4V2CB

Mouse flrt2 lrr domain in complex with rat unc5d ig1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
b'TLPHFIEEPEDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 2
publication title Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 18
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4v2cB00
4ELMA 2GEEA 4XNMA 5C0AE 5J6HA 3RHWK 3BGFB 3CX5J 1CD0A 2W91A 5DHYB 2VABB 4W70A 1D9KA 1J8HE 1C5DA 4F3FA 2X09A 1GGIL 3BVNA 3JTTA 5FM4A 1LEKB 1T21A 3F65A 2HH0L 5K9KB 3MXVL 4YDKH 4YFLI 3HG1B 1OD9A 4LPUA 3L6FB 4I0PB 2GJJA 4P2OB 5GSRB 3ZL4H 2VL5B 2X1XR 2WIMA 3QNZB 3FAXA 4PLJD 5T3XE 1BM3L 3F8UB 1K2DB 2DI7A 1FNGA 4GJTB 3U4BL 5BXFB 1S7QA 4OZHE 4TULL 4F7PB 3PL6B 1F3JB 2B7DT 4NKIH 4M02A 4OD2A 2VUYA 5DJ6A 5DRZB 4JR9H 2NXZC 1WWBX 4WGWB 1EO8H 4N5UA 3N06B 2HN7B 4QRSA 5FOBB 3VXME 2ZSWA 4APQA 2QHRH 3EYSL 2OK0H 3KYKH 2D9CA 5C0BD 3RIAF 3H3KA 5D1QD 1JZ4A 5TE6L 2AXFB 3QUYD 2AEWA 1RFDH 3KLAB 4GBXD 5I6XC 3W9EA 2P44B 4PJGF 2FLRT 5FGCB 2O61A 3D9AL 1XH3A 5GRYA 4MAYA 4PREA 2I9LB 3D2UD 1RHHB 4UNTA 5GS1C 4KJQD 5DJ2B 3A6BL 1MFDL 3PV6A 3H7BA 3PWPA 3EYQC 4JHAL 2ICWI 5IT2H 3QI9C 4M3JA 3HE6A 3RPIB 5DJDA 2XQYG 3BZ4B 4X0KB 5F9WC 1MEXH 1IQWH 3IDMA 1E6OH 5CIPA 1BFVH 1G6RH 12E8L 2NY2C 1CXLA 2X4PB 4ZUSB 2AQ3A 3FQXB 3HS0A 1MCDA 4IRSD 4YZFE 4XPHH 3UTTD 1AKJB 4N8CL 3EBAA 1HYRC 1NGXA 3EYUL 1W0WB 3MUGB 4NRXB 5D9SA 4DTGH 4WI9A 1SY6H 1JZ3A 1Q94A 4K7PL 1I3GH 3OJDB 2JELL 3UJIH 4K8RD 4P5KA 4DK6A 3DSNA 3RUGF 3UBXG 4AM0A 2R2BA 2WP3T 4M5YH 5E2TL 3WLBA 5IR1B 3BEVA 1NEUA 2Z93B 4Z5RB 4FTVD 1NAMH 2GY7B 3MNWB 3PWVA 4P46C 1WBYB 3PGFL 5ACLA 1QFWM 2W59A 3C60A 3WIFB 1EGJA 3O11A 2HKFH 3UO1L 4QKXB 3QUZA 4JN1L 3RIFK 1BVLB 3FB8A 1K4DA 1P5UA 1ZT7B 2BY3A 4HIHA 3L3GA 3MV01 3HE7B 3PGCA 4TUJA 1E0OB 1EAPB 1NCCH 1NUGA 3L9RA 5F96H 3BWUC 1OY3B 1IGTB 3TJEH 5HGGS 4Z7VE 5DD6A 3D0LA 4BZYA 2G9HB 4X7FC 4YC2C 4IMKA 3U46A 3LPFA 3MXWL 1NCWL 1E27B 5DD0L 5J4MA 1A9EB 4CVUA 3RZCB 4ZUVB 1EEZB 3E8UL 3WFHB 1JPST 4POZC 5CJQH 1MOEA 2H2PC 4N0RA 3ARGA 2Q87A 5KJRL 4JZOB 3X14A 3SDDA 2F58H 1RAMA 3JWOL 4P2RD 5GIRA 4LLUB 1KOAA 5ADPL 3UPRB 2P7TA 3O2VL 4POYA 4K9EH 3ULUL 1WFTA 2NY4B 5EO1B 3P77A 5HGHA 4HZLB 2QEJA 2VDNL 4NUGL 3ARED 4FZ8L 3VH8G 3ARDA 4JJHA 4PJ9A 2LTQC 5FB8A 2WLYA 4OLZL 3HN3A 1L6XA 3MCLH 5DDHA 1BP3B 1OT1A 4FXGA 4NJ9L 4M7LT 4H1LH 4ZFOL 4R90L 2H32B 3RTQD 3F7RA 4TSAH 4Z77B 3OR6B 1L7TH 3IFLH 3JUYA 2X9XA 4XPBL 4ODXB 2NY3D 2BNQE 3RVXC 3UYOD 5FHBH 3RGVD 1SBBA 1NMCC 4LKXB 3EJZC 5KS9A 5MHSE 2NQCA 3ETBF 3RWEB 1DCLA 1XGYH 5SWQA 3HC4L 1UA6L 1FL6B 3MRKB 3VD5A 3G08A 2R4SH 1IFHH 2DIJA 1UGNA 4NN7C 3QPQC 4HIIB 2DQTH 3HMXA 4XC3H 4M7ZB 1PG7L 5DVLA 3TN0A 1F45A 2FX8H 2NZ9C 3SKMB 4LVEA 5BS0A 4DWHA 3LHPL 1I7ZB 4PGBB 2VZOA 1LEIB 4YXLL 1HN1A 3QRGH 4OZHF 5IM7B 4C4KT 5DJYA 5I1LA 2ZCLL 2ZUUA 5IB3A 1CIDA 4L4VE 2R56H 3GIZL 1RHHA 5DUBB 5AUMB 2VLJA 5FUOH 4JO1L 5DUPL 1YYLH 4XTRD 4L8SB 3TO2A 2XWTA 2IBZY 2XY2A 1W0VB 4OIAA 2GAZA 3PP3H 4LP4A 5ICZB 5DVNA 3MA7A 2OR7A 2DDQL 3HMWL 4U7SA 5HTSA 2CMRL 3PIQB 5HPOA 5BV7B 5GQBA 1INQB 4JM4L 1H3PL 5C0AA 3GMPB 4Y4FC 1WAAE 4PJIE 1F2XK 2WWMC 5ID0B 3MLRL 2Z4QA 2P24B 4MLIA 4M93B 4QWWC 2D9QB 4HKBB 4YAQB 5FK9B 3VWJC 5HI5D 5LKNA 4Y0GA 4JDVB 4H5SB 5FO8A 4U1SB 2VTFA 3UBXI 1ZV5A 1V7ML 3PQYD 2XZCH 2XG4A 3ES6A 3TNMA 2BNRD 1FNFA 4NJAL 1TFHA 2X1PA 5T1KA 3FMGL 3QXDA 2OZ4H 3R1GL 3U1SL 3MRCB 2B0SL 4R7NB 3IT8D 5BVPL 2DJ4A 3MRBB 2OL3H 5HHVH 4OCYH 1DN0B 5HYEA 2XICA 1JP5A 3QQ4B 5T5NF 4N0FA 4UV4H 4E42B 4UDTA 3E2HB 5INCA 5EPMB 2VIRB 3VXMA 4ZDHB 5C9JA 1GH7A 1EAPA 2QHLA 3MRRA 2XWBA 4R3SA 4YGVA 3DV4B 1Q72H 3DSFH 3BPCA 4QTHB 5CWSA 1UB5B 2YD8A 4HKZA 3D39D 1NL0H 2E6QA 4NNPL 1FFNB 1A9EA 1P4IH 3ARUA 3F7QA 1YEJL 1WZ1L 2IPKA 1ED3A 4X7TA 5F70A 2JB6B 2SEBB 5E2VL 4ZAKC 1T5WA 1B4RA 2OSLA 1LE5A 3EOAB 1D5BB 3T0AA 4JFEB 3WD5H 3GEWB 1AQKH 2DQIL 5CCKL 1JNJA 2NNAB 1KEGL 4JZJB 1TTFA 1IAKA 1MLCB 5FYLD 2EDBA 4XCFL 3T77B 1N4XL 1PX4A 2VUOA 1Q0YL 3VD4A 2A9ML 2GJ6D 1KJ3H 2V7HB 4JRYB 5B8CC 1CE1H 3U7AA 2YK1L 1A4JA 3OJVC 5KOMC 4LLVB 2VLKB 4OCMC 4JPKH 4ZUUA 1QD0A 2DQJL 1DQQA 2PO6C 4CMMB 3LN9A 1NCUA 1DP0A 3P9WB 3KPPB 4LF3B 5IB1B 3D18A 4OGAC 4LLYA 3FTGA 1N0XL 1YEKL 1LE9A 4MQXC 1D5IL 5GS1B 1CLZH 4KJWC 2QJDA 3VXRA 4PRDA 3ZDXE 5EU6D 5AAWA 4RCAA 2YD4A 1AGFA 5IKCA 2AK1L 4N8VA 4KMQA 2BRQA 4Z7UE 1LMKA 4N1HB 4Z0XA 2MCG1 2NY2B 5A2IH 1KG0A 1DVFC 2YBRB 2LVEA 1Z9OA 4JRWA 4GKNB 3MCG1 2YUZA 3TT3H 2RGSA 4YE4H 3JWOC 3VFMB 1BQHA 2JJWA 3T0VA 4U31A 1AGDA 1OTTD 4DVRL 3NCYP 5IOPB 4Z7VA 4GRLC 4RBPK 3TZVB 4M1GH 1JNNH 5ENWA 3AC0A 3DHMA 3QDJA 1OM3L 2V6HA 1J10A 2ICEA 3MGOB 5F7KC 3TVMD 5KBNC 2OP4H 3A67L 4M8VA 5D2NB 5ANMB 4ZOEA 4P46B 4P49A 5DK0A 2ZUSA 4MLSA 4GKOA 3D85D 2GJZA 4JFFA 1WITA 2EYTB 4Z18A 3BD4A 4BQ6A 5ACMA 1MI5A 1Q9LA 2FB4H 4X99A 1JF6A 4JFZH 1BGXL 3V9FA 2EE2A 3I3DA 2EXWC 1RK1A 3WXWH 3WLWC 4PBWD 4JDTH 2DLGA 2HT2C 1TMCB 3MRPA 2VXVH 4WW1B 1HYSC 1WVZA 4JZNB 1A2YB 3IU3B 3V5KA 1G7QB 5TF1L 3PWUB 1LO3L 2WUCL 4JVPA 4YC2B 2OJZH 1LGVA 3TFKC 1U91A 3D87B 3CXDL 2X6MA 4MYWB 4X9HA 4Z95L 4YAQA 1C1EL 3MLWH 3DX8B 3G5ZA 5BRZE 3O9WC 3RA7L 4W4OA 2BNQA 4FFWC 4L4TB 5KVFH 