZOA 2OWXA 2BB0A 5I77A 4LS1A 1Y7VA 2REQA 3KWSA 1C8YA 3S2CA 4P7LA 3G6LA 2BLEA 7REQA 4Q8WA 2OG9A 3OG2A 3PY2A 1O1HA 1ESWA 1TV2A 1EO7A 2OLSA 2Z2UA 1OD0A 3QTGA 2OZ8A 1GOQA 4KESA 3KDNA 3C0QA 4F4RA 1PKLA 3FAXA 2J62A 2P5NA 4DF0A 1TYGA 5FEPA 5LGXA 3P61A 1TWZA 2O9OA 4JNYA 1L2QA 4B92A 3WK2A 1I75A 4HNLA 3VIMA 4AISA 3I4KA 3N13A 4IMGA 4WY0F 3W71A 4KQNA 3PBWA 3SECA 3AS3A 1KW1A 1VJIA 3OPSA 3POCA 1W54A 3GVQA 4IISA 2QCDA 3Q37A 3KOWA 5EMLA 2CPUA 4AWEA 2OMAA 4IUOA 1UWTA 4V27A 1LL7A 3P5YA 3GYCA 1UR3M 5DO8A 4Q8VA 3QPZA 3BGJA 3UETA 4JL1A 2WV8A 3WNOA 3RJXA 1X1ZA 3CIVA 3SSJA 3N18A 5E0KA 3W7MA 1EXPA 1XJBA 4A2SA 4KWWA 3LMZA 4DJED 2VD9A 4GZIA 1SZNA 5IXEA 1VIZA 1EC9A 4Q4RA 3DYPA 2OX4A 2Y5SA 4IQJA 4CN6A 2PGRA 3IAQA 2XVKA 3GW3A 2VURA 1Q6RA 3O6AA 3T44A 4XZIA 3GHRA 3IIOA 1X1OA 1QBBA 3M47A 5G4HC 4E3TA 1O5QA 4O18A 2JFEX 3M07A 2WO5A 1KC7A 1R85A 1VIWA 3OOQA 3P62A 4AU0A 1F7BA 2RHGA 5AYXA 3I6RA 2WB5A 2Z25A 1ZP4A 2PWGA 2J78A 4LVFA 2G37A 4DBUA 2ACQA 1P7TA 4H7VA 1YQ2A 4JQ1A 3WN6A 2IW0A 3TZNA 3ABSA 4HTYA 1G94A 4KWSA 4KRUA 3QC0A 3BLKA 5KITA 4MUZA 4C7GA 2A3AA 2Z6JA 5EL1A 4E6MA 3GHTA 3WCZA 4I7VA 1RY8A 2WAGA 3SURA 3F4VA 1TMQA 4Z42C 1C93A 1TWIA 1Y5WA 4POCA 3A4WA 3L0NA 4JQ4A 1L6GA 2WVVB 5IRPA 1N7KA 4ZQMA 5BRPA 3FA5A 3O63A 1Q7QA 3NEVA 1HNYA 2OEKA 3LZ3A 2XZ7A 3T4WA 4DI9A 2CHNA 4IJRA 1HL8A 4NI8A 1JNEA 3OP2A 1OFOA 2QUMA 5F2IA 4O17A 4UTWA 3BK0A 3MV11 1JPHA 4IUGA 1E9LA 4MKNA 3B05A 1JF5A 3N1AA 4O8AA 3RPTA 4LUTB 4HBKA 1RVGA 4A21A 4WJ8A 1Q8AA 3MHUA 3HFYA 1V0NA 4GCAA 3VOHA 2J7EA 1WV2A 2WMJA 3HG3A 5K7JA 4AEEA 2Z28A 4OV9A 1XSJA 7TIMA 4W93A 2O9TA 4D2JA 5EMMA 1KR0A 3IJDA 3C3UA 2WC3A 3KUMA 2Z2BA 1DJWA 2VFHA 1EJRC 4GRSA 1EKOA 2PWEA 4PTNA 2F38A 3ZFHA 3VDBA 4F3HA 4YIWA 4Y2WA 4ORIA 1R9YA 1ICPA 4I5UA 1YDOA 1HKIA 3KVKA 3GDLA 3BV7A 4HCLA