4V2XA

High resolution structure of the full length tri-modular endo-beta-1, 4-glucanase b (cel5b) from bacillus halodurans
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
534
structure length
534
Chain Sequence
b'KTLDIQSYVRDMQPGWNLGNTFDAVGQDETAWGNPRVTRELIEQIADEGYKSIRIPVTWENRIGGAPDYPIDPQFLNRVDQVVQWALEEDLYVMINLHHDSWLWIYEMEHNYNGVMVKYRSLWEQLSNHFKDYPTKLMFESVNEPKFSQNWGEIRENHHALLDDLNTVFFEIVRQSGGQNDIRPLVLPTMETATSQPLLNNLYQTIDKLDDPNLIATVHYYGFWPFSVNIAGYTRFEENSKQEIIEAFDRVHHTFVARGIPVVLGEFGLLGFDKHTGVIQQGEKLKFFEFLIHHLNERDITHMLWDNGQHFNRHTYEWYDQELFDMMRASWEGRSSVAESNFIYLKQGDRIADATVSLQLHGNELTGLRANGQRLTPGQDYELNGERLTVKAHVLSAIASSGTLGTNGMVTAEFNRGADWHFRVNTYRTPVLQSTQGHVSNFSIPASFNGNSLATMEAVYVDGGNAGPQDWTSFKEFGYAFSPSYDANEMKLTEAFFREVRDGEVRLTFHFWSGETVNYTIIKNGNQVTGIAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-BETA-1,4-GLUCANASE (CELLULASE B)
publication title Family 46 Carbohydrate-Binding Modules Contribute to the Enzymatic Hydrolysis of Xyloglucan and Beta-1,3-1,4-Glucans Through Distinct Mechanisms.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 200
structure length 534
sequence length 534
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03442 CBM_X2 Carbohydrate binding domain X2
A PF18448 CBM46 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v2xA01
1W9VA 4J3UA 1UWIA 1JD7A 2YIHA 3THDA 3VIJA 2GK1A 4PTMA 5IFTA 3UERA 4GI8A 3BMWA 3ARPA 3W0KA 1JI1A 3ARRA 1EHAA 1W91A 4B9YA 3T08A 3M46A 3WELA 3UR7A 4LPCA 4ATDA 3IJ9A 1TA3A 1B3XA 4HZ8A 2XGIA 4AEEA 4J3SA 4AXNA 4HU8A 3E1F1 3PZQA 2D0HA 3MO4A 1TUXA 4M81A 2IUZA 2WK2A 3L4WA 4ZENA 1UA7A 8A3HA 1C3FA 2GFTA 4GKLA 5A8OA 1HN1A 3WNOA 1CXLA 3OBAA 1LQ0A 1W9PA 1NWUA 2NW0A 2WC7A 1C8YA 1KXVA 3APGA 3MSDA 1C93A 1EHNA 2X05A 4PMYA 3AQUA 4CCDA 3U7BA 3K4AA 4D1IA 1GQLA 2PC8A 3ZQ9A 1UA3A 3NDYA 2J75A 4FLOA 3WEOA 1B31A 5JBEA 3EMQA 4GZEA 4HOZA 2VX4A 3ARQA 4UQDA 1GPFA 1VFFA 1CENA 3WNLA 4P8XA 4UQAA 4OOUA 4D72A 3A3HA 1EO5A 1XSJA 3VIPA 5BXTA 1US3A 1U30A 3OIHA 3I3EA 1E73M 4UCFA 3RJXA 4AIEA 3ZIZA 3SURA 1VJZA 2D0GA 4PCTA 1HJVA 2JFEX 4JFWA 5DT5A 3MMWA 4WKHA 5JIPA 3GM8A 1XD1A 1QNPA 4MNKA 2XFYA 3T0BA 2WWCA 2WB5A 3J7HA 5CGTA 3AIWA 3OGRA 5M17A 3VIIA 3WEMA 4MB4A 1EOMA 4LGXA 1O7AA 3VM7A 2WHLA 3N18A 5JUVA 1ZL1A 1E4IA 1ZBWA 2WKGA 2XWDA 3AI0A 4MDPA 1CBGA 2WBKA 2VJXA 2GVYA 2OYKA 4DWSC 4E8CA 4P8UA 3EYPA 2Y4SA 1WP6A 2PWEA 2GDVA 4W7UA 3SCTA 1WZMA 3AFBA 4H8UA 1BSIA 1OIFA 2E9BA 1HL9A 3MUAA 4N0RA 4FLQA 2BY0A 1CPUA 1RD6A 1RP8A 2ZX6A 1E55A 4KH2A 4A3YA 1SMDA 3HMCA 3ARTA 3GBDA 4U2ZA 1H2JA 3WKZA 5C8BB 4UFKA 4ACZB 4Z2HA 1MW2A 4HMEA 2VL4A 1WCGA 1E6ZA 1JF5A 2Z1SA 3F5JA 2OSXA 2ZWZA 5LYRA 2VT0A 4CU8A 1Q6FA 2W4XA 4AD5A 5JBFA 3VOCA 2DPEA 1BLIA 1W2VA 2GK1B 2W91A 1M04A 1JIBA 5HXMA 4HPGA 3NYDA 3GTNA 3IK2A 4CU6A 1UKTA 1V3MA 4IPNB 2CXGA 2E8YA 5GNXA 2RGMA 2G3IA 1DWGM 2W67A 3K1DA 1TA3B 3O2LA 4UZUA 4CN6A 1WDRA 1MW3A 3ZT7A 2XFFA 1UD4A 4DWSA 2VX7A 1BYCA 3POCA 3IJ8A 1LG2A 1Y7VA 3VNYA 3WD4A 2VTFA 1E1FA 5GNYA 3CZJA 1IT0A 2YA2A 1ITXA 3N04A 3OZPA 1J01A 1JFHA 2CITA 1E40A 3WN6A 3ZJKA 3EMCA 1TR1A 3WH5A 2YDQA 3GH7A 1V6VA 2Y8KA 3MS8A 3PZVA 1GORA 1GOOA 1ECEA 4EKJA 3NSMA 1CYGA 1K9DA 4URIA 1B1YA 4PMUA 3BCDA 3CHCA 1JZ7A 5E70A 4ZXLA 3PBGA 4JCMA 1PAMA 1BGGA 4P7QA 1CECA 3U57A 1BHGA 1VB9A 3PZTA 2VX5A 4GZIA 2WHMA 4V27A 1JXKA 5LA1A 4CVWA 1H3GA 3ZR5A 1G0CA 2PB1A 2XSAA 2WXDM 3AJ7A 4HU0A 1HKKA 1KGUA 1CDGA 1KCLA 2J78A 1W32A 4BQ4A 2OSYA 2DH2A 5AYBA 7A3HA 1OSEA 2ZUVA 3VGBA 4TTGA 1C92A 1E56A 3QHMA 3W53A 1OINA 4E4PA 4PMXA 1K9TA 3WQ4A 2VQUA 3EDFA 1QBBA 2CESA 4HA3A 1FA2A 4AIUA 4MAVA 4B15A 1HIZA 3HJEA 5IDIA 2WMHA 1ESWA 1GUVA 3ZM8A 1K9EA 4H2CA 2OLHA 3HU7A 1JGIA 4H04A 1G01A 1VAHA 2DSUA 3OLGA 6CGTA 5CXPA 4J3VA 3VDHA 1OD0A 1D2KA 5DFAA 4Z2KA 4D6CA 3WH7A 2FH8A 3W27A 1OGSA 4UFMA 5M3WA 2CERA 1UUQA 4TTUA 3KWXA 5FL0A 3BAXA 3O6AA 2FHCA 5IHRA 3LPOA 2AOSA 1KWKA 4NRRA 2ZWYA 4AZ5A 4DWSD 3UETA 4EANA 4KRUA 3VINA 2EPMX 1NP2A 1B90A 1LL4A 2CEQA 2UWFA 2V3DA 4DM1A 3BAYA 3SCRA 3ARZA 2J8FA 1GW1A 2WLYA 3SCPA 2QLYA 3AIBA 4YN5A 4YHEA 3UR8A 5A6SA 1JDCA 3RJYA 3OGVA 4CN1A 1GOMA 5CSYA 1G1YA 4DWSB 1E4LA 5EBAA 1GOWA 2D22A 1B2YA 1ISVA 3NIYA 4AZIA 1TCMA 1R7AA 4MTVA 3AS1A 3PZIA 3NCOA 3GXMA 1UKSA 4U5IA 1V6YA 4LYRA 1KWGA 2WBGA 3WF4A 2WKLA 1EH9A 4M24A 3N15A 4B3KA 2OWXA 3CPUA 2PWFA 1GQKA 2VOTA 3FN9A 2ZUMA 4MB5A 3W82A 2DEPA 2XG9A 2C7FA 1UOKA 3WDHA 3PZMA 4NSBA 3RCNA 1PBGA 2ZUSA 1W1PA 5I77A 1B3ZA 1CGWA 4XB3A 1SYTA 3QR3A 4UZSA 3WENA 3IANA 1Q6EA 1HVXA 4TUFA 2CHOA 4PMVA 4CU7A 5A6BD 1E6SM 5D9OA 3N13A 1UD3A 1XRVA 2XIBA 2QV4A 1FH7A 2ZXBA 1DWFM 1EDQA 2Y8VA 4AIOA 4AD3A 4X9YA 4UFJA 4AZBA 1ISXA 3QGVA 5F7UA 5A2CA 1WNOA 4PMDA 4HA4A 1RPKA 1W3HA 1P6WA 3SCUA 1MWOA 1DWIM 3B9EA 2OWWA 3CHDA 2EPKX 1E4NA 3BCFA 1JZ3A 2JF6A 1H0GA 5EFDA 3AHVA 1JDDA 3T0AA 2ZICA 5I3DA 1MQQA 4UOZA 1V03A 4B9ZA 2W61A 4UR9A 4MAZA 4HP5A 3QHOA 3VVGA 1XGZA 4J3TA 1HKIA 4J3XA 2VZTA 4AD1A 2Z1KA 4FF5A 3QOMA 1XYFA 5GQBA 4ACYA 3I3DA 3AXHA 1W1TA 5BYWA 2WHKA 1HJQA 4R5EA 1OD8A 4UOQA 2PBGA 3KL3A 4OZOA 1QNOA 1WDSA 1AQ0A 1FHLA 2XFRA 1ZJBA 3GNRA 2J25A 1CXKA 1L8NA 1KR0A 2J74A 1E72M 3W24A 4P7RA 1QI2A 3UG5A 4HTYA 3CZ8A 4UFHA 5BWFA 3VIMA 1CGTA 1V02A 3MUIA 1G5AA 1CZ1A 1NM9A 3SCWA 1HKMA 4F9DA 