3CX5K 1T20A 1J12A 2HT3D 1FAIL 2ATKA 3I50L 1ORQB 4LRNH 2CK0H 2G60L 1U8JA 3MRCA 3CH1A 5B39A 4PJIF 2AEQL 3OAZK 4NPYB 5DVKA 5T3XH 5DRWA 4FQCH 4WUKL 3WS3A 2APWA 1A3RL 5FGBC 3VDAA 4NKQB 4PJDE 3AS1A 5AAMA 5EOCL 1JWUB 5DRXA 3VXPB 5KSBE 4KY1H 3GMLB 3FO1A 3U4EB 1AH1A 3C6LC 4LHUD 1KV3A 4OLUH 4NSKB 4PY8I 3O3AA 1UEMA 1MWAA 4ONGH 4PS4H 3IGAB 4I0KA 2B4CC 5E99L 3C5ZD 4WTWA 1X5ZA 1NGYB 2JTDA 3VXQB 3KPLA 4UIMB 5C6WH 1HH9A 3VMOA 1NMCB 3WKML 2AXGB 3V4VL 5M94B 2HFFA 1U8IA 1U8QA 4EN3A 3OAUH 2MNUA 2X4SB 5GGUA 5A16B 1ZXQA 3PL6D 5GSVB 3QHZH 4CNIA 1DTUA 2MSPA 4JPWH 3P4MA 5EUKB 2FJGA 4TUOA 3RVVD 5JNYA 5HYJB 2VLRB 4U1MB 4QHUA 4E41A 4ODHH 4F15B 4NN7B 4V2BA 3QIWB 2R29L 4FQPA 3T77A 3SQBA 3T0ED 3DYOA 3ULSB 4NM4H 3GO1H 4DW2L 4TOYH 3V5DB 5GS0L 5L2KD 2P8LB 4FOMA 5IQ7H 3MLVH 4LK4A 5HYQB 3VGBA 5J1TC 3SE9H 2W0FA 3N85H 3RKDD 3RVWD 1P9MC 1D6EA 4WY7L 3Q6FB 4B5EA 2CRYA 3ZSTA 5F3BA 1TJHL 4JM2C 1A4KB 4KUZL 4OF6A 1INDL 2B8OT 4JRXD 1DE4B 1XR8A 3CLFH 3NA9L 3UTZB 1S7VB 2CR3A 5HHPB 3TGXA 4OFIA 4LLQB 3QI9A 4YIQA 1S5HB 3QWRA 5JO5A 3TBVA 3P9MA 4WHDA 4KUCD 3HCVB 1FVEB 2OTWB 4XP1L 3V0VA 5CAYB 2HAZA 1T1XA 1WWWX 3MV7B 3RL1A 4X6FB 4XAWL 3BJLA 1TZHB 3KYNA 4Y4FB 1T83C 5J3HD 4GSDL 2VYRE 3CJJA 4D9LH 2QL1A 3WYRA 4G42A 4B7IA 2FX9L 2FYYB 1FGVH 3VWJB 3ZDXF 2OJEA 1N6QH 1XIWD 3VRLE 3BISA 4MAUL 5CJBA 1JGVH 4DFIA 2OXGA 4NC0B 1AGCB 2EKSA 4JDZB 5KTEH 4J1UB 5KVGH 2DMBA 2CKNA 4XXDB 2FGWL 2GSIB 1I75A 2BHZA 1OAZL 4QO1A 4NCDA 2FD6L 3O3EB 4NHCH 4NKDA 4NO5A 1A7RL 1KJ2B 1AO7E 1JPSH 1UJTA 4MVBC 2J8UE 1TCMA 5IEHA 3S6CA 2QTEA 3IF1B 1FDLH 3QWQB 4MCZA 2MWCA 1IT9L 2A74B 1XCQB 2FGZA 4KI1A 1UACH 5DJAA 1MFAH 2IJ0C 4JZNA 1G7HA 1AGEA 4HAFA 5IB4B 5GS2D 1CL7L 4FMKA 1S9XB 2CXKA 4ZTOH 5JHDB 1ZHBA 2XA8L 3QEQB 3U7WH 3SBWC 1AI1H 3QJHA 3ULUE 3GSNA 3U36B 5EWIH 5HVHC 5DFTA 2J5LC 3P0YH 4XBPA 4HGWA 4JCMA 4XVSH 1RZKL 4XCEB 2F53B 2D7PA 4M7LH 4QOKE 3SGKC 2BVOB 4ZAKB 4LCYA 3X13A 1ORQA 5EC2A 3WXVH 4PJHB 3KJ6L 2Z91A 3DI3B 4NYLA 3WHE0 3PGDB 3LN4A 3QP3A 5E4EB 3ZTJH 3KAAA 4ZXBD 4XMPL 4TTDD 4Q7DA 3S36X 2CDEB 1FO0B 3SJVB 5T3ZD 2BCKA 3X12B 2EYRB 2YUVA 4GMSL 2R2HB 1MCWW 4G9DA 1AY1L 3MBED 3IGAA 2P43B 1U8PA 1U8NB 4XNUH 25C8L 4HWZB 3ZHDA 2W92A 4IMLA 5DD5H 4EOWH 5I1EH 1JJUA 4PV9B 4PUBL 3D69B 3IJHA 4FP8L 4Y19B 4UB0L 2A73B 2CUIA 3ZKQD 2XWJB 3OGOE 1DVFB 4OM0L 3CCHB 2HA1A 3ULVE 3B5TA 4EZMA 2KZWA 4P3DA 4RFEB 4C54A 3L95B 1EHAA 1RIUL 1MCHA 1KJVA 2VL4A 4WNQA 4F58L 4GRLB 3V5DA 3T2NH 2BFVL 4NQEA 2ERJC 3OTTA 3B9DA 2F9BT 4NRYB 4W4NA 5T1LA 4D3CL 4HGKC 4WI2A 5ESVB 4H26A 5F72S 1DR9A 2QADB 4XVJH 4H0IA 2DTSA 2D7OA 5GZOD 1CDIA 4QHNA 1KCKA 1FVDA 1EZVY 4XNXH 1FFQA 1ROWA 5JOPD 5C0EB 3SKNA 4JFXB 1EH9A 1NCTA 1MPAH 1X5YA 5C07E 3CFJA 4YFLF 2R2EB 1HXYB 4PJDA 3ZKMD 5F9JA 6FABL 5BJTB 1T0NB 2Z9TA 5B4MD 5I30L 3C2SA 5KSBA 4WRLA 3QEGL 1OAQH 1YPZE 3MREA 4QCIB 3LH2L 5AYUH 4YDVB 4XZUB 2O5ZL 1E4XH 3KYOB 3DRQA 1T1YA 2A0LC 1JF1B 3SDXB 3S5LG 5I1GL 2BC4B 5FUCC 4S2SA 5GRZA 3GI9H 1NAMB 2WWKO 3X3FL 3MR9B 5GS0C 1X5IA 4C56D 4RA0C 1ES0A 4KK6C 4XHJD 5ILTH 4JY5H 1I3RB 2MCPH 2XTJE 1J88A 5DJXB 4O58H 3VXUE 4KK9D 4X98B 5EOQH 4LHUG 3FQRB 4NO3B 4D8PA 2XY1A 2IANE 4NWUL 2BMKB 4RGMC 5ETUB 5FA3A 1CG9A 2W07A 1NFDB 5C0CE 1A6WL 3SKOB 1F6FB 5I2IB 1H3WM 3C6LB 3FQTB 4IOFD 1QPXA 5JW4M 3MJ9L 1H15B 4ZPVB 5JOEA 3DUSB 2DQDH 2VR9A 1DUZB 4Y4HB 3PF2A 3QFJD 3RNQB 2CQVA 5MEND 2GW5A 3NIGF 5L0QC 2X1QA 1NLDH 1K5NA 3FT2A 4PB0H 4XPGH 4XX1E 3QO1B 1A64A 3MLSL 2F53A 3FCTB 3GZKA 1LEGB 2B2XH 1V5JA 4QY8A 3GI8H 4D0BB 3WCYA 3M17A 1T1WA 5E7BA 1LP9E 1B3JA 1U8KB 4WFED 1FZMA 2PW2B 2R0ZH 4KZDL 1FIGH 5DK2B 1LO4H 3CFKB 4K71C 3T2QA 1IGML 5I1JL 4LSDA 2IQAB 4L9DA 5B8CA 5DJ8B 4H1LB 5DD1H 1TTGA 1UB6B 2VLKD 3HB3C 3ARVA 1CE6B 1B2WH 1GRWA 3RWIB 4DOHB 4N0CC 1GZQB 4UILH 2PO6A 3I6GB 4JM2B 1JRHI 5D1XB 4PJXF 5F6IB 5EC1A 3VG0L 3HC0B 5J9PA 3BKJH 1VFBA 1OAYH 2VQ1B 3GSOA 4KI5E 3U7YH 5IW6B 1AP2A 2P48B 4Z7NE 3T2OA 2Q76B 1NGWA 2YSSA 4M43L 4ZTPL 1AO7A 2I5YH 3VRJA 3GSVA 2J8UA 2HJFB 5GGTH 2NY0C 2A6JB 4L8BB 4EXPX 1RZKC 4P2QB 4Z7WE 1RVFL 2KPNA 5EDXA 4LNVA 5GGRB 1UM5L 5L2JA 1UJ3A 3DTXB 3IDGA 5DS8B 3QJFA 3B3IB 2VZTA 1FQ9C 2A77L 3LSOB 4AQOA 1RIHH 1IAII 2GSGA 4LCCB 3N1FC 4I3RL 1GSMA 1UM6L 1KT2A 3DIFB 3DURB 5AZEH 5EG6C 3FB7B 5DVOA 2CGRL 3VDBA 3ARYA 4WTZG 4CVXA 4KK8C 5B3NA 1FHGA 3DV6A 1R5VB 3F5WB 3PDGA 3WFCH 3CDGB 4R26H 3S4SA 1DBBL 3ULVF 4JN2A 4OLVL 4ZFOA 5DFVC 1F8TL 1CICD 4ZO9A 2ESVA 1A6VL 2ZWLT 3HLAB 3MV9A 5DC0A 3FL7A 4HS6A 5HPMA 5IBLD 5LXGL 4ZFFA 5CINH 1GGIH 4JO3L 4JGJA 3U2SA 4FMFA 1UH4A 1IEAB 3T0WA 3U0WL 1G7JA 3U9UB 3TV3L 2J7LA 5BJTA 4OCWL 3O0RL 3WIHH 3P30L 1FFRA 2I07A 5EZLB 3FFCD 2PN5A 4QCIA 3WFDH 4RAVB 1OTUD 3MTRA 4I9WD 5HVHB 1ERNA 1MCJA 2J5LB 3B9KD 4PJ7E 4Z8FH 5C09D 3QEHA 4LL9A 3O9WA 3JV6B 3ZYIA 1EHLL 4CU8A 3E1F1 5DURB 3ZE0E 3OGCB 5J57B 1UC6A 2BDNL 2Y4SA 5EZJA 1RULL 3T4YA 1MCWM 2I60L 4PJGB 2O5XL 4DGIL 5ISZD 1KNOB 2YC1B 3OHXA 4OSUL 5FGBA 2CDGB 5GHWL 3OKNA 3VCLB 1D5MA 1GC1C 1CZ8L 4JKMA 3TBSA 4LRIA 4BQCA 3IDUA 5HGAA 3MBXL 5T1MB 4JHAH 3C5JA 4U2ZA 1CU4H 2F54B 1RJYA 5DRNB 1QRND 5KOVC 3MJ8B 4JQXC 3I2CL 4Y5VC 2IWGA 4DKEH 1MAML 3WHXA 3ARFA 