4V2XA

High resolution structure of the full length tri-modular endo-beta-1, 4-glucanase b (cel5b) from bacillus halodurans
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
534
structure length
534
Chain Sequence
KTLDIQSYVRDMQPGWNLGNTFDAVGQDETAWGNPRVTRELIEQIADEGYKSIRIPVTWENRIGGAPDYPIDPQFLNRVDQVVQWALEEDLYVMINLHHDSWLWIYEMEHNYNGVMVKYRSLWEQLSNHFKDYPTKLMFESVNEPKFSQNWGEIRENHHALLDDLNTVFFEIVRQSGGQNDIRPLVLPTMETATSQPLLNNLYQTIDKLDDPNLIATVHYYGFWPFSVNIAGYTRFEENSKQEIIEAFDRVHHTFVARGIPVVLGEFGLLGFDKHTGVIQQGEKLKFFEFLIHHLNERDITHMLWDNGQHFNRHTYEWYDQELFDMMRASWEGRSSVAESNFIYLKQGDRIADATVSLQLHGNELTGLRANGQRLTPGQDYELNGERLTVKAHVLSAIASSGTLGTNGMVTAEFNRGADWHFRVNTYRTPVLQSTQGHVSNFSIPASFNGNSLATMEAVYVDGGNAGPQDWTSFKEFGYAFSPSYDANEMKLTEAFFREVRDGEVRLTFHFWSGETVNYTIIKNGNQVTGIAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-BETA-1,4-GLUCANASE (CELLULASE B)
publication title Family 46 Carbohydrate-Binding Modules Contribute to the Enzymatic Hydrolysis of Xyloglucan and Beta-1,3-1,4-Glucans Through Distinct Mechanisms.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 200
structure length 534
sequence length 534
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03442 CBM_X2 Carbohydrate binding domain X2
A PF18448 CBM46 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4v2xA01
1E4NA 5CPQA 4AZBA 3AS2A 1I75A 1PBGA 4Z2GA 5A6SA 2D20A 2J4GA 2G3MA 1Q6EA 4W88A 2E40A 1H09A 1BVNP 1DP0A 1OINA 3PTQA 4AZ6A 3FAXA 5I79A 4JFSA 2BHZA 1B30A 2XFFA 1H5VA 1XYZA 4GQQA 1G1YA 2J7GA 1EXPA 4J3TA 1HF6A 2XGIA 3K4AA 1HKKA 3KWXA 1V3IA 5A94A 2VZOA 1L0PA 1U30A 2O9RA 2V3FA 3NIYA 3KL3A 1GQIA 4AXNA 4QLJA 3SCPA 4E4PA 3VILA 3QHMA 3BMVA 5DO8A 4XV0A 3K1DA 4L4OA 3TTOA 4HTYA 2YLAA 1NWSA 1TCMA 4B16A 1JI2A 1H1NA 4DWSB 1GOWA 4P7OA 2VX6A 4D6DA 3SCRA 3II1A 4ZXLA 1E71M 2WSPA 1CGWA 3EDKA 1UA3A 3CHDA 3AS1A 4D71A 4PTMA 4W5UA 4IPLA 3OZPA 1JDDA 2PWGA 3L4VA 3WH6A 1OB0A 3W29A 2VQUA 3AFBA 4J27A 3HJEA 1PPIA 3UETA 3AIBA 4GO9A 4C7FA 1E5NA 5AC4A 1GUVA 1NQ6A 1ZL1A 2Z1SA 3VM5A 5E6ZA 2NW0A 5BCAA 1M53A 5E09A 4Z2KA 4KWUA 2VC9A 3TTYA 1TA3B 1KCLA 3QR3A 3QOKA 1B90A 1E6RA 3T09A 2VX5A 2YJQA 3L4XA 2VRJA 3ARUA 1D2KA 1H0GA 1GQKA 3PZUA 5CJ5A 3IAPA 2J25A 4DUWA 1CXHA 3AIWA 1J9YA 5IFPA 3AS3A 3FAWA 2YBTA 2J7EA 3PZTA 1X6NA 3ZM8A 1XD0A 5EFDA 2RGLA 5LA0A 4BZYA 2YL8A 2WSKA 4W84A 3S2CA 3W27A 4XUYA 2ZICA 1EA9C 3CZGA 3AMGA 3JUGA 3WH7A 3VPLA 1QW9A 2DSVA 2ZX6A 4HP5A 4J3SA 1UHVA 5EB8A 5GNZA 2WHKA 5I77A 3WMCA 2CNCA 4PMUA 4HMDA 3WUEA 4AYSA 4C7DA 3UERA 2CKRA 1U2YA 1M7XA 1KWKA 5D9PA 1O6IA 4EK7A 3IAQA 5BXSA 2GFTA 3A4WA 4W93A 4QCEA 4U5IA 3W28A 1E1FA 4CD6A 2VURA 1V6YA 1E72M 2XYLA 4BA0A 4CCDA 2J7CA 1ZJAA 3OIHA 3NJ3A 4R5EA 4UQAA 2VT0A 1VF8A 2WM0A 3FXYA 4H8VA 1E0WA 1UKTA 4CN4A 2JIEA 1MWOA 1ZBVA 5D8ZA 4Z2LA 4OUEA 3T0AA 2OWWA 1W9DM 1JDAA 4ACZB 5A3HA 1B31A 2J7BA 4W5ZA 3WF2A 3VU2A 2ZOXA 4MADA 4WKAA 4AISA 4UOJA 1ZBWA 3DHPA 2A3CA 4JCMA 1PZ2A 3VIGA 3AIUA 1E4IA 4PMDA 1JF6A 2D24A 1JZ2A 2BS9A 1E56A 4U2YA 2DH3A 3L4ZA 5HNNA 5A8PA 4P8WA 4DUXA 4W7WA 2YOCA 2G8ZA 5GNXA 4PRWA 1HKJA 4UOQA 2PF0A 4BQ5A 2FHFA 1G01A 1R7AA 3ZOAA 4KGJA 3B8SA 2EJ1A 1WNOA 1HKIA 5ABFA 3WMBA 1W3HA 2E8YA 1A3HA 1ZU8A 4LYQA 2CPUA 3A6OA 3CIVA 4Q7NA 1IZJA 3OZOA 1JF5A 1B9ZA 2XSBA 1JYVA 4X0NA 1FFQA 1CNVA 4U3CA 1PIGA 2JFEX 1UYQA 4BQ4A 4P8VA 2FGZA 3N17A 4NRSA 1UR9A 3AROA 1ISZA 1GHRA 3MMWA 3L2LA 1OBAA 1NWUA 4U31A 3WEMA 1NM9A 3AI0A 3WD0A 3N13A 1E6NA 4JFUA 2B31A 3K8MA 3S6TA 2UY2A 3VIMA 1M03A 3AZSA 5A6AA 2WANA 1VBRA 1LL6A 1W3LA 3SUTA 3W38A 4AD1A 1QNOA 1C91A 1KXHA 1E43A 4AEEA 3LMYA 2WKGA 5D4YA 3U5YA 3WQ4A 4J3UA 1EIBA 2YIHA 1KBBA 4UQ9A 3A4AA 4D6GA 1BG9A 4E8CA 1C8XA 4GPNA 4YHEA 3W53A 1E0VA 2Z1KA 3GBEA 4KRTA 1ZBCA 1EO7A 1MQRA 4YN5A 2VOTA 3SIMA 4UNIA 4H7VA 3VMOA 3PTKA 2BY1A 3OBAA 2ZX7A 4HU8A 1AVAA 1HL8A 3IJ8A 1V02A 1VEOA 4MTVA 4PMRA 4PMXA 4CD4A 3CUJA 3PZMA 2EXOA 3W4RA 5A6BD 3N04A 1NP2A 3WF4A 1QHOA 1XV8A 2VMFA 2V5DA 1E6XM 1MW1A 2O9PA 2WZHA 3VIJA 1C8QA 3WKZA 8A3HA 1MVYA 4W8BA 3WH8A 2GJRA 1GOQA 2GK1B 4H2CA 3W24A 2W63A 1ITCA 4QLKA 1JFXA 2OYMA 3KEHA 3UESA 3A4XA 3VGEA 1QBAA 3WENA 4DUVA 3EMQA 3WIJA 3VGDA 1VB9A 1TFVA 5CGTA 5D8WA 1RH9A 5JBDA 1PAMA 2XJ7A 4ATWA 3GH7A 3NDYA 3LPFA 2VZVA 3WDJA 1VRXA 2XIBA 3OGRA 5CGMA 1E9LA 4AZCA 3UCQA 2XM2A 2GJXA 4J3VA 4ZEPA 2Y8VA 3CBWA 1XSKA 1BLIA 1G94A 1OIMA 2WZIA 3VDCA 4S3KA 5AC5A 3VDBA 2D3NA 1CGUA 1OIFA 1TE1A 1W1YA 3AHYA 4UQDA 1PJ9A 1FOBA 2FH6A 2QMJA 3DECA 3VIOA 3AOFA 3NSMA 1JIBA 5BWFA 3SUSA 3WD4A 4V28A 2VVSA 2DT3A 1ECEA 2WLZA 1UA7A 2IUZA 1GQJA 1UD2A 5E70A 3VMPA 2WMJA 3GNPA 1J10A 4MNMA 4HA3A 3O9NA 1DWGM 3G6LA 1OGGA 5A6MA 1JYWA 3AIQA 3EDDA 3CHFA 1MXGA 3MV01 4PMYA 2JE8A 1CWYA 1GOOA 5LA2A 3WDPP 3VX1A 4CVUA 1UD8A 4M24A 1JD7A 3L4TA 2BVDA 2VL4A 3POCA 1FH7A 1WZLA 1E6ZA 4PEEA 3WL0A 2CIPA 3CZLA 4AD3A 1HJWA 3WF1A 4AD2A 2J62A 1HJUA 1J12A 2XVGA 3AYRA 1J0YA 5DMYA 3MSDA 4AZIA 4LGXA 2TAAA 3U7BA 1WDPA 3BGAA 1FP8A 3OLIA 3GBDA 3WUFA 2Y5EA 1EQCA 2E9BA 1MYRA 1OT2A 2XUCA 3MU7A 4XZWA 3AQUA 2XFYA 4CUCA 2AOSA 1E6SM 4GZIA 2DDXA 1DWJM 1WAWA 4TTUA 5F7UA 6CGTA 5IHRA 2VCBA 3WN6A 4BS0A 1UZ1A 2VO5A 4TX6A 1MW2A 1KB3A 5BXTA 3BAWA 4OZOA 2DSKA 4BCEA 5A8QA 3G6MA 2WKLA 3BLKA 2DT0A 4Z2HA 3SUWA 1NP0A 1V6VA 1SMDA 4M80A 