1H0IA 2UY3A 3VNZA 2AMGA 2V38A 2O9PA 4ACZA 1CXIA 2XJ7A 3FNDA 1PIGA 1D7FA 2DT3A 5A2AA 5IFPA 1R85A 1M01A 2VCAA 3VD5A 1NWSA 5D9PA 3QHNA 3WMBA 1LJYA 2DSWA 3BAIA 2VQTA 4PMRA 1UWSA 1CGXA 1IZJA 4NF7A 5CPTA 1ITCA 2WC3A 3LPPA 5FD0A 1JYVA 3OB8A 4BF7A 2O9TA 3AYRA 4PMZA 1GOIA 2BNJA 4B3LA 4ATLA 3WF2A 4D6FA 1X6NA 1NQ6A 1EA9C 1W9BM 2WVTA 3T2QA 3SCQA 2X8RA 3F5KA 1C91A 1E6PA 4MADA 1B30A 1G94A 4EE9A 1M03A 3OLEA 3WDPP 3MV01 3L4YA 3WNPA 2BXYA 1MVYA 2QMKA 1JL8A 2F61A 3AS3A 3T2OA 2XSBA 1PPIA 4LQ1A 2XHYA 4U5KA 1E0XA 2EBNA 2E9MA 2V5DA 3VGGA 2GJPA 3DYOA 1BYBA 1UKPA 1DWJM 2BXZA 2G8ZA 3BLPX 3CH9A 1V0MA 3WF0A 1E0WA 1W1VA 3DYMA 3GXIA 4GO8A 1Q6GA 1LL7A 3IAQA 1DTUA 1U33A 2WVUA 3L4UA 3WBAA 1A47A 2ZOXA 1ODZA 1QI3A 1QI0A 1VFUA 4X0NA 3AIQA 4HMCA 5A95A 1E3XA 2DT0A 5A69A 5EFFA 2YDRA 1BTCA 3WSUA 3M07A 3OG2A 3RILA 3BH4A 4A3HA 3RO8A 4FLSA 3ARWA 3OA5A 4TVCA 2IXVA 3L4VA 3WUEA 4EK7A 3WMSA 2G3NA 2EEXA 3LMYA 1B0IA 3I3BA 1J0YA 1QOXA 1VRXA 1KBBA 2ZE0A 4AW7A 5A8MA 2DSZA 4GZJA 1VJSA 1M7XA 2CNCA 2WMFA 3CMJA 3AZTA 1E4MM 4UTFA 1EDGA 1J0JA 3AHXA 2ZX9A 1B3WA 2WC4A 4ZE5A 2E4TA 4NI3A 1ZS2A 5HPOA 5M03A 4FK9A 3EDEA 1XH0A 3VX1A 4Z2JA 4JZ5A 2J7GA 4MB3A 2RGLA 2G3JA 4M29A 4Q22A 1LG1A 2UY5A 4P8WA 5ABGA 1SMAA 5AC4A 3BMVA 7TAAA 2W92A 3ZSSA 1LL6A 4AD2A 2CPUA 3N17A 3ARVA 4CD5A 4CD7A 1GHRA 1JG9A 1UD2A 1JZ6A 2A3AA 2YL9A 1YQ2A 2OSWA 3CZGA 3ZJ6A 1V08A 5ABHA 1JI2A 1WZKA 1E3ZA 1WZAA 3AISA 4PRWA 1QHPA 2FGZA 1S46A 1E9LA 3CZLA 1WO2A 5A1AA 4AD0A 1EO7A 1KB3A 3QOKA 3VDAA 1ZU8A 3WUFA 3BAKA 2ZXQA 1MYRA 4W84A 3B8SA 1ODUA 2Y5EA 2VR4A 3BXWA 4JFUA 1B3VA 4MNLA 3CUJA 4QFUA 4OIFA 1UYQA 2CKSA 2W5FA 3RM9A 1Q6DA 3GNPA 1W3JA 1MQPA 2YL6A 4M56A 3CLWA 2VURA 2V3FA 1X6LA 2D0FA 5CLTA 2AAAA 4WSKA 2VVSA 1UR8A 1QBAA 2D23A 1H49A 3WNMA 5E0CA 4AZ6A 1BYDA 1CLVA 1F4AA 4UQ9A 3CHEA 3AHYA 4BS0A 3GDBA 4X0VA 4AY1A 2WZIA 4IISA 1IV8A 3WNNA 4HA1A 2XVKA 4YPJA 1VFMA 3WQWA 4P8VA 2G3MA 3WBEA 5A2BA 2YL8A 2VI0A 1GNXA 4ZFMA 1R8LA 3LPFA 5AY7A 1R7OA 2JF7A 3WH8A 1K6AA 2YA0A 3UG3A 1E1EA 1E6QM 4W88A 4JFSA 1BF2A 3BAWA 3BLKA 1E15A 5CPQA 4MNJA 2C0HA 4GXPA 3U5YA 5KEZA 3WFLA 2J7FA 1SR0A 2WNWA 3IJ7A 4U2YA 1J12A 3RDKA 4D6IA 5DMYA 4W93A 3KL5A 5LA2A 4F66A 3DHUA 3S2CA 4RE4A 5CLWA 4W8LA 4PUEA 3W38A 1ISZA 3L2LA 1GQJA 5I2UA 4IPLA 1W3LA 3T2PA 1QHOA 3AICA 5CQ1A 4BQ3A 3EDDA 5D9MA 3F5LA 1CLXA 1TVPA 2JIWA 1J0IA 2BVYA 2VNCA 3GNOA 4JFTA 3MV11 1B3YA 1V6XA 1JDAA 2IXUA 1NH6A 1CIUA 3L4ZA 5A6MA 3ZMRA 3CZKA 4JL2A 1J11A 1HNYA 2D3NA 3N11A 2BHYA 4P7OA 2FH6A 1H11A 1IZKA 4M82A 1AMYA 4LX4A 3SUVA 4HZ7A 4AZGA 4J3WA 3GZAA 2NT0A 1NARA 2J47A 2XPKA 4PN2A 2J7EA 1GCYA 4PTWA 2VMFA 2WMIB 4H41A 3OGSA 1FH9A 3F4VA 4RE3A 2O9OA 4D71A 2B31A 2PF0A 1U2YA 3WQVA 1TFVA 2CETA 3VD4A 2VC9A 2XTKA 1MFVA 2EJ1A 2XIIA 4JKLA 1HKJA 4HMDA 1HX0A 3PZOA 3CBWA 1YHTA 1C7TA 1OCQA 2ZUNA 4U3AA 3WH9A 5A94A 3AHZA 3OZOA 2BS9A 1CEOA 1AVAA 5BXSA 3NUKA 2WPGA 1QHZA 4M1RA 5DT7A 4E8DA 3BC9A 3VPLA 3WY1A 4EAMA 1OGGA 2QF8A 2JALA 1J9YA 1JNEA 4GQQA 3WQ5A 3W6MA 1QNSA 1W1YA 1OWQA 1UD6A 4JIEA 4PSPA 4D6JA 4N42A 4RL3A 3A6OA 4DUVA 4AZHA 6TAAA 4U33A 1RP9A 1C90A 4Y7EA 1JZ4A 4PMOA 4BQ2A 1GOQA 5C70A 1ZBCA 4AEFA 2XYLA 1CNVA 2VUYA 2GJRA 3B9AA 4QLKA 2XGBA 2W63A 5A6KA 3SCNA 1DWAM 4ML4A 3N9KA 1Q6CA 2GDUA 3K8KA 1UR1A 3PZUA 4BCEA 4JFVA 1EQCA 1XH1A 3NSXA 2WANA 5A6AA 1UR4A 2E3ZA 1PX4A 3BAJA 1EOKA 4RE2A 1EGZA 3NJ3A 2BY1A 1ZB5A 3AIRA 3POHA 1I1WA 2E8ZA 1BYAA 3A4AA 3VUPA 1ZJAA 5ABFB 5CPSA 2ZIDA 3B9DA 1CGUA 4E2OA 2DT2A 1KFWA 2GSJA 3AXXA 1WAWA 4TVDA 1V0LA 4UOJA 1NP0A 3WD0A 4OOZA 2UY2A 2WSPA 4U31A 5ABEA 2FHBA 5ECUA 3ZOAA 2VRQA 3RMEA 1GONA 4ATWA 1ZBKA 2WCSA 4JHOA 1E6NA 2CIPA 4L4OA 1JZ8A 3W26A 1JFXA 1KGWA 3PTKA 4P7NA 2WZHA 4LYPA 2XM2A 3ZO9A 4W5ZA 1FFRA 1HJSA 4J28A 5FIPA 1XV8A 1MW1A 1FH8A 1HP5A 1I75A 2EPLX 3EMZA 2CBJA 2PI6A 3WUBA 3PN8A 1DEDA 3KE0A 1UG6A 4D6DA 3VDBA 3K4DA 1QI5A 2FHFA 3MMUA 1GJWA 4AD4A 4CN4A 2DSVA 4P7LA 5HBFA 1HJUA 3WDJA 2WSKA 3AZRA 4MDOA 5D8ZA 3G6LA 3AIVA 2X0YA 1WKYA 3SUSA 4W7VA 1C8XA 2E0PA 1AQMA 5AYIA 1KCKA 3WDIA 2GUYA 4PYSA 1SFSA 1TMQA 3VGFA 4Z2LA 3HN3A 3SCSA 4PUDA 2XVLA 1OBAA 3SCOA 5E6ZA 4PEEA 3THCA 1PZ3A 5HNNA 5I24A 1WPCA 2DIJA 2W66A 4KWUA 4JHZA 1MW0A 2J8GA 2DSKA 4Z2IA 2TAAA 1QI4A 2WMGA 2VO5A 2WM0A 1V3JA 4V2XA 5TD4A 3FW6A 1CXEA 3CMGA 1TVNA 2X0HA 2BVDA 4CD6A 1V0KA 1EXPA 3W6LA 1O6IA 1AQHA 3BGAA 4ZE4A 1PEZA 4WJXA 3VU2A 2Y24A 1MQRA 4A4AA 4GI6A 1EIBA 4H8VA 2O92A 1JF6A 1XH2A 3L4XA 1CTNA 5FCZA 3W29A 4XZWA 2BY2A 3O9NA 4JKMA 1VBRA 2CYGA 2W62A 1V3IA 3CGTA 3WEZA 2QHAA 1K9FA 3SUWA 3AIUA 2ZX5A 4CD8A 2JEQA 3WD2A 4CCEA 2VZOA 4M8UA 1R86A 5I23A 2JEPA 3ECQA 4BZYA 5EB8A 1UWRA 1OGBA 4KMQA 4WLCA 2YOCA 5E0FA 3VGEA 2VZSA 5A8NA 2WCGA 1KXTA 4IUGA 2DQXA 1H4PA 2V3EA 3AS2A 1J0ZA 3WDRA 1HXJA 4AC1X 4D6EA 1E6RA 3VMNA 3WL0A 4HOXA 1OT1A 3ARXA 3N12A 3CUHA 2Q8XA 4GPNA 3MANA 4QLJA 4W89A 4UFLA 1GOKA 1OIMA 2F2HA 4WK9A 1UH4A 1Z32X 3TONA 3T0DA 3AMKA 2J7HA 1JZ5A 4B16A 2WAGA 4QCEA 4MJ2A 4NZCA 1UZ4A 1V02E 3VIGA 3VIOA 1KQZA 3AROA 5I6SA 2VVNA 1OT2A 1OM0A 3S6TA 1UH2A 2EO7A 2OWCA 2X1IA 1JAKA 3VIKA 5I78A 1LF1A 3LPGA 4J7RA 1JD9A 4HOWA 4MPKA 1CXHA 2CKRA 4BQ5A 1VENA 3FAWA 2WVSA 1MFUA 1OB0A 3VMPA 1VFOA 1ZBVA 4AWEA 1HJWA 2D2OA 1BFNA 4OKDA 1WZLA 2X09A 9CGTA 1VEPA 4CGTA 3AIEA 4ZEPA 4L4PA 3RIKA 3W4RA 