4HEME 4XNYL 5TFSH 3HI5L 1BVKB 2GHWB 2R39A 4NKOA 3EOTH 3E3QC 4S0SD 4QF1B 4ZS7L 4EBQL 3LKNA 2R1XB 2P8MA 3GHBL 3RUGB 2AJVL 5K9JL 2D0GA 3VXSB 4LSRH 5C07A 1HK6A 4M4PA 4UIKH 4WHYG 1Q9WB 1U3YA 1WC7B 2BNUA 1OWWA 2KBGA 2ZOKA 4PJ5E 3SE8H 3F6LA 3OZ9L 4R4ND 1D5XA 4NM8L 1I3UA 3UDWC 2ERJB 4DN4H 2MPAL 3RWGA 1BFOA 3RQ3A 1F58L 1JPTL 3C87A 1S7RA 2X9YA 4JVWA 1TETH 1JYNA 3LRGA 4P4KC 1R3KB 4U0QB 4BSVB 1NANI 2WLZA 2H8PA 1OLZA 2OBGA 4YBLC 1HHHB 2GTZB 2PXYD 3NCJL 5DZOA 4LAQL 4Q9BA 4NGHH 1M71B 2A1WH 2Q6WB 3O41B 5LWYH 4LBEA 3VXUA 8FABB 2ED9A 4LSPL 4LVHC 1A8JH 2DMCA 3WNOA 4GS7C 2QSQA 5INDA 2ARJA 1EJ6A 4JCLA 5I1AB 1HNFA 2JCCF 4MD0A 5HJ3B 4DZ8B 3GJFH 3C2AH 3P73A 4JGMA 3E8UH 4MJ6B 3IFNL 3QH3B 5H35B 4Q0XL 5HGBB 5I8EB 2ZCHH 4P5TD 5HVFB 5KVEH 3BP4A 4KV5F 4OIIH 4U1KB 4XWGL 3VE0A 1QFHA 1JZ2A 4HC1H 1IC4L 2HJLA 3MACH 2F19H 4AENA 1YY9D 2NW3A 2QSCH 2ITCA 4NZDA 3O2VH 3L3HB 4LLDB 1RK0B 3B8YA 1TZIB 4YPGB 3ULUH 3S97C 3MFFB 4AQ1B 5I8CA 4NUGH 1CF8L 5FCSH 4OTXH 3OKMA 4P48A 4NDMB 4OLZH 4WFGD 2P5WD 3VFVA 4Q2ZB 5JW5B 4ESKA 1LP9A 5D70L 4UDUA 2Y07L 1R3IH 2LFGA 5T5FL 4OZIF 3QDGD 1PKQB 2JKXA 4XPBH 1P2CA 2MFNA 4OV5A 1NFIB 1M7DA 4HWEL 3GMQA 1TIUA 3KXFE 5DEFA 3LKPB 15C8L 3VG9C 1UM4H 4LIQL 3WDIA 5IVXE 2X2YA 1ZHKA 1I8LC 4JQIH 4FTVE 5CILL 1KLUA 3B9AA 4P4RA 4X5XA 5C0ND 5L8LB 3SBWA 2DL2A 4HS3A 1K4CA 4MSWB 5FGSA 1J8HB 4G6AC 1VDGA 2VDPL 3EAKA 3TBYA 4WO4A 1QSZA 3L5WA 4OGZA 3X3GL 4HKJA 5IHZB 4M1CD 1FL3A 2WV3A 1LNUB 3PHOA 4S1RL 5F7EL 1DBJH 2W9EH 4FFVC 4B41A 4YHNB 3QIBC 1U8HA 4XP5H 3EDDA 5E1HB 4OZHB 3GSQB 4PJGA 2DJSA 4Z7WA 5CP7B 4M6NL 3PNWB 3MLZL 4K71B 4Q6YA 2V5RA 3SGEI 5F6HI 1P7QA 3MOAL 1BFTA 2ZCLH 1MJ7H 1X4YA 5HHNA 3O3BB 4MGXA 3SCMB 3S88H 3ULVH 4JO1H 3ZE0F 4P5MB 1U93A 5D72L 2BP3A 4HMEA 4Q9QL 5FFLA 3LV3B 1T0MB 1X3DA 1ZTXH 3QIUC 5F8RC 5CKAA 2DQUH 4LLAA 4BQ8A 2R0WH 3ROOB 2FECL 1MNUH 2DM2A 4U3HA 1H3PH 5C6TL 3VFWA 2BVQB 4Y2OA 3QXTA 3CGTA 1JI1A 4GG6E 3EYVA 2R23A 5F71A 3V7MA 2DKMA 2FSEB 3QCVH 4Y2DC 4QTIH 3K4ZA 4M48L 4G8GD 2NR6D 1JV5A 4X7CC 4RZCA 1V7MH 4WDIB 4YHKL 4UBDC 3W2DH 4G7VH 5ACZA 3C08L 1YMMB 4YXKH 3FMGH 2E8YA 3NIFE 1XGUB 4Y1AD 4OB5L 5IJVA 4QT5A 5DQDH 1QSEB 4ODBD 4O00A 4PJ7A 4J3XA 3VDCA 5TDPB 4U05A 2QADD 1KIUA 1ORSB 4PGCA 4I77H 1ZGLB 2GTZA 3NZ8A 4JANB 3I75A 1A7QL 4KK5D 5DHVH 3RRQA 1PKOA 5F9OH 3LIZH 3QHFH 5DD3L 4O5LL 4NNPH 3BIAX 2WBKA 5F1NB 2Z31D 3TA3C 1QFPA 2DIAA 4R6UA 2IFFL 3OQ3B 4TVPD 2DQHH 3K74B 1AE6L 2LABA 3WL9B 3K2UH 3ILQD 1HIMH 2Y23A 4GKZB 5I8EA 4JG0L 3CSYA 1XF4A 3RX5A 4PTTB 3QB7C 3N0PB 1ZWIA 1MCPH 4JLRB 1QFOA 3TWCL 5CBEB 1MCKA 4LGRB 4EIGB 4QXWA 2YN3A 5EIIB 1KB5L 3PWJB 3ZLQC 3P11H 4IS6B 5KN5B 1URLA 3HZKB 4X4ME 3VWKA 2ADGA 3SQOL 3NZHL 3EOYG 4U1LB 1Y6NR 3MRIB 3O6MH 5AG8A 2VDRH 3TBWA 35C8L 3NMEA 1DQMH 1B90A 1V3JA 1F11A 5CSZA 4DQOL 2DQJH 3VXOA 2AV1B 2PYEB 3V5HA 2AJZA 1VADA 3PDOB 3T0DA 2PYFB 3ILPA 4U1NA 4OQ1A 4TNWK 4PG2C 1QFUL 1J5OL 4PJFE 3U0TA 4MNHB 2EDOA 2VE6A 1CGVA 4DN3H 4UV7H 2CO6B 5J13C 3QNXA 4Y4HD 4TN9A 1G0XA 5K59E 2AK1H 1ODAA 4N9GA 4OV6F 1W2KT 3ECBA 4KVNL 3QG6A 5GZND 4Y5VB 1DANU 5JR1L 4EUPA 5IHZA 3RIFF 2HFTA 3B2UC 4WW2C 5GGSB 1CVRA 4AYFA 5KSVA 3V7AG 1YYMH 4HX1A 4J6RL 5DUML 4F7EA 3I02A 4QRRB 4KROD 4EVNA 4G6KH 4PGDA 3MX0A 1FBIL 5TQ0H 2HTKC 1S9YB 2WANA 5SX4I 1ZLSH 2AI0H 1NMAL 1D9KD 2W0KA 4OLYH 3CK0L 1YMHA 5GGQH 5D1XD 4LPVA 2X4TB 3G6DL 4BQBA 4RMVA 3CXHJ 3FT3A 4YBLB 1C08B 2DKSA 3MUJA 3QPXH 2HJKB 2E9IA 2GI7A 3KNBA 3OX8B 4PJAA 5BMFH 2GJ6E 4KKAC 2N4IA 5DJCA 1SJHB 4LVHB 4NFDA 1AR1C 5IHLB 4CJ1A 2I25N 2R1YB 1OGTA 1V3KA 3LQZA 4NBYB 1IGFH 3N1MC 1RJCA 2F15A 2K7PA 3C6SA 4NCC1 5D7SL 4APQD 3FOMB 1QR1A 4YHPB 4U1IB 3KXFA 1GJIA 5IVXA 2HT4C 2E9WA 4PJIB 1RQ5A 1MQKL 2VLLB 3EFFA 1ZEAL 3SE3A 1Y6KR 1DZBA 5JPMB 5FOJA 4ONFL 4M7JH 2AEQH 1WFUA 4GG6F 1TJIH 1JWSB 1FCCA 3G5XA 2B39A 3QZWB 4MAYD 3C8KB 5JUEH 2ITDA 1KBGH 2FX7H 2XN9B 4RGNC 1YC7A 4HW6A 2VDKL 2DRUA 5E2UL 3PWPD 3DVGB 3JWDL 3IDIB 5E5UB 1FORH 3VJ6B 1G9MH 4P9HH 4IM8A 4F7MA 4RWHA 5DXWA 4YBQC 3NIFF 4Z7OF 3OKEA 4JJ5B 1MHHA 5F7WC 2YD2A 3LKQA 3WUWB 2HG5A 3QFDA 2AEPH 2R4RL 3PP3K 3LN5A 3WKMH 1U95B 3NN8A 3BUYB 4NO0A 3TIEB 4F37F 1XF3B 3WSQH 4BFIA 1I7UA 1JWMB 4NZRL 1RIVH 1RURH 1I9RH 5SWZB 3MYJA 2QKIA 2A6DB 4KTEH 3GNMH 4Y4KA 1A1OA 5HHQB 4GW4A 3IAGC 1SM3H 2V2TB 5DR5H 4MJIB 5MERA 3GRWL 5C2BL 1GIGH 4FFZH 1FH5H 1EXUA 2BSTA 3U30C 2GK2A 4YHIB 4YFEA 1QKZL 3Q48A 5ICYA 2H2SD 3O81A 2RFXA 3BO8B 1MY7A 4ZS6D 4ZUTB 3QUZD 2P4AB 2HLFD 3ZE2E 1I1AB 3MRMB 2HRPL 4ORGA 3UYPA 1MF2H 4HG4J 2BRRH 2HFGH 2PTTA 4RISH 1KCUH 4YR6A 1LO0H 4PRNB 1OB1B 1HSAB 1R24B 3RIAK 3BQUB 3BP7A 2JJSC 2H9GB 2DMKA 2XKUA 5D8JH 3GMOB 2D7TH 1ZANL 3HUJE 4DAGH 5D7JB 4UOW0 4OCRL 4PRAB 1NCNA 3T2PA 4LLWB 4ODVL 3BKCL 3EZ8A 2CLRA 2JB5L 3SDYL 5EO9A 1R3JB 4M1DL 3CFEA 1MHCA 2IH1A 4PRBB 4XAWH 3SDDD 1G0DA 1I8IB 4NT6B 5CEXA 3C9NB 5E7FA 5CEYA 1XAUA 1ADQL 1OVZA 5E9DE 1RUAL 4Y2DB 1VESA 1T7XA 4KAQL 4NQDE 3HPLA 4R97C 3TCXA 1MHPH 4LPXA 2A2QT 4HV8B 2OLDA 1A6ZB 5C0JB 2L7JA 4RX4A 1OGAA 3ARDD 5HI3C 4PJ9D 3HR5A 1QSFE 1BWMA 5F7LB 3BKYH 3GK8H 4NQXA 1OAXH 2FD6H 2FJFA 4IDLA 4PRPA 3UDWA 4RQQA 1TNMA 3TYGL 3DBXA 1U3HB 4NOFA 