3GM8A 3NYDA 3PTMA 1RPKA 3W26A 2CESA 2OYLA 1M01A 1OCQA 1YQ2A 4AIOA 3UR8A 2ZUUA 3VGHA 1JZ7A 5HXMA 1XRVA 3IJ9A 3MUY1 3WNOA 1DEDA 2DT2A 4C7GA 5A8MA 1GCYA 2D22A 1NWTA 6A3HA 5BRQA 1WDQA 4E2OA 5ABEA 1C8YA 2YLLA 1JNEA 3T2OA 2J8FA 2Y4SA 4GZJA 4J3XA 1V0KA 3RCNA 1XH1A 1XCXA 2O92A 1CXIA 2CXGA 1XSIA 4OOUA 3MO4A 3VGGA 4PUDA 2ZX8A 1E73M 3CMJA 3OB8A 3GXIA 4Z2JA 5KZ6A 4KRUA 7A3HA 1MQPA 3CLWA 4QLLA 1PEZA 2ZUSA 4EE9A 9CGTA 1TA3A 1HP4A 3THDA 4LYRA 3RJYA 1OM0A 3GDBA 1H4PA 1CYGA 5ABGA 1QI3A 1CXKA 4FLQA 1AQHA 3BAXA 2ZWYA 4AZHA 1B3WA 3CZJA 2E9MA 2DIEA 3WQWA 2QHAA 1EDGA 2PBOA 1E6QM 2DPEA 4U5KA 1CECA 2J7HA 5BXRA 2BV9A 1VEMA 1HIZA 3N1AA 1JDCA 3ZSSA 1V0NA 1B3YA 4A3YA 1W9PA 5LA1A 1EH9A 2DH2A 4IPNB 1CXEA 2A3BA 3RM4A 4MAZA 1B0IA 1FFRA 4MDOA 7CGTA 1V3HA 2OSXA 4JFTA 3AMKA 1UKOA 1LG2A 1NH6A 2C0HA 3AIEA 1E15A 3WNMA 4ZE5A 1GZJA 1CXFA 1FP9A 2A3AA 4WJXA 4CD8A 1W9UA 4UFKA 4IISA 1CZ1A 1XHGA 4W8LA 1UR2A 3PZQA 1V02E 2XG9A 2XSAA 3NDZA 4CN1A 1QNPA 3TONA 1R85A 5A6LA 2PB1A 3EMZA 4LQ1A 2QPSA 3ARZA 1V3JA 3BLPX 1OWQA 3RILA 1Q6GA 1MQQA 3EDEA 5AYIA 4AW7A 1EDTA 3F5JA 4OKDA 4MNKA 5D9NA 4WSJA 3D5HA 3ZJKA 4AIUA 1JAEA 3AISA 3K46A 2JEQA 3VX0A 1LJYA 3W6MA 4P7RA 3PZIA 1CENA 3LPOA 2WNWA 1GPFA 2UY5A 1TR1A 4PBGA 2VJXA 3SCVA 2CCRA 1GVIA 1QNRA 1UQZA 4Z2IA 2WHLA 1ESWA 5BXPA 2J79A 4TUFA 4AD5A 1JI1A 4F9DA 2AMGA 1C93A 1VFOA 3ARWA 5FL1A 1UH4A 3BAJA 1CGYA 1DWIM 3N9KA 5IXEA 1QW8A 2D3LA 1SMAA 1BSIA 2GVYA 2WC7A 1N82A 2FHBA 5E0CA 3ZSTA 1IT0A 2BVYA 4UZUA 2QF8A 4PCSA 1VFMA 3MS8A 3ARVA 3FN9A 4GO8A 1J0IA 3WDHA 5A95A 2E3ZA 2ESCA 4P7LA 3WUGA 3FHQA 3WBAA 1V6XA 3DYPA 2WK2A 4D6JA 1KXQA 2CHNA 4U2ZA 2F2HA 3CGTA 2JEPA 4PSPA 1DTUA 5FCZA 3ZJ6A 2VR5A 1H2JA 3AMDA 4JAWA 3VD9A 5ECUA 1MFUA 2J78A 2PWEA 1Q6DA 4CU6A 4LXFA 1UR4A 3VIPA 3ZT6A 2X0HA 1F4HA 4GINA 1LLOA 2HVMA 4PN2A 1E55A 2MANA 2WB5A 4J7RA 4AC1X 3TTSA 4HOZA 3CUIA 1JZ3A 1HJVA 4J3WA 1QHZA 3VDHA 1W9XA 3EBVA 4ZXOA 4U3AA 3VOCA 3WDIA 2BXZA 1EDQA 1JFHA 3SCNA 3ZMRA 2YA0A 2WHJA 2ZXAA 2J7FA 2VZSA 4JIEA 4KMQA 3BAKA 1BQCA 3CTTA 1KQYA 4UCFA 2J7DA 2JIWA 4N0RA 2EEXA 1VENA 1HVXA 2UY4A 5ABHA 5HBFA 2PBGA 2W4XA 4F8XA 1ISVA 3SUUA 4TOQA 4FK9A 4BF7A 1KQZA 2WC3A 2D0GA 2Y2WA 2VR4A 2WVVB 4HMEA 2YDSA 1QI4A 1UWSA 2EPOA 1GJUA 3PBGA 2VNCA 2NT0A 4RE2A 1I1WA 2FH8A 3AZTA 4FMVA 1GOKA 1PZ3A 2ZXQA 3GNRA 2E9LA 3IANA 5TD4A 4LYPA 4D6HA 1QNQA 5GNYA 4TVCA 2WMIA 4W8AA 2J74A 3A3HA 2ZUNA 1L8NA 4A4AA 1C92A 4F66A 3GYCA 4AD0A 4WF7A 5A2CA 1UD3A 1WZAA 2YL6A 1E40A 3AZRA 1H0IA 2NT1A 3AXIA 1YHTA 3GNOA 1UG6A 3CMGA 3RDKA 1W1TA 3VGBA 1CDGA 4TVDA 2XFRA 1WP6A 5GQBA 2BHUA 2GSJA 5EBAA 4UFLA 2YKKA 1CGVA 2JF6A 5DEZA 2XIIA 3WMSA 4PSRA 4UQCA 1GJWA 3HMCA 1F4AA 1QNSA 1W2VA 1GQLA 1KR1A 1GOIA 4RE3A 1ISWA 5ABFB 2XTKA 5C71A 1BG4A 3NUKA 2G4FA 4BQ3A 1XH0A 1JD9A 3ECQA 3B9EA 3GXMA 3J7HA 1UD6A 4GQRA 3BAYA 1OD8A 3FW6A 1B3XA 1TG7A 4PMZA 3OA5A 1G5AA 2DT1A 4EKJA 4LPCA 5I6SA 2QPUA 2WCSA 1OT1A 4XB3A 3N11A 3WQ6A 3WNKA 4URIA 1VJZA 5C8BB 3WSUA 1CGXA 2XPKA 3F4VA 2J8GA 4HA4A 2VZTA 1TVNA 3T2PA 1KXTA 2D2OA 5BYWA 4OBRA 2V3DA 1WCGA 1CEOA 2O9OA 1QI0A 1JGIA 3CUGA 3OLGA 1R86A 3MKKA 4JKMA 3WNPA 1UQYA 3SCQA 4JHZA 1BPLB 1EHNA 4LX4A 2DIJA 2YA2A 5E9AA 2WMGA 1LL4A 1UD4A 4CU7A 2WMHA 2WMFA 1W32A 2VZUA 3ARXA 4MB1A 1JZ4A 3W6LA 3M6DA 3FY1A 1M04A 5CQ1A 4CD7A 3CHEA 4AWEA 3WEOA 4W87A 3MUZ1 1V08A 1XYFA 2PWHA 3OGSA 4KH2A 5A69A 1BGAA 2QLYA 3AXHA 4L4PA 4V27A 1HJSA 1BF2A 4D1JA 2J75A 3ZJ7A 2D0FA 2BXYA 1D3CA 2W5FA 3GXFA 4UTFA 4NSBA 3TA9A 3RMEA 4UQEA 1TMQA 1LQ0A 1HJQA 1MW0A 1EOKA 1US2A 1E1EA 1R87A 4HOXA 1B3VA 3IJ7A 3VIKA 5CLTA 1AQMA 3OG2A 1ZS2A 4WSKA 3AIVA 2WWCA 3EDJA 1SYTA 1UWRA 3CZKA 1LF1A 3TTQA 5HPCA 3M7SA 4M82A 3WEZA 1UR0A 3RJXA 1UH3A 4S3JA 5A6BA 2CERA 1RP9A 2CEQA 2EPKX 2CBJA 3EYPA 3MMUA 4ZFMA 4DM2A 1HX0A 1CIUA 2FGLA 1NWRA 5JIWA 3WD2A 1W3KA 3WD3A 3WH9A 4XX6A 2VRKA 4OBSA 4ATDA 1C7SA 2G3NA 5GPRA 4ZE4A 4ZENA 2XVPA 4H8HA 1JZ8A 3OGVA 3ARYA 5CPSA 3WELA 1OD0A 1CTNA 1CXLA 3GTNA 3PZNA 5CPTA 5A2AA 2E4TA 2O9TA 2ZX5A 1ITXA 1I1XA 3KL0A 1GORA 2UY3A 5DF0A 4W85A 4AZCB 2ZX9A 1W9VA 1D7FA 2GJXB 2D23A 1W1VA 3VVGA 1DWHM 2J77A 2V38A 1DHKA 1QBBA 1G0CA 1GOMA 3VO0A 3K4DA 3W82A 1FHDA 4PMNA 1CBGA 2ZIDA 1CLVA 1K9TA 3UEQA 3WY1A 4TXEA 1R8LA 4W7VA 2BY2A 4AMCA 1LG1A 3PZOA 2X09A 4AZ5A 1HKMA 5I5RA 1LL7A 3VDAA 4QFUA 5M3WA 1QOXA 3ALGA 1X6LA 3APGA 4Y7EA 1E6PA 1HVQA 3ZR6A 3BSGA 3L2MA 1P6WA 2V3EA 3EMCA 4M81A 1UKQA 2WPGA 1PIFA 2WMKA 3N15A 4DWSA 5JUVA 4GZEA 1QI5A 1W1PA 2JF7A 4B9YA 1GVYA 2IXVA 3OLDA 1HT6A 2PI6A 3M07A 4D6FA 4AY1A 4FLRA 2WAGA 3GXDA 5I2UA 1RP8A 5HPOA 3BXWA 4A3HA 4TTGA 1KGXA 2RGMA 4PYSA 3AHTA 1BGGA 4OIFA 3T0BA 3VD4A 4QDMA 2DSWA 1TVPA 2G3JA 3VTRA 5KEZA 3WNNA 3VD7A 2GUYA 2X05A 3GH5A 1WE5A 3ZO9A 2HISA 4WKHA 5M17A 3W37A 4PTVA 1V6UA 1J0JA 2XWEA 2VX7A 5I3DA 4M1RA 2YBUA 1EGZA 4P7NA 2AAAA 3MUIA 2XWDA 1LWHA 2CBUA 3RIKA 4JFVA 5E6YA 3K8KA 2EO7A 1W2PA 4J28A 3O2LA 2EBNA 5JIPA 5DT7A 2E8ZA 5LYRA 3QHNA 2VCCA 3BCFA 1FHLA 1Q6FA 3MUAA 3ARSA 4N42A 3U57A 4ACYA 3LPPA 2ZUTA 4NF7A 1E5JA 3BC9A 4B9ZA 1WZMA 4PTXA 1VFUA 3PZVA 3AXXA 1W9BM 1ZJBA 1GNXA 4JHOA 4QP0A 1UD5A 4JKKA 1H11A 4D6IA 2F8QA 1E4LA 1ODUA 4DM1A 4PCTA 4K68A 4OJYA 2PC8A 1MW3A 1KBKA 2X8RA 4EANA 2V5CA 3WL1A 3FNDA 2A3HA 2VVNA 2OLHA 4H8UA 4AEFA 3RO8A 1JL8A 4HZ7A 1JAKA 