3SIMA 3GH4A 4NRSA 1J10A 1MXGA 3AS0A 1VBUA 3VM5A 3ARYA 2WYSA 3W25A 2EPOA 4S3JA 3UEQA 3WQ6A 1XSKA 4LXFA 2XUCA 2DGAA 1FP8A 2WVVB 3NSNA 3OLDA 1HL8A 2OYMA 2V5CA 4M80A 5A3HA 4CCCA 4AISA 3AHTA 3DYPA 4OUEA 3DC0A 1G9HA 1FHDA 4PTXA 5D8WA 2J7DA 4JCLA 4D6HA 3TTSA 3RM4A 1FFQA 1FP9A 5DF0A 1CGVA 3D5HA 2ZUUA 2WMIA 4GIAA 4PTVA 3K8MA 2E40A 3AXIA 1EQPA 1C7SA 2BHUA 1XYZA 2WCAA 1UKQA 5AC5A 3M6DA 5HOSA 1DP0A 2HVMA 1HT6A 8CGTA 3ZSTA 2WLZA 1C8QA 1CXFA 5GPRA 1E43A 4PCSA 4K68A 1UR2A 4PMNA 5E9AA 5BXPA 1XD0A 4C7FA 3L4TA 1FOBA 2CBIA 3K46A 2YBUA 1WDPA 1W9UA 4AZCA 4WSJA 3ZT5A 2YA1A 2J4GA 3GH5A 3SEPA 4AYSA 3WF1A 1JYNA 4CUCA 1WB0A 1N82A 3L2MA 3UESA 3MUY1 3TA9A 1UD8A 4GI9A 4TXEA 5BXRA 1KGXA 3FAXA 3IAPA 3K8LA 3N1AA 3TTOA 4V28A 3WDQA 2WHJA 3TP4A 2DDXA 3AMGA 3OLIA 1Q4NX 1QNQA 1UWTA 3VMOA 4MNMA 3PHAA 1W9DM 2VR5A 3CUFA 1CGYA 5M5DA 4F79A 3GBEA 4JKKA 4TOQA 2F8QA 5JBDA 1UKOA 3AZSA 3TTYA 3W37A 4YHGA 3PZNA 1NWTA 3VGHA 5DEZA 3PTQA 4W85A 2WWDA 3AMCA 3UG4A 1BAGA 5HPCA 6A3HA 5FL1A 1QPKA 2A3EA 1TE1A 2CBUA 4H8HA 2XM1A 2ZXDA 2WMKA 2GJXA 2NT1A 3NDZA 2YLAA 1VEMA 1VF8A 1CWYA 1NWRA 4AMCA 1RH9A 1E71M 5CGMA 3VD3A 3FY1A 2DH3A 2D1ZA 5IXEA 2PWDA 2ZX8A 1M53A 3T09A 5ABFA 3WNKA 2C8NA 2J7BA 2JE8A 5A6JA 3CHFA 4JAWA 4TX6A 1EDTA 1V0NA 2YLLA 3UCQA 5DO8A 5CG0A 1PIFA 1UR0A 1E5JA 7CGTA 2PWGA 2YBTA 3WUGA 1GHSA 4QP0A 4WKAA 2D3LA 2UY4A 2A3HA 5C71A 5CZKA 2J62A 1JZ2A 2YL5A 4GO9A 1HVQA 1X1NA 4XZBA 4GINA 1HJXA 5I79A 3AMLA 4QCFA 1GVYA 1V6UA 2CHNA 4F9JA 1JNDA 4CVUA 1XC6A 3MUZ1 1J18A 4S3KA 1V6WA 4MB1A 4QAWA 3VGDA 3G6MA 1KR1A 4C7GA 3WFZA 2XWEA 2FGLA 3A4WA 1BVZA 3GXFA 5BCAA 2BVTA 3SCVA 4QLLA 1VIWA 3VO0A 3KZSA 1UQZA 3MSGA 1KBKA 2ZUTA 4Q7NA 5A6BA 5A8PA 4UQCA 2NSXA 1WDQA 1KXHA 1BG4A 4XX6A 2YDSA 1QW8A 1L0PA 1NOUA 3FXYA 5CJ5A 2JIEA 2E9LA 1XHGA 5A6LA 1UD5A 3EDJA 3MMDA 4AZCB 4ZXOA 3WQ8A 4D6GA 4BA0A 3PZ9A 4KGLA 5A8QA 4W5UA 1W3KA 4WKFA 1PZ2A 3WIJA 3DECA 3VIHA 5BRQA 2XVNA 2EPNA 4WF7A 4XUYA 1TZ7A 5IHSA 1W2PA 1ISWA 3VDCA 3PZGA 1UWUA 4CD4A 5E09A 1NOFA 2XVGA 1UQYA 1GZJA 1JXJA 3VILA 4WIWA 3CTTA 1QVBA 5JIWA 1B9ZA 3W81A 2ZX7A 3ALFA 3CO4A 1J0KA 1H09A 3ZT6A 1UHVA 4F8XA 5FKYA 3CUGA 2BV9A 3VX0A 3AOFA 2VZUA 4W7WA 1UR9A 1KXQA 1LLOA 2XVPA 1H1NA 1TG7A 2D24A 3MU7A 4TVUA 4KRTA 3VKKA 2Y2WA 1BVNP 3FHAA 2GJXB 4FLRA 1GVIA 2J7CA 2BFGA 2A3BA 1E70M 2G41A 2QPSA 3WL1A 3AYSA 4MJ4A 1H5VA 2VCCA 4U3CA 2WMJA 4HZ6A 2WZEA 3VIFA 5BROA 3AMDA 4DM2A 1XCWA 2YJQA 1JAEA 1MXDA 5I5RA 2EXOA 2YKKA 1NOWA 3II1A 3RM8A 3WMCA 2QPUA 1XSIA 5CSUA 4Z2GA 2EQDA 1J0HA 1GJUA 4QDMA 1HF6A 3EDKA 2BY3A 2VX6A 1PX8A 3BSHA 1QW9A 3WH6A 4DUXA 3WD3A 1GQIA 2VRJA 2O9RA 2X2YA 4AZ7A 1I1XA 1LWHA 1D3CA 2V3GA 3U7VA 2WW5A 4IM4A 3SUTA 5D9NA 3D3AA 4OBRA 4CKQA 1V3LA 3ZJ8A 5HDRA 4OJYA 3ALGA 1BQCA 1BG9A 1QNRA 1PX3A 4KGJA 1V3KA 3GYCA 4R27A 5D4YA 1E0VA 1BPLB 2HISA 4UQBA 3ARUA 2FDMA 2G4FA 3A47A 2ZXAA 1JYXA 3SUUA 4UQEA 4W8AA 3KL0A 1VEOA 1F4HA 1E6XM 1WE5A 1W9XA 2WVVA 4PSRA 2CBVA 4XV0A 4DUWA 4D1JA 4FMVA 1PJ9A 2J79A 2DT1A 1ISYA 1E5NA 5I0DA 1DWHM 4W87A 1BGAA 4PBGA 4JL1A 5BRPA 2VCBA 2QMJA 3CIVA 1JYWA 1A3HA 5FOOA 5GNZA 1UZ1A 2D20A 3ZJ7A 1R87A 3DHPA 3KEHA 2CCRA 3ARSA 2VZVA 3A4XA 4GQRA 3PTMA 4H7VA 2OYLA 3ZR6A 2VRKA 1LWJA 1V3HA 3BSGA 3W28A 3RPMA 3VD7A 3WF3A 1DHKA 4UNIA 5LA0A 2J77A 2ESCA 2BHZA 2PBOA 2DIEA 4W86A 2MANA 1UH3A 3EBVA 4C7DA 1XCXA 3TOPA 4LYQA 4PMQA 4W8BA 3M7SA 3VD9A 1US2A 2PWHA 3JUGA 3GXDA 5E6YA 3VTRA 3FHQA 3MKKA 3WD1A 3TTQA 2A3CA 3U5UA 5EMYA 4UFIA 1UWQA 4OBSA 1H41A 4HPHA 4TX8A 3CZEA 1HP4A 5KZ6A 1KQYA 4J27A 3CUIA 2ZUWA
chains in the Genus database with same CATH superfamily
4HVXA 1GZ1A 3DFHA 4YMZA 1EYEA 1UWIA 2JQXA 2VOMA 3OG3A 4ROPA 3THDA 3VIJA 5CZTA 4LVDA 3ARPA 1JI1A 1XIMA 3IVUA 3W02A 3UXLA 3M46A 3W23A 1MO0A 4ATDA 5BOEA 5REQB 2GQAA 1VS1A 4PULA 3BO9A 1R3SA 4M1BA 4HZ8A 2JKPA 4J3SA 4AXNA 1O1HA 1TPH1 2V82A 3T05A 3GIYA 2EKGA 3E1F1 1VYRA 3PZQA 1P4CA 2D0HA 3MO4A 1SJCA 5C6MA 1S38A 2WSQA 2OZ8A 2GFTA 4GKLA 1OK4A 3G0UA 3TU9A 4HNOA 3SZ8A 4GGBA 4Z42C 1IT7A 4CCDA 3AQUA 5EKYA 4S3EA 5GJMA 5KSWA 1UA3A 4FLOA 2GGEA 3EMQA 2PSNA 1TKKA 4GZEA 1R3WA 4XQ6A 1VCGA 3ARQA 3ZVIA 1VFFA 2PDMA 2VWTA 4P8XA 5DCBA 5BU9A 3W74A 1R38A 3VIPA 1U30A 3OIHA 2INZA 3I3EA 3GE7A 5H8MA 3O05A 4BI7A 4AIEA 1VJZA 2D0GA 2V0TA 1S1PA 4QIUA 2FMNA 4O11A 4H9YA 1EJSC 5EGRA 1ZP3A 2OGYA 3T0BA 3FGCA 3DUGA 3USBA 3OGRA 3W72A 3TJLA 3VIIA 3WEMA 3QFWA 3HBLA 1ZL1A 1E4IA 4H7ZA 5EU9A 1D8WA 3HPSA 3A3WA 3CB8A 3GVWA 3QGKC 3WBYA 5TQLA 1KFLA 2GDVA 1WZMA 2XINA 4H8UA 4UMAA 4N0RA 5AYXA 2BY0A 1CPUA 3L5AA 4JR5A 4KH2A 1E9IA 2BGNE 1TPVA 3GBDA 3QYQA 1L8PA 4XIAA 3A5FA 4DAIA 1AQFA 2WV8A 1QOPA 3MQTA 4UC5A 4GXMA 4YS1A 4HMEA 2VL4A 4J1OA 2E6DA 1J6PA 4RDYA 2NSOA 2OELA 3W86A 1JF5A 2GGIA 3F5JA 4B5TA 1R2RA 4CU8A 2ZZ1A 4XBJA 3R89A 4QQUA 2PP0A 1BLIA 1W2VA 2GK1B 2W91A 2NVDA 1M04A 4RDVA 4JHMA 2I57A 3RF9A 1F8MA 5HXMA 4JTTA 1PTAA 3FA4A 2O7SA 1G4SA 2DUXA 2E1DA 1ZRQA 4QX4A 1JCLA 2PGRA 2G3IA 3URNA 2W67A 1TA3B 2QIWA 1MW3A 3IARA 4GD0A 2AQOA 3IJ8A 4XZLX 5IBXC 1Y7VA 3STEA 1XYMA 2DW6A 5FSEC 1IT0A 1ITXA 3MP3A 1S2VA 1RQBA 1V77A 5ABTA 3KRSA 4MVAA 3WH5A 4UIOA 1WUFA 1LOLA 4V33A 2VEGA 3GH7A 4IF2A 4WQ6A 4XKYB 3N6HA 5F1UA 4PL2A 1WXZA 3NSMA 1UJQA 4QHRA 4DBEA 1R3VA 3BCDA 1XF0A 2RDUA 5AYZA 4A6GA 1JZ7A 2QIIA 4GUFA 