3BP6A 4KKCC 1MY5A 1TDQA 4P4KA 4HPOL 4X4MA 1T6VN 3MJ9A 3ISWA 4X5WA 2D4FA 3O2WH 1UEYA 1Z9SA 4DVBB 5FDYA 4MNGE 3BT2L 4KHXH 5E00A 1CL7H 3QUXC 1A5FL 5ESQA 4QYOA 3OR7B 2XA8H 3AXLB 4JPIA 1XGPB 4Q6IA 1AD0B 3M8OL 4JY6B 4MNQE 2R1WB 3VFRB 5F21B 4QXUH 3TA3B 2IMNA 1SJEA 1QLEL 1YEFL 2DQGL 5JZ7C 3TN0D 4JRXE 5EBLB 3VI4F 5C8JA 1XEDA 5FYKL 5A2JH 1DEDA 4WUUB 2IH3A 1P4BL 2FCBA 3KJ6H 5C2UB 1DL7H 4MS8C 5E8EA 3BE1L 4GUPA 5JIKA 2IPTL 4BH7A 4C83A 3IS0X 1HEZA 4LIQE 5IB5A 2DJUA 5BRZB 5AWNL 3K7UA 4LSVL 4NQCE 1EZVX 5HDBE 2VLJD 5ICXB 4L8CA 2ICES 3P4LA 1QLFA 3FB5B 5M7QA 1B0WA 4GMSH 4WFFD 4HJGA 4UTBL 5D4QA 1MJ8L 3ZHKA 4AJ0A 2IADB 2H6PB 4JJ5A 3WFZA 1HH6A 3MV8E 3LPWA 3BDYL 4NKMB 3FO0L 3QUMH 4QRTB 5C0AD 5F1IA 5FDWA 4K3EL 4KKLC 3HNSL 1J8HD 1JWMA 2HLAA 3NH7H 3PJSB 3O6FC 2ZUWA 5HHOA 3CAFA 1QFWL 1YEGH 3CMOL 5DK3A 3VXTB 4XP6L 1RJZA 3EO1B 5I1CH 4JO2L 5CLTA 4YHML 1R3HB 2X1WL 3FFDA 1OHQA 4PP1C 5T1KD 1LK3L 5T3XD 2CIKA 1HHJA 2VB5A 4F9PC 3QIBA 1KN2H 4H1LG 5J1AA 1DSFL 3BRFA 3SOBL 3S35X 3RU8L 1IEBA 5IW3A 5TGBB 3ZTNL 2E7LA 4HEPG 1MCCA 1NEZB 4K7PY 2VDML 3VXMD 2GQHA 2Q1EA 4QXGL 2FATL 1PQZB 3KPQA 5I1IL 3SCMD 1L9NA 3ET9F 4G5ZL 3RNKA 3RDTC 2YS4A 3LDBC 3WNKA 3AGVA 4KDWA 2AK4B 5FKAA 3G6JE 4X6CF 4OF5A 3QIUA 4X6DF 3P4OA 5E4IA 5C0GA 4J12A 3DRTA 4OZFA 2VQUA 1MFBL 3P0VH 2EDQA 4FZEH 4XBEL 3HZYB 3L5HA 3NCYS 4Y16C 4TUKH 3RWFA 3QEGH 2IFGA 4MQSB 4PRIE 1NAKH 1Y18A 4K8RL 1IC7L 3LRSA 3E6FB 4X5LA 3DVNB 3ZKXC 5D71L 4DK3A 1QBML 2N7AA 2WZPD 5I1GH 1MCFA 2Q86A 1QYGH 1XCTA 4HUXB 1B88A 2DLIA 1WBZB 1N64H 3ZKNC 5D1ZB 3X3FH 1A7PH 1CGTA 5EBMB 1FV1B 2FEEL 5IGXL 2ED8A 1IGIL 4OJFH 4WWKC 5CUSH 5E1AB 3GBMH 5IBTL 1J1OH 3BDXA 1G9NH 4KHTL 1DFBL 1ZVSB 4YDLC 3GKWL 5C08B 2X4NA 1G7PA 1KCSL 2AXHA 1QNZH 1K6QL 1WFOA 1OAKL 1NGQL 4ONOA 2AJ3B 1SEBA 4EXKA 4RGNB 3IVKA 3VXRD 1N3NB 4AEIH 2YZ8A 1FLRH 4KKBD 1N5AB 5D7KD 1VACA 4LSTL 1I9IH 3MJ9H 4HH9B 2CKBL 3KPRE 3GJFB 4PRHE 4OZGF 1CD9B 3SGJC 1FCGA 4HQQH 3RWCA 1JTOA 3U9PL 1MHEB 4DJMA 4ALAL 4M6ML 3WN5C 2DWDA 3QA3A 4LKCA 4O2EB 3MC0A 3TCLA 3MLSH 4N5EC 3U48A 3TF7C 1CK0H 1D3CA 4F8TA 3QDME 3LMJL 4HWBH 4WUUA 3SDAA 2DYPA 5T33H 1JGLH 2FL5A 3OXRB 2Z92A 2I26N 3MLXL 1FVCB 4XC1H 2GUOA 2WQ8A 5JOPE 4UAOC 3NFNB 4I2XA 3RGHA 3ZZ1A 5K9OB 4JPVH 3IDNA 1G9MC 3U30B 4QOKB 4W6YB 2OTUA 4U6HB 2V2XB 3F6IA 4UQ2A 4XBGA 1QBAA 1CDJA 4PJXB 4G8FB 1QSVA 5LG1A 2XZQH 2IQ9H 4FQJL 1BQLL 1P4LB 1JHTB 3REVB 1P7KA 3QUKB 1TTUA 1ZVHA 4PG2A 3TPUA 2MHAB 1AXSA 2XFXB 2A83B 4GW5B 3F7YA 1EUTA 1QSFA 2FR4A 1PGRB 3VGDA 3L3DA 5IV2B 1OPGH 1PLGL 2EDKA 4M43H 3S37X 3GIVB 3FQWB 3KDMB 3FO2B 3AY4C 1NBYA 4BSWA 1IM9B 4EDWL 4PJ8A 5DMKA 3DROA 1KULA 5IW1B 4OF7A 4LQFL 3U0PB 1ND0A 2BNQD 2R15A 5MEPA 3S36H 2XA3A 1CFQA 5IF0A 3B8SA 4WW2A 5GISL 4MNGA 5MHSD 3BMVA 2H1PL 3GSRA 1BECA 3L5IA 1A6AB 4I3RH 1AXIB 3BKML 3SGDH 5FYLH 1UM6H 5A2LH 3CXHK 4GAYB 3Q5YA 1AR2A 1OARL 1OSZB 1KTDA 4MNQA 5C0RH 4R97B 1EEYA 1HI6A 3IFOB 4J3SA 3QFJE 3MMEA 4AEHL 5BZDB 4PPTA 4G3YL 4ERSH 4Y5XB 2HVKA 2UYLA 1W8NA 3ZHLA 1W72L 4MMXC 1C5CH 4IDJL 4OLVH 2EDEA 3JUZA 5DMIH 1TVBB 1MFNA 2Y7QA 4X4ZA 4YDIH 3OKLB 4PLJC 3TEUA 4FABH 3ZSSA 2Q3AA 2Z35A 3LKRB 4K3JL 1A14H 5HSFA 1KIPB 1UQSB 4WFEE 4LQ1A 1V7NH 4P59L 3G6AB 1JRHH 3U0WH 1IGCH 3FOLB 1F6AB 1TCRB 4L3EB 5TE4H 4L4VD 3OPZH 4OQTA 1U58B 1M6OA 4OCWH 5E8OA 5ALCL 2EEDA 4WHTA 4AEFA 4EN3D 1ZE3C 4Q9RL 3ALWA 4X80H 4L1DA 5HY9A 43CAA 1HE7A 3JTSB 1C16B 2GITB 4KMTH 5D7IE 4BH8B 3WIIH 1ZS8A 5D1QC 4L1HA 2YPLA 1FPTL 3MV8A 3NCMA 2XOTA 2Q7YA 3HNTH 4M5ZL 3BXNB 1X7QA 3QUYC 4RMQA 1WBXB 1EHLH 1DLFL 3QCUH 1U8OA 5LGKA 4DGYH 1YPZB 5JORB 2AAVA 1F6LL 2WINB 3S98A 5FYJU 3SPVA 3UTSB 4KJQC 3UP1A 1A7NL 1Y6MR 5FA4A 5KZCB 3KPMA 4NO2B 2O5XH 2NLJA 3EFDH 3DGGB 5GGRY 3W0WB 2BVPA 1T7YA 3CFDA 5DHVB 1RZFH 3G9AB 2XNAB 5GHWH 4L5FH 1JHLL 1JTPA 1A21A 2ICWA 3HI6H 4IRSC 1CDBA 2XTJB 4KQ3H 3MBXH 2P5EE 1J9CT 4RWYL 3D3VE 5LAXB 1IZJA 2IANB 3GJEB 1CGSH 1DDHB 4JG1H 3H9SB 4G43B 2F8OA 3MGTA 4XCYB 5EH1A 5C0CB 4K8RC 4ZQKB 1MAMH 2D03L 1AGBB 3KLSA 5E6IA 2ATPB 4YO0B 4HUKB 3WBDA 1IGYA 4U2YA 1D7FA 1V8HA 1Z3GH 3VGGA 4PY7B 3HC3L 4ZG1A 3G6JA 5TH2A 1DQDL 4O2FA 3MNZB 3HRZA 2BJML 3UBXB 4FHBD 4ZOBA 3LEYL 3V6OE 3KS0H 1CXFA 4QXTA 3BIKB 3M1BA 5E8NA 2QQNL 1IZKA 4PRIA 3L7EA 3QG7L 3WFBL 1I1AD 1T7ZA 4N0UE 5E8PA 5JHLH 2BK8A 3AUVA 2FIKA 2MPAH 3BWAB 1RZJL 2V7NA 1GGBL 1JPTH 3P9LA 1MIMH 3R06B 5CJ5A 2B1AL 4LDLB 1S3KH 3VFUB 5C09E 1HDMA 2RHEA 5JMRA 1L0YA 4JHWH 5IHUH 4XH2A 3T65A 4LAQH 3RDTB 3LDBB 5D7JD 4WI4A 5AZ2H 1TPXC 1WIPA 4CN4A 1I8MA 3S3SA 4FQ1H 1FYTE 3KYMA 5IEKA 4E0RA 4V1DB 3HFML 1AQDB 2JCCB 4LEOA 1D6VL 4HBCH 1MCSA 1MH5B 2CRIA 4WU5B 2EICA 3W39B 4POZD 4Z0BL 5ISZE 2OR9H 4FQXA 3DMMA 1MVUB 3S3JA 5DMGD 4Y16B 1K8IA 1ETZA 1Q0XH 3IDXL 2IALB 3IFNH 3AREC 4JFOA 3ZKXB 1KB5A 4A2LA 1F97A 4TQEL 3O8XA 3WO4B 3KPRA 4PRHA 3MRJA 1EO7A 1BIIB 1NBZB 1YEEH 4FQHB 4CL7A 4K3DL 4O51B 1R0AH 5IG7B 1GZPA 3MCKB 3BN9D 5FKPA 3VH8B 3RTQC 1FZJB 4M9PA 5DWUL 4PV8B 4X4XA 1CQYA 2NY3C 4WWKB 2VDLH 3QDAA 2WUBH 3L3KA 3L7FA 3W82A 4XRCA 1KTKE 3S34L 3RGVC 3AU1B 3EOBA 1A3LL 1CR9L 2CRMA 4IOIB 4YDLB 3QULA 2EIZB 5JQ6L 4OZIB 5I1DA 4KRPD 4N8VG 1PZUB 2FH8A 