2W92A 3DHUA 1GONA 4UFIA 3GH4A 4B15A 1XC6A 2ZUMA 3SURA 1JYNA 1QI2A 3WNLA 3SCWA 2OWCA 1J18A 1V0MA 4EAMA 1J11A 2YA1A 1KGWA 3CH9A 4WKFA 1G9HA 1VBUA 3VIFA 3HU7A 3ZQ9A 3WH5A 2VRQA 6TAAA 1ZB5A 1H3GA 3CO4A 3WFZA 2W67A 2E0PA 1XCWA 3TOPA 1UKSA 4ACZA 2PWDA 1NOUA 2WVUA 1CPUA 1ZBKA 3M46A 4AIEA 4YPJA 1J0ZA 4HZ8A 1H41A 3VMNA 1W3JA 2XGBA 3AYSA 1BYAA 3TP4A 1K6AA 2VQTA 3ARPA 1Z32X 1V6WA 1J0KA 4HOWA 3AHXA 4P8UA 4NI3A 3VNYA 3MMDA 2C7FA 3I3EA 1WDSA 3DC0A 5D9OA 2NSXA 3VM7A 5JBFA 2VX4A 2Y8KA 3B9AA 3VKKA 3NSNA 2UWFA 4M56A 4MB4A 3I3DA 2J47A 4WK9A 2CITA 3T0DA 2WWDA 4GI9A 1UWIA 1AQ0A 4X9YA 3WBEA 3ZR5A 1BTCA 4JL1A 1PX4A 2VTFA 2EPNA 1XH2A 2ZWZA 5HDRA 2DSZA 3QHOA 4MJ4A 2EPMX 2WVVA 2BNJA 2WLYA 3SCOA 4UOZA 5JBEA 1JXJA 2C8NA 1BVZA 4H41A 3ALFA 2VI0A 2YDRA 1WPCA 2WHMA 2Y24A 5CLWA 4CD5A 1GW1A 1UOKA 3THCA 3UG4A 3W25A 1SFSA 3POHA 2QV4A 5A6KA 3SEPA 1BYDA 1IZKA 2GJPA 4IUGA 1V3LA 1O7AA 4PUEA 5CG0A 4GI8A 1X1NA 4CGTA 3RM9A 2WBGA 3VINA 2WW5A 1BYCA 3VD5A 1S46A 1C7TA 4AZ7A 3BCDA 1XSJA 3WDRA 1E70M 4KGLA 3PN8A 2DSUA 2ZUWA 4W86A 5CXPA 1EOMA 1JXKA 1KGUA 1FA2A 4GIAA 4YHGA 2YL5A 5A6JA 1OGBA 3BAIA 4CN6A 1HJXA 4MNLA 1VIWA 5E0FA 2OSWA 1HNYA 3LPGA 3F5LA 5I23A 3GZAA 4RL3A 2X2YA 2Q8XA 2WYSA 2XHYA 1WB0A 4MDPA 1XD1A 1QPKA 2DQXA 4QAWA 4BQ2A 5FL0A 5IHSA 2WZEA 3HN3A 3K8LA 5AYBA 2WBKA 1OGSA 4XZBA 3WD1A 3AMLA 2ZUVA 5D9MA 2GK1A 5HOSA 1GHSA 4NZCA 3RPMA 1K9DA 1WO2A 2ZXDA 1KXVA 4AD4A 1KFWA 4P7QA 3L4YA 4AZGA 1C3FA 4RE4A 3L4WA 4F79A 3VGFA 1E4MM 1B1YA 4MJ2A 2GDVA 4HZ6A 5C70A 2EQDA 2WVSA 3UG3A 2DGAA 4QCFA 1EO5A 2YDQA 4OOZA 4W89A 3ARQA 4UFJA 8CGTA 1V03A 4FLSA 1UH2A 5I24A 1E3ZA 1MFVA 2D0HA 3QOMA 5I0DA 2W62A 3A47A 5DFAA 3SCTA 3AICA 2OWXA 2IXUA 1QVBA 5M03A 1BYBA 7TAAA 2W91A 3N18A 1KWGA 4GKLA 2ZXBA 4U33A 4UZSA 3PZ9A 3NSXA 4H04A 3W81A 2G41A 1PX3A 4P8XA 1UZ4A 4D6EA 4JL2A 5DT5A 3WDQA 1Q4NX 4R27A 1CGTA 3AIRA 3ZT7A 2WMIB 4NRRA 1V3KA 2BY3A 3VNZA 3CHCA 3BMWA 4V2XA 4MB5A 1CLXA 5EFFA 5FIPA 3KL5A 4JFWA 1UWQA 5BROA 4MAVA 3WQ5A 5EMYA 3DYOA 1RD6A 1NOFA 3WUBA 1ISXA 4E8DA 1VEPA 2W61A 2CETA 5M5DA 3ZJ8A 1BAGA 3D3AA 1QHPA 3U5UA 3CUFA 1VAHA 3SUVA 3PZGA 2ZE0A 3WQVA 5I78A 2FHCA 3QGVA 3FHAA 1VJSA 3CPUA 5A1AA 3AJ7A 2WCAA 4JKLA 5FD0A 4FF5A 1EHAA 2CBVA 2X0YA 4JZ5A 5CSYA 5FOOA 2DEPA 4CU8A 1ISYA 1K9EA 1Y7VA 4UQBA 4GI6A 1UR1A 2XVNA 4M8UA 3WFLA 3MANA 3DYMA 4ML4A 2OYKA 4D1IA 1KCKA 4CVWA 2QMKA 3N12A 1AMYA 1UR8A 1U33A 4F9JA 2F61A 1PX8A 1EQPA 1Q6CA 1JZ5A 2BHYA 4GXPA 3CZEA 1A47A 4FLOA 4D6CA 3NCOA 2WC4A 1NOWA 4HA1A 3KE0A 1SR0A 5FKYA 4D72A 1E3XA 3ZIZA 1K9FA 5A8OA 4HMCA 4B3KA 2CKSA 3SCUA 4Q22A 4DWSD 2BY0A 2CYGA 1TZ7A 3BH4A 1BFNA 4CKQA 3RM8A 1HN1A 1E0XA 1UKPA 2PWFA 1J01A 1OSEA 5IFTA 1DWAM 2WXDM 3MSGA 5CSUA 4CCEA 1VFFA 4PTWA 2W66A 2G3IA 2CBIA 3ARRA 3EDFA 4PMOA 4MPKA 2EPLX 4WIWA 3T08A 2V3GA 2D1ZA 4HU0A 3I3BA 5A2BA 1IV8A 3L4UA 3IK2A 1JNDA 1HL9A 4HPGA 4B3LA 1UWUA 3VIHA 2YL9A 2JALA 2XVKA 3WF3A 3B9DA 4DWSC 3UR7A 1UUQA 4CCCA 4IM4A 1JZ6A 4W7UA 3AS0A 3VUPA 1V0LA 2XVLA 2BVTA 3E1F1 3CUHA 2A3EA 1WDRA 2X1IA 2BFGA 5BRPA 4PMQA 4TX8A 1BHGA 1B2YA 1HXJA 3PHAA 1MXDA 2VUYA 5AY7A 3W0KA 4X0VA 1DWFM 1ODZA 1FH8A 1XGZA 1LWJA 3U7VA 2GDUA 3CZ8A 3BSHA 1WKYA 4UFMA 2XM1A 5IDIA 4ATLA 1WZKA 4TVUA 3O6AA 3AHZA 3VD3A 3WQ8A 1W91A 1V3MA 1UWTA 3F5KA 3T2QA 1JYXA 4MB3A 3AMCA 4JCLA 1B3ZA 4MNJA 1TUXA 2VCAA 3AHVA 3OLEA 3MV11 1US3A 1KR0A 3KZSA 1FH9A 2CHOA 5A8NA 1J0HA 4UFHA 2WVTA 1H49A 1NARA 4HPHA 2WCGA 3ZT5A 5CZKA 4M29A 3WF0A 1HP5A 3VIIA 2OSYA 3SCSA 3ARTA 4PMVA 4WLCA 1JG9A 3UG5A 4UR9A 1C90A 1R7OA 2FDMA
chains in the Genus database with same CATH superfamily
3AS2A 1YNYA 5DANA 2J4GA 2PCEA 4LEQA 1PDZA 1A5AA 2XN2A 2IKHA 1P6BA 1H09A 1OINA 2GVGA 4JFSA 2BHZA 2XFFA 3N2MA 1H5VA 3M0VA 1HF6A 3K4AA 1HKKA 2PGFA 2J6XA 4UTUA 3OVRA 3G2GA 4UTLA 1I2PA 3GVVA 1U30A 3NFUA 3NIYA 4AXNA 1QO2A 5FAJA 4QLJA 3SCPA 3C86A 4L4OA 2GPTA 3V5OA 5KINA 1NWSA 1TCMA 5D37A 4P7OA 2VX6A 2HPIA 4ZXLA 1E71M 2WSPA 3AS1A 4IPLA 2Z28A 1S2TA 4LY4A 3C2OA 3CT7A 1O95A 1P0DA 3ID7A 3W29A 2C79A 1PCWA 3LSBA 4N9DA 5JU6A 1OQFA 3MKCA 3REQA 4EXAA 4C7FA 5AC4A 1ZL1A 3INPA 1IGWA 2YW3A 2NW0A 5H8UA 4NX0A 1TMHA 2ZZ6A 4CLMA 1G4EA 3ITOA 3U2CA 3T09A 3T0TA 1RLDA 2DVUA 2VRJA 4Q4PA 1I4NA 2E1DA 4GOAA 3UPBA 4HHLA 2RUSA 3KTXA 3RG6A 4RPQA 3AIWA 5DCEA 3LRLA 3AS3A 3FAWA 2J7EA 3ZM8A 1XD0A 3BG3A 5AZ1A 1QT1A 4BZYA 5LGZA 1U22A 3W7OA 3W27A 3AMGA 3TCSA 3JUGA 3WH7A 3VPLA 4O1CA 2C1IA 2DSVA 4FR6A 3BPWA 3R25A 3SDOA 5GNZA 2WHKA 1WDDA 3FGCB 2TPSA 3M16A 3LEPA 3OQEA 2PFHA 2RDUA 2OTDA 1Y65A 3NA8A 3WLTA 4R33A 3M0LA 4XTDA 5EA9A 5JH1A 4NJKA 5F2GA 2BGSA 3IAQA 4NILA 3GAKA 3A4WA 2R1LA 4CD6A 1V6YA 3UP8A 4FAMA 2J7CA 2Z6IA 1FHVA 4R5EA 4Z08A 4UQAA 2WM0A 4H8VA 3SN1A 1UKTA 4CN4A 1I2RA 1O12A 4FNQA 1R3VA 1ZBVA 2ABBA 4Z2LA 2DU2A 4OUEA 3QY7A 1XIGA 3H2FA 4H7ZA 2DZBA 2WV8A 5E9XA 2P8CA 3XIMA 3UZWA 3IVUA 2Q02A 4DEFA 2A0NA 3TKFA 1PO9A 2YYTA 2ABAA 4FNUA 5AHEA 2P0IA 1EYWA 4KFOA 5LNSA 2VEKA 1JF6A 1GEHA 2D24A 1AW5A 5J04A 3PPCA 2BS9A 2PD5A 3TH6A 4IXXA 3WK3A 4DUXA 4P8WA 2INZA 2Y88A 1ZUAX 3QM3A 5GNXA 1Q5MA 4PMJA 1HKJA 3ZOAA 3B8SA 2EJ1A 1HKIA 7ENLA 5TF0A 4FNSA 2HTMA 3ITYA 1A3HA 1IF2A 2FTPA 4LYQA 3A21A 1IZJA 5E93A 1JYVA 4U3CA 4FHAA 1UYQA 3FKRA 2FGZA 2GWGA 1UR9A 2J88A 3W1QA 3MMWA 1Z8AA 3IGUA 1ZPTA 4FOKA 