1ZENA 3N3TA 2ACSA 1PAMA 1XM3A 1E1CB 2YZRA 3GKAA 1WX0A 1VB9A 3NGJA 3R13A 2VX5A 4UTUA 1KM3A 4HPXA 1QOQA 4V27A 5JVLA 3ITGA 1H3GA 1G0CA 2WXDM 2ZBTA 4HU0A 4UB9A 5HMDA 2ZC8A 2J78A 1UC5A 2QDEA 4AHQA 3PC0A 2DH2A 5AYBA 3W3OA 5C0QA 7A3HA 1RLDA 1SO4A 5G2WA 3DXIA 5IBXA 4NVTA 4F48A 1C92A 5C2GA 4E4PA 1K9TA 3IV8A 1K03A 3EDFA 2CESA 3E74A 4AIUA 4O57A 3HJEA 4OFCA 1CX9A 5BZAA 3MWAA 4WUIA 4BFAA 2OEKA 4MWAB 5T9BG 3WG6A 2I5IA 3HU7A 1JGIA 3SO7A 4Q4MA 3HQPA 2YYTA 1T5AA 1VAHA 3OLGA 3E3HA 5CXPA 5L9FA 4NI8A 2VR2A 5DFAA 6ALDA 3MI6A 2BP1A 2YCEA 5M3WA 2UV8G 3MSYA 2CERA 3KWXA 2V5JA 3O6AA 3LPOA 1K7EA 2ZWYA 1KTBA 4DWSD 4EANA 3F4NA 1XG3A 1B90A 2OQLA 4NASA 4LU0A 4B2DA 4DM1A 1OF6A 1PDZA 3KVMA 4XD6A 3GXPA 2CLPA 1EP1A 3PM6A 2V5LA 3ARZA 2WLYA 3SCPA 2QLYA 4YHEA 3UR8A 3GFZA 5LIWX 3IK4A 3RJYA 3OGVA 3BMXA 1GOMA 3T6CA 4DWSB 1E4LA 1W5MA 2P3EA 1ISVA 3HO8A 3NIYA 1TCMA 1R7AA 2F6XA 2V30A 4EPBC 4MYAA 3NCOA 1JCYA 4U5IA 3M5VA 1XBYA 3UPBA 4LYRA 4LUSB 2V6AA 3WF4A 4X3ZA 3STPA 1EH9A 3W88A 3N15A 4FF7A 1A5CA 1LBFA 4Z08A 3RYSA 4B3KA 4PZVA 3FVDA 3BJTA 3L66A 4QG8A 1V7YA 2YCLB 2NUYA 2PDQA 4A3QA 4MUPA 3CM4A 3B8DA 2I7GA 3E12A 4QE5A 1PBGA 1B3ZA 4ZO6A 1SYTA 1KFBA 3M0LA 1W54A 1TREA 3OEXA 1RJPA 3QR3A 4UZSA 3DFYA 4TUFA 4RKAA 4ADSA 4PMVA 3PBUA 1E6SM 1W5PA 1XRTA 3N13A 5LKYA 4UTWA 3OQ8A 2ZXBA 1DWFM 1EDQA 1OQFA 3GB6A 4K37A 4AZBA 3CXOA 1OZMA 2NQHA 3SCUA 1MWOA 1DWIM 4P61A 2EPKX 5C54A 3TZFA 2FVMA 4O8RA 2ZICA 3HOJA 4UR9A 3BZGA 4MAZA 3VVGA 1XGZA 4KETA 3UWQA 3GDRA 3LCIA 4AD1A 3RCYA 1JRCA 1XLKA 2VYOA 3E6EA 3I3DA 5BYWA 4M51A 3I4KA 4R5EA 4UOQA 3KL3A 3B05A 1WDSA 4DXKA 3O6CA 3EWXA 1TPB1 2CLKA 2DW7A 3T1GA 3VFLA 1CXKA 4N02A 1KR0A 3B9OA 4LVGA 3ITXA 3MUIA 3LI1A 1CZ1A 1NM9A 4HT3A 4F9DA 1H0IA 2UY3A 3R5EA 3V16A 3VC6A 4ZOEA 3XIMA 2O9PA 2XJ7A 3FNDA 2XH0A 1TRDA 3ZWTA 1TV7A 3CS2A 3VD5A 2OCZA 2WQPA 3NL5A 3BAIA 1FVPA 4BEQA 1XFBA 3WK3A 1IZJA 5CPTA 2CXEA 2Y8UA 1MUCA 2O9TA 4PMZA 4AF0A 2BNJA 2G95A 2YXXA 4F0HA 3TH6A 1W9BM 2DQWA 3PWAA 3T2QA 2X8RA 1XLEA 1E6PA 2NZLA 1M68A 3VFCA 1G94A 1NIUA 2C1GA 3EWCA 3L4YA 3MV01 1W3TA 3W9ZA 1JL8A 2ACUA 1X96A 3ABZA 2F61A 5I3JA 2NV1A 4PCPA 1KLZA 1NSJA 2Q71A 1PPIA 2XSBA 4QISA 5HJXA 4LQ1A 2XHYA 4WXZA 3PJUA 2PD9A 4A8RA 5XIAA 4ORMA 3C6CA 4FNRA 3BLPX 3L9CA 2X1UA 3K5XA 1NQKA 1W1VA 3DYMA 5BMWA 3WQCA 3GXIA 4GO8A 4IIFA 3LCFA 2QUMA 3IPWA 1DTUA 2E5DA 4XO6A 1U33A 2WVUA 2PDCA 3L4UA 1A47A 4DF1A 2GDQA 1ODZA 1QI0A 4X0NA 3AIQA 2GQ8A 4G5DA 1E3XA 2FLIA 4I7VA 5LNRA 3O06A 5A69A 3EWBX 5EFFA 3RR4A 3M07A 3OG2A 3RILA 3BH4A 3OA5A 3L4VA 4R3UA 3WUEA 3LMYA 3UP8A 1AW1A 1PZ1A 1VRXA 3C61A 2ONEA 4UNKA 5A8MA 2DSZA 3G2GA 2DVTA 3F4CA 3M0KA 3AZTA 2OOGA 4ZO9A 4HGXA 1U1JA 1ZS2A 5M03A 2IS7A 5I3GA 3L2IA 1X6UA 8TIMA 4BF9A 1XH0A 3VX1A 5M1TA 3BV7A 5MKGB 2NQ9A 1GG1A 1UC4A 3LB0A 2G3JA 4M29A 4L6DA 4Q22A 2UY5A 2HK0A 2FZ8A 3E49A 3NR0A 4PMJA 3USZA 3O0KA 1B4KA 2BASA 4S2CA 4O4WA 3E38A 2ALDA 2C1HA 1N8IA 4HBKA 1YQ2A 3CZGA 2ABBA 1RVKA 5CEWA 3E2VA 4PRWA 1E3ZA 2ATSA 3H21A 5F4XA 1QHPA 1E9LA 3CZLA 3BLDA 3VDAA 2P10A 3U4FA 3BG3A 4EPEC 3BAKA 5M2FX 4LAZA 3NPXA 1LCOA 4IJCA 2VR4A 4FNTA 4A22A 2GPTA 3BOLA 1UYQA 2CKSA 5CAHA 2XH2A 1RCOB 3GNPA 2YL6A 3CLWA 2D0FA 5CLTA 1OFBA 5GJNA 4PE8A 1T8XA 2ISWA 1G4PA 1W17A 1UR8A 2VVSA 3KOFA 1H49A 1RBAA 1U83A 4H9ZA 1IR2A 1BYDA 4AZ6A 4AYGA 5AC7A 3AHYA 2WSYA 1XLMA 4BS0A 3C2OA 4WY0B 3U2OA 3PFRA 4LS2A 2JKEA 2VUNA 4C6DA 2NWSA 4O1CA 2OPJA 4P8VA 3KZPA 3UT0A 1TPC1 2YL8A 3LCWA 4DF0A 1GNXA 1R7OA 1ZALA 1E1EA 4W88A 1BF2A 3BLKA 4GHRA 1Q6LA 2C0HA 1A5NC 4RW3A 5AB3A 1K8XA 5AZ0A 2C13A 3U5YA 4QSHA 2VFDA 3R2GA 2NQLA 1J12A 3W1TA 1EEPA 3TNOA 3KL5A 2TRSA 5AVHA 3WLJA 1W6TA 1GQJA 5KMYA 5AVNA 1W3LA 1KW1A 3ZVHB 3T2PA 3HGSA 4BQ3A 4TR9A 3QN3A 3F5LA 4HJFA 4EXBA 2JIWA 5DN1A 3B0UX 3BW3A 3H55A 2QR6A 1JDAA 1UMYA 2IXUA 2ATMA 1NH6A 4LCSA 3BANA 4AG0A 1Q8JA 1J11A 3OZYA 4MJZA 3N11A 2BHYA 1H11A 3TZNA 3W7PA 2DY3A 3S2NA 1RD5A 1NFPA 1DJXA 1OYCA 3VE7A 3QLDA 2MUCA 1GCYA 3PULA 2VMFA 3MJYA 3OGSA 3BLIA 3TVAA 2QXWA 2ZRYA 4D71A 4JTHA 4KEMA 1BXNA 1EJUC 3CV1A 3VD4A 1PCWA 3DFQA 4DWDA 2VC9A 3KHDA 2C79A 2NX9A 3W1PA 1MFVA 1AK5A 1HKJA 1C7TA 1JCXA 2ZUNA 4JTGA 3RX2A 1P0NA 8XIAA 3T0CA 5A94A 1RCQA 4JYEA 1SSGA 1CEOA 1AVAA 4YYFA 4JIHA 3M9YA 3CPGA 3U2ZA 4DZAA 3BC9A 2V2HA 1ZHAA 2QF8A 3PB2A 1HG3A 3O16A 1UBSA 3WQ5A 4XK2A 3W6MA 4XBKA 1PSCA 4PSPA 1KM4A 4D6JA 4RL3A 2ZRZA 2V68A 3DG6A 4LJ3A 5C70A 4IG2A 3MC5A 3EB4A 4E2BA 1VLIA 5F4WA 4Y9AA 2NX1A 3GFYA 2E67A 2W63A 4DBDA 2IPGA 3TJ4A 1DWAM 3BE7A 4ML4A 1K8YA 5L6UA 3ZXWA 3OA3A 3VNKA 3OQEA 2GDUA 4JEQA 3K8KA 1UR1A 4BCEA 4C60A 1UZHA 3HQNA 1UR4A 2E3ZA 5FAGA 2CW6A 1LWIA 3C3NA 4ZVJA 3H8AA 4RE2A 3M5XA 3R8RA 2Z2BA 1TWSA 2OKTA 4B5WA 2R14A 2V67A 1FDZA 2CZDA 3VNLA 3B9DA 4MUZA 2GSJA 3AXXA 4IIEA 4TVDA 1V0LA 1XLDA 3WD0A 1P1XA 2WSPA 4U31A 2FHBA 4LYKA 4ATWA 1OYAA 1U5VA 1POKA 1UWAA 2CLOA 3G5EA 4L4OA 1ADOA 1JFXA 2REQA 4LYPA 1QW7A 3ZO9A 3M0YA 1F2JA 5D2YA 5FIPA 1XV8A 1VLWA 1MW1A 4XZHA 4YTQA 5CZSA 2Z24A 3RX3A 4UCGA 2J9XA 4O50A 1SM9A 1XL9A 3K4DA 3REQA 5KZEA 1GJWA 1XLHA 4IZGA 2I16A 3AZRA 4MDOA 5D8ZA 3G6LA 1L9WA 1C8XA 5E93A 5AYIA 3RRAA 1SFSA 3VGFA 4AUBA 4Z2LA 3TOYA 2AMXA 3MP5A 2AL1A 1OBAA 5E6ZA 4QJ4B 3W07A 1PZ3A 5HNNA 2DIJA 2W66A 2EG7A 1NFBA 4JHZA 3LXBA 2FKPA 5C9RA 2WMGA 4NZ3A 4IGHA 