5KSUB 3RVXD 1U9KA 5F88B 2HVJB 5HGDB 2Y36L 1T5XB 5FXCH 1NANH 4NWTH 1LO5B 1FZKA 3IKCB 2C3WA 3H0TB 2XV6B 2YEZB 4G9FB 1BQHG 4WI3A 2FHBA 3QUXA 1FNEA 3OSKA 4L9LA 2JIXA 4AIXA 2YXMA 3VI3F 1Z6JT 3I3BA 4N0YL 4NBZB 1C12B 5I8KL 4I4WB 1KIQA 3X3GH 1DBMH 4UT6L 4P23A 5BZWB 2FZ3B 4OFDA 5I8OL 3NAAH 4XCNA 1KJMB 1N26A 4Z7QE 1G9NC 1KENH 2N7BA 3KR3L 1T03H 2PW1B 3O4LE 5GRJH 4JKWA 3KVQA 1S7TB 4A6YH 3TO4C 3DUUB 4ODUA 2VDQL 5T1LD 4MD5B 5BRZD 4UAOB 2F5AL 3CFCL 1AFVL 3MLTA 4CVZB 2H26A 4CDHA 3MGAA 5GRUL 3T1WA 1EVTC 1HHIB 4FQQB 2NX5E 2CLVA 1VEOA 4KTDH 1IGJA 5D72H 1J11A 1NBVL 5IIEB 3HZVB 4Q9QH 1RU9H 1XMWA 3D5OF 3L1OL 3ESVF 4H8WH 3HAEH 3MA9H 4IIQC 4XCYA 2J1KA 5GS2H 3BZFB 5J06A 1KC5L 2XPGA 2Z0BA 2VN7A 4JFDA 4AL8L 1F00I 2YMXH 4OF0A 4AIZA 4QEGA 3CVIL 4WVRA 4LCUA 2UWEF 3HMXL 3O6FA 3LZFL 2DQEH 1UWEL 4G6JL 4MX7B 3ZTJG 1BEYH 4YXHL 2GFBB 2BSSB 4OZ4B 1DQLH 5D2LE 1CVSC 4ODSH 5DC4B 4RIRB 2BHYA 4YX2L 4K3GA 4UU9B 3MRFA 1NC2A 4ZOAA 4FQLL 4LCWB 5EUOE 1VKXB 4K07A 1S9WA 4HIEA 4JFYB 4ODWA 3C08H 3MRNB 1F90H 2E5EA 3BSZL 1YUHA 3OJMB 5MEQB 2VAAA 5TDNB 5D7IA 3CSPA 2IAMA 3UTPE 7CGTA 2ZOLB 3JSSA 1H3GA 3VFGH 3OF6A 2W9DL 5T3ZH 5L7XH 3G5VA 3LD8B 3ZT6A 5DQJB 1B0GB 3CDCA 3OXSA 1IAOA 1BBJA 1QG3A 4OF3A 1FG9C 4QHLA 3M45A 2E9JA 1CD1B 1T89C 4PJ5B 2D31A 1GGYA 3GMRA 3QWOB 4RMTA 4DGVL 2YUWA 1ZHLA 4JB9L 1ZSDB 4O4YH 3EIFA 4U4BA 2HMIC 5CEZL 4NQUA 3QQ3A 4GW1A 4HFWA 4PJEE 1YECL 1CDGA 4ZO7A 3PV7A 3IAPA 4XVUD 3DXAA 3RL2A 2OM5A 1SYVA 2FJHB 2GT9A 2IFFH 4ISVA 4ORZC 1RUKL 2P5EA 1WT5A 3KPOB 4LASL 5C0BB 5FM5M 3GRWA 5D1QB 5KSAA 4YGAB 3UEZA 4S1QL 1KB5H 1HINL 3MNVA 7FABH 3QUYB 1Z5LB 3VH8A 4GBXB 4NHUB 1CFNA 5EBWB 3KGRA 3MLUL 4JKPL 1ZT1B 1WV7T 3PG2A 4LSUL 4DZBA 2X1OA 2X44D 1CLYL 3QZWG 3BHBA 2YXFA 4PY8J 3D2UB 3NZHH 1UVQA 3BZEB 2YUXA 1CFVH 4QGTA 2PO6D 5EZOH 2DOCA 5JA9A 2ADIB 2DQFA 4X6EA 3K3QA 3EYOB 4DQOH 4ZSOB 1X4ZA 1K9TA 2BOBA 3MOBL 5EN2A 4NQVB 3STLA 4MQXD 3V6OA 1XGRA 1QBLH 4KJWD 3BH8B 4MCYA 3WUWG 3EO0A 4IRSB 3V52H 4R0LB 5TE7L 1Y0LA 5CJ8A 3UTTB 1AO7D 2V5SA 4N0UA 3MRDA 1OTTC 5FYKU 4XPFH 4OD1H 4Y1AE 3IJSA 1FFPB 1MUJA 1E28A 3G5YA 4KVNH 2QQQA 3WN5A 4HS8L 3WEXA 3VFNA 4HIXL 3T3MF 1OCWH 3UPCA 3MO1A 4CW1B 4E5XA 3QO0B 3TVMC 2YPVL 4XPTL 1GGUA 1TJGH 5D7LA 4ELKB 3QXAB 3O3DA 1FYTA 2YR3A 4FTVB 3THMH 3W9DA 1LD9A 3GJFK 5ADOL 5LGJB 3ULUD 4DFHA 3OKOB 1N6UA 2FRGP 1EFXA 2ADJA 3BIBX 4J4PD 1WEJH 4AMKL 1KCVL 4OD3H 1KGCE 1RUML 3HI1B 4QOKD 1B6DA 5IFJB 1M7IB 1FL5B 1HQ4A 1OLLA 1FBIH 4YNYA 1U8LA 1DBAL 3CVHH 2AV7A 3MV9D 1XR9B 2DI8A 1JGDB 1FJ1A 4Z7QF 4EI5A 5I75C 3TJHD 5E24E 3QUMB 2WBJA 2OTPA 2E27L 4M61A 1F4XL 4FA8A 5EOTA 5IMKA 4KH2A 5LQBL 3AS3A 4HUWB 4F33A 1TPXB 1CGUA 5H8DA 1H5BC 1T66D 2J8OA 3FQUA 4NFCA 2P8PB 1WJ3A 2HT3C 3AY4A 2VZVA 1H0DA 3H9HA 4P2RB 2OQJB 1IKFL 4PIRF 1NSNH 1YJDL 5C86A 1JGUL 4RGOL 1U92B 32C2A 4AH2B 5CBAA 3AREB 2I9TB 3RY6A 1MQKH 3T1FB 3FB6B 3FRUB 4MA8L 3KG5A 4PJBE 4GG6B 5H2BA 1U8MB 1ZA3B 1SJVA 3ULVD 4ONFH 3BPNB 1BF2A 1UG9A 4QRPE 4AG4H 3G04A 3RTQB 3OV6A 4CJ0A 1YEIH 1QPPA 4WJ5B 4I0PC 5DT1H 2NY3B 2Y5TB 3C5ZC 4HWNA 1RZ8A 3O4LA 3RGVB 5L9DL 1BAFL 4KDVA 4ONHA 2RCSL 3BP5A 4F57H 5BV7L 1MRFL 1NCBL 1G7MA 5AD0A 3DETD 1R3LA 4PTUA 2LQRA 5MEOA 4L8DA 3PL6C 5GXBB 1QA9B 3B9EA 2ZKHH 4K2UL 1MFEH 3ARFD 4NOBA 3RVVC 4GKSB 4P9ML 4IBLT 4BK4A 1CFTB 5GPRA 4OM1H 4DCQB 2NX5A 4NNYA 5E2WL 3T0EC 5DI8B 3WO3B 5EU4B 2WK2A 5KG9A 1SYSB 1HQRA 2X5PA 2YKLL 1JE6A 5D1QA 5C07D 2DKUA 1Q9OB 3RVWC 3RKDC 5L6YH 3KPSE 4CADB 1QHPA 1KCRL 1NC4D 5CZVL 1BF8A 5C2BH 3CUPA 2HTLC 1IC1A 1S8DA 2NMSA 1KLGA 4R4FL 2YD7A 3UYRL 3KLHD 3LQAL 4PB9L 5I71B 4M9OA 1JGEA 1CFBA 4LU5H 4D0CA 4IRZH 3LEVL 5JW3H 3QCTH 1YDPA 4IRSA 1YQVL 1AHWA 3VXUD 1E4XI 4XB8A 2W65B 1BD2E 5J3HC 5AYQA 4AT6B 5E94B 1L4IA 1MREL 4OCRH 2WIIA 4ETQB 3IETB 3MRGA 5I66A 3CDYA 3BKCH 5I17A 2R0KL 5C0CD 3SDYH 1LK2A 1XIWC 3OB0H 4HXAL 4PJFB 2C1OA 3BGMB 2HWZH 3PQYB 4M62H 2XQYK 1GXEA 3QXAA 3CC5B 5DTFA 3OMZA 4FFYL 2BNRB 2X4QB 5IQ9B 1KF9B 1OAUH 3MJ7A 1ADQH 3TIDA 1IBGH 2X70B 2VXQH 4PJEA 5F89B 1FC1A 5EB9A 3L3IB 2FWOA 2WMPA 4GG8A 3CU7A 3HE7C 5IFAL 3VFOA 1NEZG 2QQKL 4U6YA 3KPNA 5EA0L 3TYFB 5D5ME 3RWDB 5CHNB 2V2WB 4U1JA 4MVBD 3JV4A 4H8WC 2EDRA 4CMHC 3TYGH 1HILA 2R9HD 3CPLB 4JHBA 1IAMA 1NGZB 1DUYA 1MRCH 3TESA 3IJYB 1HHGB 4PJCF 4GRWF 2NZIA 4MDJA 4RFOL 2CKBA 2A6KB 1HKLH 3BT2H 1NCAL 3Q1SH 1Q1JL 4UT9L 2FO4A 4X4YB 4D0DB 1A5FH 4HK0A 2G2RB 4WO4D 4PP2A 1U6AH 2Y5EA 3MRQA 2D7MA 4KI5D 3LEXA 4R4BB 4XPAH 2XZZA 5JOFB 2O93L 3AVEA 1G7LA 4TRPL 2NY4C 1QLEH 1FNSL 5JPNB 2NY6B 1S5IL 1PDKA 4MWFB 4ZXBC 2IF7A 3EJYD 4TTDC 2GJ6B 5FCUL 1UXWB 2Q8BL 3BYTA 3WNNA 1MFCL 3IXAB 5DJ0A 5EORL 4P57A 4OUUA 5B38A 1ONQA 2ORBL 3MBEC 2NW2A 1UXSA 2UVEA 5AWNH 1T04B 5ALBH 4I3SL 4ZNEE 4Y7MA 3VFTB 2H3NB 1NFDF 2C7UA 1X44A 5GGVY 1ZLWH 1JVKA 1BX2A 5LGHH 3RPKA 3MODL 2NYYD 5EU6B 2VXUL 4EKXA 3DO7A 2B1HL 1EBAA 4I5BA 5IB2A 3GHEH 4U6XA 1I8KB 3Q0HA 5I76B 1LO2H 3BDYH 2CJUL 4H88L 1KTLA 3H7LA 3W11C 4KPHL 4UT7H 3CSGA 4M7ZC 5DA4A 4HGMA 3TBTB 4LSQL 3F12B 4K3EH 1WISA 1DLHA 2EC8A 1HOCA 3HNSH 1CT8A 1I4FA 2OCFD 5CKGA 1RZGB 1JK8A 4R96B 5E56A 3GM0A 4KGLA 5LVEA 1Q9OA 2JK5A 3T8XB 3HG1E 4O9HL 