2QNEA 2B31A 3UJ2A 1SZFA 3VA8A 5FSDC 2QIWA 1W3LA 4R9OA 1KRAC 5T26A 3S5YA 3IJQA 2CZDA 1E43A 4K8HA 3HQNA 3LMYA 3UWYA 1QTWA 4C6PA 3GDMA 1ZAHA 3WQ4A 3AAMA 3MP4A 1EIBA 2YIHA 3GKFA 4LB3A 3A4AA 2FYMA 3I68A 4AEOA 4GPNA 1QOPA 3TC3A 5DCDA 3UNDA 2IQ0A 2Z1KA 4UMCA 4BWLA 3SO7A 4KRTA 3Q94A 1MQRA 3GFYA 3LBMA 5C2CA 2VOTA 4H7VA 3VMOA 2HNHA 3UGRA 1XLJA 2BY1A 2VC7A 2FPYA 4HU8A 2IQTA 2Z2UA 3KOYA 3IJ8A 1VEOA 4R53A 3BSMA 3UFYA 4MTVA 4IFRA 4PMRA 4LY8A 4CD4A 3E96A 3W4RA 5C2XA 4H00A 3WJZA 1NP2A 4O18A 2VMFA 1XV8A 5I02A 3WK0A 4IMAA 1OYBA 2OVLA 5D2XA 1X8FA 3MUCA 2PLJA 4ADSA 2WZHA 4MG4A 4DY1A 3V1HA 1EWDA 1G4PA 2PWVA 1A5LC 1JGMA 4KCVA 4YTRA 5LZLA 1XYMA 3CUZA 2GJRA 3CS2A 5B7ZA 3NOYA 4HVXA 1T7LA 4JQ1A 2W63A 3GG1A 1UASA 2HRWA 1JFXA 2OQLA 5HMSA 3MHUA 1OFOA 2W6RA 3AU2A 4GJ1A 4QRNA 4DUVA 3EMQA 3VGDA 4Q32A 1JPMA 1QMLA 5CGTA 3C8NA 3W2MA 1PAMA 4QS6A 1S3TC 1XBXA 4IGSA 5I00A 2Z1XA 1ZCOA 2A1YA 1W3IA 1IIHA 4GIYA 3OGRA 3UCQA 4I9MA 3FJNA 2GJXA 1DJQA 4PBFA 4L64A 4J3VA 4U28A 4IG2A 4HMNA 2WZIA 3VDCA 5AC5A 3VDBA 3E0WA 2EG8A 4QDWA 2FVKA 1TE1A 4UQDA 3IGXA 1PJ9A 1FOBA 3KCOA 2QMJA 4F40A 4X61A 4I8YA 2JK2A 3NSMA 4HBKA 1MEHA 1ZHAA 4TR9A 2XINA 3JR2A 4P61A 3E02A 2WLZA 1RY0A 1GQJA 3VMPA 2WMJA 1WDWA 1J6PA 1DWGM 5A6MA 1V7YA 1JYWA 3AIQA 3FOKA 3EDDA 3TW7A 3ZFHA 5HA7A 3T07A 4WXYA 2IS7A 1MXGA 3UXIA 1GOOA 1RK6A 3WDPP 3WZ0E 1UD8A 2FMOA 3WJSA 2NX9A 4O54A 1FH7A 3A64A 4RCXA 4AD3A 2PGWA 3M9YA 1HJWA 3WF1A 1I60A 4AD2A 2C18A 1J12A 2XVGA 3MSDA 4AZIA 4F2UA 1LUCB 5G1YA 1WDPA 3OLIA 3GBDA 3WUFA 2Y5EA 4JTHA 4QG9A 2E9BA 3KS5A 5KSWA 4OU1A 3S5SA 3AQUA 2AOSA 4GZIA 3MMTA 5F7UA 5IHRA 3BCJA 4BS0A 1UZ1A 4GCXA 3LBOA 3TR2A 4TX6A 2XSXA 1KB3A 4LVDA 3BAWA 4LEFA 1RQBA 4HNLA 2ZC1A 1KRMA 3W01A 1SPQA 4BCEA 2QZRA 4Q8NA 3G6MA 3BLKA 5DXXA 4LAUA 1EP3A 1YPIA 1V6VA 1SMDA 3O06A 1GQNA 5IOBA 2VFFA 6TIMA 4RE0A 1VHNA 1YTDA 3GM8A 5TNVA 2OKOA 4IZGA 1M01A 1EJWC 2ZUUA 5HJYA 1JZ7A 1P7TB 1XQKA 1NDVA 3MP3A 1DEDA 3M64A 2VENA 1GCYA 5CZSA 2D22A 5I06A 1NWTA 2PZNA 2R8WA 4AF0A 4DYJA 4EPDC 1F7BA 2YLLA 1MRAA 4GZ7A 4M0XA 3T2OA 3UPWA 4GZJA 5AVHA 1SJBA 3M6YA 3RCNA 1KBLA 1T99A 3MUXA 3DBNA 2QCMA 4PUDA 2ZX8A 1GEQA 1MQPA 1E0TA 4QLLA 3W6YA 2FB3A 2GVJA 1BTMA 3ELFA 3S1GA 1H4PA 1CYGA 3TQ0A 3UWVA 1FWDC 1DV7A 1CXKA 3V0SA 4FNRA 1U5VA 1AQHA 2CZ5A 3CEUA 3P60A 2QAFA 8XIMA 1SZRA 2Z1BA 1KM3A 2QIIA 4D8AA 3BVJA 4WY0A 2QHAA 2PBOA 2NQJA 1XPYA 5D30A 1XLLA 1VEMA 3N1AA 1JDCA 2HXTA 3W1RA 1I8JA 3M7WA 4H19A 2A3BA 2JKEA 5CZ0A 3UYCA 2QCHA 5H6HA 3S1UA 1E15A 4ZE5A 2E77A 3QPZA 1FP9A 2A3AA 4CD8A 4UFKA 4IISA 2R14A 4AY7A 3PZQA 1P1MA 2XG9A 3C61A 3NDZA 2BSLA 1GOXA 1LRTA 1DQXA 4O14A 1R85A 5A6LA 3EMZA 3NO3A 4LQ1A 4C6DA 3HA1A 3ARZA 3W7HA 3S1VA 3BLPX 2ANUA 4S3CA 3EDEA 4AW7A 4OKDA 4E4UA 3GXPA 4DO7A 2YCLB 1Z69A 5J5DA 2WM1A 2Y1HA 3BMXA 3H55A 2X40A 3KZPA 4WSJA 4U4MA 4YTSA 1PDYA 1JAEA 3AISA 3VX0A 1TR1A 1O5XA 2ISVA 3SCVA 1GVIA 2WJEA 1OADA 3FXGA 2I57A 2WSQA 4PB4A 4L1XA 1QDSA 1SJAA 1JI1A 3S9ZA 1VFOA 3ARWA 5FL1A 3CASA 1A0DA 2J9ZA 1CGYA 1DWIM 3HBLA 2D3LA 4LVGA 1VYSX 1SMAA 4C1KA 1N82A 3KOZA 2QCDB 2QF8A 2IKGA 2B7PA 1VFMA 3MS8A 2NV1A 3W7RA 5G4EA 3B9NA 1J0IA 4NVTA 5H2ZA 2ESCA 4KRZA 2YCEA 4H9ZA 3TOYA 3DYPA 2WK2A 4D6JA 3URNA 1KXQA 3CC1A 5FJPA 4DPQA 1YXCA 3VFCA 2F2HA 3W1TA 4XWUA 3WG6A 3ZJ6A 3MP5A 4XUGA 1H2JA 3W88A 4JAWA 3A5VA 3VD9A 4JX6A 4HPJA 4LXFA 1UR4A 3VIPA 2BP1A 1OFDA 1F4HA 4GINA 1XIFA 2HVMA 1E55A 3URBA 1B3OA 1O94A 3LG3A 3CUIA 5GJMA 1HJVA 4J3WA 3DG6A 3MA8A 3EBVA 1KV8A 1XLCA 4ZXOA 3MSYA 1H50A 1AZ1A 2BXZA 3RU6A 1JFHA 3ZMRA 1KA9F 3N2CA 1PHWA 3ZWTA 1MUMA 2BB0A 3BAKA 3EA3A 3CTTA 5FSEC 2FPTA 4UCFA 3LTPA 4F0RA 3GHSA 1R3YA 2UY4A 5LNUA 4LUTA 2WVVB 3G1DA 2VNCA 2F6XA 9XIAA 4S3FA 4FMVA 1GOKA 1FWGC 2VOMA 2ZXQA 1H1ZA 2OOFA 4HT3A 3VOGA 5TD4A 4LYPA 1QNQA 4G2DA 3RR1A 2WMIA 2ZUNA 3EPOA 2F2KA 3KWSA 4DLMA 1XDLA 1ME9A 3GYCA 1B4EA 3FA3A 2NT1A 3AXIA 1BXBA 2OEMA 4TVDA 3CWOX 3N34A 2ZRUA 2BHUA 3LN3A 2Z24A 1TPB1 4HN8A 4FX6M 7PTDA 1QNSA 3DIPA 1R2RA 4KF1A 3XINA 5ABFB 3QBUA 4Z17A 3SADA 3NUKA 1M5WA 3GZ3A 4LUIA 1RBLA 1H7RA 1Q7QA 1JVNA 1J2WA 1B3XA 4DJED 1TG7A 3OA5A 1IR2A 2DT1A 1W5MA 2HMCA 1OEPA 4LAOA 4WGHA 5I6SA 1OVDA 5IM51 4XB3A 4R34A 1CLKA 3M5VA 4YLWA 3BG5A 3ME3A 1VJZA 2UZ9A 5IDZA 3C8FA 2JKPA 1XKJA 4HA4A 5HAOA 2I56A 1KXTA 2D2OA 3W2LA 1CEOA 2O9OA 3CUGA 1X38A 3MKKA 4IX2A 1A3XA 1REQB 4QXIA 4RK8A 4HCDA 3RX4A 2X41A 4LX4A 1NIUA 2WMFA 3GAYA 5AB3A 1L8PA 3PULA 3N6QA 1POJA 4XVDA 3M6DA 5CQ1A 1BKSA 3L23A 2PWHA 1IQ8A 3TMLA 5A69A 1BGAA 2QLYA 3AXHA 3W7EA 4YWIA 3S1XA 1ADSA 4GWEA 3ZJ7A 3M1ZA 2AGKA 2ZZ7A 1RJPA 3DBPA 1SVDA 4GYKA 3EAUA 2QCGA 3MBDA 2W5FA 3GXFA 4UTFA 6XIAA 3WLOA 1GG1A 5C9UA 1MW0A 2E28A 2Z7GA 4A8RA 3VIKA 1KM5A 2Z00A 2I14A 3NPXA 3W2UA 3AIVA 2WWCA 1W8SA 2YGYA 4ZO9A 4K7YA 3TTQA 3NZGA 1DIDA 4M82A 3RJXA 3W75A 4A8NA 4S3JA 2YXOA 3DI0A 2CEQA 2IPJA 2EG7A 3GX9A 5REQA 3FCPA 4ZFMA 3V75A 1CIUA 4LSBA 3WD2A 2TRSA 1TRDA 1D8WA 4XIMA 4HSHA 1SSDA 4IUOA 3PJUA 3UBPC 3OP2A 1P5BA 1A50A 2XVPA 4LAZA 3ARYA 5CPSA 3NXLA 2VEGA 5BW6A 3GTNA 4GD0A 3P8IA 3G0UA 1ITXA 2J8TA 1I1XA 1U5JA 3PJXA 3BLIA 1GORA 2XISA 2FLIA 3BJFA 3EB4A 2W9MA 4OGZA 1D7FA 1W1VA 2RH9A 1DHKA 2QGYA 2X7WA 4RW3A 1FHDA 3HGSA 1TQJA 4JEQA 1CLVA 2X16A 1LT8A 3DDMA 1HUVA 3DN5A 3AU6A 3TWAA 3QR1A 4AMCA 5CZJA 1U83A 