2NXGA 4GK8A 2Z4GA 1M7PA 4M3PA 2PAJA 1I2RA 1EFZA 1XLGA 1OK6A 1KRMA 1V0KA 1YBQB 3M47A 3HFYA 1AQHA 1XIJA 4ZSTA 4ZE4A 1MQRA 1BRLB 4XZWA 1TTJA 1VBRA 2W62A 4GMEA 1ONRA 3CQHA 1DIKA 3SUWA 4EPKA 4M8UA 4ALDA 2AL2B 4RUBA 3V1PA 2B7NA 1OGBA 1ZAHA 4KMQA 5AHFA 3E0FA 2WCGA 2Y7GA 3L65A 1W1ZA 1OJXA 1GVFA 5CBJA 2YCKX 1J0ZA 4IH3A 3M6YA 1HXJA 2WOQA 5FJPA 1ONXA 4ERIA 3WL0A 4DXXA 4YVPA 3N12A 3MJMA 3TSDA 4GYPA 5B80A 4UFLA 4AHPA 4F0SA 1OIMA 1VGAA 2G0WA 3AMKA 4IQJA 2FTYA 4MY1A 1SPQA 1W0MA 1U22A 3VI2A 5AKQA 4IQDA 3SI9A 2VVNA 2HNHA 2NQZA 1ZTVA 3T9PA 5CC3A 2OWCA 9RUBA 1W31A 2X1IA 1JAKA 2F7FA 5TIMA 4YVXA 4GBUA 3SDOA 3KM8A 4HOWA 3G1VA 3GU2A 5HJLA 5J8LA 3MVTA 1MFUA 4I6KA 3PJWA 1YPIA 2QCDB 4AWEA 1MEHA 3FOKA 1ZPTA 4NILA 4NJIA 1O68A 1T41A 2X09A 3B9NA 1FWSA 2X30A 4C6PA 4CQ8A 3RIKA 3GH4A 4H2HA 1MXGA 2C16A 1VBUA 2YX0A 3PAOA 3ARYA 4IPPA 3VABA 3VKCA 2WYSA 3W25A 3CQ0A 3M43A 3GVQA 2F38A 2AAMA 3BJFA 4LWWA 5HR7A 1FDYA 2OB3A 1FHDA 1XKYA 3LZ5A 3PP7A 1O95A 3EXTA 4H9XA 2J7DA 5F4SA 4DN1A 2XN2A 1FP9A 4MM1A 3BV4A 5XINA 3JZUA 3PJTA 4MGGA 4F4RA 4GIAA 4CCZA 2E40A 2PDUA 2CLHA 1XYZA 4IXHA 2WCAA 4OVXA 1UKQA 1SZGA 1DP0A 2HXUA 4DLFA 1KTCA 2OVLA 4K38A 3NEHA 3AU6A 3OPSA 4C1NB 4E0CA 3UZ5A 4PCSA 4PMNA 5BXPA 1XXXA 4JY9A 3MKVA 4C7FA 4REQA 2KZHA 5GVJA 4JYFA 4DZ5A 1NF0A 4L80A 4GABA 3UCCA 3NL3A 3GH5A 3KBVA 3SEPA 4EP8C 5G2IA 3P5YA 1QWGA 1N82A 3L2MA 3MUY1 4BI5A 3TA9A 1UD8A 3TTOA 3OLIA 3N73A 1Q4NX 3URBA 3M0VA 3OW1A 3PHAA 3LCXA 5G4WA 5M5DA 1B4EA 3VZYA 6REQB 3NGFA 4NY2A 3W37A 3SAZA 3PZNA 1NWTA 1Q6RA 5HAOA 5DEZA 3CJPA 1WV2A 4GQGA 3PTQA 3EWDA 4AY7A 3BURA 5FL1A 1EC9A 3W7IA 3Q94A 4LB4A 3H53A 4WX2A 1DJQA 2ZADA 2GJXA 2Q3RA 2VWSA 2X7VA 3H4GA 3R79A 1VYPX 2RKXA 4JN6A 2DJXA 3CV7A 4GNVA 2YLAA 1VEMA 1VF8A 2DZUA 4AMCA 3PSVA 5CGMA 4J5NA 3Q37A 2DH3A 3FS2A 2WJDA 2ZX8A 1M53A 4HJWA 3T09A 5ABFA 3TN6A 5DXYA 5A6JA 1PWMA 4RLIA 3KLKA 3W7KA 4TX6A 5DX7A 2HK1A 3CNYA 3FVMA 4UR7A 1E5JA 3FJ6A 3M4HA 3GXNA 4GCXA 4NNCA 1GHSA 3MPGA 4QP0A 2QT3A 4FIQA 3GC2A 3R10A 3UJSA 2J62A 4FI4A 2Z2UA 1JZ2A 1Q7MA 1P6BA 3ZFHA 1HVQA 5C7VA 2HJPA 1MRQA 1HJXA 3A21A 1WBJA 5I79A 3AMLA 1GVYA 3DDMA 4DO4A 3XINA 1F6YA 4I6VA 1JNDA 4CVUA 4S3KA 3G6MA 4Y9OA 4C7GA 3TV8A 5E9XA 4DHGA 1FCUA 4ZSUA 2FGLA 3QMRA 3A4WA 3GXFA 3OZMA 3VC5A 4JTDA 4OWGA 1UQZA 2P0IA 4C6OA 4UQCA 1BG4A 4ZQRA 5FJUA 1R6WA 1KKRA 1Z89A 1NOUA 3GTIA 3BDKA 1Y8BA 4XKMA 5I3FA 3ES7A 1R2SA 4BA0A 2ZRWA 1YIXA 4JN7A 4LANA 1XIEA 5BRQA 4XUYA 3OVRA 4AMAA 1TZ7A 2VC7A 1W2PA 1Y65A 3VOGA 3V1HA 2O7QA 2AKMA 1O66A 1SZEA 4XVEA 3PZGA 3QH2A 4CD4A 4CNOA 4GWEA 3BARA 1NOFA 2EPHA 3ABSA 1R9ZA 4KERA 3WK2A 3QM3A 4IMFA 3TA6A 5DANA 1QVBA 3W01A 5G4EA 4ZGYA 4E6MA 3W81A 4IUOA 3CO4A 1H09A 3ZT6A 1SFTA 1UHVA 3O63A 5G5IA 2V9DA 2ISDA 3VX0A 5CAKA 3AOFA 4DXVA 5D09A 2AGTA 2HE8A 5FI8A 1PUDA 1NU5A 2Y2WA 2PRHA 1EL3A 4EF9A 5LNVA 3FHAA 1W3NA 4Q4RA 3KS5A 4V1YA 3RRXA 2J7CA 2BFGA 1IXQA 2A3BA 1E70M 2CWXA 2PCEA 2QPSA 3KDOA 4MJ4A 4R33A 4PODA 4GY1A 3VIFA 5JU6A 5H91A 2V8ZA 1IGSA 3TWAA 1ONWA 4N4PA 3W85A 2W79A 1JAEA 4R88A 2EXOA 4A05A 1O1ZA 1E9YB 3RM8A 4HTBA 3OODA 4JIPA 2QJGA 3UZXA 3EDKA 3WFAA 1XGEA 2VX6A 2WJFA 4IGSA 4PRRA 4G1NA 3QTPA 5DY2A 5KINA 5LIXX 3NQGA 3RO6A 3LD5A 1BXBA 3NQDA 2X2YA 3O15A 2V3GA 1V7AA 3SUTA 3LUTA 1V3LA 4LRTA 4OJYA 2IQDA 3UG8A 2C14A 2VEFA 7ODCA 5MHBA 1KM1A 3UVIA 3U48A 3SECA 4G7EA 1W8GA 5D4YA 2CLEA 1BPLB 4PEKA 4UQBA 4S3CA 3S1VA 3A47A 2ZXAA 4M6PA 4YTTA 3KL0A 1OF8A 1F05A 1E6XM 4GNKB 3UCDA 4D1JA 4FMVA 1N8FA 4DUWA 2J79A 1F61A 1ISYA 1E5NA 3LY0A 5I0DA 2GGJA 2QUVA 4W87A 4DYKA 1X98A 3MHFA 4JNZA 3SY8A 3ZJ7A 1R87A 3DHPA 2CCRA 4GQRA 3PTMA 2VRKA 4CQDA 2QKFA 1LWJA 5AOUA 3HG5A 3BSGA 4N9BA 3W28A 3P2VA 4IIGA 3SN4A 3W7MA 1KCZA 2HVNA 2PBOA 2Z1WA 5HATA 2X42A 2PLKA 3THUA 4W86A 3OOQA 4W8BA 3JUGA 1IYXA 5E6YA 4AHOA 1TX0A 1W1IE 3WD1A 3TTQA 1YRRA 3U5UA 3PUEA 4UFIA 4HPHA 1IWPA 4LC8A 5HINA 4PUJA 3ABRA 3CUIA 4Y9MA 3P74A 4J3UA 1A53A 1SW7A 3CT2A 4A2SA 3ZZ1A 2PCQA 2I56A 4QE1A 4Y8FA 3UJEA 3HGJA 3ARRA 5F2MA 3T78A 1R3QA 1W91A 3T08A 4IT1A 3UR7A 5DMMA 3WLIA 4HHPA 4MG4A 3UY7A 3G1YA 1B3XA 2XGIA 4AEEA 2GVJA 2E77A 2DORA 4QE4A 3DESA 3VNJA 3N2MA 1TUXA 3UBPC 3L4WA 1MXSA 3B4UA 1UA7A 1F07A 1C3FA 4S23A 1HN1A 4Z0SA 4YJ5A 4MHBA 1CXLA 3MCNA 3KRZA 3E0WA 1S5TA 4MZYA 3H70A 4B5XA 1EHNA 1QU4A 4TQTA 3K4AA 4G8TA 3C0JA 3UA3A 3G3DA 1GQLA 5K2ZA 4KW2A 2EAWA 3WEOA 2FB2A 2Z00A 3KOYA 3GG8A 3W75A 2INFA 4HOZA 1T99A 4KWWA 2EF9A 3DERA 1GPFA 3WNLA 4UQAA 4OOUA 1OHLA 3A3HA 1EO5A 1US3A 1KM5A 3GHRA 2V5KA 3UFYA 3A9BA 3O6DA 3A23A 3ZIZA 5G4HC 1AW5A 1TWDA 2JFEX 5DT5A 4WKHA 5JIPA 4IIBA 2HBXA 1QNPA 4B5VA 2WB5A 3J7HA 5M17A 5D03A 1SZRA 3LBCA 4B5NA 3T81A 2Y70A 4L56A 3F2CA 1J5TA 3VM7A 3TQVA 1ZBWA 4IIHA 2XWDA 1CBGA 1FWDC 2WBKA 2GVYA 2ZA2A 2OYKA 1VCVA 3GW3A 3LTSA 1WP6A 1N2VA 4NQ1A 2HDJA 3SCTA 3AFBA 4AY8A 1OIFA 2E9BA 3MUAA 1RD6A 2ZX6A 1E55A 3EOUA 1VR6A 4QTGA 3HMCA 3GU9A 4HB7A 3FDGA 3CL8A 4U2ZA 3OVPA 3HG2A 1XKJA 3EB3A 1S3HA 1VCFA 4PL1A 4ACZB 4F0MA 1MW2A 1XBXA 1Q85A 4IFOA 4LUTB 3W1NA 3QV9A 4HN8A 4JQ2A 2J24A 1E6ZA 3L0GA 1NVMA 2Z1SA 1AD4A 2DZBA 2Q6ZA 3SW6A 4Q6JA 4GE8A 2OSXA 5LYRA 2XFWA 2W4XA 2DPEA 2UZ9A 4JQ4A 5F2LA 1KKOA 3BGGA 2PDPA 3S1UA 3IK2A 1F6KA 3BSMA 3O07A 1XBVA 4NIRA 4IPNB 3TCSA 3NQ2A 2E8YA 3VKDA 2D73A 2X1TA 3S5SA 