3FQNB 3EHBD 1S9VB 4KVCH 3TVMB 1FN4A 1W8OA 3GSUA 1B4JH 1TZGL 1GHFH 1KEML 1LK3H 1WTLA 2VC2L 4L3CA 1EIBA 1T22A 4G6MH 3RWHA 3TO4A 5J6GA 4L8SC 3D85B 4ELMF 5E8DL 1IC5H 1BZ9A 3ABZA 2DBJA 1W72A 1N8ZA 3IAQA 1XF2A 4M8QA 1AXTL 1B9ZA 2EXYD 1IM3A 3GGWA 1I7RA 3O6KL 5EO0A 5IVZA 3ZKMC 4FQIH 5SWSA 3SDCB 4G5ZH 2VNCA 5B4MC 2IPUK 3NIDE 4X6CB 3SO3B 2IEPA 5KW9L 5BS0E 4X6DB 4PJBA 4BKLA 3Q5OA 4GAJL 1OOAA 1K8DB 4M93C 5IFHH 3H3PH 4ETQA 4IIQA 3X11B 1Z0NA 4QRPA 1BVZA 4QRQB 2EC9U 2NY5H 1R6VA 3WNLA 5HYSB 5FGCE 2DTML 3WE6B 1UWGH 1EO5A 1H5BB 2DB8A 1S7SB 1J05A 4LGPB 4HJJL 3HUJB 4XHJC 2NXYB 3RWJA 4RFNB 4DKAA 3FZUC 5IHBA 5HDQH 4OKDA 1YEHH 4YHZH 4KK9C 2RJMA 3U6RA 4WV1B 4PGEA 1M4KA 3PWLB 5GS0D 3LVEA 3D25B 3VWKD 5B3JE 2B5IC 5KAQF 43C9B 2PR4L 2BXZA 4BJLA 2AQ1A 2C3VB 1A6TB 4N1EA 3LQAC 5CEZE 4XP9H 1PG7X 2FH6A 3VFSA 4XHQA 4LHUB 2LV4A 1F3RB 4PBVC 4S1SL 5E9DB 1NQBA 2GK0B 3RVUD 1CBVH 1DFBH 1MRDL 1EJOH 1GAFH 3CPLA 5L88H 6CGTA 3D39A 4NQDB 3KPSA 1PJ9A 4PJ5D 4HKXB 3C5ZB 5DJZA 5C0DA 5JW4N 4NUJB 4B7LA 1L6ZA 2MKWA 3OKKB 4G80A 3DYMA 4OGYH 4OZGB 5B21A 4EI6A 3HPJA 3SY0A 3NA4A 1XGQB 1T1ZB 3OKDB 5ESAB 3DVIA 1YA5A 2DLFH 2ZUQB 3A6CL 1VCAA 2EIDA 3KS0J 4NP4H 4JZJC 3WS6A 1DEEB 3V0WH 1GYAA 3L5XL 2J4WL 3B43A 3T0XA 1DBKH 4JFQA 2HKHH 1SEQL 3T0EB 3X17A 4PGZA 3IFPB 1BD2A 5L2KB 3DPBA 5T1DL 1X5GA 2E7CA 2BSRB 5IJKA 3MLXH 3GSWB 1FFOA 1S7UA 3L3JB 1KJ2L 4LLMB 2CXGA 1BJ1J 3MROB 4U6VL 3K80A 4ZUWB 2F74A 4JRXB 5K9QG 4MHHG 4LARH 4XMLL 4D9RE 5C9KA 1M05B 5D6DA 4FQ2L 1KSRA 2UZXB 3NTCL 2AABL 2Y6SD 1Q9KB 1LDSA 3I85A 1YNLH 3BEWA 2BVUA 1JHKL 1TVHA 3R0NA 2GCYA 2Q8AL 5H94B 2L4OA 4NQCB 1S78D 2YRZA 1JNLL 2R0LH 4GRWH 5D5MA 3MOQA 5TPWL 3OBAA 1OP3H 1MCQA 3GB7A 4W6WB 2NY0D 1PLGH 1FRGL 1KIRB 4JY4B 4NRZA 3TZVC 4UNUA 3RAJH 2QQLL 1FE8H 5C3TA 3TT1H 5C1MB 4EDWH 4TVPH 1XIWB 5F7DB 1QLRA 5IMLB 5A43C 2O5YH 3BH9B 3KXFD 4A6YB 2M8XA 4X8JA 1CDYA 3IU4H 1TLKA 2XKNA 4G8IA 3WHE1 3B2VH 4XX1G 5D2NC 1WCBB 5DEGB 5IK3B 3VXRE 1L7IH 2V9TA 5DZLA 3VD3A 4IHOA 5D7KE 1P1ZB 1CICC 4LNRB 3DX7A 1FO0L 5HDOA 5EBGA 1UADC 2MQ0A 2EH8H 4BELD 4YDKL 3RFZC 4TSCH 4Y89A 5IBLC 1G6VK 4MXWH 4YPJA 1U2CA 1SMOA 4G3YH 3AS2A 1F4WH 2NY1D 4TSBH 3S9DB 5BQ7B 4NC1E 1UZ8B 1OQOA 3HAEB 4DUWA 1JUFB 4CMHB 1RZ7L 1RJLA 2VZ1A 4J7RA 3QDJE 5KS9F 3V8CA 1OTUC 4NKIL 4WCYH 4YQXH 4MDIA 1N59B 2PTVA 4JR9L 1EVUA 4HUUB 4S10A 4EDXB 2P1YA 1CTNA 3B5HA 2X4RA 1MJJB 3CFBA 4MA3B 4ZNEA 2QHRL 4BQ9A 4D9QE 5ID1B 4LOUD 2OK0L 1J0IA 4RAUB 3KYKL 4JFFE 2P46B 3S5LA 1KXTB 3S35H 4UUJA 1MI5E 3CDFA 4HIJB 1T7VA 3FRPA 4Y4KD 2EYSA 3NIDF 1RFDL 1CN4A 1REIA 3E6HB 3O2DH 4HCRH 3TNNB 5EU5B 1JPFB 2AJSL 4QRUA 4HZAA 1I1FA 5TDOB 1YY8B 3CMGA 4L29A 3IYLW 4ZXBB 4IRJA 4ACPA 5IROC 4QHMB 5IT2L 4KQ4L 5DHYA 2VABA 5FGRA 1JN6B 1KPRB 1A1NB 3B6SB 1J0KA 1IQWL 1LEKA 1E6OL 3REWB 3LOWA 1BFVL 5K9KA 3MBEB 1A0QH 3HG1A 1OT2A 3L6FA 4I0PA 4P2OA 5GSRA 4DUXA 4OIBA 4XPHL 2VL5A 2DQCH 2APTA 3ROLB 3QNZA 1Z9LA 3BGAA 4DTGL 3RZWA 1JTTA 4LSSL 1SY6L 3KLDA 1K2DA 5ESAA 5BXFA 4RWYH 1I3GL 4UINH 4F7PA 3PL6A 4C55A 1F3JA 3Q3GB 1A9BB 5DYOB 5DRZA 2YPKB 1CD8A 4FXKB 3ARQA 4F15C 2VZSA 2VWEE 1ACZA 2HN7A 3QIWC 4M5YL 4O2CB 5FOBA 4PG9B 2D03H 3LY6A 1X4XA 4MD4B 1NAML 1SJXA 3CNKA 3U4AA 4CAGA 2KQNA 2EDTA 3OG6B 1MELA 1IQDB 4WGVB 1JIBA 1ZLVH 2CDFB 1MCOL 1U36A 4R4NC 2IPUG 3MQIA 4HFUH 2AXFA 1G9EA 1B0RB 3VFPB 5ABDE 3KLAA 5BVJB 4RX4D 1OGAD 4LEXH 4F37K 3F7VB 5F6HJ 3LEYH 2EDDA 3K8LA 1I7TB 5TQ2H 2I9LA 1NCCL 5F96L 5GJSL 5DJ2A 5K9QI 1GPOL 2PXYC 5CLWA 4MHHI 3QDMB 1M05A 5EU7C 1EEUA 2NTFB 4JFEE 3RPIA 3BZ4A 4X0KA 3IDYC 4E41E 2CIIB 2X4PA 4ZUSA 4NQSB 2B1AH 4TNVF 3FQXA 4YEFA 3BI9X 3QSKB 5CJQL 4ENED 5H94A 3H2WA 1JPGB 1AKJA 2B4CL 5CIPH 4NRXA 3MUGA 1W0WA 1DJSA 3K1KC 2FHCA 4JRYE 3GMMB 1IL1B 2IG2H 3LKSB 3A0OA 5FV1L 4K3HA 1J1XL 4BFGA 1I1RA 4I8DA 2C4XA 2Z8RA 1T3FB 1KB9J 3OJDA 3ZT7A 4P5TC 2ZSVB 5F7DA 1YY9C 5CD5D 5J1SC 3V6FB 3DX6B 5IR1A 4C56B 2Z93A 4Z5RA 3IDXH 4O02H 1I85C 2K7QA 2GTWB 3CZFB 4OUOA 3MNWA 3V6ZB 4G7YH 4YZFF 3MCLL 1WBYA 1VENA 4HF5H 3WIFA 4WTZA 3WKNA 2X4UB 2QBWA 1BVLA 1EX0A 3FN0H 2B5IB 4TSAL 1ZT7A 1L7TL 3CVHB 3IFLL 5F93C 3VA6A 3HE7A 4ETYA 1EGJH 2X7LB 4PGJA 5FHBL 1FZOB 5DWUH 5I1KH 4M7KH 5I0ZA 1IGTA 1JUFA 1X5JA 5E5MB 3S37H 2G9HA 5GJTH 3BAEL 1XGYL 3IDJB 1E27A 2PCPB 3ZDYE 2R4SL 3QFJB 1IFHL 3QRFM 3RZCA 5MENB 4ZUVA 1EEZA 2BVEA 1A1MB 2E6JA 3H3BC 3WFHA 3T3PE 2DQTL 2Y36H 2BZDA 5CZXC 2HFEB 4XC3L 2ARWA 1QQDB 5C70A 4JZOA 4M1CC 2FX8L 5D6CB 1ZOXA 4FRWA 2XTLA 1QP1A 4LLUA 1YZZA 2EDFA 4Z7VF 3UPRA 4N0YH 3QRGL 4I48B 1ZHNB 5E4EC 2NY6D 4DKFL 1AIFB 5EO1A 4HZLA 5I8OH 2R56L 4JFPB 3QIBD 1MAKA 3JXAA 5FUOL 1YYLL 5LBSH 2AJXL 3DUHA 1T4KB 5CJXA 2H32A 1N2RB 5IMMB 2BY0A 4Z77A 3OR6A 3EYFB 3CFCH 5DO2D 4K94H 3IRZA 4ODXA 1OSPH 1OL0A 4YDJB 4U3XA 4L4TE 5GRUH 2FHFA 1HHKB 4NFBA 4LKXA 2BY1A 3V4PL 1FGNH 5EZIL 5EU3B 3RWEA 1S7WB 2BOCB 4Q97A 5BW7A 3H42H 1FL6A 3MRKA 3AS0A 2D0FA 1PYWB 2WP3O 2DWEB 4HIIA 2XZCL 4HHAB 2JJTC 2UWEB 4F7TB 3PABB 4HT1H 4K7FB 3ZDZE 2OZ4L 3SKMA 1QUNA 2AGJH 1S7XB 4WI8A 4RAHA 3HMXH 3D3VB 3LZFH 1I7ZA 5HHVL 2R69H 4PGBA 1LEIA 4WU7B 5IM7A 1T6WA 4R7DB 1UH3A 3VXNB 2QADC 5DUBA 5AUMA 3BW9B 5C0FB 3T09A 