5GJNA 3PZOA 4C6CA 3ORWA 5I5RA 2QDDA 1LL7A 3W7QA 4G6CA 4F2TA 4ZSTA 3EOSA 1QOXA 1Q85A 2EF9A 4WEVX 1QRQA 1TTJA 1MI3A 4DJDD 3ZR6A 2V3EA 3EMCA 1EEXA 3UZZA 3NQCA 4L1WA 1ADDA 3N15A 2ATMA 5JUVA 4GZEA 3S9YA 1GVYA 2IXVA 3OLDA 5HJLA 4IGNA 1X1ZA 1W6TA 4D6FA 3W1MA 3KCLA 3GXDA 4L9YA 1RP8A 3PBMA 5HPOA 3BXWA 4TTGA 2Z1WA 1KGXA 2RGMA 4UTTC 3AHTA 4H2HA 1BGGA 4RZ5A 4CQDA 4GE8A 1I9CB 5CZTA 4YCOA 1TTIA 2DSWA 3CXOA 2G3JA 3VTRA 3WNNA 4JD4A 2CLIA 4YWSA 2PP3A 3P84A 1WE5A 1JQVA 1PB0A 4TMCA 1PZ1A 3WK1A 5FJRA 4M1RA 1S1PA 3ZLHA 3FA5A 1BRLB 5C9WA 3I7QA 2XWDA 3RIKA 1T96A 5E6YA 4N4PA 3K8KA 2EO7A 1S2UA 5JIPA 4MIMA 3AXMA 3BCFA 3MUAA 2FZMA 3ARSA 4N42A 4GX8A 4KW2A 3LPPA 2ZUTA 1YRRA 4NF7A 4QE1A 4KFNA 4B4FA 3BC9A 5F1UA 3NQ6A 3H22A 1W9BM 3EOOA 3WBXA 2ZKMX 3P0WA 4GK8A 2F8QA 4EIVA 2H9AA 3T6CA 4PCTA 2QVNA 1JQXA 4K68A 4QGCA 3FGCA 3V7PA 5BOOA 3CU2A 4OJYA 1MW3A 3LB0A 1WAUA 3WL1A 1JUKA 4JTGA 4HZ7A 3QVQA 4OT7A 2ZZ5A 4DJFD 5BWAA 4ORMA 3LQLA 3SBFA 2OGJA 4Z0JA 4B15A 3SURA 3B4YA 2ZZ2A 2OWCA 3GY1A 2ZQ0A 1J18A 1V0MA 1KGWA 1G9HA 2QEZA 1V79A 3ZQ9A 6TAAA 4IIGA 5T9CE 1H3GA 1PHQA 2V5BA 5K4ZA 1SFTA 4GH1A 1UKSA 3R58A 3A12A 4DXVA 2PWDA 1WBHA 1ZBKA 3CAWA 3C0QA 3M46A 4IJRA 2GYIA 2ICSA 3MJYA 2XGBA 3RGTA 2DIKA 4FF7A 4DJFC 4S3GA 1Z32X 4E2VA 1VFTA 1V6WA 1VKFA 3VABA 5KZEA 1V51A 4HOWA 4GY0A 1XWYA 2GLKA 1TZ9A 2C7FA 3I3EA 4GY1A 4XAFA 1XKYA 3TYDA 1XYLA 1IXQA 3W70A 1YEYA 1H7WA 2OODA 1JDFA 1NU5A 3I3DA 4I6KA 2I5IA 1J8VA 3BOLA 1PKYA 4LNYA 3IIZA 3B04A 1R3TA 1TIWA 2CZFA 1CT5A 3TW9A 1XLAA 3WBYA 3PK7A 3IJIA 1MSSA 3PUGA 2ZWZA 2BNJA 3IWPA 4H41A 2YDRA 4ZQCA 5DLCA 4MFDA 1TE6A 3H2AA 3LI0A 4CD5A 4E6MA 3M0ZA 3W25A 3STEA 1RQHA 3UY7A 3SEPA 2QCNA 1BYDA 2GJPA 1OX4B 2VEPA 2B0MA 4IUGA 4AC7C 3RMJA 4QDPA 4AHOA 1O7AA 3KOXA 4PUEA 5CG0A 4GI8A 3USZA 3RX2A 2V5KA 3RM9A 2HBVA 3VINA 1ME7A 1XSJA 1K70A 3LU2A 4HHHA 4US5A 2DSUA 1KGUA 1QR7A 1OCJA 4BKNA 1OGBA 4NZ1A 4Y9NA 1HJXA 1VIWA 1R30A 1IWAA 5I23A 4RL3A 2X2YA 3QV6A 4Z1BA 1I6NA 3G1FA 1SM9A 2W0UA 4FXFA 4DF0A 1K1DA 1AD4A 1E1CB 3C0LA 1EP2A 4PTNA 4MDPA 3UNTA 1XD1A 2Y5JA 3QTPA 3E49A 2PDNA 5AYBA 1IIGA 1W5OA 1OGSA 3PPFA 3DESA 3B4UA 1YNPA 2C71A 4IPIA 2Q8LA 5HOSA 1WO2A 3N9RA 1NEYA 4LBUA 4HSNA 4AD4A 1M1BA 4P7QA 1B54A 2QT3A 3L4YA 3KLKA 1C3FA 4RE4A 4GFSA 3LLXA 2EQDA 4AIBA 3TW6A 2WVSA 2YDQA 2C6QA 1TKKA 2AKMA 1ELSA 4HU4A 4OV9A 8CGTA 4FLSA 1TB3A 3FJLA 2Y7DA 1VFLA 1UH2A 1J5TA 3UZ5A 5T8GA 3LGEA 3NNTA 4NJJA 2D0HA 5I0DA 2W62A 5EU9A 5DFAA 1P43A 4B2DD 4MSSA 1WUEA 2Q6ZA 5M03A 1EFZA 7TAAA 4ZQOA 4U33A 3GR7A 1TV8A 4Z1AA 2QQ6A 4P8XA 4O16A 1TPWA 4AWUA 2H6RA 3WDQA 2ZA3A 1TJ1A 2WKJA 3EX1A 2C15A 1V3KA 4G9PA 4ZOEA 4IIDA 3V5CA 1X39A 2Y61A 3GTXA 4XZ9A 4MAVA 3B8TA 2TODA 1RD6A 2WNZA 5AHFA 1WUFA 1MUCA 3NZRA 4O52A 5DMMA 2CETA 2BDQA 2J9XA 3R0DA 4PTDA 4ICNA 5K3VA 1BAGA 1RCOB 3D3AA 1BWKA 3TYZA 3PZGA 1UZHA 3WQVA 2Y89A 3OJGA 4A05A 3BG9A 3CPUA 4WX2A 4FPSA 2WCAA 5CEWA 5FD0A 3TQPA 1LUCA 3QF0A 4LNCA 4CU8A 4R3UA 1ISYA 1K9EA 4A3UA 1X7FA 4M8UA 1V6TA 3DYMA 2OYKA 3NG3A 1U33A 1EQPA 1JZ5A 3LMZA 1A47A 1GGOA 4GBDA 5E5CA 3NCOA 4Y96A 1NOWA 4HCLA 4Q3MA 2AGTA 1SR0A 4DJEA 1E3XA 5AYYA 4AG0A 1TTQA 3NQBA 3E9AA 2GZXA 2FVLA 3NQEA 3SCUA 1K4HA 1Y5XA 4DWSD 2XIJA 2CYGA 4A2SA 4IPJA 3F1QA 3BH4A 5BU6A 1BFNA 3T7VA 1A5OC 2A5HA 3P61A 3UJEA 4ZGYA 1J01A 3HZ3A 3EWWA 4GIRA 2G3FA 4PTWA 2NZLA 2G3IA 1AD1A 3S2JA 3EDFA 4KQNA 3L0KA 4JNZA 2EPLX 2XH4A 4IP7A 2J66A 1Z48A 4HU0A 3I3BA 4JN7A 3PBWA 4GYPA 3QH2A 1TPC1 2JALA 2XVKA 1K02A 4DWSC 4CCCA 4WOZA 4IM4A 5I3FA 4W7UA 2GJNA 1RSCA 2HZGA 1O1HA 2HSAA 2A3EA 1WDRA 4RZ6A 3EPNA 2BLEA 1A0CA 2H8ZA 4PUMA 1BHGA 4QM1A 1B2YA 2P0OA 3UG8A 1RA0A 3PHAA 4NJGA 1MXDA 1AG1O 1CX9A 1WOBA 5AY7A 3W0KA 1LLZA 1LYXA 1OCNA 1XGZA 4WZHA 5KZDA 1JULA 1YBQB 2GDUA 4XZHA 4EPKA 4ATLA 4ENLA 3TROA 3CMFA 3MJMA 3LBCA 3T2QA 1KTNA 1DORA 4LB4A 4UTWA 3M43A 3AHVA 3OLEA 4QJ5B 3E74A 3GXNA 4IMEA 3W73A 2CHOA 4JR5A 5AZ0A 1IEVA 1NARA 4HPHA 2WCGA 3ZT5A 5L6UA 4CQBA 1Y8BA 5CZKA 3ARTA 2QF7A 3EKGA 2ON3A 3HV9A 5I3JA 3I65A 1A5SA 4GBUA 1JG9A 4L9ZA 3FIGA 1QPNA 1R7OA 2FDMA 4V1XA 4FP1A 1SO3A 2D20A 2G3MA 4AB4A 3N9SA 4O17A 1WYIA 5C5YA 1DP0A 3PTQA 4JXCA 4RR4A 4AZ6A 1H7NA 3FAXA 1K4GA 3U8GA 1XYZA 1EXPA 4J3TA 4F4RA 4GUIA 2J24A 3QXBA 1U5HA 4LV4A 4C1LA 1EXBA 1L0PA 2O9RA 1RCXB 1PCKA 2YCLA 1XG3A 3C52A 1Y5WA 4A8LA 3GIYA 5DO8A 3K1DA 2DORA 1VCFA 3R7MA 4B16A 3K2GA 3SN4A 3CYVA 1GOWA 3CPGA 1UA3A 3KOWA 4LVBA 5AHIA 4DJDA 3PG8A 3L4VA 3P81A 3THAA 3QPYA 4G1NA 3LCXA 3R5EA 4RUBA 4YS1A 4QITA 3TYAA 1L6FA 3HURA 3R8GA 1YTEA 3JS3A 2WJDA 4L6OA 2ASHA 4UXDA 3KVMA 3WYZA 2Z1SA 2PCQA 5BCAA 5E09A 5PTDA 4KFPA 4Z2KA 1XQLA 1V4YA 2QCDA 3S6DA 4E4FA 3QR3A 1E6RA 2C19A 2NV9A 2OX1A 4C90A 2VP8A 3Q4DA 4X63A 3ARUA 1D2KA 4JTRA 3EOUA 3ICJA 3PZUA 3ENLA 1SW3A 1PYFA 5F4WA 2XFWA 3SR7A 5EFDA 1K7EA 2RGLA 2YL8A 2WSKA 2F84A 3FDKA 4S3BA 3U2EA 4XUYA 1EA9C 3TDFA 4HP5A 3GW0A 5I77A 3LI1A 4PMUA 3HOJA 4C7DA 1T40A 3NPUA 3WFAA 2XIQA 1TZZA 5LKYA 1A49A 1O6IA 1GK8A 1YTKA 2GFTA 2YSWA 1E1FA 1E72M 2XYLA 2ZBTA 1S3HA 1SGJA 1ONXA 3OIHA 1VF8A 5DBTA 3FXYA 2CXEA 2E25A 4H9TA 1E0WA 1MO0A 2AL2B 2JIEA 2J9YA 4NAEA 1W9DM 1W1ZA 5D2YA 2P10A 4GACA 2PWUA 4TV6A 5A3HA 1B31A 1H51A 2J7BA 1Q7MA 4W5ZA 4ZBCA 3SY5A 2QUTA 3GNXA 4MADA 4D8ZA 1ZBWA 4JCMA 1PZ2A 3VIGA 3AIUA 5K2ZA 