3NZPA 1FWRA 3GG1A 3K1DA 3EWUA 1FWAC 3GK0A 3VNYA 3WD4A 2VTFA 5IM51 3QMTA 4LTSA 3OZPA 3WN6A 1GEQA 2CITA 4ORIA 3ZJKA 3GZ3A 3RLVA 3V36A 3CC1A 2YDQA 1NY1A 3KFTA 4LFYA 3VCNA 3A3XA 1GORA 1GOOA 3CIWA 3R7MA 4EKJA 4TV6A 2BODX 2R91A 3FYOA 1K9DA 3V0UA 4PMUA 1SSDA 3KXQA 3MP4A 3PUGA 1B5TA 4LUYA 4ZXLA 5BOOA 1X38A 1RALA 4QXIA 1CECA 3PF3A 1GYNA 2PZNA 3P0WA 3TN4A 4L61A 1XIDA 1KGUA 1G67A 1REQA 4MZ8A 1TMHA 4BQ4A 2B7QA 4I5XA 3DBPA 5TAOA 3FGCB 5U7SA 5H8PA 3M44A 3SM0A 3VGBA 2F6UA 4N9CA 2OO6A 2VQUA 3W1AA 3N25A 4E8GA 4HA3A 3FX4A 3PR2A 7TIMA 1Q7QA 1HIZA 3IJDA 1GUVA 2HPIA 1DE5A 3ZM8A 2DUZA 3C56A 4H2CA 3PPGA 4FNSA 1H61A 1VBJA 1G01A 1I45A 2DSUA 4H8NA 5C9WA 6CGTA 2R9RA 5PTDA 3LBOA 1D2KA 4KWVA 4D6CA 3W7RA 1DTNA 4TTUA 1IE7C 5FL0A 3VK5A 2DZVA 2HZGA 4R7WA 1K7FA 1SW3A 4IX0A 1F3XA 3VINA 4JDYA 3PS7A 1J96A 2EPMX 1TZZA 4GVHA 1QR7A 2V3DA 4OECA 3LV5A 4EAYA 3KBWA 4M6UA 1J5SA 1NFGA 1MZRA 4ZODA 4M6QA 5HA7A 3MO7A 3AALA 2PLMA 4JNMA 1GOWA 2D22A 3R0DA 2XDFA 1B2YA 2BOEX 5ENLA 1QJWA 1HL2A 4X61A 4XTIA 1H7OA 3TXZA 4DJEA 4NZ4A 4M24A 2F2KA 3SRHA 1TIWA 3NAVA 4EIVA 4D2JA 3NXFA 4QJ5B 2PWFA 5CPLA 2YDAA 3W2NA 3W82A 1TZ9A 3UWWA 4H01A 2VDIA 1VPYA 3UA4A 2GVGA 5I77A 4YWSA 2OZTA 4NJJA 1A0DA 4WDTA 5LHEA 3Q2DA 5A6TC 1TELA 2I9UA 4WDUA 4LS1A 1IEIA 4PBFA 5D9OA 1XUUA 3OBKA 1TV3A 2QV4A 4WVXA 1NDYA 1EGMA 1TPEA 4X9YA 1ISXA 3QGVA 3UWEA 2VEIA 3LCLA 4PA8A 5D04C 2OT0A 4RPPA 4GNJA 3WLNA 2JKAA 3CHDA 3LHWA 2Q3OA 1E4NA 3BCFA 1H0GA 5EFDA 3T0AA 3T0TA 1Q2RA 1JEZA 1FQ0A 3CWHA 2CZEA 4B9ZA 2P5NA 4LH8A 1L6YA 4JS3A 5EMJA 3ORWA 1TJ0A 1HKIA 5LNSA 2Z1KA 5I02A 4IWWA 3GG0A 3QOMA 3LG3A 4ACYA 2RUSA 4GUGA 1A0EA 1EUAA 4OZOA 4E3TA 3WLHA 1DXEA 1T0OA 1FHLA 1XICA 3W6YA 3GNRA 1S5VA 5FEZA 1L8NA 2ICSA 3CLMA 1YMYA 1E72M 2J74A 4P7RA 2NVAA 4XD3A 2D2JA 3NM1A 3TW6A 1C29A 2INEA 3VIMA 1CGTA 5CSRA 3ATYA 1YKWA 2GSEA 2VC5A 1QT1A 5TF0A 2AMGA 5T9CE 1K8CA 4ILSA 4JTLA 1AUSL 3HTWA 3GLCA 4IP4A 4MFEA 3P60A 2DT3A 1VC4A 3DC8A 1R85A 3S5YA 2CLMA 5EYWA 1NWSA 4UUIA 3VKBA 3QHNA 3RU6A 2VQTA 5AHIA 2PLJA 5C9UA 4TIMA 4NF7A 1ITCA 2WC3A 3SN1A 3L68A 4GYJA 3CWOX 4B3LA 4KIEA 3WF2A 3TK7A 1X6NA 1RXOB 4D9PA 2VENA 1S5MA 5DMLA 1C91A 2ZTKA 3VNIA 3MZNA 1B30A 1MI3A 4EE9A 4ZQNA 1LOQA 4I9AA 3W2LA 2BXYA 1MVYA 2YCIX 1XISA 1U1UA 4TV5A 3KS6A 4NXKA 4GYKA 3M0MA 4U5KA 2E9MA 2BMBA 1MEWA 3V5OA 3DYOA 1UKPA 2G8ZA 1S1RA 2BXZA 5F2IA 3CH9A 1V0MA 1E0WA 4XVDA 2C0AA 1Q6GA 3CPRA 4HK7A 1R9XA 4MWAC 3W2KA 1JPHA 5HR6A 1IR1A 4XKYA 1QI3A 4A21A 5HWJA 1YYAA 5EL1A 3TNBA 4FB7A 1ZP4A 4X2PA 1SZNA 2XU2A 2DT0A 4RDWA 4I3GA 4ZQMA 4LNYA 1E1CA 1OFRA 4LALA 4A3HA 4DZHA 4N4QA 4Q8TA 3RO8A 4XAYA 4RNFA 2IXVA 2Z1BA 1TTPA 4EK7A 3WMSA 2G3NA 2EEXA 4LAUA 4Q4OA 4R9XA 5D32A 1PO9A 4KEUA 1M1BA 1ZNNA 3F03K 4GZJA 1A49A 4C6EA 2QUNA 2WMFA 4INFA 3AHXA 2WC4A 2PUZA 2E4TA 4NI3A 5DRIA 2VXNA 4WRHA 2QCEA 4IL2A 2BXVA 3W7DA 2J7GA 2RGLA 2PDKA 3BMVA 4MWAA 3OJGA 3PB0A 1R0MA 1LL6A 5CKSA 3V4BA 3RMJA 3AO0A 1ZAJA 4FOKA 3N14A 2QUUA 4L4MA 1FUYA 4D8ZA 4IMEA 3RN6A 4H6QA 1JZ6A 3T4WA 2A3AA 5HWMA 1DBTA 3ZJ6A 4JTCA 4BEUA 3IEBA 1WZAA 3AISA 4Q7IA 1PKYA 3SRDA 2ZVIA 4N6EA 1XLIA 2WM1A 4BHYA 1WO2A 1VFLA 2QCFA 5EMMA 1EO7A 1KB3A 1OC5A 1ZU8A 3WUFA 1ALDA 3T8QA 3IS4A 4J35A 4AF0B 3LXAA 1A0CA 3NEVA 2FTPA 1ZY9A 4EXAA 4NYYA 4DBSA 1B3VA 1D3GA 4GH1A 4TO8A 2W5FA 4JNYA 4M56A 4B91A 2PTYA 1X6LA 3SSZA 3IJQA 2D23A 1QPRA 5E0CA 2WNNA 1CLVA 3M64A 1F4AA 1OCNA 3CHEA 3GDBA 4IJRA 4RZ5A 1MMFA 2HE5A 3K4WA 4NJGA 2PTZA 4HA1A 1IQ8A 1POJA 4YPJA 1KFJA 1VFMA 3LBMA 3WQWA 1VD6A 2G3MA 3WBEA 1PTDA 4LUSA 1YDOA 2HS8A 3ZYZA 3U2CA 1LYXA 1R8LA 3V7PA 1L6FA 3OIXA 2R1PA 1K6AA 3Q45A 3QR0A 3EWWA 1E15A 3LHTA 1Q13A 4MNJA 1DQWA 2O55A 4GXPA 1F76A 4HNVA 4LRSA 3I6EA 5I09A 3BLFA 1SR0A 1GTHA 2DP3A 2FMOA 1ZAIA 1GKPA 2J13A 2YFOA 3EPOA 5DMYA 4W93A 5EPDA 5LA2A 4F66A 4WOQA 4RE4A 3W38A 3L2LA 5I2UA 4IPLA 3P80A 5K4ZA 3AICA 2BGSA 5D9MA 4MMWA 1J0IA 2BVYA 1B3OA 1GTEA 2VNCA 1V6XA 4C6NA 1CIUA 2H90A 3OYZA 3L4ZA 5A6MA 5CBBA 4X9SA 2IPFA 1KM6A 2OEMA 1KV5A 1O5RA 2FH6A 4P7OA 3S46A 3WJXA 4HZ7A 3M0IA 3T40A 3GZAA 1NARA 4ZOBA 3VNMA 1TB3A 5JXQA 1KFKA 1ZSXA 4RE3A 3LRMA 4PH6A 2H6RA 3GW0A 1VFSA 2B31A 3UWUA 1U2YA 4L1GA 2PF8A 1XIHA 2CETA 1GQNA 4PRTA 1F8IA 1VRDA 4I5RA 1Q7ZA 3W7JA 1V4YA 4JKLA 4M19A 4GACA 4U3AA 2QJJA 3WH9A 5CPNA 2Z1VA 3AHZA 3OZOA 1PVNA 1F3TA 2GQ3A 2PS2A 2WPGA 3R6IA 3NO1A 2PDNA 4YIWA 3EKLA 3VPLA 3WY1A 1H7NA 1OGGA 2FZDA 2JALA 1J9YA 4AWUA 1AFSA 2VFGA 4GQQA 3O7UA 1AL7A 1QNSA 3KCOA 1OWQA 1XWYA 1D3HA 1M3UA 4JIEA 2F9RA 4N42A 6TAAA 3T07A 1AZ2A 2PC4A 4M7SA 1C90A 4Y7EA 4IMDA 1JZ4A 4AEFA 2C18A 2XYLA 3B8UA 4KEVA 1CNVA 3EKGA 5LZLA 1ZJIA 2VUYA 3TROA 4QLKA 3U3HA 2WKJA 1H7RA 2ZVRA 4ROQA 3N9KA 3HG3A 3PPCA 4KIRA 1Q6CA 3KBNA 1XH1A 1DPMA 3NSXA 3EEZA 3IJ6A 1PX4A 4O13A 1EOKA 3LGGA 1BYAA 3A4AA 4UTIA 3HGOA 2XN1A 1P5BA 2ZIDA 1V79A 1CGUA 1YPFA 2DT2A 1KFWA 3MTWA 2PWVA 4HU4A 4UOJA 1NP0A 4OOZA 2UY2A 3WJWA 5ABEA 4GUJA 1YNQA 1IXPA 3ZOAA 5IOBA 4XZ9A 1GONA 2PGEA 3PWIA 4DELA 5KZMA 5C7HA 1JZ8A 3W26A 1KGWA 4F40A 2CZ5A 4P7NA 5MF5A 4KF1A 3TE9A 1K7XA 3L0KA 5DBTA 1NF7A 2CC0A 2OX4A 4XUGA 1EC8A 1I75A 2ZZ3A 2NV2A 4E3VA 3CO8A 1EX5A 3L7RA 4AVOA 3KE0A 3T4CA 3VDBA 3MMUA 3Q58A 3C0LA 4P7LA 1RK6A 1HJUA 3ABXA 5LXXA 4I7WA 4WXYA 3TN5A 4QS5A 2X0YA 2PTXA 2Z1XA 1YXDA 2E0PA 3HGRA 