3UJJH 1Q72L 4L8SA 3ARTA 1CICB 4KK5C 3BSZH 1W0VA 1UCBH 2AJYH 3VW3H 1NL0L 5HYJE 2VLRE 3S7GA 1CXKA 5ICZA 4KZEH 5JA8B 4IOSD 4WFHE 1F4AA 1P4IL 4XNQB 1CS6A 4XMKH 2YD6A 3PIQA 3SDCD 1INQA 3V7AE 5CMAB 2Z31C 4FXLA 4F9LA 3GMPA 3ESUF 5CD3B 1ZVYA 5ID0A 4JB9H 1H8NA 2P24A 4NQEE 3FFCB 2DM7A 4TYUA 2CPCA 1AQKL 3ILQC 5CSBA 1KXQE 4HKBA 4OAWB 5FK9A 5CEZH 1R5WB 3F7PC 1CCZA 4UMGA 3WFEH 1YECH 4H5SA 4JDVA 1VPOH 3B9KB 3DYPA 4N68A 4U1SA 5C09B 1QTYT 4KJYB 1XT5A 3HNVH 3SE4A 1KJ3L 5I15H 2NXYD 4P99A 4WI7A 4GRMB 1CE1L 1JF5A 3SDAD 1PZ5B 2DYPD 4JPKL 4R7NA 1E6JH 1WAAF 1HSBB 3MRBA 5HI4D 3NBNA 1DN0A 3QQ4A 2DL9A 5EFIB 5ISZB 4E42A 4EEEA 5EPMA 2VIRA 3C5SB 3MLUH 3WMSA 1IAIM 1T7WA 4ZDHA 1KPUB 1CLZL 4HDIB 2ADFH 5DGRA 3DV4A 5E9DD 3RX8A 4QTHA 5LJYH 1UB5A 3N9GH 4NQDD 4Y4HC 1BOGB 4OKVB 5GRVK 1FFNA 5ITFB 3QEUB 1QRNB 3TT3L 5GZNC 1QSFD 3GDBA 2HFEA 2JB6A 3Q6GL 2A6IB 2SEBA 3RY4A 1QVOB 1F4YH 3EOAA 1D5BA 4M1GL 4JFEA 4GO6B 4S0TD 1JNNL 3PWNB 4RSVA 2X4OB 1FG2B 4PJ8D 4K9EC 2R2CA 2G75B 2NNAA 3HZMB 4JZJA 4C4KO 4JFHE 1MLCA 2QLVB 4KROC 3UC0H 2OP4L 4JVUA 2XQBH 2V7HA 4JRYA 1AJ7H 2AKRB 2CK2A 2BX5A 4H25B 1JZ6A 2VISB 4OBRA 4LLVA 2VLKA 3NFPB 5JHDE 4FG6D 3QEQE 4MNQD 4Z78B 2IGFH 4YUEH 1XF5B 5FO9B 2FB4L 5CFHA 4CMMA 1D9KC 4HSQA 5I18H 4WEBH 4JFZL 3KPPA 1KTRL 2UY6A 4LF3A 5D1XC 5F6IC 5IB1A 1VFAB 3WXWL 1A7OL 2MOVA 4HH8A 1RUMH 2VXVL 1VGEH 5GS1A 2F53E 2PXYB 1DBAH 3GMNB 3CD4A 1CL7I 3QXVA 3PE9A 4YHOH 2OJZL 4PJHE 5EU3A 1GGCL 4UQ3B 5DEZA 3FT4B 3IDYB 2IC2A 1U3JA 2YBRA 5FF6B 3K46A 2E27H 4GKNA 4NQCD 2W0PA 4OGXH 3VFMA 1C5BH 4APQC 3SJVE 5IOPA 1VGKB 4LRNL 4LCCC 2ZCKH 3UTQB 2CK0L 1ZA6B 3TZVA 1S7XA 4X9IA 4P5TB 4AIOA 2YPLD 4LVOB 3MV8D 3AB0C 1A6UH 1QO3B 5FO7B 4Z7UF 3CSBA 3MGOA 1EBPA 3DNKA 1JGUH 5D2NA 4KY1L 5ANMA 4ZPTB 4M03A 1NBQA 5JDSB 4MAYC 5JIHA 4P46A 2D2OA 1ZT4B 2RR3A 4XB7A 4Y19E 1WSST 2EYTA 1YN6B 1EMTH 2GKIA 4ONGL 1QHOA 2P5WB 1I9JH 4PS4L 3ZDZF 5JTWA 2VXTH 3KWWB 3C8HA 4Z76B 4XNQA 5EUOB 4RNRB 4WW1A 3QDGB 3UJTH 2LU4A 1A2YA 3IU3A 4NNXB 1G7QA 3OAUL 3PWUA 4YBQD 3FO9B 3QHZL 4OCNC 5BV7H 1MCBA 3VD9A 1NCBH 4JPWL 4DKDC 1JMXA 3MZTA 4H0HB 3DX8A 5IMOB 4ODHL 2FNBA 2WW8A 5E6ID 4GAGH 1RY7B 4L4TA 3LS5L 3PP4H 4XCCH 4NM4L 3GO1L 4TOYL 1TQBC 2CUHA 3MUHL 4XXCC 2ESVE 2F5BL 3MLVL 4U1HB 3MV9E 5DSCB 2WNGA 2H2SC 2QR0B 4ZS6C 1BLNB 3P4NB 3QUZC 4NPYA 4F7CB 2HLFC 4QHKI 5FECB 1TNNA 1T2QL 3I6KB 1JWUA 1KCRH 3VXPA 4MQ7B 3CLFL 2NTSP 4PRID 2VH5H 3GMLA 5IROA 3U4EA 3W5NA 4NSKA 2K3TA 3SDXE 4IMKC 2VERN 1NJ9B 2EKJA 2Y06H 5I1HH 4YK4B 1MWAH 1NGYA 3VXQA 1KPVB 4UIMA 4J8RB 4U7KA 4OCSH 4OZFG 2AXGA 4PJDF 1CFSB 4D9LL 3PXHA 1YNKL 2X4SA 1LDPH 5KSBF 5A16A 3SDDC 5GSVA 3MUZ1 3O6LL 3BESR 2DD8H 1FG2A 1N6QL 5EUKA 5F1SA 5HYJA 2VLRA 5J7CC 4U1MA 3HZMA 1JGVL 3ALPA 2R0KH 4X8XA 4FQXD 3DMMD 5JLZB 3QIWA 1OW0C 2E9BA 5KTEL 5KVGL 4G8GB 1OF2B 4QLRA 3GSXB 3ULSA 1HXMB 2APVA 3CX2A 4HXBL 3ARDC 4PJ9C 4NHCL 3O8XD 2P8LA 3KPRD 4PRHD 2VISA 2XZAH 5HYQA 3NFPA 2KL6A 1TENA 3BX7C 4K94C 1JNHB 1XF5A 2V5MA 3NGBC 4Y1AB 3Q6FA 1J1PH 2UZIH 1A4KA 3ARBB 5I19H 1P84J 1DE4A 1UACL 3SKJH 3LB6D 2EH7H 3UTZA 5ERWB 1S7VA 3QDMD 2PXYA 3GMNA 1GC1L 5HHPA 1KB9K 1G6RB 4LLQA 3TP4A 4ZTOL 1S5HA 2NPLX 4KKCD 3U7WL 4XGZB 1AI1L 3QR2A 2AJUL 4MA7H 5EWIL 3HCVA 4PJCB 2W60B 1FVEA 4GRWB 2OTWA 3UCRA 2C1PB 1XZ0B 5CS7A 5F7MC 4BZ1H 2ARJQ 4XVSL 5JXAH 3MV7A 4C59B 2Z31B 4X6FA 4RFOH 4MJ5B 5HYSG 1TZHA 4Y4FA 3PHQB 1BZ7B 1TXKA 3TN0C 3WXVL 1INEH 1NCAH 4D94A 4UT9H 2G5BB 4DOHE 2FYYA 3KHOA 3T0BA 3VWJA 1QEWB 5C0IB 2ZUTA 5BCAA 5DQ9B 3BDBA 4Y8DC 5B22A 4GQPH 4P23D 2I27N 1AGCA 4JDZA 1JI2A 4J1UA 3MV11 1I1YB 5DLMH 5SX5H 4XXDA 2GSIA 3S96B 5FM5O 1CDUA 2DBLH 4MB5A 3O3EA 2AERT 1KJ2A 1MFCH 2R8SH 2EE6A 1XGTB 4ZFZB 3IF1A 4P2QE 4XNUL 1VHPA 5ITBH 1EAJA 2A74A 5DD5L 3VRLF 2K1MA 4EOWL 5I1EL 1XCQA 1MIEH 1NUDA 3QDGA 4I3SH 5KVDL 4BZ2H 4NNXA 4OCXH 5IB4A 4OLWH 4NZUL 1YEDB 1S9XA 4XNZB 4DUVA 5JHDA 4S1DD 3QEQA 3O4OB 3FONB 3U36A 5CP3A 2EDWA 3HTLX 2J8UF 4YWGL 4X6BB 3JV5A 4RDQG 1PAMA 4XCEA 1YNTB 4JFDD 3GSNH 2DI9A 3MRHB 1PEZA 2UUDH 2BVOA 4Y5YB 4ZAKA 3SGDI 1DQJB 3NABH 1F13A 4G8EB 3O6FD 4PJHA 2EDNA 1AD9B 5DSCA 5A1AA 3PGDA 1LILA 1NC2D 3ULUF 4KROB 4PP1D 3H9ZA 2ZG2A 3DX9B 5FHAH 2CDEA 1FO0A 3SJVA 4ELMB 3X12A 2EYRA 4XNMB 5J6HB 2VC2H 3SCMC 2R2HA 4XNXL 2IAMD 1D9KB 4F3FB 1C5DB 3BVNB 3JTTB 5MP6H 1T21B 4PYGA 3DOSA 1U8NA 4HWZA 3AMLA 2N56A 1F3DH 1RUQH 4PV9A 4LPTA 4H20H 3NPSB 3D69A 4B53A 4R8WL 4Y19A 1RMFH 5AYUL 2A73A 2OX5A 1E4XL 2XWJA 1FNGB 1S7QB 4PJGE 1DVFA 3VGHA 2ZJSH 3CCHA 4OD2B 3GI9L 5DJ6B 2E6PA 1KUMA 4RFEA 1CGYA 4F2MB 4QRSB 1EV2E 1KFAH 3L95A 2JJTA 3V4UH 2ZSWB 1KACB 5ILTL 4APQB 4JY5L 4K23H 2P5ED 5BO1H 1G1CA 4GRLA 4NZJA 1NH6A 4U6TA 4O58L 4HJJH 3D3VD 4X7SH 4P2YA 2VDOH 2KUTA 5KSAD 3AB0B 4NRYA 2F54E 3OJ2C 3SHSA 3W9EB 4OT1L 5ESVA 2O61B 1XH3B 5SV4A 4MAYB 4PREB 3PV6B 5F7FA 3H7BB 3PWPB 2DQDL 3HAEG 4KKBC 3HE6B 3QBTB 5DJDB 5C0EA 4JFXA 1NCDL 3QQ9D 3IDMB 5CIPB 3VXSE 2HH0H 3MXVH 2R2EA 1HXYA 1NLDL 1SY6A 3HS0B 4PB0L 4UOW1 4XPGL 1T0NA 1J0HA 4UZGA 4BA8A 4MJ5A 1NGXB 5D9SB 1YQ2A 2B2XL 3GI8L 5LCVL 1BM3H 4YDVA 1Q94B 4XZUA 3KYOA 1MCIA 3U4BH 1J8KA 1JF1A 2PUQT 3SDXA 4TULH 2BC4A 4P5KB 