2GOKA 4LFYA 4B3ZA 4PMDA 4ZOCA 3HTWA 3CWNA 4O8RA 4U2YA 4ROPA 2DH3A 1ZQ5A 2X1SA 5A8PA 4W7WA 3UJSA 2GUBA 4M6VA 3LA4A 4M7TA 1L2QA 2PF0A 2RJGA 1R7AA 2FFCA 4KGJA 2DY3A 4JTUA 5ABFA 2MNRA 3WMBA 2QV5A 4Q7BA 4Q7NA 4JTDA 3O6YX 3OZOA 1B9ZA 2XH0A 4HD5A 1FFQA 4AU0A 4IIFA 2JFEX 4GCAA 4BQ4A 2PU0A 3TE9A 4MM1A 4UTMA 4S3DA 4IQLA 3N17A 4GHRA 2WO5A 2HVOA 5CAHA 3W83A 2E5BA 3GO2A 4U31A 3WEMA 1ONWA 3AI0A 3QSRA 3PBYA 1SO5A 1W5QA 2Y63A 3K8MA 3S6TA 1GJPA 3GG7A 1XYAA 1M03A 3VC6A 3VIMA 4O13A 2ZZ4A 5A6AA 3SN0A 1VBRA 3EB2A 4ZFCA 1REQA 3S0CA 3LTSA 1KW1A 4AEEA 2WKGA 5D4YA 2IPGA 4J3UA 1Q66A 2PDQA 4D6GA 3LK6A 3QQ0A 2OEKA 2PLMA 3W9ZA 4LW7A 3T8QA 3R8HA 2B81A 3IUIA 1CI1A 4K36A 2YBVA 4KEUA 3PTKA 3EWBX 3LDVA 3H2OA 3EWDA 4RXFA 5C55A 3KUMA 1AVAA 1YXYA 2YX0A 1RY8A 4FSAA 3EWXA 1V02A 4IIEA 1OK4A 3MDUA 4HK6A 2VDIA 3CUJA 3PZMA 3ZVHB 5A6BD 3N04A 5DMNA 1NDZA 5IRPA 3M47A 3WF4A 1W56A 2V5DA 4Z42C 3QKZA 2OMAA 1C8QA 3MC5A 3EX3A 1MVYA 1OABA 3A5FA 3WH8A 3OPSA 3SY8A 1VIZA 4C91A 2E6FA 4MLRA 1IYXA 4QLKA 3KEHA 4C6FA 2V63A 2IW0A 3DFQA 1TJPA 3WENA 4JTEA 4JGDA 1DJNA 3VFLA 1EZWA 2V0TA 2JKAA 5D8WA 1RH9A 1S5NA 1KFLA 4H4IA 2ZA1A 4H6KA 4ATWA 3NDYA 1T5AA 3HPXA 4ZB5A 1ZAJA 2OZ3A 2VZVA 3WDJA 3BZGA 3B3DA 4C6LA 4O4WA 2POTA 2L5HA 2XIBA 3S9IA 5G1MA 5CGMA 1E9LA 6REQB 3RHGA 3WLSA 1BLIA 1G94A 3P62A 1GKRA 4UTKA 2D3NA 1QO5A 2NQ9A 3SM0A 4UNLA 4B2DA 1W1YA 3AHYA 3I4KA 2FH6A 3B0VC 1TO3A 4RDWA 3WCZA 2CW6A 1HG3A 4Q4KA 3KRZA 3P3BA 3BURA 4V28A 4E3VA 1E9YB 2VFDA 3W3OA 4HNVA 5D09A 1J10A 4MNMA 1MZHA 4JIQA 2A21A 3NQ2A 3B05A 3LCFA 1FWJC 4ZB2A 1W1B1 4J5NA 6ALDA 1YPXA 1EUNA 3MV01 4CVUA 4O28A 5CPLA 1YE4A 3LHZA 2OZTA 3G1AA 1E6ZA 3LY0A 4GKTA 2CIPA 2J62A 5EBUA 4XIAA 4LGXA 3TJXA 3AWNA 2NWRA 2NLIA 1H60A 3CUXA 1GVSA 2ZFAA 4Q8MA 1GT8A 1MYRA 3MU7A 3KDNA 2ZC8A 3SGGA 3KRSA 2V30A 4S1FA 2DDXA 1DWJM 1L6WA 4TTUA 1N8FA 3WN6A 1YX1A 3NO1A 4EOUA 2OOGA 1BRLA 1UMLA 1FWIC 5BXTA 4H9UA 4KWOA 2WKLA 1XC4A 5CCZA 1O1ZA 3N6HA 2CLKA 4IL0A 3ABRA 1OFEA 1RPKA 2G4JA 2CESA 3MI6A 4AIOA 3LNMA 3G0XA 3N29A 4REQB 1XYBA 3B8IA 2DT2A 5XIMA 4C7GA 5A8MA 3QQWA 1XINA 2E09A 1R2TA 2PDCA 1EJ7L 2CLOA 3QZEA 1JCNA 1ONEA 4BK9A 2OT0A 1W0MA 2QCCA 1B5TA 1XCXA 2O92A 3KRBA 1QW7A 1UB3A 3VGGA 3P93A 3CMJA 1NDWA 4KRUA 1TUFA 7A3HA 3EX6A 3CLWA 3L12A 3A9BA 3W00A 1TA3A 3RJYA 1PL9A 1VCVA 3PWIA 1DJHA 3ERPA 1NF7A 1Z9AA 4Q6JA 1Z89A 5I07A 3BAXA 2V8ZA 1RJRA 3KAOA 4KWVA 2CLHA 1B3WA 3O6CA 4FOJA 3CZJA 2DIEA 4LCSA 9RUBA 2H3BA 3QZ6A 1E6QM 1N8WA 4JS3A 4R7JA 2FDSA 3T4WA 1VQTA 1HTIA 3O3RA 3D0CA 1AJ2A 1B3YA 4QROA 5LA1A 5KMYA 1P0EA 1CXEA 3G22A 4PCPA 3RM4A 1B0IA 2HWGA 4MDOA 1TTPA 7CGTA 1O66A 2OSXA 1DIOA 3M41A 3AIEA 3WNMA 4BHYA 1GZJA 3S8HA 1CXFA 1TCDA 5MF5A 1F6PA 3WLMA 1XIEA 4V33A 4NZ5A 1CZ1A 4ADTA 2PAJA 1UR2A 1UROA 3KBWA 1RA5A 1R3RA 1VR6A 1Y5VA 1O5QA 2XSAA 3IARA 1QNPA 4M6PA 5AC8A 2PB1A 1XRTA 3WQCA 3HQOA 2A6NA 3EPMA 1V8EA 1OWQA 2AMXA 3RILA 3HPAA 3PNUA 1Q6GA 3E5BA 4N7QA 5FJJA 4C5ZA 1B57A 3BW2A 1GZ1A 3D5HA 4AIUA 4IP4A 3K46A 3W6MA 3GU1A 1LJYA 1TMLA 3RK8A 4DQWA 4LUSB 4X2RA 5G1TA 3S3GA 1OX4A 3H7UA 4PBGA 2VJXA 1XLMA 3VI2A 1FY6A 2X2GA 1OYAA 2FGBA 3NQMA 1F6YA 5M1TA 4QQ3A 4AWTA 4TUFA 2R6OA 4AD5A 1DBTA 1C93A 5FAGA 2YCIX 3FLUA 3NZPA 3N9KA 5IXEA 5K9DA 1HGYA 3SY1A 3O0FA 1PKMA 3A24A 5E0CA 3EB3A 3ZSTA 1MDLA 2BVYA 3H7RA 3ITXA 2E6DA 3JZUA 1XIHA 1UW9A 1H7PA 2X1UA 3G3MA 4GO8A 1G69A 1W1IE 3VKJA 2E3ZA 1E1CA 3FHQA 1SO4A 1KCZA 3LD5A 4U2ZA 4XKYB 1M7OA 4YXGA 2JEPA 4PSPA 1DTUA 3S4TA 2P88A 2PWEA 4CU6A 3DZ1A 3VDGA 4ZTYA 3ZT6A 1XCFA 1FXPA 1LLOA 4PN2A 4DIAA 2AL1A 4AC1X 4PB3A 1JZ3A 4YTUA 1QHZA 2FZDA 3QGAC 4XAYA 4MLJA 4Q4MA 2IPFA 4J40A 4NU7A 3HQ1A 3EA2A 5G4HC 4KMQA 3DCPA 2DQWA 4MWAB 1QU4A 2YB1A 1GZGA 2J7DA 4PRTA 1M41A 3TSDA 4GUFA 3L5LA 1VENA 2A7RA 3UJRA 3QV8A 2VUNA 2PBGA 2W4XA 4AX6A 4F8XA 1R46A 3SUUA 4TOQA 1KQZA 2WC3A 2YDSA 4QEHA 3TXZA 2VFHA 3V5FA 3ATZA 4RE2A 4BWLC 3P0XA 3AZTA 1W8GA 2CWNA 4C6NA 2E9LA 3WLKX 4GVHA 4D6HA 5GNYA 4MUPA 1I2QA 5D04C 2DW6A 1NELA 1C92A 3QMSA 3R1ZA 3OBKA 4WF7A 5A2CA 4CQCA 1E40A 5EYWA 4A3QA 3G1HA 1XLEA 3CAQA 1UG6A 4FS9A 4JHMA 1W1TA 4NZ4A 1CDGA 1XBYA 2XFRA 3R79A 4OBTA 3VNIA 1WQ5A 5I3GA 2GSJA 5HULA 2YKKA 1DOSA 4HIBA 3APTA 4HNUA 4UQCA 3HMCA 3WQEA 1JDEA 1W2VA 4IICA 5HMFA 3PB2A 1OFQA 3N4AA 4RE3A 2P1FA 1ICPA 3LHYA 3FYPA 4BQ3A 4NJIA 3H70A 5D02A 3UPMA 1EKOA 3I7SA 4JOMA 4H6RA 3B9EA 3J7HA 1UD6A 2GSEA 3BAYA 3FW6A 1G5AA 1H7XA 3MT1A 4A29A 4EKJA 3N19B 4LPCA 3LV5A 1UUMA 3D3FA 4B5TA 4URIA 1PVNA 2J8GA 3T2PA 1FWSA 4OBRA 2V3DA 3DENA 1WCGA 3TC7A 4KEZA 3NR0A 4J3ZA 1JGIA 4IIBA 4M6UA 4Y8FA 4JKMA 3URAA 3NQFA 3M5XA 5EGRA 4YL2A 2WMGA 2YZRA 2WMHA 4CNSA 1M9HA 3ARXA 4KWWA 1JZ4A 3U4AA 3WEOA 1XYFA 2V69A 1HJSA 3R4IA 4QSFA 3BARA 4DAIA 4POCA 4Q8TA 2BXYA 4KEMA 2E68A 1TJRA 2QJHA 4GNVA 4GQBA 2DP3A 3GWQA 2A3LA 4KIRA 1WXJA 3MHFA 1US2A 4KCWA 1E1EA 2WJZA 4TV5A 3TK7A 4IIHA 5F4SA 4WSKA 1KLYA 4ZVJA 3W02A 3CZKA 5EMLA 3F4NA 3WEZA 1UR0A 2QCFA 4V1YA 5A6BA 2ZADA 4RDYA 2EPKX 4LYKA 2CBJA 4WDUA 1S2AA 3M0YA 2Z2BA 2FGLA 1NWRA 1YBQA 1P0BA 5D2VA 2VRKA 1C7SA 5GPRA 2V5LA 5KZMA 1R9ZA 1KKOA 3RLGA 2FZ8A 1EF2A 4YNGA 3WELA 1CTNA 1Q7ZA 1VBJA 3PZNA 1BXNA 4YJ5A 2WJFA 4EAYA 1F3EA 2DUZA 7ODCA 3KL0A 2NVAA 2UY3A 4FX8A 3CL7A 1VYRA 4AZCB 3AWOA 2YB4A 1K8ZA 4AHPA 1US0A 3NQVA 2HXUA 4EVZA 