4PYSA 4PCNA 1TMQA 1JULA 4YU1A 4PUDA 4PCFA 4JN8A 2XISA 1BTMA 3SSJA 2RHGA 3PANA 3GUWA 2OR2A 3DOPA 1MW0A 2J8GA 2DSKA 4MKSA 2TAAA 1QI4A 4N7QA 2VO5A 5U4NA 5CH9A 3NYZA 3FLUA 5TD4A 1HZYA 3QZ6A 1IHIA 5B7ZA 1CXEA 3CMGA 4QEEA 1TVNA 1RHCA 2CLFA 1TV2A 3N2BA 3W6LA 1M5WA 2BOGX 1DJHA 3NTYA 3BGAA 5JMUA 4WJXA 3VU2A 4A4AA 2RAGA 4GI6A 1KFEA 1DL3A 4S3FA 1EIBA 4H8VA 3KVJA 3H2OA 2NQ5A 1JF6A 3K13A 3KRUA 4GRSA 1CTNA 5DLCA 1CLKA 3ITCA 2CYGA 3GO2A 3UXDA 4IG2B 1RQEA 1V3IA 4Q8OA 3CGTA 2QHAA 2ISVA 3AIUA 4MSSA 2ZX5A 2JEQA 4CCEA 3NPVA 2JEPA 1X1OA 4BZYA 1UWRA 3AU2A 2H3BA 5A8NA 5F1VA 1EJTC 3HPXA 3IVSA 3R4IA 2PFHA 1FDJA 4KCVA 2CHRA 3WDRA 3N2XA 4ADTA 1XIBA 2PGFA 3F1QA 4GUIA 4CQAA 4NZJA 2Y61A 4QLJA 4HHLA 4W89A 3WQOA 4WY0A 1UH4A 4M0XA 3G1AA 2J7HA 4B16A 1F3EA 2ZZ4A 4NZCA 1V02E 3VIOA 3SFWA 1KQZA 3QJAA 4C6BA 3AROA 3HF3A 5I6SA 1XR2A 4C6KA 3OHIA 3IIPA 1OT2A 2Z6JA 3S6TA 1UH2A 4DJDC 2EO7A 3WX7A 4QEHA 1OZQA 4J3ZA 1TV4A 3TCEA 3OO2A 1LF1A 2Z25A 4BJHA 3HURA 1GT8A 1R5YA 2FQIA 2WJZA 2BGQA 2PRMA 4I9MA 5FAJA 1OB0A 1VFOA 3DGRA 3HMJG 4QQ3A 2D2OA 2IW0A 4QS6A 2R6OA 4EWND 3W7QA 1I0BA 5LHFA 4ZEPA 3REQB 3WLMA 4E2DA 3PVFA 3SIMA 4NRSA 3W7HA 1DQXA 3AS0A 2E6FA 4PBEA 1TV8A 3VM5A 3BQ5A 3NZQA 4S3JA 3WQ6A 2WVVB 4IL0A 2G96A 2OYMA 1C9DA 4GA8A 4CCCA 4GIEA 2XIMA 4OUEA 1GPWA 2QNEA 2PTDA 4JCLA 2Z26A 4G2DA 3TTSA 3KTSA 5D05A 4AB4A 1JDEA 2PP1A 5FSDC 4DJDA 4R53A 1THFD 4NJKA 4PTVA 3K8MA 4MIMA 1C7SA 2ISFA 4S38A 4B92A 1LM1A 3QYSA 4BF5A 3TC7A 1AZ1A 3NQ6A 2WLZA 3ZSTA 4JIRA 1E43A 5FACA 1YE6A 1UR2A 1SQ7A 3LCHA 3SGUA 5K9XA 1FOBA 2CLLA 3K46A 1WDPA 3VOJA 4AZCA 1XQLA 3GRIA 4WSJA 3WCZA 3BLEA 3G1FA 2YA1A 2J4GA 3T44A 2DV0A 3R11A 1V5XA 2VGFA 3G0XA 1JYNA 2ZZ5A 4CUCA 1WB0A 1V6TA 5BXRA 1H60A 4OV4A 1DV7A 1C9WA 2HVOA 1P6CA 2DDXA 5CPMA 1QNQA 1UWTA 4DIAA 1X7FA 1PB0A 4MNMA 3TFXA 3CUFA 3LU2A 5EY5A 4IPJA 4TOQA 2F8QA 3AZSA 3TTYA 1EJXC 5I07A 2O4MA 4G1KA 3SJNA 1AMKA 2BSLA 4W85A 3WLOA 2J6XA 3AMCA 1BAGA 6A3HA 1UP2A 2PA6A 4QITA 1FKXA 3I7QA 2X16A 2A3EA 3MSRA 4FXFA 3FA5A 1QK2A 2XM1A 3KOZA 1BD0A 2NT1A 1OX5A 1DE6A 4WY0F 4WZHA 3KP0A 3ZLFA 2VGGA 1FY6A 2FPTA 1CWYA 3QC3A 3NURA 3QEZA 1I4NA 1FTXA 4Q4QA 1R47A 4QR6A 1KRAC 2QZRA 1DYSA 4W4QA 5CC7A 3O6YX 3D6NA 4UXDA 2I5QA 1EDTA 2YLLA 3UCQA 3FYYA 4DF2A 2PWGA 3WUGA 2A21A 4LV4A 3IIZA 1Z6KA 3S1GA 5C71A 1NJJA 3RFAA 1G7VA 3EX3A 1JRBA 4K36A 4QCFA 1CW2A 1V6UA 1H5YA 3NZGA 1XC6A 1J18A 1V6WA 4QAWA 3RU8X 1KR1A 1KCXA 2TSYA 5A5WA 1D8CA 2BVTA 2GL5A 3QV6A 1LP6A 3MBDA 1VIWA 3VO0A 2QJMA 1MUMA 1WAUA 3JU2A 4JD4A 3SRKA 1KBKA 2VEMA 4KPLA 5A8PA 1MNZA 2G4JA 1GW9A 4HIBA 2NSXA 1Q63A 1KXHA 3GU1A 4XX6A 2PDFA 4CQBA 4AXKA 1L0PA 3N29A 5GJPA 4FIRA 4AVNA 4REQB 3QF0A 2RDWA 4C6IA 3EDJA 3MMDA 3WQ8A 2A2IA 1TWWA 1YPXA 3C0SA 4WOZA 3EGJA 3RAOA 3PZ9A 3HFTA 3EKZA 4J40A 2OQHA 3O8AA 3WIJA 4UTKA 3GD6A 3VIHA 2EPNA 3H12A 4HZMA 2A6LA 5IHSA 4XZMX 2VEKA 3OU8A 3QSTA 4KBXA 1IEXA 5E09A 2XVGA 1GZJA 1M6JA 3RXZA 1HGWA 2GJNA 3ALFA 3IGUA 1J0KA 3UYCA 3CL7A 2E5BA 7PTDA 3LDVA 3RNDA 1PV8A 1KC7A 2RDTA 4W7WA 4JTRA 3XISA 1H1NA 4XAGA 1TG7A 4QSFA 4OT7A 2GJXB 1GVIA 3FDKA 1VZWA 1EZ2A 4S3BA 2G41A 2A7RA 1KV8A 3H4XA 3L0NA 3NQ7A 4Q6XA 2OOFA 4HZ6A 2PWUA 1SU5A 2WZEA 3JS3A 5BROA 4K39A 1XCWA 1TPFA 1Z42A 1G4TA 3ITOA 1JUKA 4AU0A 1NOWA 3II1A 3WMCA 2QPUA 5CSUA 2Y85A 1QDSA 2EQDA 1SGJA 2BY3A 3W00A 5FF3A 4Z17A 2A1YA 1C8VA 1QW9A 3WH6A 1GYLA 1A5MC 4DUXA 1KBJA 4EVZA 1GQIA 2VRJA 2ASHA 1D3CA 1F6PA 1SFJA 1MDLA 4IM4A 2BB0A 1XYBA 3ID7A 4CKQA 2DIKA 3IV3A 5HDRA 1QCWA 3UGRA 3UR2A 1EF3A 1LBLA 3NWRA 1QFEA 4YNGA 2J9YA 3U6WA 1RV8A 2AQWA 4F2UA 2BZNA 2C6QA 3ARUA 1Z44A 3OVQA 3LERA 1JCMP 3B8VA 3UZYA 1UASA 3QLLA 1PYMA 1VEOA 3GY1A 1W9XA 4XV0A 1DJYA 1R3YA 3SJ3A 2H9AA 3ZLHA 2PGWA 3P67A 2DT1A 3NVDA 3T55A 4JTEA 4E5TA 2A3LA 2VCBA 3CIVA 1A3HA 5FOOA 5GNZA 3IWPA 1D7KA 4N9EA 4L65A 3KEHA 1AODA 3B8WA 1V3HA 3SBFA 3COTA 3E0LA 3CUZA 4DLMA 1DHKA 2X40A 2Z7GA 4IXXA 5CJMA 1LRTA 3A5VA 1EXBA 2PTWA 2ESCA 1O94A 2BHZA 2ZRXA 4ASTA 1RK5A 1XCFA 3TAKA 1FKWA 3TX9A 1UH3A 2VC6A 4JIQA 1GWJA 3VD9A 3M7SA 2GVEA 4MLJA 4NKCA 4WGHA 3MKKA 5F2GA 4JQ3A 3DFPA 5EMYA 4OBSA 2WSRA 4O0ZA 2DZXA 2PRLA 3I10A 2QUTA 1KQYA 5HMEA 3IUDA 3ZS4A 3WQDA 4TX9A 3TTEA 4JTQA 1XI3A 5T26A 2ODOA 3MUXA 5IFTA 3UERA 1R2TA 4GI8A 3E2SA 4M7TA 3W0KA 4PUMA 3NO5A 1EHAA 1RA0A 6ENLA 4B9YA 3R25A 4LPCA 3QV7A 5CJNA 1CI1A 1XUZA 1F7BA 3MYPA 2KAUC 4RPQA 3IJ9A 4DI8A 1IF2A 3PUDA 4QM1A 4V15A 1XP3A 4HU8A 4WGXA 3O1NA 3LSBA 3LRLA 1GK8A 2IUZA 2WK2A 4HNLA 5FJOA 3E96A 5FESA 3B0YA 2LLEA 3MB9A 3HZ3A 2PU0A 1AL8A 3BVJA 1IEQA 2WC7A 1YNPA 3U2EA 1KXVA 3APGA 4PMYA 1QUMA 3U7BA 1AJ2A 2PC8A 1ICSA 4ZQOA 3GNXA 1VFHA 3NPUA 3TYDA 3K1GA 3UWVA 3NDYA 1JPMA 4CNTA 3UWYA 1YE4A 1B31A 4FNPA 1EWEA 4G7EB 2XIJA 4UQDA 1O12A 1UCWA 3S8HA 1W5QA 3QV8A 1UUMA 4GH3A 4D72A 1K8ZA 2FVLA 3TYZA 1O4UA 4QG9A 4XZIA 4UCFA 3RJXA 3SURA 1HJVA 4JFWA 4DYEA 3GM8A 1NDZA 4HU3A 4R7OA 4IICA 2WWCA 5CGTA 3AIWA 5I3KA 4A8LA 1LRQA 4NAEB 4PTDA 3LHYA 4RJEA 5XIMA 5JUVA 3M5YA 1JQVA 2OKOA 3AI0A 4PUNA 2VJXA 3WZ0E 1US0A 2E7FA 2YR1A 4NJHA 4E38A 2OO0A 3CL6A 2NVCA 2XZ7A 1RP8A 2OXNA 2FIQA 2Y63A 4A3YA 4FXJA 2NXHA 1ELSA 3S1XA 1SMDA 3VAVA 1H2JA 5I3IA 3WKZA 3QW3A 3OVGA 5C8BB 4UFKA 2V5BA 4A3RA 2YB1A 4Z2HA 3GWQA 2Y1HA 3IJLA 4BK9A 3DFSA 1WCGA 1XRSA 5BOFA 3QBUA 