1LO4L 1NAMA 5GGVL 1LHZA 3MR9A 4AM0B 2C3HA 2R2BB 3WLBB 3BEVB 1TQBB 3EYSH 2OL3B 1FYTD 1I3RA 2XXMB 1SEQH 3PWVB 2C3GA 3OB0K 5DJXA 4PLKD 1B2WL 3BD3A 4X98A 3C60B 1YPZF 1EFXD 4UILL 1G7IB 3FQRA 3QUZB 2UY7A 4NO3A 5TE6H 2BMKA 3FB8B 5ETUA 1K4DB 1PX3A 1KYOJ 3BKJL 4HIHB 3L3GB 1OAYL 3LKOB 1NFDA 3SKOA 3U7YL 3D9AH 5I2IA 4TUJB 3C6LA 1JZ7A 3FQTA 3L9RB 1CQKA 4ZOCA 3A6BH 1MFDH 1BOYA 4XMLH 1H15A 1I3VA 4ZPVA 4EI5D 2E7MA 3DUSA 5DD6B 8CGTA 2I5YL 3D0LB 1DUZA 2WBJD 4Y4HA 1BJMA 2VR4A 5GGTL 3U46B 5FUCE 3RNQA 3NTCH 12E8H 1JZ8A 5I74C 3QO1A 2OR8A 3N1QC 4OI8A 4N8CH 3EYUH 3AAZB 3FCTA 4WHCA 1LEGA 5TPWH 4D0BA 1DQJA 1QOKA 1ZLUH 3X14B 3SDDB 1FC2D 4RRPG 1CXHA 5AZEL 4OCLC 3ELAT 4K7PH 1FRGH 1AD9A 5GIRB 1U8KA 2PW2A 2Z8WC 5F9AC 5A3IC 2JELH 5DK2A 2P7TB 3CFKA 3WFCL 1XFPA 2IQAA 3P77B 5E2TH 5HGHB 3ARDB 5DJ8A 4PJ9B 4H1LA 3UMTA 1UB6A 5FB8B 1CE6A 1BIHA 2WSKA 3PGFH 3RWIA 3UROR 5DDHB 1GZQA 3NGBB 1P9MA 3UO1H 4FXGB 1QBBA 4JN1H 5CINL 1FO0H 3I6GA 4JM2A 5D1XA 1PG7W 1LP9F 3HC0A 2VQ1A 1CDCA 5IW6A 3O4LD 1Q8MA 3WIHL 2Q76A 4KJPD 5CGTA 1UENA 5KS9B 3WFDL 4EN3C 3STZB 1RZ7H 2HJFA 5SWQB 4OFPA 2A6JA 4L8BA 4P2QA 3BOVA 1NCWH 3MXWH 5DD0H 4Z8FL 2W1NA 3G08B 1ZLWK 5GGRA 3MLYL 3DTXA 5DS8A 4F2MA 1NMBL 4YHYC 1T83A 2NX5D 3B3IA 3EDEA 3LSOA 3UAJD 3TN0B 4KI5F 4LCCA 5KJRH 3DIFA 3DURA 3JWOH 3FB7A 4FNLL 4UI2A 5BS0B 4Z7NF 3P0GB 1BHGA 2YD3A 5ADPH 4F8QA 3MUY1 1R5VA 3F5WA 2AJSH 4Z7WF 5DJYB 2Y72A 2VDNH 5I1LB 5IB3B 3CDGA 2IBZX 4FZ8H 4I13B 4PJAE 2VLJB 5C71A 3HLAA 3TO2B 2XWTB 1HCVA 4KQ4H 1R5IB 1GOGA 5F1KC 1CU4L 4NJ9H 2GAZB 4R90H 1UZ6E 5F7HA 1IEAA 3U9UA 3MA7B 4DKEL 2FECI 2FO1A 5TFSL 1DANT 1YMME 4U0RB 3EOTL 5C0AB 1MCNA 5EZLA 1K3IA 4LSSH 1I9EA 2Z4QB 4OQTL 4RAVA 3WDHA 2FLBT 3UTPD 3HC4H 3K8MA 1QSEE 1UA6H 4LSRL 2E3VA 3I9GL 4GMTL 4UIKL 5FO8B 4NZTL 2OZ4A 3JV6A 3SE8L 3SGKA 3ES6B 3OGCA 3TNMB 1PG7H 2OL3A 4XXCA 4GXUM 3O3UN 5T1KB 3QXDB 4DN4L 4RA3A 1G7IA 1MCOH 1BMGA 1I1AC 3RX7A 3LHPH 1TETL 4M00A 1KNOA 4YXLH 2YC1A 4BUGA 2CDGA 2CRZA 3VCLA 4N0FB 3LKOA 4UDTB 5INCB 4PJ7F 2EDXA 3VXMB 1KLFA 5C9JB 3BQUC 4NGHL 5I9QC 3QAZC 3GIZH 2A1WL 5GJSH 5LWYL 3MRRB 2XWBB 4DEPC 4R3SB 1GPOH 2D7QA 2VR5A 4YGVB 5DUPH 5T1MA 5D7JC 3V2AR 5MI0C 3BPCB 3N50A 3NACL 2VLME 5CWSB 3ARSA 4HKZB 2F54A 2C4FU 5DRNA 5CZKA 5HYFA 3MJ8A 2DDQH 3C2AL 3HMWH 5ELIA 2CMRH 2IPKB 1ED3B 4X7TB 4JM4H 2B4CH 1BVKA 3AAZA 5DMGC 2J8HA 1T5WB 2X10A 2OSLB 2ZCHL 3MLRH 4QF1A 1LE5B 5KVEL 1J1XH 4OIIL 2R1XA 1P84K 3RUGA 4HC1L 5JXED 3MACL 2F19L 4HULB 2PYEE 3CIQA 3VXSA 2QSCL 1IAKB 1OW0A 4M6OL 1Q9WA 1WC7A 4Q9CA 2ZUVA 2DF3A 3BN9C 3R8BB 4OTXL 4JO4L 4NJAH 3KJ4C 4HWUA 1A4JB 3R1GH 3U1SH 4ZUUB 2B0SH 2XRAL 5BVPH 2W0LA 1U3HC 1DQQB 3ARBD 3B9VA 5HXMA 1R3IL 3DI2B 2VQTA 1R3KA 3D18B 4BSVA 4KRPC 4POUB 2I24N 4K55A 4LLYB 3FTGB 1HHHA 1LE9B 5FYJL 1UM4L 1FSKC 1M71A 3E3QE 3O41A 2Q6WA 2PNDA 4JQIL 3VXRB 4PRDB 8FABA 1AGFB 3STZA 4N8VB 5IKCB 3MSPA 1PW3A 3BAEH 3EDKA 4Z0XB 5IBUB 4QRRE 5I1AA 1N5YL 1KGCD 1KG0B 5HJ3A 4DZ8A 1OGAE 1YEJH 4MJ6A 1WZ1H 1BQHB 2YOCA 3V8OA 1AGDB 1DBJL 2W9EL 3QH3A 5E2VH 1H3XA 4PRPE 5H35A 4XP5L 4Z7VB 5HGBA 1ITCA 3K81A 4B50A 1H3TA 4U1KA 5ENWB 2DQIH 3QDJB 5CCKH 2YWYA 1KEGH 1OP3K 4CVWA 2DM3A 2ICEB 3L3HA 4LLDA 4LDOB 1RK0A 4XCFH 3LCYA 1TZIA 4YPGA 1N4XH 3MFFA 4DKFH 1MJ7L 1Q0YH 2A9MH 1JFQL 3S88L 3ULVL 5DK0B 3TO4D 4NDMA 2GJZB 4JFFB 1UWXH 2YK1H 2P47B 4Q2ZA 5JW5A 2AJXH 1MI5B 1R5IA 2C26A 1Q9LB 4X99B 1ZTXL 4OI9A 1A3QA 1HCFX 1RK1B 2DQUL 4HK3J 1PKQA 2Q3ZA 2R0WL 1NFIA 1MQ8A 3MRPB 1MNUL 1N0XH 1V3MA 1YEKH 5SWSD 1D5IH 3LKPA 3V5KB 3V4PH 5EZIH 1FP5A 1U91B 4PJAF 4MSWA 4LP5A 1J8HA 3QCVL 1ZGLP 4QRPD 4QTIL 1O7VA 2DLTA 5D96B 3G5ZB 5I74B 4N90E 2A9NL 3STBA 2BNQB 1UZ6F 3W2DL 4G7VL 2XN9E 1T20B 1LNUA 3NCBB 5HD8D 4YXKL 2ATKB 4DVRH 4YHNA 1U8JB 3CH1B 5IVXF 1VEMA 5B39B 4OZHA 3GSQA 5DQDL 5CP7A 4HUVB 1OM3H 3K8KA 3PNWA 1OTSD 5JQHC 5DRWB 2OI9C 1DQTA 3WS3B 4I77L 4ZFGL 3A67H 3N1GC 2WBWB 5DRXB 4HMCA 1OQXA 3FO1B 3O3BA 3SCMA 1O7SA 3O3AB 4P5MA 1MWAB 3INUL 5SWZE 5F9OL 3LIZL 3LV3A 1T0MA 5HHOE 4M6AA 3QHFL 3UTOA 1BGXH 3KPSD 4ZO8A 1I1CA 4Z6AT 3ROOA 1FNAA 4MJIE 3KPLB 1HH9B 4L4VB 4XVUC 2HFFB 2P45B 2DQHL 1U8IB 4EQ2A 1U8QB 3K2UL 5TF1H 4EN3B 2ENSA 5GGUB 2BVQA 2HMID 1HIML 1LO3H 2JJUA 2WUCH 5H37H 2ZZUT 3CXDH 4CNIB 3P4MB 1MCPL 2FSEA 1H8SA 2FJGB 4TUOB 4Z95H 5JNYB 1C1EH 2NXZB 1Q38A 4QHUB 3P11L 4E41B 1N7ML 1M7XA 4YHYB 3RA7H 3GM8A 5D1ZC 4WDIA 3FJTA 4HLZH 4BFEA 1YMMA 1FAIH 2YA0A 1BD2D 3O6ML 2VDRL 3I50H 2G60H 5F1OB 3R8QA 1XGUA 1DQML 2ENYA 4JKKA 2W0FB 1QSEA 1D6EB 4CN1A 5I6XB 1L0XA 4XP4L 5F3BB 5TDPA 4WUKH 1ZLVK 1ORSA 5HHME 3RJQB 1A3RH 1ZGLA 5EOCH 1XR8B 4JANA 2HRLA 4DN3L 4UV7L 3HE6D 4LFHD 4XI5D 4BUHA 3QI9B 4YIQB 5JO5B 1H9VA 5F9WB 3TBVB 3P9MB 5C7XL 1H8OA 2XG5A 2VKXA 5E99H 3V0VB 5F1NA 3BZDA 4GH7B 4R2GD 1T1XB 1UJ3C 3RL1B 3ARWA 3PDDA 3V4VH 3KYNB 3Q6GH 3WL9A 1YYML 4G42B 4GKZA 1KYOK 4PTTA 2OJEB 4JLRA 2FEDD 5CBEA 3QDHA 3ULUC 5EIIA 3PWJA 4G6KL 4IS6A 5KN5A 3HZKA 2EKSB 2R29H 4J4PC 4KU1A 3HHRB 5TQ0L 3VGEA 2ZNWA 1ZLSL 4U1LA 4DW2H 3C60D 3MRIA 5GS0H 1X5FA 2AI0L 4NKDB 4NO5B 4OLYL 1FLTX 5GGQL 2AV1A 5IEHB 2XXCB 2PYEA 4WY7H 3PDOA 4MCZB 1TJHH 3TJHC 2PYFA 5GRWA 2XT1B