2QULA 3ITTA 2V38A 4INFA 1G0CA 1GOMA 2Y7FA 4OHQA 4QISA 1PWMA 4HQVA 1AH3A 1DE5A 3UEQA 2RDWA 4TXEA 3FSTA 2GQ9A 4GNJA 4EPBC 2ZRZA 4C1NB 1LG1A 4NZ3A 5CJNA 2X09A 4GC3A 4AQLA 3IJDA 3VDAA 5M3WA 5LNVA 2YCKX 3QYSA 1TREA 1OJXA 3APGA 4Y7EA 1A3WA 4IJCA 1PIFA 1S5MA 2H3DA 1DJZA 1QI5A 1W1PA 5C2GA 2CWXA 3S2NA 2Z1VA 3M07A 4MYXA 1Q3NA 4FLRA 1ENUA 2WAGA 2BVWA 4JNYA 1FHUA 1GVRA 3R11A 2PDXA 5G2IA 4CEXC 3ZWSA 2V9DA 4ECLA 3WQDA 3LRMA 3LCWA 1M7JA 5KEZA 2JGQA 3M5ZA 2GUYA 5DELA 2X05A 3ES7A 3GH5A 1SJDA 4AXKA 5B80A 4K8EA 4GUHA 3MB9A 3QJAA 4WKHA 2ISWA 2IQDA 3IK4A 1AJ0A 2Z6JA 1GYLA 3BWWA 3RXZA 3QLLA 2VDGA 1J0JA 3BK0A 4FNPA 2VX7A 1OX5A 2AAAA 3NGJA 2NV2A 3BOFA 4JFVA 4I6VA 1FCQA 3PUDA 1GKPA 2E8ZA 1TWDA 3E6EA 3QW3A 4DYEA 1F3TA 3SI9A 2BWGA 5IBXA 1V7AA 3MDWA 3ZVIA 1PKNA 1ZALA 3AXXA 4JHOA 1GNXA 1OF6A 4BEQA 1UD5A 4JKKA 1EJRC 1H11A 1S5WA 3W7DA 4MWAD 4DM1A 3MY9A 3VZYA 2PC8A 1KBKA 4F0HA 4I3GA 3FNDA 1L6SA 2VVNA 2OLHA 3P7YA 4H8UA 4GRSA 4O4VA 1QUMA 3RO8A 2W92A 4UFIA 3GH4A 3RCMA 4K6AA 3B8DA 3WNLA 3SCWA 2EKGA 4EAMA 2GWNA 2O0TA 2YA1A 3TTEA 4ZODA 3TR9A 3ZR4A 1ZLPA 3CH9A 1VPYA 2NQZA 3SQSA 4IQJA 2AL2A 3G1XA 4NZJA 3UZJA 3E2SA 1ZB5A 3VZXA 2PUZA 1EZ2A 4M6QA 1R47A 2WVUA 4JPGA 3DXIA 3LLFA 4YPJA 3BUVA 3VMNA 4TU1A 1BYAA 3GQYA 3CT2A 4C6KA 1SZEA 5CGQA 4QG6A 2GGHA 1UJQA 1XYCA 4NI3A 3VNYA 1RBAA 2YPIA 4AUBA 6PTDA 3UVAA 1WDSA 3OEXA 3DC0A 2AQOA 5D9OA 4PCNA 5FACA 5JBFA 2A7PA 3GNDA 4E2BA 3VKKA 3NSNA 1PV8A 2UWFA 5I09A 2ISSA 4L5ZA 2J47A 4WK9A 3W84A 5D2TA 3T0DA 4NNCA 1XLHA 3H2CA 1AQ0A 1N7KA 1GKQA 3W2JA 3WBEA 4CNTA 3ZR5A 3LZ3A 5HWMA 2VTFA 3UJFA 4EF9A 1S2CA 3NL5A 3IRSA 4MJ4A 1SW0A 1JXJA 2VEFA 4GGHA 2C8NA 1BVZA 2BASA 2BOFX 3PTDA 4E0CA 1WPCA 4IHCA 3CV1A 2VELA 1YYAA 4YVPA 5CLWA 3T40A 3CV2A 3UWUA 1DQWA 2O55A 1UOKA 3UG4A 4JIPA 1YLVA 2G0WA 3KLLA 5CH9A 2MUCA 3LHTA 4IFKB 5A6KA 2C3ZA 3MKVA 4ERGA 3AUOA 2NWSA 5I7GA 3R2GA 3CQHA 4M7SA 2FJKA 1X1NA 2PLCA 1GYNA 2EJAA 2WW5A 4H8NA 4Q8QA 4LRTA 3IS4A 4AZ7A 3NDOA 3WDRA 1E70M 4A6GA 4RNIA 2B7OA 4KGLA 1F76A 3OG3A 1A5NC 2ZUWA 3BV7A 4YHGA 2YL5A 3BJSA 4DELA 5A6JA 2A4AA 1EC9A 4CN6A 4MNLA 2ZRYA 4XSLA 2OSWA 1UBPC 1HNYA 4XZIA 3H4XA 4Y6GA 2OG9A 3ZVHA 4F3HA 4IQDA 3H54A 3BW4A 1OC6A 1WB0A 1QPKA 1R6WA 2NSOA 2DQXA 5HNTA 3HN3A 3LNPA 3LLDA 4I5UA 2WBKA 2YYUA 3GHRA 2TYSA 4LV9A 4XZBA 1NDYA 4JQ2A 1KFKA 2ZUVA 4LJ3A 1GHSA 3N2OA 3RPMA 1FDJA 1FDZA 1EJUC 4F79A 1TX0A 4JTFA 2GDVA 1ZP3A 5F2MA 5JQ9A 1JCLA 1EO5A 4OOZA 1ZTVA 3FYYA 3ARQA 1V03A 1LQ2A 5K4XA 2GGEA 4JTQA 4PBEA 1E3ZA 3PPHA 1PTDA 4C65A 3W1NA 1OF8A 1LTDA 4JYDA 2PRHA 4ZL1A 3LQGA 1JRCA 3LTYA 3AICA 1KBJA 6REQA 3TSBA 1QVBA 3UWWA 1R3WA 3QLDA 3QW4B 5FF7A 3SIZA 3LX9A 4GKLA 4JTCA 3SGUA 4H04A 4X3ZA 3PAJA 1D7KA 1U1UA 2G41A 3CJPA 5HMDA 4LRSA 5CPMA 1EPVA 1J6OA 3QFWA 1UZ4A 4D6EA 4JL2A 4ZMGA 4F0LA 4O0QA 5DT5A 3WBWA 4R27A 4DO6A 4NRRA 4Q33A 1VYPX 3VNZA 4MB5A 2IKJA 5A5WA 4JFWA 3QTGA 3BGGA 5BROA 3WQ5A 1ZNNA 5EMYA 1ZCCA 1QK0A 4JICA 4DBWA 3RRAA 2EGZA 4E8DA 3CK5A 1VEPA 2W61A 3MPGA 1PZ0A 1PE1A 3KW3A 4XD4A 4JNMA 3ZJ8A 2VXNA 1QHPA 2E1WA 2PDGA 1VAHA 4ERIA 2FHCA 1VJSA 3NQ8A 4TO8A 3QRHA 4GQ0A 4NNAA 1TWZA 2XIOA 2PTWA 3AALA 1EHAA 1XLKA 1F3XA 3OQ8A 4PUJA 5FOOA 2DEPA 2O4MA 1OYCA 3F03K 4UQBA 4GI6A 3WFLA 3EEGA 3MANA 3IIVA 4ML4A 4CVWA 1XISA 1AMYA 1UR8A 2VDHA 1RBOB 4Z0SA 2PTDA 1IT8A 1Q6CA 3B9OA 3OBEA 3DFPA 3SECA 2BHYA 4GXWA 4S38A 2V2CA 5FJUA 4D6CA 1R3QA 5FKYA 4D72A 1KM4A 2OLAA 3GR4A 1RVGA 1TPEA 1K9FA 3PFRA 4GYFA 3ZIZA 5A8OA 2ISFA 3FV9A 5G2WA 1KC7A 1EGVA 1QFEA 4PUKA 1R9YA 3MZ2A 3R12A 2QYGA 1FWNA 1SZGA 2FMNA 3PC0A 1E0XA 1AL8A 1UKPA 2YFNA 2FVMA 3HM7A 1R0MA 2RHGA 4QQUA 5CSUA 2LLEA 1VFFA 2EPHA 2CBIA 1B4KA 4LS2A 4L6HA 4REQA 3T08A 2G96A 2P3ZA 2D1ZA 1Q8AA 4RZBA 3UWQA 1BWVA 3CM4A 2HS6A 2BBFA 3EKLA 3DG7A 2OX4A 4ZQMA 3NQGA 1HL9A 4HPGA 3WQGA 1DXFA 5HWJA 5KITA 1A5MC 3WF3A 3I4EA 3UR7A 3DHDA 2PDKA 3VUPA 4H9MA 2VGGA 2HCVA 3CUHA 4ONVA 3L5AA 1UIPA 4TX8A 3IEBA 4PC8A 1V5XA 4B5XA 1NFBA 4X0VA 1DWFM 2PRMA 4JN8A 1UUOA 4E2DA 2XM1A 2I16A 3PR2A 2Y5SA 3O6AA 1C9WA 1DJXA 3VD3A 4MY9A 3G0SA 3AMCA 3IIXA 1M68A 4MNJA 4FR1A 4MHBA 1SR9A 2VCAA 4HYWA 4FI4A 4C6EA 3MV11 1US3A 2WVTA 4L7ZA 5C54A 4NIRA 4PE8A 4M29A 1HP5A 3VIIA 3RU8X 4PMVA 3WLPA 4ICMA 3QZAA 1EEPA 4OECA 4UR9A 3MSRA 3RCYA 1E4NA 5CPQA 1I75A 3O63A 1PBGA 1MEWA 4Z2GA 5A6SA 1HKVA 2OGYA 1GVQA 3CL8A 3PP7A 3E2VA 4WGXA 3E5PA 3NURA 4GI4A 4A35A 3ABOA 5I79A 2ZDSA 3BLDA 1B30A 1UPPA 4S39A 2GL5A 2J7GA 1PUDA 3TV8A 2PE4A 3HG2A 4XO6A 2YCJA 1VRDA 1V3IA 3DFNA 3FDGA 1DQUA 3ATYA 2VZOA 2V3FA 1GQIA 3WLIA 4E4PA 3VILA 4MY8A 3QHMA 3BMVA 3SJNA 2YLAA 3GHTA 1OY0A 1PKLA 1XDJA 2WQPA 3HFTA 3VK5A 3P2VA 4C60A 2W27A 4CEUC 3P5YA 3NEVA 4D6DA 3SCRA 1K8XA 3II1A 4AFYA 3EDKA 3CHDA 4D71A 4PTMA 4W5UA 3OZPA 1JDDA 2PWGA 1E0UA 3WH6A 4ZSUA 3WLLA 4JQAA 1N8IA 2VQUA 2CU0A 3HJEA 3Q2DA 4FZIA 3M0MA 4IPPA 3AIBA 1KCXA 3CEPA 1XUUA 1WOAA 1JPKA 3DKLA 4X60A 1GUVA 1QPOA 2QCLA 1RVKA 3VM5A 5E6ZA 4IFOA 3TTYA 3QOKA 1ICSA 2A79A 2VX5A 2ODOA 3L4XA 5DN1A 4AMAA 3L65A 2J25A 2ISDA 1W5PA 4XKYA 1QNVA 1J9YA 2GVLA 3WJXA 3PZTA 4RDVA 1D8CA 5LNWA 4W84A 3EWZA 3S2CA 3W85A 2NXIA 2Y85A 4XAPA 4NY2A 2ZICA 5C7HA 1AH0A 4PULA 1QW9A 1D3GA 1GPWA 2ZX6A 4MJZA 5HQMA 1HQTA 5LHEA 4HMDA 2PODA 3WUEA 1ZY9A 4AYSA 2ZA2A 4US5D 4F0KA 3D6NA 4JTKA 4A22A 