2ZWZA 2Z7KA 1HQTA 2VT0A 5T91A 1Q6FA 1ZJHA 3LHVA 4AD5A 5JBFA 1TYGA 1JIBA 4ICNA 4HPGA 3NYDA 3GTNA 4L64A 1ITUA 4CU6A 3GHTA 3H2CA 3I68A 2R1LA 3H2MA 4FXRA 3TWBA 2V2CA 3LN3A 5TBOA 1LUCA 3BOXA 4NNBA 1TR9A 2PDBA 5GNXA 1UMLA 3W2MA 2RGMA 3N2CA 3DHDA 1WDRA 3W71A 3ZT7A 2ZZ7A 1UD4A 1W3IA 1LG2A 1DQUA 1UPMB 2P1FA 1EJRC 1E1FA 3SFKA 2EG8A 1VPXA 1J4EA 3CZJA 1OFPA 3G1XA 4JY8A 2PDJA 1J01A 1E40A 1A4LA 1H7XA 1WKFA 4L6OA 2RJGA 3RK8A 2A7PA 1TR1A 1S2CA 2R1NA 1FWIC 1V6VA 1VKFA 4IFKB 1OFDA 4EX4A 3MS8A 1M7OA 4KFPA 4CNPA 4ICMA 5HQMA 3DH7A 4JTAA 7REQB 2RDXA 1P0DA 1CYGA 1B1YA 2Z27A 2ANUA 1EA0A 3LYEA 3TQPA 1CT5A 2HS6A 3G18A 3EPNA 1G4EA 2OG9A 5E70A 1XLJA 3ONBA 1LQ2A 3SB0A 3W2UA 4HYVA 4P7QA 4LUJA 1BHGA 3KHJA 3PZTA 4Q33A 2WHMA 2Q8LA 1JXKA 4CVWA 4XBSA 1XYCA 2DJLA 2VELA 3ZR5A 1DJGA 2PB1A 3C2VA 3AJ7A 1HKKA 4WR3A 4FOJA 3D0CA 1T8QA 4GFSA 4CNSA 3CHVA 4GKTA 2YXOA 3R0UA 3W83A 5DQPA 3QW4B 2ZUVA 3WK1A 1RAKA 1ZUAX 1E56A 3QHMA 1TX2A 1UJPA 1SJDA 1YNYA 2DUAA 3C86A 4RDZA 1BSLA 1FA2A 1XYAA 4MAVA 4S3GA 4B15A 3A64A 3LMZA 5IDIA 2WMHA 1ESWA 1EUNA 3PBMA 4H3DA 3Q65A 1UPPA 1K9EA 4AFYA 3H6OA 2WNQA 1ADSA 1OADA 4AC7C 1VH7A 1W5NA 2Q8ZA 4US6A 2EKCA 4ZO8A 4DRSA 3W22A 3ZR4A 1OD0A 3PK7A 2DZTA 3RLUA 2FH8A 2IPWA 4UFMA 4DNHA 1UUQA 5IHRA 2AOSA 3I6RA 4NRRA 1KWKA 4KKXA 3MY9A 3EZ4A 3H26A 4K7VA 3C0QA 2BBFA 1H7WA 2PDWA 4KRUA 3UW6A 3WQFA 1NP2A 4Z1BA 1W5OA 4K8EA 2UWFA 1Z7AA 3SCRA 2KX9A 3WLRA 1ICQA 3F4DA 3A24A 3I65A 4NL1A 1S2AA 5AYYA 1FWGC 3NQFA 3AIBA 2HCVA 4YN5A 5LXEA 1XRFA 1JDCA 2DZPA 2QDDA 2ZTJA 4CN1A 5AECA 1FWTA 3UXKA 4LBSA 1U5JA 3PBYA 1R3TA 1TO3A 3W1MA 3TMQA 2O56A 1WUEA 4MTVA 1I2QA 3AS1A 3GXMA 1UKSA 3Q67A 4YCPA 2BLEA 1V6YA 2WNZA 4JQ1A 1EBHA 1TWZA 3VZZA 4ZQPA 5DXXA 3S83A 3DG7A 1DVJA 2ADAA 3W7LA 3CPUA 5TNVA 3C52A 2VOTA 2ZUMA 4MB5A 3EB2A 1Y5WA 1MSSA 1X7IA 2XG9A 1UOKA 1VFTA 3WDHA 3RCNA 2ZUSA 4FR1A 4LY4A 3FJ4A 1CGWA 4O19A 4XB3A 3TR2A 4HNNA 1YTKA 1X8CA 3WENA 3IANA 4L1WA 1Q6EA 3WJZA 3G1DA 4YTUA 5EA9A 1REQB 1ME8A 3P8JA 1UD3A 3C8FA 2XIBA 5AHLA 4K1GA 2YW3A 3S9YA 1TTIA 2FYMA 4UFJA 3GYEA 3QKZA 5F7UA 3WLLA 3TQKA 4PMDA 4HA4A 1RPKA 1W3HA 4C6QA 5LNWA 2OWWA 2Y7DA 1JZ3A 2JF6A 1K77A 1HFBA 2A85A 3AHVA 1JDDA 3I6TA 3DHFA 1ZQ5A 5H8UA 5I3DA 4XO7A 4UOZA 1V03A 1SJBA 3EXRA 3FSTA 4HP5A 3QHOA 3WLKX 3WO8A 4LB3A 1VBGA 4J3XA 2VZTA 1A4MA 3W7EA 3N2TA 4JQAA 5GQBA 5D2TA 1W1TA 3PAJA 2E09A 2WHKA 3AXMA 3UJFA 4R34A 2FVKA 3CV2A 2B7OA 3H54A 1ZJBA 1P43A 3E5BA 2J25A 2GUUA 4QGCA 1OX4A 1XPGA 4IIDA 4NX0A 3W24A 1WXYA 3WJSA 4HTYA 3APYA 3TLLA 3CZ8A 1VHNA 4UFHA 5BWFA 1EEXA 1LORA 8RUCA 3UYIA 1G5AA 1XW8A 3SCWA 3TMLA 4DJED 2VDGA 3VNZA 4O0KA 1K02A 4Y90A 4O17A 4GFIA 5EMLA 1M9HA 4ACZA 1CXIA 3RPDA 1JPDX 1PIGA 1D7FA 3QZEA 1I0DA 4LBRA 1M01A 2VCAA 3QY7A 1Q5MA 1LJYA 3LS9A 2DSWA 4RXFA 4C6FA 1SW0A 4PMRA 1UWSA 2XIQA 3RLHA 4JEJA 4OUIA 3LPPA 1QNVA 1JYVA 3AYRA 1GOIA 1FXQA 3G3MA 3NVTA 1KBLA 3H23A 2WVTA 2A6NA 3F5KA 3QPYA 4BI6A 4MADA 1M03A 4B90A 3OLEA 3WNPA 1UP0A 4HYRA 3CK5A 1FWWA 3CEPA 4HSNA 1I6NA 3LM7A 3T2OA 1GVOA 3TR9A 1DJZA 4JBRA 3GC5A 1QMLA 1E0XA 3BQ6A 2EBNA 2V5DA 4RK8A 3TYEA 1BYBA 1DWJM 3F2BA 3ZWSA 2FZ9A 4MKNA 1LL7A 4M6VA 2PURA 3IAQA 1AA1B 1S2TA 1X39A 4MJMA 3ABOA 2BG5A 3WBAA 1DJNA 2H8XA 2ZOXA 3GUGA 4IMGA 3TYAA 4MZ1A 2I14A 1VFUA 3ENLA 4HMCA 5DRCA 5IDZA 3PG9A 3GR8A 6XIAA 1OC7A 4GX8A 1BTCA 1RVGA 1U5HA 3ARWA 4TVCA 4LF2A 3I3BA 1N55A 4MOZA 1QOXA 2H3DA 3APTA 4O1BA 1MRAA 1XLBA 2CNCA 3E2RA 3CMJA 4UTFA 3TN3A 1J0JA 2ZX9A 1E51A 2XN0A 4YVVA 1B3WA 1DXFA 3THQA 5EMKA 4ZE5A 3GHUA 5HPOA 4EACA 4NAFB 1O5KA 4FK9A 3I7RA 4Z2JA 1WDWA 2E1WA 4O1EA 4JZ5A 4J9JA 2P8CA 3IGSA 3EX6A 3ANYA 4QBXA 4P8WA 1SMAA 7TAAA 3B06A 3H2FA 4AD2A 2C19A 4CD7A 1GHRA 2IQ0A 2E6AA 3M0JA 2QYGA 1JG9A 1UD2A 1LT7A 4QNEA 2YBVA 5ABHA 1V08A 1JI2A 1WZKA 3WQGA 1PXGA 2G3FA 2OODA 3B40A 5C5YA 1ZLPA 5A1AA 5B7YA 3CT7A 4HNUA 4AD0A 3QOKA 4LF1A 4PFMA 3VDGA 4Z1DA 2ZXQA 1K6WA 4I90A 1Z48A 3P0XA 3B8SA 1ODUA 3BXWA 3LGDA 1SJAA 4JFUA 1UZDA 4MNLA 4OIFA 1ICPA 3FJNA 1W3JA 3A12A 1VHCA 3QMSA 2Y89A 1X1ZA 1K4GA 3KTCA 4G6CA 3V75A 3GX9A 3P3BA 4US5A 3IGHX 4X0VA 4AY1A 2WZIA 3EWYA 4IISA 1FHVA 3CAKA 3WNNA 4ZQCA 2XVKA 3V35A 3AC0A 6XIMA 4BWLC 3O0FA 3FJLA 4G7FA 4WSHA 1L2UA 5A2BA 4AQLA 2VI0A 3KW3A 5KZDA 5J04A 3VKAA 4ZFMA 2A0NA 3LPFA 5AY7A 2UBPC 3G1HA 1QPOA 1Q45A 2JF7A 2CU0A 4ZFCA 2YA0A 3VKJA 3RPTA 3T7VA 3H22A 3CAQA 4JFSA 4RNJA 5CPQA 4X22A 4LAMA 4WJEA 4UTHA 1IIHA 1BXCA 3MBFA 3WFLA 1QK0A 1TTQA 3HG4A 1J2BA 1YTDA 2WNWA 1A3WA 3JRKA 2VHLA 3H24A 1LOSA 1LLZA 3N4EA 3DHUA 3S2CA 3BWWA 4W8LA 4PUEA 1ISZA 3A22A 2VFIA 5FEPA 1L2QA 1FWFC 3VOHA 3TIMA 4B5UA 3B4YA 4MWAD 3LV6A 3EDDA 1CLXA 1TVPA 4IOTA 3SGZA 3LHUA 1JDFA 1Y5VA 5AHNA 3GNOA 1YDVA 4JFTA 1B3YA 2QCCA 4I7UA 3ABQA 5DBUA 1Z3NA 1GEHA 1LRNA 5J5RA 1P7TA 4BWLA 1HNYA 3JZEA 2XIOA 1IZKA 2ZZ6A 5I03A 2NQJA 1AMYA 2HPMA 3EAUA 3SUVA 1AH3A 1K3UA 2NT0A 1UB3A 4PN2A 2TMDA 1LT8A 4PTWA 2WMIB 3BW4A 2FB3A 3KCLA 2XSXA 3F4VA 2W27A 4Q8QA 3BJSA 3WQVA 1SR9A 4N2YA 4HQVA 4Y9NA 2FZMA 3V3WA 3LQGA 4AX7A 3S2JA 2XIIA 3IACA 1PHQA 2P8BA 3IJIA 4HMDA 3PZOA 4LY8A 3UD6A 1K70A 3CBWA 5AC6A 1YHTA 1OVDA 3NZ1A 3QGAC 4XD4A 4W9TA 2VDHA 3DIPA 5BXSA 3NUKA 4M1RA 5E0KA 2HEJA 4XISA 4HSHA 3A13A 3KVLA 3NPWA 3KTXA 3IUIA 2XGZA 1JCTA 4RNHA 4UTWC 1WYIA 1UD6A 3AWOA 3A6OA 4DUVA