4V2YA

Cereblon isoform 4 from magnetospirillum gryphiswaldense in complex with thalidomide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'ASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEREBLON ISOFORM 4
publication title Thalidomide Mimics Uridine Binding to an Aromatic Cage in Cereblon.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Signaling protein
total genus 25
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.20 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Peptide methionine sulfoxide reductase. 4v2yA00
4V2ZA 3WX1A 4CI3B 4CI2B 3E0OA 1L1DA 4V30A 3MAOA 4TZ4C 4V2YA 4TZCA 4TZUA 4CI1B 2KV1A 2KZNA 3HCGA 3CXKA 3HCJA 5AMHA 3CEZA 3HCHA 4V31A 3E0MA 3WX2A 2K8DA 3HCIA
chains in the Genus database with same CATH superfamily
2RQAA 4V2ZA 3WX1A 3DJMA 4CI3B 2YKGA 3ZD6A 4CI2B 2QFDA 3FACA 4A2XA 4AY2A 3E0OA 5E3HA 1L1DA 5F9FA 4V30A 2KWBA 3MAOA 3NCUA 1TXJA 4TZ4C 4V2YA 4TZCA 3GA3A 3ZD7A 4TZUA 3EQTA 4CI1B 3LRRA 2LOYA 3P3KA 2KV1A 2KZNA 3HCGA 3EBMA 2FU5A 1YZ1A 2W4RA 3CXKA 3HCJA 3LRNA 2LVLA 5AMHA 4A2VA 5F98A 1H7YA 2HR9A 3CEZA 3HCHA 4V31A 2RMJA 4BPBA 1HXRA 2RQBA 1H6QA 3E0MA 5F9HA 3WX2A 3OG8A 2K8DA 1FWQA 3HCIA 2QFBA
chains in the Genus database with same CATH topology
4V2ZA 3WX1A 4CI3B 4CI2B 3E0OA 1L1DA 4V30A 3MAOA 4TZ4C 4V2YA 4TZCA 4TZUA 4CI1B 2KV1A 2KZNA 3HCGA 3CXKA 3HCJA 5AMHA 3CEZA 3HCHA 4V31A 3E0MA 3WX2A 2K8DA 3HCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2Z A;  3WX1 A;  4CI3 B;  4CI2 B;  3E0O A;  1L1D A;  4V30 A;  3MAO A;  4TZ4 C;  4V2Y A;  4TZC A;  4TZU A;  4CI1 B;  2KV1 A;  2KZN A;  3HCG A;  3CXK A;  3HCJ A;  5AMH A;  3CEZ A;  3HCH A;  4V31 A;  3E0M A;  3WX2 A;  2K8D A;  3HCI A; 
#chains in the Genus database with same CATH topology
 2RQA A;  4V2Z A;  3WX1 A;  3DJM A;  4CI3 B;  2YKG A;  3ZD6 A;  4CI2 B;  2QFD A;  3FAC A;  4A2X A;  4AY2 A;  3E0O A;  5E3H A;  1L1D A;  5F9F A;  4V30 A;  2KWB A;  3MAO A;  3NCU A;  1TXJ A;  4TZ4 C;  4V2Y A;  4TZC A;  3GA3 A;  3ZD7 A;  4TZU A;  3EQT A;  4CI1 B;  3LRR A;  2LOY A;  3P3K A;  2KV1 A;  2KZN A;  3HCG A;  3EBM A;  2FU5 A;  1YZ1 A;  2W4R A;  3CXK A;  3HCJ A;  3LRN A;  2LVL A;  5AMH A;  4A2V A;  5F98 A;  1H7Y A;  2HR9 A;  3CEZ A;  3HCH A;  4V31 A;  2RMJ A;  4BPB A;  1HXR A;  2RQB A;  1H6Q A;  3E0M A;  5F9H A;  3WX2 A;  3OG8 A;  2K8D A;  1FWQ A;  3HCI A;  2QFB A; 
#chains in the Genus database with same CATH homology
 4V2Z A;  3WX1 A;  4CI3 B;  4CI2 B;  3E0O A;  1L1D A;  4V30 A;  3MAO A;  4TZ4 C;  4V2Y A;  4TZC A;  4TZU A;  4CI1 B;  2KV1 A;  2KZN A;  3HCG A;  3CXK A;  3HCJ A;  5AMH A;  3CEZ A;  3HCH A;  4V31 A;  3E0M A;  3WX2 A;  2K8D A;  3HCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...