2CKRA 1KWKA 5D9PA 4MWAA 1G4SA 3V36A 4EK7A 5AVNA 4A3RA 4W93A 4QCEA 4U5IA 4BA0A 3NJ3A 2VT0A 3KTSA 4IP5A 1NF0A 1YNQA 2TSYA 1MWOA 1DXEA 5D8ZA 4RNFA 1W5NA 2POZA 2OWWA 3T0AA 3TMQA 1JDAA 3B40A 2FKPA 3W23A 4DBDA 1J4EA 4IMCA 3RYSA 2ZOXA 4WKAA 2RKXA 3WLNA 4MUZA 4QR6A 5H8PA 2WOQA 1KFCA 2G97A 4K1GA 1BWLA 3KHDA 3BICA 3W76A 3APYA 4CQ8A 2DUXA 1E56A 5HNNA 1XRFA 1O60A 1H63A 2YOCA 1JEZA 1JPIA 2G8ZA 3KRUA 2Q3OA 3HGOA 2E6AA 2FHFA 1G01A 3BE7A 2R24A 3C56A 2VWSA 1WNOA 4G5DA 2E8YA 3LRKA 1VC4A 3CIVA 4I8DA 4QJ4B 1YE6A 1QXLA 3GVWA 4X0NA 1CNVA 3EX2A 5FJOA 1RPXA 2Y7EA 1CCWB 3AROA 3OO2A 1GHRA 1TPDA 1NWUA 1C8VA 4TQTA 3THUA 3N13A 1PTAA 4O0KA 3W7KA 3QEZA 4NG3A 1LL6A 3SUTA 2OT1A 4AD1A 1QNOA 1C91A 2PDBA 1P0NA 5EMJA 2QUVA 3C2EA 5AYZA 2ZE3A 3U5YA 3P5ZA 4UQ9A 4GIEA 3TVAA 1UWAA 4Y2WA 4E8CA 1C8XA 3W53A 4JQ4A 1E0VA 1KTCA 3GBEA 4NHVA 4NYYA 2X42A 4UNIA 3AXKA 4MFEA 2ZX7A 5U7SA 2D69A 3MWCA 3DKJA 2CLFA 3OODA 4GUGA 3SRFA 3DFOA 4I7WA 3QSTA 4EP8C 1K7FA 3SGZA 1Z41A 1TRIA 5XINA 2EXOA 3P67A 1XBVA 4O1AA 4IGHA 2GSHA 2HDJA 4MKSA 1E6XM 1MW1A 1T41A 2AQVA 3DEQA 1JCMP 3VIJA 8A3HA 2GDQA 3IUHA 2KX9A 3SQLA 4EPEC 1GOQA 3TU9A 2ZTJA 3GTFA 3TAOA 2G5WA 2GK1B 3GFXA 4H2CA 3W24A 4H9YA 2C16A 3UESA 3A4XA 3L21A 1XLDA 2A6LA 3OOQA 2R1MA 5CBBA 2HV5A 3H4WA 5JBDA 4FNTA 2XJ7A 4WJEA 3GS6A 4DJEC 3GH7A 5HNUA 4Z1CA 3NZ1A 5TIMA 3E3HA 3PWAA 4BF9A 1VRXA 2R1KA 4HJFA 2VKZG 5AHLA 4AZCA 1G7VA 3DU0A 3GIQA 2A7NA 4ZEPA 2Y8VA 1FWAC 4Y9AA 4RZ4A 1CGUA 3EKZA 2AAMA 5FJIA 1OIFA 2QJIA 4X2PA 1FDYA 3A3WA 3G77A 4XD3A 3HG4A 2C1HA 2J13A 2FQIA 3DECA 2I5GA 2QJNA 1F73A 5CPNA 1JIBA 3PANA 3COTA 3VE9A 4GYPC 3WD4A 3F7JA 1UR3M 2VVSA 4ZQRA 2ZTKA 3OYZA 4FEZA 3T1GA 2IUZA 1A4MA 1UD2A 5HANA 1FWHC 3M0HA 1FTXA 1FWTA 3O9NA 2NLYA 1O68A 5AC6A 1FX6A 7TIMA 3CHFA 4XBSA 2OZ8A 4PMYA 4XKMA 1CWYA 2ACRA 5LA2A 1RV8A 3VX1A 3GIPA 1I2NA 4M24A 3DX5A 1UCWA 2YXXA 4H9XA 3IGHX 2BVDA 2R82A 3C0JA 3TLQA 3POCA 1WZLA 3WL0A 5LHFA 2ATSA 3CZLA 2HQAA 3AYRA 5DMYA 3ANVA 3MVTA 4OUIA 2TAAA 3U7BA 3BGAA 3LM7A 1DJYA 3KCJA 5JMUA 4MF4A 1OT2A 4S2BA 1FCVA 4XZWA 2PDWA 2XFYA 4BJHA 4UTWC 1IHIA 3VCNA 1F74A 2VCBA 2EAWA 1JCJA 1K7XA 1MW2A 3NXFA 1JUEA 1XIDA 3TYUA 4GY7A 1FXQA 3W22A 3PY2A 2DT0A 1DIKA 1TV7A 1FWBC 3SUWA 3W72A 3CH0A 3TFCA 4JDYA 4M80A 1OC7A 1TSIA 1GYMA 3NYDA 3PTMA 7XIMA 2QDEA 4H7CA 4NI8A 1ZGDA 1FBAA 3H4GA 1OCQA 4HNNA 3MYPA 4HSOA 4PB5A 5MHBA 2HE8A 1ALDA 5HXMA 3URQA 3QQ1A 4H6QA 3D46A 3K13A 2VEIA 2NXGA 1XG4A 2QJMA 3DG3A 2NX1A 4XK2A 5BRQA 1M6JA 5ABEA 4RNHA 1C8YA 4C6MA 1RCQA 4FO4A 2J8FA 4JTTA 3PS7A 2Y4SA 2ZYFA 5C0QA 3OW1A 4HKPA 1KRCC 4Q4QA 2CXGA 1XSIA 1PTGA 4OOUA 4Z2JA 4DJDC 2F9RA 4UUIA 4JIIX 5FF2A 1PEZA 2PPGA 2QJJA 3CAKA 3THDA 1HP4A 2QJGA 1OM0A 2ONEA 2Y70A 4ZO7A 1SFJA 3LYEA 5ABGA 5GJPA 4FLQA 2DZUA 4WRHA 2PD9A 4ADUA 2ZWYA 4ZA0A 5CC5A 1KV5A 3WQWA 1EDGA 4NNBA 2DPEA 3R0UA 2J7HA 4MVAA 1HIZA 4A3YA 1V77A 1EH9A 4O53A 3KP1A 4FXSA 3EA1A 1V3HA 2VYOA 4EF8A 4JTLA 4UTJA 4EWND 4DBSA 4RV8A 1NH6A 2C0HA 3VOHA 4UNKA 2J6VA 3KBJA 4WJXA 2PDPA 1RAKA 3SFWA 4B92A 3S83A 1W9UA 5JVLA 5BMXA 5CC6A 4W8LA 1YDOA 1V02E 1IEWA 5HJXA 5AHNA 4CN1A 1DHPA 3TONA 3NPVA 1XFCA 3GVRA 2XU2A 3L0NA 4XSMA 1V3JA 4QJ1A 4HJWA 1CB7B 1E51A 5A8GA 1QPRA 4PFMA 1EDTA 3T0CA 4EXBA 4MNKA 5D9NA 1ITUA 4PR4A 3N4EA 2PA6A 2QXWA 3W74A 3OHIA 4IJBA 3W7NA 3PZIA 1CENA 1XP3A 2H9AB 4IFKA 1GPFA 2NVCA 2UY5A 2C91A 2E6YA 5CC7A 4GMEA 4OWGA 3OHMB 5DMLA 1UQZA 4KESA 3STPA 1ESWA 1X96A 3IACA 5BXPA 5K7JA 2J79A 5CG7A 2XN0A 4F9DA 3LCGA 4LC6A 4J2MA 1UH4A 2V81A 3GU9A 2VWTA 1DKWA 2GVYA 1EP1A 4JDBA 4GISA 4YIWA 1ITQA 3SFKA 4PCSA 2PDJA 5ECVA 2PTYA 3LUTA 2HEJA 3TX9A 1KM1A 1DPMA 5A95A 4KPLA 5FJTA 3WUGA 1V6XA 1EJXC 3N2TA 3QGKC 1KM6A 3CGTA 1TV5A 1FKXA 1K6WA 5FCZA 4Z1DA 4CNOA 2NVDA 2VR5A 3TQKA 3AMDA 5ECUA 1MFUA 2J78A 1Q6DA 4LT9A 4G56A 2MANA 4GFIA 2WB5A 3TTSA 4HOZA 3UT0A 4OVXA 4Y8EA 1YADA 3MWAA 3VDHA 1W9XA 3WQFA 3T8LA 3VOCA 1AUSL 3ANYA 3WDIA 1EDQA 1OFBA 2YA0A 2WHJA 4QJ3B 4KS0A 3RR4A 4LOCA 2Y62A 1S38A 4JIEA 5FI8A 4BY3A 4LALA 2R1PA 1XPGA 1ZZMA 4LTSA 4WDXA 3ANUA 3TNBA 1BQCA 2PDYA 1KQYA 2A2IA 1QPQA 3H8AA 5LIYX 4LUYA 1HVXA 1G7UA 5ABHA 2FZ9A 3W1UA 5HBFA 4Z1YA 2PDUA 4LS0A 3PAOA 1Q6RA 4BF7A 2D0GA 2VR4A 1TWWA 3UF9A 2VD8A 2QDGA 1LOQA 3HJZA 3RPTA 2NT0A 2FH8A 1PZ3A 5I3KA 3HIJA 3PB0A 2YZ5A 2DZWA 3U48A 1XGDA 4TVCA 3G1YA 4W8AA 3N2XA 4A4AA 4AD0A 3CIWA 3MHGA 1NFPA 4DBEA 1UD3A 4DI8A 1H0IA 1YHTA 2I7GA 3GNOA 1CB2A 1GWJA 1LZOA 3CMGA 3UU0A 3RDKA 1Q45A 3PBUA 1FWCC 5DEZA 2XIIA 3R89A 5GVJA 4DUOA 1EIXA 1GJWA 3NM3A 1I0BA 4F48A 1GQLA 4IMGA 1KR1A 1GOIA 3TNOA 1ISWA 3CIXA 1BG4A 4NP7A 1UOZA 3T05A 5FESA 2RJHA 2GQ8A 4E3TA 3FFSA 4GQRA 3R43A 3L5MA 4RV3A 1OD8A 3BQ5A 4QNEA 3R6IA 3IVTA 2QPUA 2WCSA 1OT1A 3N11A 4Q8OA 3H7VA 3WQ6A 3WSUA 4JY9A 3HQPA 5KETA 2XPKA 3D47A 3F4VA 3MVIA 4H9VA 1TVNA 3SSZA 4RW5A 3ZZ1A 3E2QA 2VGBA 4O15A 3WNPA 1BPLB 2XZ7A 3KDOA 3UXDA 3H24A 3TJIA 2INFA 2DIJA 1JPDX 1POKA 4GA8A 1MDRA 3LHUA 1F9CA 4TMBA 4CNNA 2O56A 1HL2A 3WX7A 3KXQA 3W6LA 3K30A 2HVNA 3FY1A 3CHEA 4DWDA 4AWEA 4RPPA 2HPMA 4W87A 1V08A 2X7VA 1EWEA 1XFBA 4HYVA 3QC3A 8XIAA 4GUJA 4V27A 4NX5A 1BF2A 4IGMA 4IT1A 5TBOA 3OU8A 2D0FA 4FIQA 1BQGA 2VM8A 1U1JA 4A2RA 4DN1A 3TA9A 3RMEA 3S46A 3I7RA 1LQ0A 1HJQA 1YMYA 4DB7A 3W71A 1R87A 2D73A 3IJ7A 3OG2A 3NEHA 3OYXA